F481236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 797 | 336 | 742 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100024447|Ga0068853_1000244472 |
| Length | 329 |
| Sequence | VRSKWPFVDFFGLIMLPFLPYERDCGWRPIFASMKKALVQLHIAVFLAGFTAILGKLITLNEGLLVWFRLLITVVTLGAILFFKKQLLRIPVKDMFKIFGVGIIVAIHWVTFYGSVKYANVSVALVCFSATGFFTAFFEPLILKRKISWTEVGLGLIAICGIYIIFDFHPQYKLGIIFGIIAAIGSALFPIFNKRLLLIYSPKILTLYELGGGLLALTVLVPFYLMQFPAAYYLPTASDWLWLLILAWLCTVLSFDLQLNALKKISAFTANLTYNLEPVYGIILAFIFFKENENLNGAFYIGVLLILLAVVLQMLRIGRQHKQNTGQAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 2 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 5 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 6 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 7 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 8 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 9 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 10 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 11 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 22 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 23 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 24 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 25 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 26 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 27 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 28 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 29 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 30 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 31 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 32 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 33 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 34 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 35 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 36 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 37 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 38 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 39 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 40 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 41 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 42 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 43 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 44 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 45 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 46 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 47 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 48 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 49 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 50 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 51 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 52 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 53 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 54 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 55 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 56 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 58 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 59 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 60 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 61 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 62 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 64 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 65 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 66 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 73 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 102 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 116 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 121 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 122 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 125 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 126 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 127 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 130 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 251 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 316 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 318 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 326 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.1 |
| Metatranscriptomes | 0 |
| Isolates | 6.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0 |
| Endosphere | 2.89 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 89.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c003410 | 3300000041 | Bacteria | 1414 |
| 2 | JGI24741J21665_1004867 | 3300001915 | Bacteria | 2902 |
| 3 | JGI24740J21852_10048203 | 3300001979 | Bacteria | 1238 |
| 4 | JGI25152J39213_1000228 | 3300002773 | Bacteria | 37959 |
| 5 | JGI25150J39212_1000002 | 3300002774 | Bacteria | 537631 |
| 6 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 7 | JGI25406J46586_10003120 | 3300003203 | Bacteria | 7785 |
| 8 | JGI25153J46596_10000003 | 3300003215 | Bacteria | 553253 |
| 9 | rootH2_10053452 | 3300003320 | Bacteria | 3418 |
| 10 | rootH2_10223400 | 3300003320 | Bacteria | 6000 |
| 11 | rootL2_10074881 | 3300003322 | Bacteria | 2815 |
| 12 | rootL2_10225493 | 3300003322 | Bacteria | 2010 |
| 13 | rootL2_10292385 | 3300003322 | Bacteria | 1332 |
| 14 | rootH1_10162953 | 3300003323 | Bacteria | 3353 |
| 15 | rootH1_10215749 | 3300003323 | Bacteria | 1499 |
| 16 | Ga0055536_1000007 | 3300003781 | Bacteria | 345133 |
| 17 | Ga0055534_1005957 | 3300003784 | Bacteria | 3159 |
| 18 | Ga0055530_10010824 | 3300003791 | Bacteria | 3330 |
| 19 | Ga0065714_10067637 | 3300005288 | Bacteria | 5297 |
| 20 | Ga0065714_10069057 | 3300005288 | Bacteria | 4407 |
| 21 | Ga0065714_10069763 | 3300005288 | Bacteria | 4098 |
| 22 | Ga0065714_10070648 | 3300005288 | Bacteria | 3805 |
| 23 | Ga0065704_10071464 | 3300005289 | Bacteria | 11042 |
| 24 | Ga0065704_10075289 | 3300005289 | Bacteria | 5678 |
| 25 | Ga0065704_10082759 | 3300005289 | Bacteria | 3554 |
| 26 | Ga0065712_10070399 | 3300005290 | Bacteria | 6043 |
| 27 | Ga0065712_10071179 | 3300005290 | Bacteria | 5396 |
| 28 | Ga0065707_10116229 | 3300005295 | Bacteria | 2244 |
| 29 | Ga0070658_10005453 | 3300005327 | Bacteria | 10313 |
| 30 | Ga0070658_10020168 | 3300005327 | Bacteria | 5340 |
| 31 | Ga0070658_10169290 | 3300005327 | Unclassified | 1835 |
| 32 | Ga0070658_10323119 | 3300005327 | Bacteria | 1318 |
| 33 | Ga0070658_10337318 | 3300005327 | Unclassified | 1289 |
| 34 | Ga0070658_10408721 | 3300005327 | Bacteria | 1166 |
| 35 | Ga0070676_10010611 | 3300005328 | Bacteria | 4999 |
| 36 | Ga0070676_10062169 | 3300005328 | Unclassified | 2221 |
| 37 | Ga0070676_10093197 | 3300005328 | Bacteria | 1849 |
| 38 | Ga0070683_100013965 | 3300005329 | Bacteria | 7016 |
| 39 | Ga0070683_100044272 | 3300005329 | Bacteria | 4104 |
| 40 | Ga0070683_100064309 | 3300005329 | Bacteria | 3415 |
| 41 | Ga0070683_100440456 | 3300005329 | Bacteria | 1243 |
| 42 | Ga0070690_100013620 | 3300005330 | Bacteria | 4810 |
| 43 | Ga0070690_100116217 | 3300005330 | Bacteria | 1791 |
| 44 | Ga0070670_100078484 | 3300005331 | Bacteria | 2836 |
| 45 | Ga0070670_100110379 | 3300005331 | Bacteria | 2370 |
| 46 | Ga0070670_100113164 | 3300005331 | Bacteria | 2339 |
| 47 | Ga0068869_100001786 | 3300005334 | Bacteria | 12896 |
| 48 | Ga0068869_100004205 | 3300005334 | Bacteria | 8936 |
| 49 | Ga0068869_100022245 | 3300005334 | Unclassified | 4367 |
| 50 | Ga0068869_100032502 | 3300005334 | Bacteria | 3677 |
| 51 | Ga0068869_100044679 | 3300005334 | Bacteria | 3186 |
| 52 | Ga0068869_100096449 | 3300005334 | Bacteria | 2232 |
| 53 | Ga0068869_100109898 | 3300005334 | Bacteria | 2096 |
| 54 | Ga0068869_100445585 | 3300005334 | Bacteria | 1072 |
| 55 | Ga0070666_10000247 | 3300005335 | Bacteria | 36276 |
| 56 | Ga0070666_10000885 | 3300005335 | Bacteria | 18201 |
| 57 | Ga0070666_10030544 | 3300005335 | Bacteria | 3551 |
| 58 | Ga0070666_10057807 | 3300005335 | Bacteria | 2621 |
| 59 | Ga0070680_100029249 | 3300005336 | Bacteria | 4425 |
| 60 | Ga0070682_100000173 | 3300005337 | Bacteria | 47981 |
| 61 | Ga0070682_100008776 | 3300005337 | Bacteria | 5704 |
| 62 | Ga0070682_100010074 | 3300005337 | Bacteria | 5357 |
| 63 | Ga0070682_100236861 | 3300005337 | Bacteria | 1308 |
| 64 | Ga0068868_100000075 | 3300005338 | Bacteria | 58452 |
| 65 | Ga0068868_100017734 | 3300005338 | Bacteria | 5309 |
| 66 | Ga0070660_100017556 | 3300005339 | Bacteria | 5217 |
| 67 | Ga0070660_100075397 | 3300005339 | Unclassified | 2641 |
| 68 | Ga0070689_100086903 | 3300005340 | Bacteria | 2459 |
| 69 | Ga0070689_100133840 | 3300005340 | Bacteria | 1989 |
| 70 | Ga0070689_100232037 | 3300005340 | Unclassified | 1517 |
| 71 | Ga0070687_100103531 | 3300005343 | Bacteria | 1598 |
| 72 | Ga0070687_100222134 | 3300005343 | Bacteria | 1158 |
| 73 | Ga0070661_100083927 | 3300005344 | Bacteria | 2353 |
| 74 | Ga0070668_100000859 | 3300005347 | Bacteria | 21121 |
| 75 | Ga0070668_100015872 | 3300005347 | Bacteria | 5634 |
| 76 | Ga0070668_100022201 | 3300005347 | Bacteria | 4798 |
| 77 | Ga0070668_100105382 | 3300005347 | Bacteria | 2239 |
| 78 | Ga0070668_100117342 | 3300005347 | Bacteria | 2123 |
| 79 | Ga0070668_100134789 | 3300005347 | Bacteria | 1985 |
| 80 | Ga0070669_100075392 | 3300005353 | Bacteria | 2501 |
| 81 | Ga0070669_100154218 | 3300005353 | Bacteria | 1780 |
| 82 | Ga0070669_100227247 | 3300005353 | Bacteria | 1477 |
| 83 | Ga0070675_100009839 | 3300005354 | Bacteria | 7452 |
| 84 | Ga0070675_100103762 | 3300005354 | Bacteria | 2398 |
| 85 | Ga0070671_100027461 | 3300005355 | Bacteria | 4685 |
| 86 | Ga0070671_100193944 | 3300005355 | Bacteria | 1722 |
| 87 | Ga0070673_100000448 | 3300005364 | Bacteria | 21839 |
| 88 | Ga0070673_100003108 | 3300005364 | Bacteria | 10282 |
| 89 | Ga0070673_100006701 | 3300005364 | Bacteria | 7509 |
| 90 | Ga0070673_100053248 | 3300005364 | Bacteria | 3177 |
| 91 | Ga0070673_100291076 | 3300005364 | Bacteria | 1435 |
| 92 | Ga0070673_100350115 | 3300005364 | Bacteria | 1311 |
| 93 | Ga0070688_100173591 | 3300005365 | Bacteria | 1490 |
| 94 | Ga0070659_100000828 | 3300005366 | Bacteria | 22546 |
| 95 | Ga0070659_100001692 | 3300005366 | Bacteria | 15868 |
| 96 | Ga0070659_100113125 | 3300005366 | Bacteria | 2192 |
| 97 | Ga0070659_100220177 | 3300005366 | Bacteria | 1566 |
| 98 | Ga0070667_100000482 | 3300005367 | Bacteria | 40557 |
| 99 | Ga0070667_100071365 | 3300005367 | Bacteria | 2957 |
| 100 | Ga0070667_100112829 | 3300005367 | Bacteria | 2358 |
| 101 | Ga0070701_10008166 | 3300005438 | Bacteria | 4511 |
| 102 | Ga0070700_100031346 | 3300005441 | Unclassified | 3185 |
| 103 | Ga0070700_100326504 | 3300005441 | Bacteria | 1129 |
| 104 | Ga0070663_100042799 | 3300005455 | Bacteria | 3184 |
| 105 | Ga0070663_100115809 | 3300005455 | Bacteria | 2019 |
| 106 | Ga0070663_100161486 | 3300005455 | Bacteria | 1725 |
| 107 | Ga0070678_100123890 | 3300005456 | Bacteria | 2042 |
| 108 | Ga0070678_100219591 | 3300005456 | Unclassified | 1579 |
| 109 | Ga0070662_100002983 | 3300005457 | Bacteria | 10519 |
| 110 | Ga0070662_100022405 | 3300005457 | Bacteria | 4325 |
| 111 | Ga0070662_100025313 | 3300005457 | Unclassified | 4096 |
| 112 | Ga0070662_100028485 | 3300005457 | Bacteria | 3887 |
| 113 | Ga0070662_100029479 | 3300005457 | Bacteria | 3830 |
| 114 | Ga0070662_100065057 | 3300005457 | Bacteria | 2672 |
| 115 | Ga0068867_100005606 | 3300005459 | Bacteria | 8895 |
| 116 | Ga0068867_100053168 | 3300005459 | Bacteria | 2991 |
| 117 | Ga0068867_100106477 | 3300005459 | Unclassified | 2148 |
| 118 | Ga0068867_100223718 | 3300005459 | Bacteria | 1518 |
| 119 | Ga0068867_100297874 | 3300005459 | Bacteria | 1329 |
| 120 | Ga0070685_10001175 | 3300005466 | Bacteria | 14009 |
| 121 | Ga0070685_10215623 | 3300005466 | Bacteria | 1255 |
| 122 | Ga0070698_100001454 | 3300005471 | Bacteria | 26303 |
| 123 | Ga0070698_100021851 | 3300005471 | Bacteria | 6701 |
| 124 | Ga0070698_100060779 | 3300005471 | Unclassified | 3812 |
| 125 | Ga0070679_100015863 | 3300005530 | Bacteria | 7251 |
| 126 | Ga0070679_100026151 | 3300005530 | Bacteria | 5729 |
| 127 | Ga0070679_100322623 | 3300005530 | Bacteria | 1493 |
| 128 | Ga0070684_100000417 | 3300005535 | Bacteria | 29183 |
| 129 | Ga0070684_100000979 | 3300005535 | Bacteria | 20363 |
| 130 | Ga0070684_100002647 | 3300005535 | Bacteria | 13212 |
| 131 | Ga0070684_100007270 | 3300005535 | Bacteria | 8607 |
| 132 | Ga0070684_100045521 | 3300005535 | Bacteria | 3799 |
| 133 | Ga0070684_100051673 | 3300005535 | Bacteria | 3571 |
| 134 | Ga0070684_100065031 | 3300005535 | Unclassified | 3201 |
| 135 | Ga0068853_100003954 | 3300005539 | Bacteria | 11385 |
| 136 | Ga0068853_100007967 | 3300005539 | Bacteria | 8495 |
| 137 | Ga0068853_100024447 | 3300005539 | Bacteria | 5065 |
| 138 | Ga0068853_100136790 | 3300005539 | Unclassified | 2197 |
| 139 | Ga0068853_100152553 | 3300005539 | Bacteria | 2080 |
| 140 | Ga0068853_100423920 | 3300005539 | Unclassified | 1248 |
| 141 | Ga0070672_100000361 | 3300005543 | Bacteria | 26202 |
| 142 | Ga0070686_100014169 | 3300005544 | Bacteria | 4589 |
| 143 | Ga0070686_100060381 | 3300005544 | Unclassified | 2446 |
| 144 | Ga0070696_100208976 | 3300005546 | Bacteria | 1460 |
| 145 | Ga0070693_100115314 | 3300005547 | Bacteria | 1659 |
| 146 | Ga0070665_100002163 | 3300005548 | Bacteria | 21925 |
| 147 | Ga0070665_100072520 | 3300005548 | Bacteria | 3451 |
| 148 | Ga0070704_100057017 | 3300005549 | Bacteria | 2776 |
| 149 | Ga0068855_100018669 | 3300005563 | Bacteria | 8340 |
| 150 | Ga0070664_100000487 | 3300005564 | Bacteria | 30067 |
| 151 | Ga0070664_100017274 | 3300005564 | Bacteria | 5926 |
| 152 | Ga0070664_100019108 | 3300005564 | Bacteria | 5634 |
| 153 | Ga0070664_100021290 | 3300005564 | Bacteria | 5343 |
| 154 | Ga0070664_100041612 | 3300005564 | Bacteria | 3878 |
| 155 | Ga0070664_100058013 | 3300005564 | Bacteria | 3292 |
| 156 | Ga0070664_100086494 | 3300005564 | Bacteria | 2709 |
| 157 | Ga0070664_100098400 | 3300005564 | Bacteria | 2541 |
| 158 | Ga0070664_100279874 | 3300005564 | Bacteria | 1504 |
| 159 | Ga0068857_100021467 | 3300005577 | Bacteria | 5682 |
| 160 | Ga0068857_100182834 | 3300005577 | Bacteria | 1908 |
| 161 | Ga0068857_100248992 | 3300005577 | Unclassified | 1628 |
| 162 | Ga0068854_100038025 | 3300005578 | Bacteria | 3382 |
| 163 | Ga0068854_100062845 | 3300005578 | Bacteria | 2694 |
| 164 | Ga0068854_100105771 | 3300005578 | Bacteria | 2116 |
| 165 | Ga0068854_100120409 | 3300005578 | Bacteria | 1992 |
| 166 | Ga0068854_100210067 | 3300005578 | Bacteria | 1535 |
| 167 | Ga0068856_100003735 | 3300005614 | Bacteria | 15264 |
| 168 | Ga0068856_100392121 | 3300005614 | Bacteria | 1408 |
| 169 | Ga0068852_100019362 | 3300005616 | Bacteria | 5385 |
| 170 | Ga0068852_100039630 | 3300005616 | Bacteria | 3968 |
| 171 | Ga0068852_100051678 | 3300005616 | Bacteria | 3528 |
| 172 | Ga0068852_100065791 | 3300005616 | Bacteria | 3164 |
| 173 | Ga0068852_100140884 | 3300005616 | Bacteria | 2231 |
| 174 | Ga0068852_100583615 | 3300005616 | Bacteria | 1121 |
| 175 | Ga0068852_100715152 | 3300005616 | Bacteria | 1012 |
| 176 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 177 | Ga0068859_100001754 | 3300005617 | Bacteria | 22081 |
| 178 | Ga0068859_100075852 | 3300005617 | Bacteria | 3403 |
| 179 | Ga0068859_100185247 | 3300005617 | Bacteria | 2165 |
| 180 | Ga0068859_100226136 | 3300005617 | Bacteria | 1959 |
| 181 | Ga0068864_100000785 | 3300005618 | Bacteria | 26636 |
| 182 | Ga0068864_100007484 | 3300005618 | Bacteria | 8996 |
| 183 | Ga0068864_100073656 | 3300005618 | Bacteria | 2978 |
| 184 | Ga0068864_100309994 | 3300005618 | Bacteria | 1480 |
| 185 | Ga0068866_10046946 | 3300005718 | Bacteria | 2174 |
| 186 | Ga0068866_10065300 | 3300005718 | Unclassified | 1903 |
| 187 | Ga0068861_100002247 | 3300005719 | Bacteria | 12544 |
| 188 | Ga0068861_100350129 | 3300005719 | Bacteria | 1295 |
| 189 | Ga0068861_100516031 | 3300005719 | Bacteria | 1083 |
| 190 | Ga0068851_10001706 | 3300005834 | Bacteria | 9614 |
| 191 | Ga0068851_10008331 | 3300005834 | Bacteria | 4793 |
| 192 | Ga0068851_10102878 | 3300005834 | Bacteria | 1517 |
| 193 | Ga0068870_10013725 | 3300005840 | Bacteria | 3814 |
| 194 | Ga0068870_10039800 | 3300005840 | Bacteria | 2434 |
| 195 | Ga0068870_10104929 | 3300005840 | Bacteria | 1604 |
| 196 | Ga0068870_10336288 | 3300005840 | Bacteria | 964 |
| 197 | Ga0068863_100001993 | 3300005841 | Bacteria | 20286 |
| 198 | Ga0068863_100017853 | 3300005841 | Bacteria | 6789 |
| 199 | Ga0068863_100106750 | 3300005841 | Bacteria | 2665 |
| 200 | Ga0068863_100225831 | 3300005841 | Bacteria | 1805 |
| 201 | Ga0068863_100313814 | 3300005841 | Bacteria | 1522 |
| 202 | Ga0068863_100322227 | 3300005841 | Bacteria | 1501 |
| 203 | Ga0068858_100001413 | 3300005842 | Bacteria | 24658 |
| 204 | Ga0068858_100009905 | 3300005842 | Bacteria | 9053 |
| 205 | Ga0068858_100024399 | 3300005842 | Bacteria | 5634 |
| 206 | Ga0068858_100216157 | 3300005842 | Unclassified | 1815 |
| 207 | Ga0068860_100002836 | 3300005843 | Bacteria | 18019 |
| 208 | Ga0068860_100005500 | 3300005843 | Bacteria | 12830 |
| 209 | Ga0068860_100359213 | 3300005843 | Bacteria | 1435 |
| 210 | Ga0068860_100435672 | 3300005843 | Bacteria | 1301 |
| 211 | Ga0068862_100023039 | 3300005844 | Bacteria | 5215 |
| 212 | Ga0068862_100144415 | 3300005844 | Bacteria | 2114 |
| 213 | Ga0068862_100418849 | 3300005844 | Bacteria | 1256 |
| 214 | Ga0081539_10000925 | 3300005985 | Bacteria | 55202 |
| 215 | Ga0081539_10025637 | 3300005985 | Bacteria | 3790 |
| 216 | Ga0070715_10006766 | 3300006163 | Bacteria | 3912 |
| 217 | Ga0075366_10006993 | 3300006195 | Bacteria | 6209 |
| 218 | Ga0075366_10054467 | 3300006195 | Bacteria | 2376 |
| 219 | Ga0097621_100000063 | 3300006237 | Bacteria | 55571 |
| 220 | Ga0097621_100003845 | 3300006237 | Bacteria | 10402 |
| 221 | Ga0097621_100004135 | 3300006237 | Bacteria | 10062 |
| 222 | Ga0097621_100031558 | 3300006237 | Bacteria | 4205 |
| 223 | Ga0097621_100063054 | 3300006237 | Bacteria | 3045 |
| 224 | Ga0097621_100083814 | 3300006237 | Bacteria | 2657 |
| 225 | Ga0097621_100122957 | 3300006237 | Bacteria | 2203 |
| 226 | Ga0097621_100325614 | 3300006237 | Bacteria | 1362 |
| 227 | Ga0068871_100000952 | 3300006358 | Bacteria | 19348 |
| 228 | Ga0068871_100000981 | 3300006358 | Bacteria | 19104 |
| 229 | Ga0068871_100005200 | 3300006358 | Bacteria | 9099 |
| 230 | Ga0068871_100010643 | 3300006358 | Bacteria | 6723 |
| 231 | Ga0068871_100013193 | 3300006358 | Bacteria | 6128 |
| 232 | Ga0068871_100107543 | 3300006358 | Bacteria | 2343 |
| 233 | Ga0068871_100257638 | 3300006358 | Bacteria | 1521 |
| 234 | Ga0075428_100269929 | 3300006844 | Bacteria | 1830 |
| 235 | Ga0075428_100275229 | 3300006844 | Bacteria | 1811 |
| 236 | Ga0075429_100004948 | 3300006880 | Bacteria | 11476 |
| 237 | Ga0068865_100044565 | 3300006881 | Bacteria | 3037 |
| 238 | Ga0068865_100146220 | 3300006881 | Bacteria | 1788 |
| 239 | Ga0068865_100353480 | 3300006881 | Bacteria | 1191 |
| 240 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 241 | Ga0097620_100001754 | 3300006931 | Bacteria | 22081 |
| 242 | Ga0097620_100075852 | 3300006931 | Bacteria | 3403 |
| 243 | Ga0097620_100185237 | 3300006931 | Bacteria | 2165 |
| 244 | Ga0097620_100226101 | 3300006931 | Bacteria | 1959 |
| 245 | Ga0105244_10000018 | 3300009036 | Bacteria | 244992 |
| 246 | Ga0111539_10005620 | 3300009094 | Bacteria | 16217 |
| 247 | Ga0105245_10108552 | 3300009098 | Bacteria | 2578 |
| 248 | Ga0105245_10296942 | 3300009098 | Bacteria | 1584 |
| 249 | Ga0105247_10279429 | 3300009101 | Bacteria | 1151 |
| 250 | Ga0114129_10634904 | 3300009147 | Bacteria | 1380 |
| 251 | Ga0105243_10000089 | 3300009148 | Bacteria | 103761 |
| 252 | Ga0105243_10199508 | 3300009148 | Bacteria | 1754 |
| 253 | Ga0105241_10001370 | 3300009174 | Bacteria | 18574 |
| 254 | Ga0105241_10260351 | 3300009174 | Bacteria | 1474 |
| 255 | Ga0105241_10353892 | 3300009174 | Unclassified | 1276 |
| 256 | Ga0105241_10400714 | 3300009174 | Unclassified | 1203 |
| 257 | Ga0105242_10013371 | 3300009176 | Bacteria | 6341 |
| 258 | Ga0105242_10025402 | 3300009176 | Bacteria | 4689 |
| 259 | Ga0105242_10111369 | 3300009176 | Unclassified | 2334 |
| 260 | Ga0105242_10111690 | 3300009176 | Bacteria | 2331 |
| 261 | Ga0105248_10009934 | 3300009177 | Bacteria | 10475 |
| 262 | Ga0105248_10431783 | 3300009177 | Bacteria | 1484 |
| 263 | Ga0105237_10010659 | 3300009545 | Bacteria | 9766 |
| 264 | Ga0105237_10033939 | 3300009545 | Bacteria | 5169 |
| 265 | Ga0105237_10077957 | 3300009545 | Bacteria | 3303 |
| 266 | Ga0105237_10709862 | 3300009545 | Bacteria | 1012 |
| 267 | Ga0105249_10001749 | 3300009553 | Bacteria | 18941 |
| 268 | Ga0105249_10003402 | 3300009553 | Bacteria | 13780 |
| 269 | Ga0105249_10003442 | 3300009553 | Bacteria | 13704 |
| 270 | Ga0105249_10028082 | 3300009553 | Bacteria | 5079 |
| 271 | Ga0105249_10035804 | 3300009553 | Bacteria | 4501 |
| 272 | Ga0105249_10055217 | 3300009553 | Bacteria | 3633 |
| 273 | Ga0105249_10069050 | 3300009553 | Bacteria | 3261 |
| 274 | Ga0105249_10087480 | 3300009553 | Bacteria | 2907 |
| 275 | Ga0105239_10042858 | 3300010375 | Bacteria | 4959 |
| 276 | Ga0105239_10231904 | 3300010375 | Bacteria | 2071 |
| 277 | Ga0105246_10061186 | 3300011119 | Bacteria | 2619 |
| 278 | Ga0157373_10000067 | 3300013100 | Bacteria | 92618 |
| 279 | Ga0157373_10033227 | 3300013100 | Bacteria | 3712 |
| 280 | Ga0157373_10122911 | 3300013100 | Bacteria | 1825 |
| 281 | Ga0157371_10000036 | 3300013102 | Bacteria | 215191 |
| 282 | Ga0157371_10000901 | 3300013102 | Bacteria | 33476 |
| 283 | Ga0157371_10029931 | 3300013102 | Bacteria | 3930 |
| 284 | Ga0157371_10056580 | 3300013102 | Unclassified | 2782 |
| 285 | Ga0157371_10215458 | 3300013102 | Bacteria | 1378 |
| 286 | Ga0157371_10412720 | 3300013102 | Bacteria | 989 |
| 287 | Ga0157370_10001141 | 3300013104 | Bacteria | 33176 |
| 288 | Ga0157370_10005003 | 3300013104 | Bacteria | 14995 |
| 289 | Ga0157370_10013588 | 3300013104 | Bacteria | 8378 |
| 290 | Ga0157370_10033216 | 3300013104 | Bacteria | 5030 |
| 291 | Ga0157370_10042698 | 3300013104 | Bacteria | 4368 |
| 292 | Ga0157370_10073252 | 3300013104 | Bacteria | 3231 |
| 293 | Ga0157370_10246344 | 3300013104 | Bacteria | 1653 |
| 294 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 295 | Ga0157369_10000153 | 3300013105 | Bacteria | 97572 |
| 296 | Ga0157369_10102782 | 3300013105 | Bacteria | 3044 |
| 297 | Ga0157369_10212800 | 3300013105 | Bacteria | 2025 |
| 298 | Ga0157369_10233736 | 3300013105 | Bacteria | 1921 |
| 299 | Ga0157369_10313553 | 3300013105 | Bacteria | 1631 |
| 300 | Ga0157369_10442104 | 3300013105 | Bacteria | 1347 |
| 301 | Ga0157374_10002589 | 3300013296 | Bacteria | 15240 |
| 302 | Ga0157374_10003428 | 3300013296 | Bacteria | 13327 |
| 303 | Ga0157374_10049451 | 3300013296 | Unclassified | 3905 |
| 304 | Ga0157374_10054530 | 3300013296 | Bacteria | 3729 |
| 305 | Ga0157374_10054949 | 3300013296 | Bacteria | 3715 |
| 306 | Ga0157374_10097876 | 3300013296 | Bacteria | 2808 |
| 307 | Ga0157374_10198855 | 3300013296 | Bacteria | 1962 |
| 308 | Ga0157378_10013496 | 3300013297 | Bacteria | 7144 |
| 309 | Ga0157378_10033096 | 3300013297 | Bacteria | 4569 |
| 310 | Ga0157378_10047281 | 3300013297 | Bacteria | 3825 |
| 311 | Ga0157378_10114878 | 3300013297 | Unclassified | 2473 |
| 312 | Ga0157378_10124762 | 3300013297 | Bacteria | 2378 |
| 313 | Ga0157378_10250143 | 3300013297 | Bacteria | 1696 |
| 314 | Ga0157378_10259627 | 3300013297 | Unclassified | 1666 |
| 315 | Ga0157378_10435448 | 3300013297 | Bacteria | 1298 |
| 316 | Ga0157378_10480459 | 3300013297 | Bacteria | 1238 |
| 317 | Ga0163162_10000158 | 3300013306 | Bacteria | 62514 |
| 318 | Ga0163162_10000377 | 3300013306 | Bacteria | 40533 |
| 319 | Ga0163162_10000644 | 3300013306 | Bacteria | 32326 |
| 320 | Ga0163162_10001190 | 3300013306 | Bacteria | 24282 |
| 321 | Ga0163162_10018529 | 3300013306 | Bacteria | 6822 |
| 322 | Ga0163162_10029831 | 3300013306 | Bacteria | 5399 |
| 323 | Ga0163162_10037650 | 3300013306 | Bacteria | 4828 |
| 324 | Ga0163162_10042883 | 3300013306 | Bacteria | 4529 |
| 325 | Ga0163162_10047851 | 3300013306 | Bacteria | 4284 |
| 326 | Ga0163162_10127457 | 3300013306 | Bacteria | 2653 |
| 327 | Ga0163162_10168586 | 3300013306 | Bacteria | 2314 |
| 328 | Ga0163162_10192926 | 3300013306 | Bacteria | 2165 |
| 329 | Ga0163162_10216519 | 3300013306 | Bacteria | 2045 |
| 330 | Ga0163162_10369595 | 3300013306 | Bacteria | 1567 |
| 331 | Ga0163162_10468065 | 3300013306 | Bacteria | 1392 |
| 332 | Ga0163162_10911951 | 3300013306 | Bacteria | 991 |
| 333 | Ga0157372_10005409 | 3300013307 | Bacteria | 13572 |
| 334 | Ga0157372_10027042 | 3300013307 | Bacteria | 6245 |
| 335 | Ga0157372_10071025 | 3300013307 | Bacteria | 3919 |
| 336 | Ga0157372_10142018 | 3300013307 | Bacteria | 2767 |
| 337 | Ga0157372_10228455 | 3300013307 | Bacteria | 2157 |
| 338 | Ga0157372_10571440 | 3300013307 | Bacteria | 1318 |
| 339 | Ga0157375_10000228 | 3300013308 | Bacteria | 52278 |
| 340 | Ga0157375_10001328 | 3300013308 | Bacteria | 21305 |
| 341 | Ga0157375_10003748 | 3300013308 | Bacteria | 13182 |
| 342 | Ga0157375_10004745 | 3300013308 | Bacteria | 11813 |
| 343 | Ga0157375_10008382 | 3300013308 | Bacteria | 9053 |
| 344 | Ga0157375_10049408 | 3300013308 | Bacteria | 4121 |
| 345 | Ga0157375_10065222 | 3300013308 | Bacteria | 3629 |
| 346 | Ga0157375_10069925 | 3300013308 | Bacteria | 3518 |
| 347 | Ga0157375_10084393 | 3300013308 | Bacteria | 3225 |
| 348 | Ga0157375_10133517 | 3300013308 | Bacteria | 2604 |
| 349 | Ga0157375_10175021 | 3300013308 | Bacteria | 2295 |
| 350 | Ga0157375_10442892 | 3300013308 | Bacteria | 1465 |
| 351 | Ga0157375_10518120 | 3300013308 | Bacteria | 1356 |
| 352 | Ga0163163_10000712 | 3300014325 | Bacteria | 28219 |
| 353 | Ga0163163_10000752 | 3300014325 | Bacteria | 27543 |
| 354 | Ga0163163_10009781 | 3300014325 | Bacteria | 8590 |
| 355 | Ga0163163_10031622 | 3300014325 | Bacteria | 5109 |
| 356 | Ga0163163_10119820 | 3300014325 | Bacteria | 2665 |
| 357 | Ga0163163_10486590 | 3300014325 | Bacteria | 1295 |
| 358 | Ga0157380_10004225 | 3300014326 | Bacteria | 9934 |
| 359 | Ga0157380_10189598 | 3300014326 | Bacteria | 1814 |
| 360 | Ga0182008_10000016 | 3300014497 | Bacteria | 241246 |
| 361 | Ga0182008_10001316 | 3300014497 | Bacteria | 16944 |
| 362 | Ga0157377_10006267 | 3300014745 | Bacteria | 5662 |
| 363 | Ga0157377_10046320 | 3300014745 | Bacteria | 2432 |
| 364 | Ga0157377_10071414 | 3300014745 | Bacteria | 2007 |
| 365 | Ga0157377_10089056 | 3300014745 | Bacteria | 1819 |
| 366 | Ga0157379_10000440 | 3300014968 | Bacteria | 33697 |
| 367 | Ga0157379_10028369 | 3300014968 | Bacteria | 4979 |
| 368 | Ga0157379_10049041 | 3300014968 | Bacteria | 3770 |
| 369 | Ga0157379_10051640 | 3300014968 | Bacteria | 3672 |
| 370 | Ga0157379_10113893 | 3300014968 | Bacteria | 2431 |
| 371 | Ga0157379_10195491 | 3300014968 | Bacteria | 1828 |
| 372 | Ga0157376_10000381 | 3300014969 | Bacteria | 28821 |
| 373 | Ga0157376_10001773 | 3300014969 | Bacteria | 14357 |
| 374 | Ga0157376_10003377 | 3300014969 | Bacteria | 10986 |
| 375 | Ga0157376_10031463 | 3300014969 | Bacteria | 4250 |
| 376 | Ga0157376_10048370 | 3300014969 | Bacteria | 3516 |
| 377 | Ga0157376_10103570 | 3300014969 | Unclassified | 2492 |
| 378 | Ga0157376_10109093 | 3300014969 | Unclassified | 2433 |
| 379 | Ga0157376_10122083 | 3300014969 | Bacteria | 2311 |
| 380 | Ga0182006_1000079 | 3300015261 | Bacteria | 122553 |
| 381 | Ga0182006_1001053 | 3300015261 | Bacteria | 17809 |
| 382 | Ga0182006_1001108 | 3300015261 | Bacteria | 17182 |
| 383 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 384 | Ga0183373_1005 | 3300015682 | Bacteria | 351562 |
| 385 | Ga0163161_10000206 | 3300017792 | Bacteria | 54119 |
| 386 | Ga0163161_10000729 | 3300017792 | Bacteria | 25879 |
| 387 | Ga0163161_10002605 | 3300017792 | Bacteria | 12857 |
| 388 | Ga0163161_10005480 | 3300017792 | Bacteria | 8809 |
| 389 | Ga0163161_10016285 | 3300017792 | Bacteria | 5189 |
| 390 | Ga0163161_10018054 | 3300017792 | Bacteria | 4944 |
| 391 | Ga0163161_10027223 | 3300017792 | Bacteria | 4055 |
| 392 | Ga0163161_10043480 | 3300017792 | Bacteria | 3234 |
| 393 | Ga0163161_10056639 | 3300017792 | Bacteria | 2847 |
| 394 | Ga0163161_10071466 | 3300017792 | Bacteria | 2539 |
| 395 | Ga0163161_10136713 | 3300017792 | Bacteria | 1853 |
| 396 | Ga0163161_10304949 | 3300017792 | Bacteria | 1255 |
| 397 | Ga0213876_10001384 | 3300021384 | Bacteria | 15141 |
| 398 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 399 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 400 | Ga0209675_1000159 | 3300025291 | Bacteria | 87316 |
| 401 | Ga0209676_1000058 | 3300025292 | Bacteria | 345185 |
| 402 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 403 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 404 | Ga0209050_1000054 | 3300025298 | Bacteria | 345186 |
| 405 | Ga0207656_10000424 | 3300025321 | Bacteria | 14223 |
| 406 | Ga0207656_10007438 | 3300025321 | Bacteria | 3988 |
| 407 | Ga0207655_1000058 | 3300025728 | Bacteria | 267656 |
| 408 | Ga0207682_10060158 | 3300025893 | Bacteria | 1588 |
| 409 | Ga0207642_10056040 | 3300025899 | Unclassified | 1806 |
| 410 | Ga0207642_10073459 | 3300025899 | Bacteria | 1636 |
| 411 | Ga0207688_10017118 | 3300025901 | Bacteria | 3939 |
| 412 | Ga0207680_10000031 | 3300025903 | Bacteria | 77871 |
| 413 | Ga0207680_10001363 | 3300025903 | Bacteria | 11575 |
| 414 | Ga0207680_10014750 | 3300025903 | Bacteria | 4057 |
| 415 | Ga0207680_10056804 | 3300025903 | Bacteria | 2366 |
| 416 | Ga0207647_10000045 | 3300025904 | Bacteria | 90413 |
| 417 | Ga0207647_10064758 | 3300025904 | Bacteria | 2220 |
| 418 | Ga0207645_10000949 | 3300025907 | Bacteria | 24072 |
| 419 | Ga0207645_10012613 | 3300025907 | Bacteria | 5730 |
| 420 | Ga0207645_10022921 | 3300025907 | Bacteria | 4057 |
| 421 | Ga0207645_10098705 | 3300025907 | Bacteria | 1883 |
| 422 | Ga0207645_10218429 | 3300025907 | Unclassified | 1256 |
| 423 | Ga0207643_10020523 | 3300025908 | Unclassified | 3627 |
| 424 | Ga0207643_10036648 | 3300025908 | Bacteria | 2751 |
| 425 | Ga0207705_10023675 | 3300025909 | Bacteria | 4381 |
| 426 | Ga0207705_10082373 | 3300025909 | Unclassified | 2346 |
| 427 | Ga0207705_10331340 | 3300025909 | Bacteria | 1171 |
| 428 | Ga0207654_10008187 | 3300025911 | Bacteria | 5272 |
| 429 | Ga0207707_10108650 | 3300025912 | Bacteria | 2425 |
| 430 | Ga0207671_10000981 | 3300025914 | Bacteria | 35291 |
| 431 | Ga0207660_10075317 | 3300025917 | Bacteria | 2465 |
| 432 | Ga0207662_10062623 | 3300025918 | Bacteria | 2236 |
| 433 | Ga0207657_10027098 | 3300025919 | Bacteria | 5254 |
| 434 | Ga0207657_10085559 | 3300025919 | Unclassified | 2641 |
| 435 | Ga0207657_10089214 | 3300025919 | Bacteria | 2576 |
| 436 | Ga0207649_10115826 | 3300025920 | Bacteria | 1799 |
| 437 | Ga0207649_10268265 | 3300025920 | Bacteria | 1236 |
| 438 | Ga0207652_10193262 | 3300025921 | Bacteria | 1830 |
| 439 | Ga0207652_10221839 | 3300025921 | Bacteria | 1703 |
| 440 | Ga0207681_10024459 | 3300025923 | Bacteria | 3877 |
| 441 | Ga0207681_10039482 | 3300025923 | Bacteria | 3135 |
| 442 | Ga0207650_10036624 | 3300025925 | Bacteria | 3570 |
| 443 | Ga0207650_10038496 | 3300025925 | Bacteria | 3493 |
| 444 | Ga0207650_10086550 | 3300025925 | Bacteria | 2386 |
| 445 | Ga0207650_10370276 | 3300025925 | Unclassified | 1182 |
| 446 | Ga0207659_10028881 | 3300025926 | Bacteria | 3773 |
| 447 | Ga0207659_10075294 | 3300025926 | Bacteria | 2476 |
| 448 | Ga0207659_10102255 | 3300025926 | Bacteria | 2163 |
| 449 | Ga0207659_10161286 | 3300025926 | Bacteria | 1761 |
| 450 | Ga0207659_10590876 | 3300025926 | Unclassified | 946 |
| 451 | Ga0207644_10027242 | 3300025931 | Bacteria | 3948 |
| 452 | Ga0207644_10028317 | 3300025931 | Bacteria | 3878 |
| 453 | Ga0207690_10013214 | 3300025932 | Bacteria | 4957 |
| 454 | Ga0207690_10018625 | 3300025932 | Bacteria | 4259 |
| 455 | Ga0207690_10119886 | 3300025932 | Bacteria | 1909 |
| 456 | Ga0207690_10227909 | 3300025932 | Bacteria | 1429 |
| 457 | Ga0207690_10312143 | 3300025932 | Bacteria | 1233 |
| 458 | Ga0207706_10002788 | 3300025933 | Bacteria | 16975 |
| 459 | Ga0207706_10002868 | 3300025933 | Bacteria | 16715 |
| 460 | Ga0207706_10011186 | 3300025933 | Bacteria | 8182 |
| 461 | Ga0207706_10022975 | 3300025933 | Bacteria | 5600 |
| 462 | Ga0207706_10070718 | 3300025933 | Bacteria | 3069 |
| 463 | Ga0207706_10108753 | 3300025933 | Unclassified | 2440 |
| 464 | Ga0207686_10001258 | 3300025934 | Bacteria | 14622 |
| 465 | Ga0207686_10006783 | 3300025934 | Bacteria | 6168 |
| 466 | Ga0207686_10068276 | 3300025934 | Bacteria | 2277 |
| 467 | Ga0207709_10000136 | 3300025935 | Bacteria | 106728 |
| 468 | Ga0207709_10548042 | 3300025935 | Bacteria | 909 |
| 469 | Ga0207670_10011342 | 3300025936 | Bacteria | 5169 |
| 470 | Ga0207670_10217576 | 3300025936 | Unclassified | 1460 |
| 471 | Ga0207669_10187252 | 3300025937 | Bacteria | 1490 |
| 472 | Ga0207704_10144453 | 3300025938 | Bacteria | 1669 |
| 473 | Ga0207704_10399812 | 3300025938 | Bacteria | 1084 |
| 474 | Ga0207691_10000037 | 3300025940 | Bacteria | 108385 |
| 475 | Ga0207691_10026608 | 3300025940 | Bacteria | 5428 |
| 476 | Ga0207691_10028848 | 3300025940 | Bacteria | 5193 |
| 477 | Ga0207691_10045817 | 3300025940 | Bacteria | 4020 |
| 478 | Ga0207691_10150951 | 3300025940 | Bacteria | 2043 |
| 479 | Ga0207711_10018774 | 3300025941 | Bacteria | 5750 |
| 480 | Ga0207711_10255548 | 3300025941 | Bacteria | 1610 |
| 481 | Ga0207689_10002661 | 3300025942 | Bacteria | 16517 |
| 482 | Ga0207689_10004266 | 3300025942 | Bacteria | 13005 |
| 483 | Ga0207689_10009367 | 3300025942 | Bacteria | 8462 |
| 484 | Ga0207689_10014782 | 3300025942 | Bacteria | 6627 |
| 485 | Ga0207689_10031238 | 3300025942 | Unclassified | 4436 |
| 486 | Ga0207689_10039483 | 3300025942 | Bacteria | 3907 |
| 487 | Ga0207689_10129456 | 3300025942 | Bacteria | 2077 |
| 488 | Ga0207689_10507142 | 3300025942 | Bacteria | 1011 |
| 489 | Ga0207661_10014437 | 3300025944 | Bacteria | 5790 |
| 490 | Ga0207661_10109119 | 3300025944 | Bacteria | 2337 |
| 491 | Ga0207661_10223850 | 3300025944 | Unclassified | 1664 |
| 492 | Ga0207661_10515098 | 3300025944 | Bacteria | 1094 |
| 493 | Ga0207679_10000462 | 3300025945 | Bacteria | 28637 |
| 494 | Ga0207679_10013882 | 3300025945 | Bacteria | 5281 |
| 495 | Ga0207679_10041221 | 3300025945 | Bacteria | 3309 |
| 496 | Ga0207679_10051359 | 3300025945 | Bacteria | 3018 |
| 497 | Ga0207679_10057339 | 3300025945 | Bacteria | 2880 |
| 498 | Ga0207679_10161812 | 3300025945 | Bacteria | 1833 |
| 499 | Ga0207679_10259786 | 3300025945 | Bacteria | 1481 |
| 500 | Ga0207667_10045413 | 3300025949 | Bacteria | 4653 |
| 501 | Ga0207667_10238556 | 3300025949 | Bacteria | 1861 |
| 502 | Ga0207651_10000443 | 3300025960 | Bacteria | 17529 |
| 503 | Ga0207651_10005935 | 3300025960 | Bacteria | 6325 |
| 504 | Ga0207651_10077324 | 3300025960 | Unclassified | 2382 |
| 505 | Ga0207651_10093422 | 3300025960 | Bacteria | 2209 |
| 506 | Ga0207651_10117000 | 3300025960 | Bacteria | 2013 |
| 507 | Ga0207651_10543021 | 3300025960 | Bacteria | 1010 |
| 508 | Ga0207712_10004607 | 3300025961 | Bacteria | 8711 |
| 509 | Ga0207712_10005091 | 3300025961 | Bacteria | 8312 |
| 510 | Ga0207712_10025168 | 3300025961 | Bacteria | 3952 |
| 511 | Ga0207712_10093866 | 3300025961 | Bacteria | 2215 |
| 512 | Ga0207712_10096509 | 3300025961 | Bacteria | 2188 |
| 513 | Ga0207712_10114190 | 3300025961 | Bacteria | 2031 |
| 514 | Ga0207668_10001307 | 3300025972 | Bacteria | 14792 |
| 515 | Ga0207668_10010481 | 3300025972 | Bacteria | 5601 |
| 516 | Ga0207668_10081464 | 3300025972 | Bacteria | 2348 |
| 517 | Ga0207668_10083349 | 3300025972 | Bacteria | 2326 |
| 518 | Ga0207668_10223360 | 3300025972 | Bacteria | 1514 |
| 519 | Ga0207640_10012183 | 3300025981 | Bacteria | 4892 |
| 520 | Ga0207640_10048817 | 3300025981 | Bacteria | 2738 |
| 521 | Ga0207640_10063567 | 3300025981 | Bacteria | 2453 |
| 522 | Ga0207658_10000629 | 3300025986 | Bacteria | 31155 |
| 523 | Ga0207658_10043522 | 3300025986 | Bacteria | 3264 |
| 524 | Ga0207658_10091991 | 3300025986 | Unclassified | 2355 |
| 525 | Ga0207658_10105837 | 3300025986 | Bacteria | 2213 |
| 526 | Ga0207658_10396142 | 3300025986 | Bacteria | 1213 |
| 527 | Ga0207677_10005907 | 3300026023 | Bacteria | 6662 |
| 528 | Ga0207677_10033369 | 3300026023 | Bacteria | 3321 |
| 529 | Ga0207677_10085822 | 3300026023 | Unclassified | 2273 |
| 530 | Ga0207677_10119795 | 3300026023 | Bacteria | 1977 |
| 531 | Ga0207677_10164327 | 3300026023 | Bacteria | 1728 |
| 532 | Ga0207677_10391670 | 3300026023 | Bacteria | 1176 |
| 533 | Ga0207703_10004145 | 3300026035 | Bacteria | 11957 |
| 534 | Ga0207703_10009241 | 3300026035 | Bacteria | 7751 |
| 535 | Ga0207703_10122825 | 3300026035 | Bacteria | 2231 |
| 536 | Ga0207703_10128071 | 3300026035 | Bacteria | 2188 |
| 537 | Ga0207703_10209649 | 3300026035 | Bacteria | 1736 |
| 538 | Ga0207703_10332514 | 3300026035 | Bacteria | 1394 |
| 539 | Ga0207639_10016412 | 3300026041 | Bacteria | 5239 |
| 540 | Ga0207639_10045458 | 3300026041 | Bacteria | 3307 |
| 541 | Ga0207639_10380015 | 3300026041 | Bacteria | 1268 |
| 542 | Ga0207678_10419337 | 3300026067 | Bacteria | 1160 |
| 543 | Ga0207708_10073106 | 3300026075 | Unclassified | 2628 |
| 544 | Ga0207702_10137748 | 3300026078 | Bacteria | 2204 |
| 545 | Ga0207641_10000048 | 3300026088 | Bacteria | 178206 |
| 546 | Ga0207641_10000253 | 3300026088 | Bacteria | 67848 |
| 547 | Ga0207641_10092372 | 3300026088 | Bacteria | 2650 |
| 548 | Ga0207641_10263783 | 3300026088 | Bacteria | 1614 |
| 549 | Ga0207641_10295421 | 3300026088 | Bacteria | 1528 |
| 550 | Ga0207641_10368936 | 3300026088 | Bacteria | 1372 |
| 551 | Ga0207641_10657973 | 3300026088 | Bacteria | 1029 |
| 552 | Ga0207648_10001276 | 3300026089 | Bacteria | 28144 |
| 553 | Ga0207648_10002983 | 3300026089 | Bacteria | 17886 |
| 554 | Ga0207648_10006182 | 3300026089 | Bacteria | 11925 |
| 555 | Ga0207648_10009426 | 3300026089 | Bacteria | 9354 |
| 556 | Ga0207648_10014222 | 3300026089 | Bacteria | 7360 |
| 557 | Ga0207648_10029826 | 3300026089 | Bacteria | 4837 |
| 558 | Ga0207648_10046709 | 3300026089 | Bacteria | 3796 |
| 559 | Ga0207648_10047918 | 3300026089 | Bacteria | 3744 |
| 560 | Ga0207648_10063228 | 3300026089 | Bacteria | 3226 |
| 561 | Ga0207648_10123232 | 3300026089 | Bacteria | 2279 |
| 562 | Ga0207648_10469249 | 3300026089 | Bacteria | 1148 |
| 563 | Ga0207676_10002535 | 3300026095 | Bacteria | 13033 |
| 564 | Ga0207676_10013593 | 3300026095 | Bacteria | 5842 |
| 565 | Ga0207676_10023708 | 3300026095 | Bacteria | 4533 |
| 566 | Ga0207676_10140043 | 3300026095 | Bacteria | 2070 |
| 567 | Ga0207676_10271657 | 3300026095 | Bacteria | 1535 |
| 568 | Ga0207674_10010902 | 3300026116 | Bacteria | 10234 |
| 569 | Ga0207674_10011266 | 3300026116 | Bacteria | 10051 |
| 570 | Ga0207674_10020174 | 3300026116 | Bacteria | 7208 |
| 571 | Ga0207674_10122461 | 3300026116 | Bacteria | 2567 |
| 572 | Ga0207674_10142993 | 3300026116 | Bacteria | 2352 |
| 573 | Ga0207675_100000304 | 3300026118 | Bacteria | 47181 |
| 574 | Ga0207675_100023895 | 3300026118 | Bacteria | 5685 |
| 575 | Ga0207675_100034036 | 3300026118 | Bacteria | 4748 |
| 576 | Ga0207675_100077897 | 3300026118 | Bacteria | 3106 |
| 577 | Ga0207675_100297918 | 3300026118 | Viruses | 1570 |
| 578 | Ga0207675_100647957 | 3300026118 | Viruses | 1062 |
| 579 | Ga0207683_10004127 | 3300026121 | Bacteria | 12564 |
| 580 | Ga0207683_10010066 | 3300026121 | Bacteria | 8066 |
| 581 | Ga0207698_10004963 | 3300026142 | Bacteria | 8157 |
| 582 | Ga0207698_10038652 | 3300026142 | Bacteria | 3528 |
| 583 | Ga0207698_10066040 | 3300026142 | Bacteria | 2846 |
| 584 | Ga0207698_10284271 | 3300026142 | Bacteria | 1532 |
| 585 | Ga0268266_10004818 | 3300028379 | Bacteria | 12818 |
| 586 | Ga0268265_10486649 | 3300028380 | Unclassified | 1160 |
| 587 | Ga0268264_10001271 | 3300028381 | Bacteria | 23942 |
| 588 | Ga0268264_10008067 | 3300028381 | Bacteria | 8759 |
| 589 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 590 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 591 | Ga0265327_10000051 | 3300031251 | Bacteria | 257963 |
| 592 | Ga0265327_10000192 | 3300031251 | Bacteria | 129439 |
| 593 | Ga0307513_10084237 | 3300031456 | Bacteria | 3266 |
| 594 | Ga0307509_10025206 | 3300031507 | Bacteria | 6645 |
| 595 | Ga0307509_10053235 | 3300031507 | Bacteria | 4317 |
| 596 | Ga0307405_10000035 | 3300031731 | Bacteria | 92134 |
| 597 | Ga0307407_10000005 | 3300031903 | Bacteria | 233125 |
| 598 | Ga0307412_10000640 | 3300031911 | Bacteria | 20375 |
| 599 | Ga0307412_10001858 | 3300031911 | Bacteria | 11683 |
| 600 | Ga0307412_10002518 | 3300031911 | Bacteria | 10189 |
| 601 | Ga0307409_100015519 | 3300031995 | Bacteria | 5003 |
| 602 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 603 | Ga0307416_100000020 | 3300032002 | Bacteria | 192862 |
| 604 | Ga0307414_10000041 | 3300032004 | Bacteria | 144783 |
| 605 | Ga0307414_10067446 | 3300032004 | Bacteria | 2563 |
| 606 | Ga0307414_10079185 | 3300032004 | Unclassified | 2398 |
| 607 | Ga0307414_10099280 | 3300032004 | Bacteria | 2187 |
| 608 | Ga0373944_0076323 | 3300035089 | Bacteria | 1100 |
| 609 | Ga0373954_0165959 | 3300035118 | Bacteria | 1081 |
| 610 | Ga0373943_0116184 | 3300035170 | Bacteria | 1417 |
| 611 | Ga0373955_0112840 | 3300035172 | Unclassified | 1573 |
| 612 | Ga0373924_0139268 | 3300035410 | Bacteria | 1058 |
| 613 | Ga0395905_0002094 | 3300037471 | Bacteria | 22677 |
| 614 | Ga0395905_0048344 | 3300037471 | Bacteria | 3987 |
| 615 | Ga0395905_0481311 | 3300037471 | Bacteria | 1141 |
| 616 | Ga0400483_199042 | 3300039062 | Bacteria | 39689 |
| 617 | Ga0400483_249684 | 3300039062 | Bacteria | 1494 |
| 618 | Ga0400489_32343 | 3300039093 | Bacteria | 2468 |
| 619 | Ga0436365_0502188 | 3300039437 | Bacteria | 16571 |
| 620 | Ga0439465_0000489 | 3300041413 | Bacteria | 11781 |
| 621 | Ga0439442_033746 | 3300042002 | Bacteria | 1070 |
| 622 | Ga0439445_0000605 | 3300042004 | Bacteria | 7352 |
| 623 | Ga0439445_0048892 | 3300042004 | Unclassified | 1138 |
| 624 | Ga0450903_024675 | 3300042138 | Bacteria | 922 |
| 625 | Ga0451577_0000599 | 3300042876 | Bacteria | 57951 |
| 626 | Ga0451577_0114052 | 3300042876 | Bacteria | 2419 |
| 627 | Ga0466972_0115267 | 3300044658 | Bacteria | 1269 |
| 628 | Ga0453683_0000311 | 3300044673 | Bacteria | 61262 |
| 629 | Ga0453683_0016047 | 3300044673 | Bacteria | 4839 |
| 630 | Ga0453683_0082057 | 3300044673 | Bacteria | 2020 |
| 631 | Ga0453683_0210088 | 3300044673 | Bacteria | 1236 |
| 632 | Ga0466966_0009648 | 3300044684 | Bacteria | 6388 |
| 633 | Ga0453684_0001039 | 3300044712 | Bacteria | 88840 |
| 634 | Ga0453684_0050317 | 3300044712 | Bacteria | 5484 |
| 635 | Ga0451576_0001077 | 3300045051 | Bacteria | 50060 |
| 636 | Ga0451576_0018027 | 3300045051 | Bacteria | 7746 |
| 637 | Ga0495627_000029 | 3300046453 | Bacteria | 232349 |
| 638 | Ga0495627_007357 | 3300046453 | Bacteria | 4226 |
| 639 | Ga0495592_0041234 | 3300046454 | Bacteria | 3460 |
| 640 | Ga0495638_0055927 | 3300046460 | Bacteria | 2449 |
| 641 | Ga0495638_0114161 | 3300046460 | Bacteria | 1602 |
| 642 | Ga0495580_0324771 | 3300046472 | Unclassified | 1046 |
| 643 | Ga0495596_0011828 | 3300046500 | Bacteria | 3747 |
| 644 | Ga0495606_0003913 | 3300046507 | Bacteria | 15321 |
| 645 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 646 | Ga0495610_0000405 | 3300046512 | Bacteria | 44184 |
| 647 | Ga0495610_0000441 | 3300046512 | Bacteria | 42808 |
| 648 | Ga0495632_0006192 | 3300046519 | Bacteria | 7746 |
| 649 | Ga0495663_0000243 | 3300046525 | Bacteria | 21677 |
| 650 | Ga0495663_0003226 | 3300046525 | Bacteria | 4743 |
| 651 | Ga0495652_0324197 | 3300046529 | Bacteria | 1112 |
| 652 | Ga0495654_0000008 | 3300046530 | Bacteria | 398340 |
| 653 | Ga0495586_0073546 | 3300046535 | Bacteria | 1870 |
| 654 | Ga0495587_0023999 | 3300046536 | Bacteria | 3743 |
| 655 | Ga0495587_0174795 | 3300046536 | Bacteria | 1219 |
| 656 | Ga0495609_0000010 | 3300046538 | Bacteria | 342605 |
| 657 | Ga0495621_0077088 | 3300046539 | Bacteria | 1237 |
| 658 | Ga0495645_0221546 | 3300046543 | Bacteria | 1272 |
| 659 | Ga0495633_0000163 | 3300046558 | Bacteria | 87285 |
| 660 | Ga0495633_0003132 | 3300046558 | Bacteria | 11208 |
| 661 | Ga0495633_0030156 | 3300046558 | Bacteria | 2636 |
| 662 | Ga0495668_0000878 | 3300046616 | Bacteria | 33873 |
| 663 | Ga0495668_0002497 | 3300046616 | Bacteria | 15047 |
| 664 | Ga0495635_0098756 | 3300046663 | Bacteria | 1996 |
| 665 | Ga0495661_0001581 | 3300046665 | Bacteria | 18761 |
| 666 | Ga0495657_0064417 | 3300046675 | Bacteria | 2415 |
| 667 | Ga0495658_0148905 | 3300046683 | Bacteria | 1436 |
| 668 | Ga0495604_0246748 | 3300047317 | Bacteria | 1219 |
| 669 | Ga0495672_0014449 | 3300047320 | Bacteria | 5407 |
| 670 | Ga0495676_0085516 | 3300047321 | Unclassified | 2376 |
| 671 | Ga0495684_0114416 | 3300047471 | Bacteria | 2034 |
| 672 | Ga0495686_0000153 | 3300047472 | Bacteria | 133256 |
| 673 | Ga0495686_0008687 | 3300047472 | Bacteria | 7416 |
| 674 | Ga0495686_0009346 | 3300047472 | Bacteria | 7069 |
| 675 | Ga0496100_0079254 | 3300048903 | Bacteria | 2213 |
| 676 | Ga0496102_0008085 | 3300048905 | Bacteria | 8999 |
| 677 | Ga0496110_0032664 | 3300048913 | Bacteria | 4498 |
| 678 | Ga0496116_0000037 | 3300048919 | Bacteria | 374675 |
| 679 | Ga0496117_0000086 | 3300048920 | Bacteria | 212331 |
| 680 | Ga0496118_0000284 | 3300048921 | Bacteria | 88966 |
| 681 | Ga0496118_0040654 | 3300048921 | Bacteria | 3694 |
| 682 | Ga0496119_0000037 | 3300048922 | Bacteria | 210912 |
| 683 | Ga0496122_0000389 | 3300048925 | Bacteria | 93538 |
| 684 | Ga0496122_0000489 | 3300048925 | Bacteria | 82241 |
| 685 | Ga0496122_0004673 | 3300048925 | Bacteria | 16820 |
| 686 | Ga0496122_0013915 | 3300048925 | Bacteria | 7825 |
| 687 | Ga0496122_0019795 | 3300048925 | Bacteria | 6129 |
| 688 | Ga0496123_0000739 | 3300048926 | Bacteria | 52947 |
| 689 | Ga0496123_0050450 | 3300048926 | Bacteria | 2780 |
| 690 | Ga0496124_0006053 | 3300048927 | Bacteria | 13321 |
| 691 | Ga0496125_0000685 | 3300048928 | Bacteria | 56407 |
| 692 | Ga0496125_0009248 | 3300048928 | Bacteria | 10176 |
| 693 | Ga0496125_0011751 | 3300048928 | Bacteria | 8727 |
| 694 | Ga0496126_0002873 | 3300048929 | Bacteria | 22479 |
| 695 | Ga0501034_0000225 | 3300049571 | Bacteria | 107163 |
| 696 | Ga0501034_0039704 | 3300049571 | Bacteria | 4767 |
| 697 | Ga0501034_0442694 | 3300049571 | Unclassified | 1218 |
| 698 | Ga0501036_0006194 | 3300049572 | Bacteria | 9707 |
| 699 | Ga0501036_0008882 | 3300049572 | Bacteria | 8253 |
| 700 | Ga0501037_0100092 | 3300049573 | Bacteria | 2093 |
| 701 | Ga0501037_0151126 | 3300049573 | Bacteria | 1659 |
| 702 | Ga0501038_0050525 | 3300049574 | Bacteria | 3592 |
| 703 | Ga0501039_0010851 | 3300049575 | Bacteria | 6942 |
| 704 | Ga0501043_0008369 | 3300049579 | Bacteria | 8144 |
| 705 | Ga0501043_0016758 | 3300049579 | Bacteria | 5742 |
| 706 | Ga0501046_0005502 | 3300049580 | Bacteria | 11314 |
| 707 | Ga0501046_0111537 | 3300049580 | Bacteria | 2089 |
| 708 | Ga0501047_0258657 | 3300049581 | Bacteria | 1589 |
| 709 | Ga0501067_0103081 | 3300049583 | Bacteria | 1585 |
| 710 | Ga0501070_0157057 | 3300049586 | Unclassified | 1876 |
| 711 | Ga0501073_0010728 | 3300049589 | Bacteria | 6709 |
| 712 | Ga0501074_0003026 | 3300049590 | Bacteria | 11842 |
| 713 | Ga0501235_024453 | 3300049669 | Unclassified | 1349 |
| 714 | Ga0501242_004828 | 3300049674 | Unclassified | 1504 |
| 715 | Ga0501251_009533 | 3300049681 | Unclassified | 1121 |
| 716 | Ga0501257_041941 | 3300049686 | Bacteria | 1125 |
| 717 | Ga0501259_005848 | 3300049688 | Bacteria | 1951 |
| 718 | Ga0501225_0033622 | 3300049705 | Unclassified | 1411 |
| 719 | Ga0501245_004916 | 3300049708 | Unclassified | 1844 |
| 720 | Ga0501079_0054375 | 3300049741 | Bacteria | 3088 |
| 721 | Ga0501080_0021495 | 3300049742 | Bacteria | 5971 |
| 722 | Ga0501083_0011009 | 3300049744 | Bacteria | 6357 |
| 723 | Ga0501241_000009 | 3300049758 | Bacteria | 128695 |
| 724 | Ga0501266_008295 | 3300049763 | Unclassified | 1307 |
| 725 | Ga0501269_000196 | 3300049766 | Bacteria | 18180 |
| 726 | Ga0501035_0122673 | 3300049822 | Bacteria | 2270 |
| 727 | Ga0501035_0175310 | 3300049822 | Bacteria | 1850 |
| 728 | Ga0501035_0370589 | 3300049822 | Bacteria | 1195 |
| 729 | Ga0501044_0056273 | 3300049823 | Bacteria | 4038 |
| 730 | Ga0501044_0105161 | 3300049823 | Bacteria | 2836 |
| 731 | Ga0501044_0119141 | 3300049823 | Bacteria | 2642 |
| 732 | Ga0501044_0547834 | 3300049823 | Unclassified | 1054 |
| 733 | nmdc:mga0k408_216379_c1 | 3300050493 | Bacteria | 1144 |
| 734 | nmdc:mga0k408_25445_c2 | 3300050493 | Bacteria | 1797 |
| 735 | nmdc:mga0k408_6569_c1 | 3300050493 | Bacteria | 6195 |
| 736 | nmdc:mga09592_67026_c1 | 3300050508 | Bacteria | 3044 |
| 737 | nmdc:mga08y16_118242_c1 | 3300050511 | Bacteria | 2758 |
| 738 | nmdc:mga0n895_624793_c1 | 3300050512 | Bacteria | 1078 |
| 739 | Ga0500641_0012237 | 3300053096 | Bacteria | 3130 |
| 740 | Ga0500588_0000578 | 3300053146 | Bacteria | 5997 |
| 741 | Ga0500616_0019994 | 3300053153 | Unclassified | 3765 |
| 742 | Ga0500611_000022 | 3300053727 | Bacteria | 102349 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005841 | Ga0068863_100322227 | Ga0068863_1003222272 | 233 |
| 2 | 3300009101 | Ga0105247_10279429 | Ga0105247_102794292 | 236 |
| 3 | 3300025926 | Ga0207659_10590876 | Ga0207659_105908762 | 236 |
| 4 | 3300042138 | Ga0450903_024675 | Ga0450903_024675_43_810 | 237 |
| 5 | 3300013297 | Ga0157378_10047281 | Ga0157378_100472813 | 248 |
| 6 | 3300017792 | Ga0163161_10136713 | Ga0163161_101367131 | 249 |
| 7 | 3300049571 | Ga0501034_0000225 | Ga0501034_0000225_9734_10636 | 252 |
| 8 | 3300005288 | Ga0065714_10069763 | Ga0065714_100697634 | 253 |
| 9 | 3300031911 | Ga0307412_10001858 | Ga0307412_100018583 | 253 |
| 10 | 3300049758 | Ga0501241_000009 | Ga0501241_000009_2258_3136 | 253 |
| 11 | 3300046500 | Ga0495596_0011828 | Ga0495596_0011828_2331_3209 | 255 |
| 12 | 3300050493 | nmdc:mga0k408_6569_c1 | nmdc:mga0k408_6569_c1_842_1744 | 255 |
| 13 | 3300006195 | Ga0075366_10054467 | Ga0075366_100544672 | 256 |
| 14 | 3300013104 | Ga0157370_10073252 | Ga0157370_100732523 | 256 |
| 15 | 3300013308 | Ga0157375_10069925 | Ga0157375_100699252 | 256 |
| 16 | 3300017792 | Ga0163161_10005480 | Ga0163161_100054804 | 256 |
| 17 | 3300025972 | Ga0207668_10083349 | Ga0207668_100833492 | 256 |
| 18 | 3300046538 | Ga0495609_0000010 | Ga0495609_0000010_3202_4080 | 256 |
| 19 | 3300001915 | JGI24741J21665_1004867 | JGI24741J21665_10048672 | 257 |
| 20 | 3300005289 | Ga0065704_10071464 | Ga0065704_100714643 | 257 |
| 21 | 3300005337 | Ga0070682_100008776 | Ga0070682_1000087763 | 257 |
| 22 | 3300048905 | Ga0496102_0008085 | Ga0496102_0008085_2621_3499 | 257 |
| 23 | 3300048919 | Ga0496116_0000037 | Ga0496116_0000037_2294_3172 | 257 |
| 24 | 3300048920 | Ga0496117_0000086 | Ga0496117_0000086_2775_3653 | 257 |
| 25 | 3300048921 | Ga0496118_0000284 | Ga0496118_0000284_85315_86193 | 257 |
| 26 | 3300048922 | Ga0496119_0000037 | Ga0496119_0000037_2831_3709 | 257 |
| 27 | 3300048925 | Ga0496122_0013915 | Ga0496122_0013915_2831_3709 | 257 |
| 28 | 3300048926 | Ga0496123_0000739 | Ga0496123_0000739_2831_3709 | 257 |
| 29 | 3300048927 | Ga0496124_0006053 | Ga0496124_0006053_10178_11056 | 257 |
| 30 | 3300048928 | Ga0496125_0011751 | Ga0496125_0011751_2803_3681 | 257 |
| 31 | 3300005535 | Ga0070684_100000979 | Ga0070684_1000009793 | 258 |
| 32 | 3300014968 | Ga0157379_10051640 | Ga0157379_100516402 | 258 |
| 33 | 3300003323 | rootH1_10215749 | rootH1_102157492 | 260 |
| 34 | 3300039062 | Ga0400483_199042 | Ga0400483_199042_27690_28571 | 261 |
| 35 | 3300048921 | Ga0496118_0040654 | Ga0496118_0040654_1549_2391 | 261 |
| 36 | 3300017792 | Ga0163161_10043480 | Ga0163161_100434802 | 262 |
| 37 | 3300005617 | Ga0068859_100001754 | Ga0068859_10000175410 | 263 |
| 38 | 3300006931 | Ga0097620_100001754 | Ga0097620_1000017548 | 263 |
| 39 | 3300013308 | Ga0157375_10049408 | Ga0157375_100494084 | 263 |
| 40 | 3300031251 | Ga0265327_10000192 | Ga0265327_100001922 | 263 |
| 41 | 3300039062 | Ga0400483_249684 | Ga0400483_249684_184_1068 | 263 |
| 42 | 3300050512 | nmdc:mga0n895_624793_c1 | nmdc:mga0n895_624793_c1_106_1005 | 263 |
| 43 | 3300003323 | rootH1_10162953 | rootH1_101629532 | 264 |
| 44 | 3300005327 | Ga0070658_10169290 | Ga0070658_101692902 | 264 |
| 45 | 3300009036 | Ga0105244_10000018 | Ga0105244_100000184 | 264 |
| 46 | 3300013104 | Ga0157370_10013588 | Ga0157370_100135881 | 264 |
| 47 | 3300013105 | Ga0157369_10102782 | Ga0157369_101027822 | 264 |
| 48 | 3300025728 | Ga0207655_1000058 | Ga0207655_1000058262 | 264 |
| 49 | 3300009553 | Ga0105249_10028082 | Ga0105249_100280824 | 265 |
| 50 | 3300025961 | Ga0207712_10025168 | Ga0207712_100251682 | 265 |
| 51 | 3300044673 | Ga0453683_0210088 | Ga0453683_0210088_253_1125 | 265 |
| 52 | 3300044712 | Ga0453684_0050317 | Ga0453684_0050317_1059_1931 | 265 |
| 53 | 3300005327 | Ga0070658_10323119 | Ga0070658_103231192 | 266 |
| 54 | 3300005366 | Ga0070659_100113125 | Ga0070659_1001131252 | 266 |
| 55 | 3300005530 | Ga0070679_100015863 | Ga0070679_1000158632 | 266 |
| 56 | 3300013100 | Ga0157373_10033227 | Ga0157373_100332272 | 266 |
| 57 | 3300025912 | Ga0207707_10108650 | Ga0207707_101086502 | 266 |
| 58 | 3300025917 | Ga0207660_10075317 | Ga0207660_100753172 | 266 |
| 59 | 3300025921 | Ga0207652_10221839 | Ga0207652_102218392 | 266 |
| 60 | 3300025932 | Ga0207690_10018625 | Ga0207690_100186257 | 266 |
| 61 | 3300025949 | Ga0207667_10045413 | Ga0207667_100454137 | 266 |
| 62 | 3300028794 | Ga0307515_10000076 | Ga0307515_10000076107 | 266 |
| 63 | 3300048929 | Ga0496126_0002873 | Ga0496126_0002873_18399_19277 | 266 |
| 64 | 3300044684 | Ga0466966_0009648 | Ga0466966_0009648_2882_3784 | 267 |
| 65 | 3300005327 | Ga0070658_10020168 | Ga0070658_100201682 | 268 |
| 66 | 3300005329 | Ga0070683_100013965 | Ga0070683_1000139656 | 268 |
| 67 | 3300005335 | Ga0070666_10057807 | Ga0070666_100578072 | 268 |
| 68 | 3300005336 | Ga0070680_100029249 | Ga0070680_1000292492 | 268 |
| 69 | 3300005337 | Ga0070682_100010074 | Ga0070682_1000100744 | 268 |
| 70 | 3300005339 | Ga0070660_100017556 | Ga0070660_1000175562 | 268 |
| 71 | 3300005344 | Ga0070661_100083927 | Ga0070661_1000839272 | 268 |
| 72 | 3300005366 | Ga0070659_100001692 | Ga0070659_10000169211 | 268 |
| 73 | 3300005457 | Ga0070662_100002983 | Ga0070662_10000298311 | 268 |
| 74 | 3300005530 | Ga0070679_100026151 | Ga0070679_1000261515 | 268 |
| 75 | 3300005535 | Ga0070684_100002647 | Ga0070684_1000026473 | 268 |
| 76 | 3300005539 | Ga0068853_100007967 | Ga0068853_1000079674 | 268 |
| 77 | 3300005563 | Ga0068855_100018669 | Ga0068855_1000186693 | 268 |
| 78 | 3300005564 | Ga0070664_100058013 | Ga0070664_1000580132 | 268 |
| 79 | 3300005578 | Ga0068854_100120409 | Ga0068854_1001204092 | 268 |
| 80 | 3300005614 | Ga0068856_100003735 | Ga0068856_10000373511 | 268 |
| 81 | 3300005616 | Ga0068852_100039630 | Ga0068852_1000396302 | 268 |
| 82 | 3300005834 | Ga0068851_10008331 | Ga0068851_100083316 | 268 |
| 83 | 3300006237 | Ga0097621_100031558 | Ga0097621_1000315583 | 268 |
| 84 | 3300009553 | Ga0105249_10055217 | Ga0105249_100552172 | 268 |
| 85 | 3300013100 | Ga0157373_10122911 | Ga0157373_101229111 | 268 |
| 86 | 3300013102 | Ga0157371_10215458 | Ga0157371_102154582 | 268 |
| 87 | 3300013105 | Ga0157369_10313553 | Ga0157369_103135532 | 268 |
| 88 | 3300013296 | Ga0157374_10003428 | Ga0157374_1000342812 | 268 |
| 89 | 3300013297 | Ga0157378_10013496 | Ga0157378_100134961 | 268 |
| 90 | 3300013306 | Ga0163162_10018529 | Ga0163162_100185292 | 268 |
| 91 | 3300013306 | Ga0163162_10216519 | Ga0163162_102165191 | 268 |
| 92 | 3300014745 | Ga0157377_10071414 | Ga0157377_100714142 | 268 |
| 93 | 3300014968 | Ga0157379_10195491 | Ga0157379_101954912 | 268 |
| 94 | 3300014969 | Ga0157376_10109093 | Ga0157376_101090932 | 268 |
| 95 | 3300017792 | Ga0163161_10016285 | Ga0163161_100162852 | 268 |
| 96 | 3300025321 | Ga0207656_10007438 | Ga0207656_100074381 | 268 |
| 97 | 3300025903 | Ga0207680_10056804 | Ga0207680_100568042 | 268 |
| 98 | 3300025904 | Ga0207647_10064758 | Ga0207647_100647582 | 268 |
| 99 | 3300025919 | Ga0207657_10027098 | Ga0207657_100270984 | 268 |
| 100 | 3300025921 | Ga0207652_10193262 | Ga0207652_101932622 | 268 |
| 101 | 3300025932 | Ga0207690_10119886 | Ga0207690_101198862 | 268 |
| 102 | 3300025933 | Ga0207706_10002788 | Ga0207706_100027889 | 268 |
| 103 | 3300025944 | Ga0207661_10109119 | Ga0207661_101091193 | 268 |
| 104 | 3300025945 | Ga0207679_10161812 | Ga0207679_101618122 | 268 |
| 105 | 3300025949 | Ga0207667_10238556 | Ga0207667_102385562 | 268 |
| 106 | 3300025981 | Ga0207640_10012183 | Ga0207640_100121832 | 268 |
| 107 | 3300026023 | Ga0207677_10164327 | Ga0207677_101643271 | 268 |
| 108 | 3300026041 | Ga0207639_10045458 | Ga0207639_100454582 | 268 |
| 109 | 3300026078 | Ga0207702_10137748 | Ga0207702_101377482 | 268 |
| 110 | 3300005347 | Ga0070668_100022201 | Ga0070668_1000222014 | 269 |
| 111 | 3300005539 | Ga0068853_100423920 | Ga0068853_1004239201 | 269 |
| 112 | 3300009148 | Ga0105243_10000089 | Ga0105243_1000008992 | 269 |
| 113 | 3300013307 | Ga0157372_10005409 | Ga0157372_1000540911 | 269 |
| 114 | 3300025935 | Ga0207709_10000136 | Ga0207709_1000013696 | 269 |
| 115 | 3300025972 | Ga0207668_10223360 | Ga0207668_102233602 | 269 |
| 116 | 3300048925 | Ga0496122_0000389 | Ga0496122_0000389_89268_90146 | 269 |
| 117 | iso_pu_bacteria | 2511231000 | 2511234417 | 269 |
| 118 | iso_pu_bacteria | 2582581281 | 2585159918 | 269 |
| 119 | iso_pu_bacteria | 2582581282 | 2585164133 | 269 |
| 120 | iso_pu_bacteria | 2739367663 | 2739644319 | 269 |
| 121 | iso_pu_bacteria | 2751185877 | 2753675035 | 269 |
| 122 | 3300005366 | Ga0070659_100000828 | Ga0070659_1000008286 | 270 |
| 123 | 3300005616 | Ga0068852_100051678 | Ga0068852_1000516782 | 270 |
| 124 | 3300026088 | Ga0207641_10657973 | Ga0207641_106579731 | 270 |
| 125 | 3300026142 | Ga0207698_10038652 | Ga0207698_100386522 | 270 |
| 126 | iso_pu_bacteria | 2582581278 | 2585142356 | 270 |
| 127 | iso_pu_bacteria | 2582581873 | 2585426726 | 270 |
| 128 | iso_pu_bacteria | 2585428045 | 2587680712 | 270 |
| 129 | iso_pu_bacteria | 2585428061 | 2587752732 | 270 |
| 130 | iso_pu_bacteria | 2585428095 | 2587868559 | 270 |
| 131 | iso_pu_bacteria | 2585428115 | 2587942598 | 270 |
| 132 | iso_pu_bacteria | 2585428182 | 2588211835 | 270 |
| 133 | iso_pu_bacteria | 2585428183 | 2588216498 | 270 |
| 134 | iso_pu_bacteria | 2585428184 | 2588217694 | 270 |
| 135 | iso_pu_bacteria | 2585428185 | 2588225868 | 270 |
| 136 | iso_pu_bacteria | 2585428187 | 2588230932 | 270 |
| 137 | iso_pu_bacteria | 2588254255 | 2590603690 | 270 |
| 138 | iso_pu_bacteria | 2739367874 | 2740060635 | 270 |
| 139 | iso_pu_bacteria | 2765235839 | 2765575902 | 270 |
| 140 | iso_pu_bacteria | 2772190705 | 2772606622 | 270 |
| 141 | iso_pu_bacteria | 2775506739 | 2775674141 | 270 |
| 142 | iso_pu_bacteria | 2816332188 | 2816875610 | 270 |
| 143 | iso_pu_bacteria | 2842083920 | 2842087775 | 270 |
| 144 | iso_pu_bacteria | 2889290771 | 2889293606 | 270 |
| 145 | iso_pu_bacteria | 2905999023 | 2906002840 | 270 |
| 146 | iso_pu_bacteria | 2919097161 | 2919099902 | 270 |
| 147 | iso_pu_bacteria | 2945924605 | 2945928719 | 270 |
| 148 | iso_pu_bacteria | 2977243572 | 2977247571 | 270 |
| 149 | iso_pu_bacteria | 2993372514 | 2993374895 | 270 |
| 150 | iso_pu_bacteria | 2993480792 | 2993481750 | 270 |
| 151 | 3300013307 | Ga0157372_10142018 | Ga0157372_101420182 | 271 |
| 152 | 3300039093 | Ga0400489_32343 | Ga0400489_32343_765_1658 | 271 |
| 153 | 3300046665 | Ga0495661_0001581 | Ga0495661_0001581_1675_2580 | 271 |
| 154 | iso_pu_bacteria | 2585427687 | 2586208502 | 271 |
| 155 | iso_pu_bacteria | 2738541302 | 2738856650 | 271 |
| 156 | iso_pu_bacteria | 2739367651 | 2739590121 | 271 |
| 157 | iso_pu_bacteria | 2739367656 | 2739615351 | 271 |
| 158 | iso_pu_bacteria | 2818991437 | 2819548494 | 271 |
| 159 | iso_pu_bacteria | 2842722452 | 2842722933 | 271 |
| 160 | iso_pu_bacteria | 2842909656 | 2842913325 | 271 |
| 161 | iso_pu_bacteria | 2849281842 | 2849286651 | 271 |
| 162 | iso_pu_bacteria | 2857627736 | 2857631188 | 271 |
| 163 | iso_pu_bacteria | 2904445276 | 2904448500 | 271 |
| 164 | iso_pu_bacteria | 2919509842 | 2919512770 | 271 |
| 165 | iso_pu_bacteria | 2945997725 | 2945999895 | 271 |
| 166 | iso_pu_bacteria | 2954016120 | 2954016509 | 271 |
| 167 | iso_pu_bacteria | 2984572630 | 2984574640 | 271 |
| 168 | iso_pu_bacteria | 2984606641 | 2984608091 | 271 |
| 169 | 3300002773 | JGI25152J39213_1000228 | JGI25152J39213_10002283 | 272 |
| 170 | 3300002774 | JGI25150J39212_1000002 | JGI25150J39212_1000002192 | 272 |
| 171 | 3300003187 | JGI25151J46595_10000003 | JGI25151J46595_10000003466 | 272 |
| 172 | 3300003215 | JGI25153J46596_10000003 | JGI25153J46596_10000003298 | 272 |
| 173 | 3300003781 | Ga0055536_1000007 | Ga0055536_100000726 | 272 |
| 174 | 3300003791 | Ga0055530_10010824 | Ga0055530_100108244 | 272 |
| 175 | 3300005288 | Ga0065714_10067637 | Ga0065714_100676373 | 272 |
| 176 | 3300005327 | Ga0070658_10005453 | Ga0070658_100054538 | 272 |
| 177 | 3300005334 | Ga0068869_100109898 | Ga0068869_1001098982 | 272 |
| 178 | 3300005335 | Ga0070666_10000885 | Ga0070666_100008857 | 272 |
| 179 | 3300005338 | Ga0068868_100000075 | Ga0068868_10000007512 | 272 |
| 180 | 3300005347 | Ga0070668_100000859 | Ga0070668_10000085911 | 272 |
| 181 | 3300005364 | Ga0070673_100000448 | Ga0070673_1000004489 | 272 |
| 182 | 3300005367 | Ga0070667_100000482 | Ga0070667_10000048229 | 272 |
| 183 | 3300005455 | Ga0070663_100042799 | Ga0070663_1000427991 | 272 |
| 184 | 3300005457 | Ga0070662_100029479 | Ga0070662_1000294793 | 272 |
| 185 | 3300005543 | Ga0070672_100000361 | Ga0070672_10000036122 | 272 |
| 186 | 3300005548 | Ga0070665_100002163 | Ga0070665_1000021639 | 272 |
| 187 | 3300005617 | Ga0068859_100075852 | Ga0068859_1000758522 | 272 |
| 188 | 3300005618 | Ga0068864_100000785 | Ga0068864_1000007854 | 272 |
| 189 | 3300005834 | Ga0068851_10001706 | Ga0068851_100017068 | 272 |
| 190 | 3300005841 | Ga0068863_100017853 | Ga0068863_1000178534 | 272 |
| 191 | 3300005842 | Ga0068858_100001413 | Ga0068858_10000141320 | 272 |
| 192 | 3300005843 | Ga0068860_100002836 | Ga0068860_10000283613 | 272 |
| 193 | 3300006237 | Ga0097621_100004135 | Ga0097621_1000041356 | 272 |
| 194 | 3300006237 | Ga0097621_100122957 | Ga0097621_1001229572 | 272 |
| 195 | 3300006358 | Ga0068871_100000981 | Ga0068871_1000009814 | 272 |
| 196 | 3300006358 | Ga0068871_100005200 | Ga0068871_1000052009 | 272 |
| 197 | 3300006931 | Ga0097620_100075852 | Ga0097620_1000758524 | 272 |
| 198 | 3300009098 | Ga0105245_10108552 | Ga0105245_101085522 | 272 |
| 199 | 3300009174 | Ga0105241_10353892 | Ga0105241_103538922 | 272 |
| 200 | 3300009176 | Ga0105242_10111690 | Ga0105242_101116903 | 272 |
| 201 | 3300009545 | Ga0105237_10077957 | Ga0105237_100779573 | 272 |
| 202 | 3300009553 | Ga0105249_10003402 | Ga0105249_1000340211 | 272 |
| 203 | 3300010375 | Ga0105239_10042858 | Ga0105239_100428582 | 272 |
| 204 | 3300013102 | Ga0157371_10000901 | Ga0157371_1000090119 | 272 |
| 205 | 3300013104 | Ga0157370_10005003 | Ga0157370_100050039 | 272 |
| 206 | 3300013104 | Ga0157370_10042698 | Ga0157370_100426981 | 272 |
| 207 | 3300013105 | Ga0157369_10000015 | Ga0157369_1000001514 | 272 |
| 208 | 3300013105 | Ga0157369_10212800 | Ga0157369_102128002 | 272 |
| 209 | 3300013296 | Ga0157374_10002589 | Ga0157374_100025899 | 272 |
| 210 | 3300013297 | Ga0157378_10114878 | Ga0157378_101148783 | 272 |
| 211 | 3300013297 | Ga0157378_10124762 | Ga0157378_101247622 | 272 |
| 212 | 3300013297 | Ga0157378_10250143 | Ga0157378_102501433 | 272 |
| 213 | 3300013306 | Ga0163162_10000377 | Ga0163162_100003779 | 272 |
| 214 | 3300013306 | Ga0163162_10000644 | Ga0163162_100006445 | 272 |
| 215 | 3300013307 | Ga0157372_10228455 | Ga0157372_102284552 | 272 |
| 216 | 3300013308 | Ga0157375_10004745 | Ga0157375_1000474510 | 272 |
| 217 | 3300013308 | Ga0157375_10518120 | Ga0157375_105181201 | 272 |
| 218 | 3300014325 | Ga0163163_10000752 | Ga0163163_1000075213 | 272 |
| 219 | 3300014497 | Ga0182008_10001316 | Ga0182008_1000131614 | 272 |
| 220 | 3300014968 | Ga0157379_10000440 | Ga0157379_100004408 | 272 |
| 221 | 3300014969 | Ga0157376_10000381 | Ga0157376_100003819 | 272 |
| 222 | 3300014969 | Ga0157376_10003377 | Ga0157376_100033774 | 272 |
| 223 | 3300014969 | Ga0157376_10048370 | Ga0157376_100483703 | 272 |
| 224 | 3300015261 | Ga0182006_1001053 | Ga0182006_100105315 | 272 |
| 225 | 3300015261 | Ga0182006_1001108 | Ga0182006_100110816 | 272 |
| 226 | 3300015262 | Ga0182007_10000010 | Ga0182007_10000010201 | 272 |
| 227 | 3300015682 | Ga0183373_1005 | Ga0183373_1005217 | 272 |
| 228 | 3300017792 | Ga0163161_10000206 | Ga0163161_1000020624 | 272 |
| 229 | 3300017792 | Ga0163161_10000729 | Ga0163161_100007299 | 272 |
| 230 | 3300017792 | Ga0163161_10018054 | Ga0163161_100180543 | 272 |
| 231 | 3300017792 | Ga0163161_10071466 | Ga0163161_100714663 | 272 |
| 232 | 3300025245 | Ga0207425_1000004 | Ga0207425_1000004751 | 272 |
| 233 | 3300025258 | Ga0209129_1000005 | Ga0209129_1000005191 | 272 |
| 234 | 3300025292 | Ga0209676_1000058 | Ga0209676_100005825 | 272 |
| 235 | 3300025294 | Ga0209025_1000009 | Ga0209025_1000009751 | 272 |
| 236 | 3300025297 | Ga0209758_1000010 | Ga0209758_1000010752 | 272 |
| 237 | 3300025298 | Ga0209050_1000054 | Ga0209050_100005425 | 272 |
| 238 | 3300025321 | Ga0207656_10000424 | Ga0207656_100004248 | 272 |
| 239 | 3300025903 | Ga0207680_10001363 | Ga0207680_1000136310 | 272 |
| 240 | 3300025907 | Ga0207645_10000949 | Ga0207645_1000094914 | 272 |
| 241 | 3300025909 | Ga0207705_10023675 | Ga0207705_100236754 | 272 |
| 242 | 3300025933 | Ga0207706_10011186 | Ga0207706_100111867 | 272 |
| 243 | 3300025934 | Ga0207686_10068276 | Ga0207686_100682763 | 272 |
| 244 | 3300025940 | Ga0207691_10000037 | Ga0207691_1000003784 | 272 |
| 245 | 3300025960 | Ga0207651_10000443 | Ga0207651_100004435 | 272 |
| 246 | 3300025961 | Ga0207712_10114190 | Ga0207712_101141903 | 272 |
| 247 | 3300025972 | Ga0207668_10001307 | Ga0207668_100013075 | 272 |
| 248 | 3300025986 | Ga0207658_10000629 | Ga0207658_1000062910 | 272 |
| 249 | 3300026023 | Ga0207677_10005907 | Ga0207677_100059077 | 272 |
| 250 | 3300026035 | Ga0207703_10004145 | Ga0207703_1000414510 | 272 |
| 251 | 3300026088 | Ga0207641_10092372 | Ga0207641_100923722 | 272 |
| 252 | 3300026095 | Ga0207676_10002535 | Ga0207676_1000253510 | 272 |
| 253 | 3300026142 | Ga0207698_10066040 | Ga0207698_100660403 | 272 |
| 254 | 3300028379 | Ga0268266_10004818 | Ga0268266_100048189 | 272 |
| 255 | 3300031731 | Ga0307405_10000035 | Ga0307405_1000003524 | 272 |
| 256 | 3300031903 | Ga0307407_10000005 | Ga0307407_1000000545 | 272 |
| 257 | 3300031995 | Ga0307409_100015519 | Ga0307409_1000155193 | 272 |
| 258 | 3300032002 | Ga0307416_100000001 | Ga0307416_100000001403 | 272 |
| 259 | 3300032004 | Ga0307414_10067446 | Ga0307414_100674462 | 272 |
| 260 | 3300042876 | Ga0451577_0000599 | Ga0451577_0000599_34171_35076 | 272 |
| 261 | 3300044712 | Ga0453684_0001039 | Ga0453684_0001039_65396_66301 | 272 |
| 262 | 3300045051 | Ga0451576_0001077 | Ga0451576_0001077_14985_15890 | 272 |
| 263 | 3300046512 | Ga0495610_0000405 | Ga0495610_0000405_23806_24684 | 272 |
| 264 | 3300046512 | Ga0495610_0000441 | Ga0495610_0000441_8267_9145 | 272 |
| 265 | 3300046558 | Ga0495633_0030156 | Ga0495633_0030156_1441_2319 | 272 |
| 266 | 3300048925 | Ga0496122_0019795 | Ga0496122_0019795_2369_3244 | 272 |
| 267 | iso_pu_bacteria | 2585428060 | 2587748831 | 272 |
| 268 | iso_pu_bacteria | 2588253712 | 2588447767 | 272 |
| 269 | 3300003203 | JGI25406J46586_10003120 | JGI25406J46586_100031206 | 273 |
| 270 | 3300003320 | rootH2_10053452 | rootH2_100534524 | 273 |
| 271 | 3300003784 | Ga0055534_1005957 | Ga0055534_10059573 | 273 |
| 272 | 3300005288 | Ga0065714_10069057 | Ga0065714_100690573 | 273 |
| 273 | 3300005289 | Ga0065704_10075289 | Ga0065704_100752895 | 273 |
| 274 | 3300005327 | Ga0070658_10408721 | Ga0070658_104087212 | 273 |
| 275 | 3300005364 | Ga0070673_100053248 | Ga0070673_1000532485 | 273 |
| 276 | 3300005367 | Ga0070667_100112829 | Ga0070667_1001128292 | 273 |
| 277 | 3300005616 | Ga0068852_100140884 | Ga0068852_1001408842 | 273 |
| 278 | 3300005985 | Ga0081539_10000925 | Ga0081539_1000092527 | 273 |
| 279 | 3300006237 | Ga0097621_100000063 | Ga0097621_10000006322 | 273 |
| 280 | 3300006358 | Ga0068871_100000952 | Ga0068871_1000009521 | 273 |
| 281 | 3300006881 | Ga0068865_100044565 | Ga0068865_1000445651 | 273 |
| 282 | 3300009174 | Ga0105241_10260351 | Ga0105241_102603512 | 273 |
| 283 | 3300009177 | Ga0105248_10009934 | Ga0105248_100099349 | 273 |
| 284 | 3300013100 | Ga0157373_10000067 | Ga0157373_1000006787 | 273 |
| 285 | 3300013102 | Ga0157371_10029931 | Ga0157371_100299312 | 273 |
| 286 | 3300013297 | Ga0157378_10033096 | Ga0157378_100330962 | 273 |
| 287 | 3300013297 | Ga0157378_10480459 | Ga0157378_104804592 | 273 |
| 288 | 3300013306 | Ga0163162_10000158 | Ga0163162_1000015831 | 273 |
| 289 | 3300013307 | Ga0157372_10571440 | Ga0157372_105714402 | 273 |
| 290 | 3300013308 | Ga0157375_10000228 | Ga0157375_1000022831 | 273 |
| 291 | 3300013308 | Ga0157375_10001328 | Ga0157375_1000132816 | 273 |
| 292 | 3300013308 | Ga0157375_10442892 | Ga0157375_104428921 | 273 |
| 293 | 3300014497 | Ga0182008_10000016 | Ga0182008_100000163 | 273 |
| 294 | 3300014969 | Ga0157376_10001773 | Ga0157376_100017734 | 273 |
| 295 | 3300015261 | Ga0182006_1000079 | Ga0182006_1000079120 | 273 |
| 296 | 3300017792 | Ga0163161_10002605 | Ga0163161_100026054 | 273 |
| 297 | 3300025291 | Ga0209675_1000159 | Ga0209675_100015973 | 273 |
| 298 | 3300025909 | Ga0207705_10331340 | Ga0207705_103313401 | 273 |
| 299 | 3300025931 | Ga0207644_10028317 | Ga0207644_100283174 | 273 |
| 300 | 3300025935 | Ga0207709_10548042 | Ga0207709_105480421 | 273 |
| 301 | 3300025941 | Ga0207711_10018774 | Ga0207711_100187741 | 273 |
| 302 | 3300025960 | Ga0207651_10543021 | Ga0207651_105430211 | 273 |
| 303 | 3300025986 | Ga0207658_10105837 | Ga0207658_101058372 | 273 |
| 304 | 3300026088 | Ga0207641_10263783 | Ga0207641_102637832 | 273 |
| 305 | 3300026089 | Ga0207648_10046709 | Ga0207648_100467092 | 273 |
| 306 | 3300026118 | Ga0207675_100647957 | Ga0207675_1006479571 | 273 |
| 307 | 3300031456 | Ga0307513_10084237 | Ga0307513_100842372 | 273 |
| 308 | 3300031507 | Ga0307509_10025206 | Ga0307509_100252066 | 273 |
| 309 | 3300031507 | Ga0307509_10053235 | Ga0307509_100532352 | 273 |
| 310 | 3300031911 | Ga0307412_10000640 | Ga0307412_1000064015 | 273 |
| 311 | 3300031911 | Ga0307412_10002518 | Ga0307412_100025187 | 273 |
| 312 | 3300032002 | Ga0307416_100000020 | Ga0307416_100000020195 | 273 |
| 313 | 3300032004 | Ga0307414_10000041 | Ga0307414_10000041134 | 273 |
| 314 | 3300032004 | Ga0307414_10099280 | Ga0307414_100992801 | 273 |
| 315 | 3300041413 | Ga0439465_0000489 | Ga0439465_0000489_5639_6517 | 273 |
| 316 | 3300042004 | Ga0439445_0000605 | Ga0439445_0000605_2176_3054 | 273 |
| 317 | 3300046453 | Ga0495627_000029 | Ga0495627_000029_3272_4150 | 273 |
| 318 | 3300046453 | Ga0495627_007357 | Ga0495627_007357_785_1663 | 273 |
| 319 | 3300046460 | Ga0495638_0055927 | Ga0495638_0055927_542_1420 | 273 |
| 320 | 3300046460 | Ga0495638_0114161 | Ga0495638_0114161_47_919 | 273 |
| 321 | 3300046507 | Ga0495606_0003913 | Ga0495606_0003913_13896_14774 | 273 |
| 322 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_5062_5940 | 273 |
| 323 | 3300046519 | Ga0495632_0006192 | Ga0495632_0006192_5402_6280 | 273 |
| 324 | 3300046525 | Ga0495663_0000243 | Ga0495663_0000243_17388_18266 | 273 |
| 325 | 3300046525 | Ga0495663_0003226 | Ga0495663_0003226_2051_2929 | 273 |
| 326 | 3300046530 | Ga0495654_0000008 | Ga0495654_0000008_394108_394986 | 273 |
| 327 | 3300046558 | Ga0495633_0000163 | Ga0495633_0000163_83418_84296 | 273 |
| 328 | 3300046558 | Ga0495633_0003132 | Ga0495633_0003132_5062_5940 | 273 |
| 329 | 3300047472 | Ga0495686_0000153 | Ga0495686_0000153_5380_6258 | 273 |
| 330 | 3300047472 | Ga0495686_0009346 | Ga0495686_0009346_27_905 | 273 |
| 331 | 3300048903 | Ga0496100_0079254 | Ga0496100_0079254_573_1451 | 273 |
| 332 | 3300048925 | Ga0496122_0000489 | Ga0496122_0000489_77681_78559 | 273 |
| 333 | 3300048925 | Ga0496122_0004673 | Ga0496122_0004673_8941_9819 | 273 |
| 334 | 3300048926 | Ga0496123_0050450 | Ga0496123_0050450_384_1262 | 273 |
| 335 | 3300048928 | Ga0496125_0000685 | Ga0496125_0000685_46485_47363 | 273 |
| 336 | 3300048928 | Ga0496125_0009248 | Ga0496125_0009248_2196_3074 | 273 |
| 337 | 3300049766 | Ga0501269_000196 | Ga0501269_000196_5275_6153 | 273 |
| 338 | 3300053146 | Ga0500588_0000578 | Ga0500588_0000578_3619_4491 | 273 |
| 339 | iso_pu_bacteria | 2523533629 | 2524006768 | 273 |
| 340 | iso_pu_bacteria | 2588254257 | 2590610412 | 273 |
| 341 | iso_pu_bacteria | 2728369107 | 2729202551 | 273 |
| 342 | iso_pu_bacteria | 2946019816 | 2946019832 | 273 |
| 343 | 3300005355 | Ga0070671_100027461 | Ga0070671_1000274614 | 274 |
| 344 | 3300005456 | Ga0070678_100219591 | Ga0070678_1002195911 | 274 |
| 345 | 3300005544 | Ga0070686_100060381 | Ga0070686_1000603812 | 274 |
| 346 | 3300005564 | Ga0070664_100017274 | Ga0070664_1000172743 | 274 |
| 347 | 3300005719 | Ga0068861_100350129 | Ga0068861_1003501291 | 274 |
| 348 | 3300005841 | Ga0068863_100225831 | Ga0068863_1002258312 | 274 |
| 349 | 3300005985 | Ga0081539_10025637 | Ga0081539_100256371 | 274 |
| 350 | 3300006844 | Ga0075428_100275229 | Ga0075428_1002752291 | 274 |
| 351 | 3300009176 | Ga0105242_10111369 | Ga0105242_101113692 | 274 |
| 352 | 3300025901 | Ga0207688_10017118 | Ga0207688_100171184 | 274 |
| 353 | 3300025907 | Ga0207645_10218429 | Ga0207645_102184292 | 274 |
| 354 | 3300025926 | Ga0207659_10161286 | Ga0207659_101612863 | 274 |
| 355 | 3300025936 | Ga0207670_10217576 | Ga0207670_102175762 | 274 |
| 356 | 3300025940 | Ga0207691_10045817 | Ga0207691_100458172 | 274 |
| 357 | 3300025945 | Ga0207679_10013882 | Ga0207679_100138824 | 274 |
| 358 | 3300025960 | Ga0207651_10093422 | Ga0207651_100934222 | 274 |
| 359 | 3300026089 | Ga0207648_10047918 | Ga0207648_100479183 | 274 |
| 360 | 3300026118 | Ga0207675_100034036 | Ga0207675_1000340367 | 274 |
| 361 | 3300028381 | Ga0268264_10008067 | Ga0268264_100080676 | 274 |
| 362 | 3300037471 | Ga0395905_0048344 | Ga0395905_0048344_2687_3583 | 274 |
| 363 | 3300045051 | Ga0451576_0018027 | Ga0451576_0018027_1678_2583 | 274 |
| 364 | iso_pu_bacteria | 2818991444 | 2819586717 | 274 |
| 365 | 3300005337 | Ga0070682_100000173 | Ga0070682_1000001738 | 275 |
| 366 | 3300005471 | Ga0070698_100001454 | Ga0070698_1000014544 | 275 |
| 367 | 3300005546 | Ga0070696_100208976 | Ga0070696_1002089761 | 275 |
| 368 | 3300005616 | Ga0068852_100583615 | Ga0068852_1005836151 | 275 |
| 369 | 3300013102 | Ga0157371_10056580 | Ga0157371_100565802 | 275 |
| 370 | 3300013306 | Ga0163162_10192926 | Ga0163162_101929262 | 275 |
| 371 | 3300014325 | Ga0163163_10000712 | Ga0163163_100007125 | 275 |
| 372 | 3300026089 | Ga0207648_10001276 | Ga0207648_1000127611 | 275 |
| 373 | 3300037471 | Ga0395905_0002094 | Ga0395905_0002094_5035_5931 | 275 |
| 374 | 3300046535 | Ga0495586_0073546 | Ga0495586_0073546_687_1574 | 275 |
| 375 | 3300046536 | Ga0495587_0174795 | Ga0495587_0174795_13_900 | 275 |
| 376 | 3300046663 | Ga0495635_0098756 | Ga0495635_0098756_547_1434 | 275 |
| 377 | 3300046683 | Ga0495658_0148905 | Ga0495658_0148905_50_937 | 275 |
| 378 | 3300047321 | Ga0495676_0085516 | Ga0495676_0085516_1325_2212 | 275 |
| 379 | 3300049822 | Ga0501035_0370589 | Ga0501035_0370589_33_965 | 275 |
| 380 | iso_pu_bacteria | 2738541273 | 2738699628 | 275 |
| 381 | iso_pu_bacteria | 2738543014 | 2739253377 | 275 |
| 382 | iso_pu_bacteria | 2881955468 | 2881956688 | 275 |
| 383 | 3300003320 | rootH2_10223400 | rootH2_102234003 | 276 |
| 384 | 3300003322 | rootL2_10225493 | rootL2_102254933 | 276 |
| 385 | 3300005290 | Ga0065712_10070399 | Ga0065712_100703993 | 276 |
| 386 | 3300005295 | Ga0065707_10116229 | Ga0065707_101162293 | 276 |
| 387 | 3300005331 | Ga0070670_100078484 | Ga0070670_1000784843 | 276 |
| 388 | 3300005334 | Ga0068869_100032502 | Ga0068869_1000325022 | 276 |
| 389 | 3300005334 | Ga0068869_100044679 | Ga0068869_1000446793 | 276 |
| 390 | 3300005334 | Ga0068869_100445585 | Ga0068869_1004455851 | 276 |
| 391 | 3300005335 | Ga0070666_10000247 | Ga0070666_100002477 | 276 |
| 392 | 3300005337 | Ga0070682_100236861 | Ga0070682_1002368611 | 276 |
| 393 | 3300005340 | Ga0070689_100232037 | Ga0070689_1002320372 | 276 |
| 394 | 3300005343 | Ga0070687_100222134 | Ga0070687_1002221341 | 276 |
| 395 | 3300005459 | Ga0068867_100223718 | Ga0068867_1002237182 | 276 |
| 396 | 3300005466 | Ga0070685_10001175 | Ga0070685_1000117512 | 276 |
| 397 | 3300005471 | Ga0070698_100021851 | Ga0070698_1000218514 | 276 |
| 398 | 3300005471 | Ga0070698_100060779 | Ga0070698_1000607793 | 276 |
| 399 | 3300005549 | Ga0070704_100057017 | Ga0070704_1000570172 | 276 |
| 400 | 3300005578 | Ga0068854_100210067 | Ga0068854_1002100672 | 276 |
| 401 | 3300005616 | Ga0068852_100019362 | Ga0068852_1000193625 | 276 |
| 402 | 3300005617 | Ga0068859_100000012 | Ga0068859_1000000125 | 276 |
| 403 | 3300005617 | Ga0068859_100185247 | Ga0068859_1001852473 | 276 |
| 404 | 3300005618 | Ga0068864_100007484 | Ga0068864_1000074845 | 276 |
| 405 | 3300005840 | Ga0068870_10336288 | Ga0068870_103362881 | 276 |
| 406 | 3300005841 | Ga0068863_100001993 | Ga0068863_10000199319 | 276 |
| 407 | 3300005842 | Ga0068858_100009905 | Ga0068858_10000990513 | 276 |
| 408 | 3300005843 | Ga0068860_100005500 | Ga0068860_1000055002 | 276 |
| 409 | 3300005843 | Ga0068860_100359213 | Ga0068860_1003592132 | 276 |
| 410 | 3300005844 | Ga0068862_100418849 | Ga0068862_1004188492 | 276 |
| 411 | 3300006237 | Ga0097621_100063054 | Ga0097621_1000630542 | 276 |
| 412 | 3300006237 | Ga0097621_100083814 | Ga0097621_1000838142 | 276 |
| 413 | 3300006358 | Ga0068871_100107543 | Ga0068871_1001075433 | 276 |
| 414 | 3300006358 | Ga0068871_100257638 | Ga0068871_1002576382 | 276 |
| 415 | 3300006880 | Ga0075429_100004948 | Ga0075429_1000049483 | 276 |
| 416 | 3300006881 | Ga0068865_100146220 | Ga0068865_1001462202 | 276 |
| 417 | 3300006881 | Ga0068865_100353480 | Ga0068865_1003534802 | 276 |
| 418 | 3300006931 | Ga0097620_100000012 | Ga0097620_1000000125 | 276 |
| 419 | 3300006931 | Ga0097620_100185237 | Ga0097620_1001852373 | 276 |
| 420 | 3300009098 | Ga0105245_10296942 | Ga0105245_102969421 | 276 |
| 421 | 3300009174 | Ga0105241_10001370 | Ga0105241_1000137016 | 276 |
| 422 | 3300009545 | Ga0105237_10010659 | Ga0105237_100106599 | 276 |
| 423 | 3300009553 | Ga0105249_10001749 | Ga0105249_100017494 | 276 |
| 424 | 3300009553 | Ga0105249_10003442 | Ga0105249_1000344210 | 276 |
| 425 | 3300009553 | Ga0105249_10035804 | Ga0105249_100358044 | 276 |
| 426 | 3300011119 | Ga0105246_10061186 | Ga0105246_100611863 | 276 |
| 427 | 3300013102 | Ga0157371_10000036 | Ga0157371_1000003651 | 276 |
| 428 | 3300013104 | Ga0157370_10001141 | Ga0157370_1000114119 | 276 |
| 429 | 3300013104 | Ga0157370_10033216 | Ga0157370_100332164 | 276 |
| 430 | 3300013105 | Ga0157369_10000153 | Ga0157369_1000015352 | 276 |
| 431 | 3300013306 | Ga0163162_10047851 | Ga0163162_100478516 | 276 |
| 432 | 3300013306 | Ga0163162_10468065 | Ga0163162_104680652 | 276 |
| 433 | 3300013306 | Ga0163162_10911951 | Ga0163162_109119511 | 276 |
| 434 | 3300013307 | Ga0157372_10027042 | Ga0157372_100270423 | 276 |
| 435 | 3300013308 | Ga0157375_10065222 | Ga0157375_100652224 | 276 |
| 436 | 3300013308 | Ga0157375_10084393 | Ga0157375_100843934 | 276 |
| 437 | 3300014325 | Ga0163163_10031622 | Ga0163163_100316224 | 276 |
| 438 | 3300014326 | Ga0157380_10189598 | Ga0157380_101895982 | 276 |
| 439 | 3300014968 | Ga0157379_10028369 | Ga0157379_100283694 | 276 |
| 440 | 3300014969 | Ga0157376_10031463 | Ga0157376_100314634 | 276 |
| 441 | 3300025893 | Ga0207682_10060158 | Ga0207682_100601582 | 276 |
| 442 | 3300025899 | Ga0207642_10073459 | Ga0207642_100734591 | 276 |
| 443 | 3300025903 | Ga0207680_10000031 | Ga0207680_1000003150 | 276 |
| 444 | 3300025911 | Ga0207654_10008187 | Ga0207654_100081874 | 276 |
| 445 | 3300025914 | Ga0207671_10000981 | Ga0207671_100009815 | 276 |
| 446 | 3300025918 | Ga0207662_10062623 | Ga0207662_100626232 | 276 |
| 447 | 3300025919 | Ga0207657_10089214 | Ga0207657_100892142 | 276 |
| 448 | 3300025925 | Ga0207650_10038496 | Ga0207650_100384962 | 276 |
| 449 | 3300025926 | Ga0207659_10075294 | Ga0207659_100752943 | 276 |
| 450 | 3300025937 | Ga0207669_10187252 | Ga0207669_101872522 | 276 |
| 451 | 3300025942 | Ga0207689_10014782 | Ga0207689_100147824 | 276 |
| 452 | 3300025942 | Ga0207689_10039483 | Ga0207689_100394833 | 276 |
| 453 | 3300025942 | Ga0207689_10507142 | Ga0207689_105071421 | 276 |
| 454 | 3300025961 | Ga0207712_10004607 | Ga0207712_100046078 | 276 |
| 455 | 3300025961 | Ga0207712_10005091 | Ga0207712_100050913 | 276 |
| 456 | 3300025961 | Ga0207712_10093866 | Ga0207712_100938663 | 276 |
| 457 | 3300025972 | Ga0207668_10081464 | Ga0207668_100814643 | 276 |
| 458 | 3300025986 | Ga0207658_10043522 | Ga0207658_100435222 | 276 |
| 459 | 3300025986 | Ga0207658_10396142 | Ga0207658_103961421 | 276 |
| 460 | 3300026023 | Ga0207677_10391670 | Ga0207677_103916702 | 276 |
| 461 | 3300026035 | Ga0207703_10009241 | Ga0207703_100092417 | 276 |
| 462 | 3300026088 | Ga0207641_10000048 | Ga0207641_10000048142 | 276 |
| 463 | 3300026088 | Ga0207641_10000253 | Ga0207641_1000025317 | 276 |
| 464 | 3300026089 | Ga0207648_10029826 | Ga0207648_100298265 | 276 |
| 465 | 3300026089 | Ga0207648_10469249 | Ga0207648_104692491 | 276 |
| 466 | 3300026095 | Ga0207676_10013593 | Ga0207676_100135933 | 276 |
| 467 | 3300026095 | Ga0207676_10023708 | Ga0207676_100237084 | 276 |
| 468 | 3300026095 | Ga0207676_10140043 | Ga0207676_101400434 | 276 |
| 469 | 3300026116 | Ga0207674_10020174 | Ga0207674_100201747 | 276 |
| 470 | 3300026142 | Ga0207698_10004963 | Ga0207698_100049637 | 276 |
| 471 | 3300028381 | Ga0268264_10001271 | Ga0268264_1000127115 | 276 |
| 472 | 3300046539 | Ga0495621_0077088 | Ga0495621_0077088_147_1052 | 276 |
| 473 | 3300049669 | Ga0501235_024453 | Ga0501235_024453_171_1058 | 276 |
| 474 | 3300049674 | Ga0501242_004828 | Ga0501242_004828_260_1147 | 276 |
| 475 | 3300049681 | Ga0501251_009533 | Ga0501251_009533_175_1062 | 276 |
| 476 | 3300049686 | Ga0501257_041941 | Ga0501257_041941_177_1064 | 276 |
| 477 | 3300049688 | Ga0501259_005848 | Ga0501259_005848_52_939 | 276 |
| 478 | 3300049705 | Ga0501225_0033622 | Ga0501225_0033622_117_1004 | 276 |
| 479 | 3300049708 | Ga0501245_004916 | Ga0501245_004916_725_1612 | 276 |
| 480 | 3300049763 | Ga0501266_008295 | Ga0501266_008295_177_1064 | 276 |
| 481 | 3300050508 | nmdc:mga09592_67026_c1 | nmdc:mga09592_67026_c1_1173_2210 | 276 |
| 482 | 3300053153 | Ga0500616_0019994 | Ga0500616_0019994_2202_3086 | 276 |
| 483 | 3300001979 | JGI24740J21852_10048203 | JGI24740J21852_100482031 | 277 |
| 484 | 3300005288 | Ga0065714_10070648 | Ga0065714_100706483 | 277 |
| 485 | 3300005289 | Ga0065704_10082759 | Ga0065704_100827593 | 277 |
| 486 | 3300005328 | Ga0070676_10093197 | Ga0070676_100931971 | 277 |
| 487 | 3300005330 | Ga0070690_100013620 | Ga0070690_1000136203 | 277 |
| 488 | 3300005334 | Ga0068869_100001786 | Ga0068869_10000178610 | 277 |
| 489 | 3300005347 | Ga0070668_100117342 | Ga0070668_1001173421 | 277 |
| 490 | 3300005353 | Ga0070669_100227247 | Ga0070669_1002272472 | 277 |
| 491 | 3300005364 | Ga0070673_100003108 | Ga0070673_1000031088 | 277 |
| 492 | 3300005456 | Ga0070678_100123890 | Ga0070678_1001238901 | 277 |
| 493 | 3300005457 | Ga0070662_100022405 | Ga0070662_1000224053 | 277 |
| 494 | 3300005457 | Ga0070662_100065057 | Ga0070662_1000650573 | 277 |
| 495 | 3300005459 | Ga0068867_100053168 | Ga0068867_1000531683 | 277 |
| 496 | 3300005459 | Ga0068867_100297874 | Ga0068867_1002978741 | 277 |
| 497 | 3300005544 | Ga0070686_100014169 | Ga0070686_1000141694 | 277 |
| 498 | 3300005564 | Ga0070664_100041612 | Ga0070664_1000416124 | 277 |
| 499 | 3300005578 | Ga0068854_100105771 | Ga0068854_1001057711 | 277 |
| 500 | 3300005614 | Ga0068856_100392121 | Ga0068856_1003921211 | 277 |
| 501 | 3300005617 | Ga0068859_100226136 | Ga0068859_1002261362 | 277 |
| 502 | 3300005718 | Ga0068866_10046946 | Ga0068866_100469461 | 277 |
| 503 | 3300005840 | Ga0068870_10104929 | Ga0068870_101049292 | 277 |
| 504 | 3300005841 | Ga0068863_100106750 | Ga0068863_1001067502 | 277 |
| 505 | 3300005842 | Ga0068858_100216157 | Ga0068858_1002161571 | 277 |
| 506 | 3300006163 | Ga0070715_10006766 | Ga0070715_100067663 | 277 |
| 507 | 3300006237 | Ga0097621_100003845 | Ga0097621_1000038458 | 277 |
| 508 | 3300006358 | Ga0068871_100013193 | Ga0068871_1000131936 | 277 |
| 509 | 3300006844 | Ga0075428_100269929 | Ga0075428_1002699292 | 277 |
| 510 | 3300006931 | Ga0097620_100226101 | Ga0097620_1002261012 | 277 |
| 511 | 3300009147 | Ga0114129_10634904 | Ga0114129_106349042 | 277 |
| 512 | 3300009176 | Ga0105242_10013371 | Ga0105242_100133716 | 277 |
| 513 | 3300009545 | Ga0105237_10033939 | Ga0105237_100339392 | 277 |
| 514 | 3300009545 | Ga0105237_10709862 | Ga0105237_107098621 | 277 |
| 515 | 3300009553 | Ga0105249_10069050 | Ga0105249_100690502 | 277 |
| 516 | 3300010375 | Ga0105239_10231904 | Ga0105239_102319042 | 277 |
| 517 | 3300013297 | Ga0157378_10259627 | Ga0157378_102596272 | 277 |
| 518 | 3300013306 | Ga0163162_10029831 | Ga0163162_100298313 | 277 |
| 519 | 3300013306 | Ga0163162_10127457 | Ga0163162_101274572 | 277 |
| 520 | 3300013308 | Ga0157375_10008382 | Ga0157375_100083825 | 277 |
| 521 | 3300014325 | Ga0163163_10119820 | Ga0163163_101198203 | 277 |
| 522 | 3300014745 | Ga0157377_10046320 | Ga0157377_100463202 | 277 |
| 523 | 3300014968 | Ga0157379_10049041 | Ga0157379_100490412 | 277 |
| 524 | 3300014969 | Ga0157376_10122083 | Ga0157376_101220831 | 277 |
| 525 | 3300017792 | Ga0163161_10027223 | Ga0163161_100272233 | 277 |
| 526 | 3300025904 | Ga0207647_10000045 | Ga0207647_1000004568 | 277 |
| 527 | 3300025907 | Ga0207645_10098705 | Ga0207645_100987051 | 277 |
| 528 | 3300025908 | Ga0207643_10020523 | Ga0207643_100205232 | 277 |
| 529 | 3300025920 | Ga0207649_10115826 | Ga0207649_101158261 | 277 |
| 530 | 3300025920 | Ga0207649_10268265 | Ga0207649_102682651 | 277 |
| 531 | 3300025923 | Ga0207681_10039482 | Ga0207681_100394823 | 277 |
| 532 | 3300025932 | Ga0207690_10013214 | Ga0207690_100132146 | 277 |
| 533 | 3300025933 | Ga0207706_10002868 | Ga0207706_1000286814 | 277 |
| 534 | 3300025934 | Ga0207686_10006783 | Ga0207686_100067833 | 277 |
| 535 | 3300025938 | Ga0207704_10399812 | Ga0207704_103998121 | 277 |
| 536 | 3300025940 | Ga0207691_10028848 | Ga0207691_100288483 | 277 |
| 537 | 3300025942 | Ga0207689_10002661 | Ga0207689_100026619 | 277 |
| 538 | 3300025944 | Ga0207661_10515098 | Ga0207661_105150981 | 277 |
| 539 | 3300025945 | Ga0207679_10057339 | Ga0207679_100573394 | 277 |
| 540 | 3300025961 | Ga0207712_10096509 | Ga0207712_100965092 | 277 |
| 541 | 3300025981 | Ga0207640_10063567 | Ga0207640_100635673 | 277 |
| 542 | 3300026023 | Ga0207677_10119795 | Ga0207677_101197952 | 277 |
| 543 | 3300026035 | Ga0207703_10128071 | Ga0207703_101280713 | 277 |
| 544 | 3300026035 | Ga0207703_10209649 | Ga0207703_102096492 | 277 |
| 545 | 3300026035 | Ga0207703_10332514 | Ga0207703_103325141 | 277 |
| 546 | 3300026089 | Ga0207648_10014222 | Ga0207648_100142225 | 277 |
| 547 | 3300026089 | Ga0207648_10063228 | Ga0207648_100632285 | 277 |
| 548 | 3300026118 | Ga0207675_100023895 | Ga0207675_1000238952 | 277 |
| 549 | 3300026121 | Ga0207683_10010066 | Ga0207683_100100666 | 277 |
| 550 | 3300047320 | Ga0495672_0014449 | Ga0495672_0014449_983_1867 | 277 |
| 551 | 3300003322 | rootL2_10292385 | rootL2_102923852 | 278 |
| 552 | 3300005328 | Ga0070676_10010611 | Ga0070676_100106112 | 278 |
| 553 | 3300005328 | Ga0070676_10062169 | Ga0070676_100621693 | 278 |
| 554 | 3300005329 | Ga0070683_100044272 | Ga0070683_1000442723 | 278 |
| 555 | 3300005329 | Ga0070683_100440456 | Ga0070683_1004404562 | 278 |
| 556 | 3300005330 | Ga0070690_100116217 | Ga0070690_1001162172 | 278 |
| 557 | 3300005331 | Ga0070670_100113164 | Ga0070670_1001131642 | 278 |
| 558 | 3300005334 | Ga0068869_100004205 | Ga0068869_1000042052 | 278 |
| 559 | 3300005338 | Ga0068868_100017734 | Ga0068868_1000177343 | 278 |
| 560 | 3300005340 | Ga0070689_100086903 | Ga0070689_1000869033 | 278 |
| 561 | 3300005340 | Ga0070689_100133840 | Ga0070689_1001338402 | 278 |
| 562 | 3300005343 | Ga0070687_100103531 | Ga0070687_1001035313 | 278 |
| 563 | 3300005347 | Ga0070668_100105382 | Ga0070668_1001053823 | 278 |
| 564 | 3300005353 | Ga0070669_100075392 | Ga0070669_1000753922 | 278 |
| 565 | 3300005354 | Ga0070675_100103762 | Ga0070675_1001037622 | 278 |
| 566 | 3300005355 | Ga0070671_100193944 | Ga0070671_1001939442 | 278 |
| 567 | 3300005364 | Ga0070673_100006701 | Ga0070673_1000067017 | 278 |
| 568 | 3300005364 | Ga0070673_100350115 | Ga0070673_1003501152 | 278 |
| 569 | 3300005366 | Ga0070659_100220177 | Ga0070659_1002201771 | 278 |
| 570 | 3300005441 | Ga0070700_100326504 | Ga0070700_1003265042 | 278 |
| 571 | 3300005459 | Ga0068867_100005606 | Ga0068867_1000056065 | 278 |
| 572 | 3300005530 | Ga0070679_100322623 | Ga0070679_1003226231 | 278 |
| 573 | 3300005535 | Ga0070684_100007270 | Ga0070684_1000072708 | 278 |
| 574 | 3300005535 | Ga0070684_100045521 | Ga0070684_1000455211 | 278 |
| 575 | 3300005535 | Ga0070684_100051673 | Ga0070684_1000516734 | 278 |
| 576 | 3300005539 | Ga0068853_100152553 | Ga0068853_1001525531 | 278 |
| 577 | 3300005564 | Ga0070664_100019108 | Ga0070664_1000191082 | 278 |
| 578 | 3300005564 | Ga0070664_100021290 | Ga0070664_1000212902 | 278 |
| 579 | 3300005564 | Ga0070664_100098400 | Ga0070664_1000984002 | 278 |
| 580 | 3300005578 | Ga0068854_100038025 | Ga0068854_1000380252 | 278 |
| 581 | 3300005578 | Ga0068854_100062845 | Ga0068854_1000628452 | 278 |
| 582 | 3300005718 | Ga0068866_10065300 | Ga0068866_100653001 | 278 |
| 583 | 3300005719 | Ga0068861_100516031 | Ga0068861_1005160311 | 278 |
| 584 | 3300005840 | Ga0068870_10039800 | Ga0068870_100398003 | 278 |
| 585 | 3300005841 | Ga0068863_100313814 | Ga0068863_1003138142 | 278 |
| 586 | 3300005844 | Ga0068862_100144415 | Ga0068862_1001444152 | 278 |
| 587 | 3300006195 | Ga0075366_10006993 | Ga0075366_100069933 | 278 |
| 588 | 3300006237 | Ga0097621_100325614 | Ga0097621_1003256142 | 278 |
| 589 | 3300006358 | Ga0068871_100010643 | Ga0068871_1000106432 | 278 |
| 590 | 3300009148 | Ga0105243_10199508 | Ga0105243_101995083 | 278 |
| 591 | 3300009174 | Ga0105241_10400714 | Ga0105241_104007142 | 278 |
| 592 | 3300013102 | Ga0157371_10412720 | Ga0157371_104127201 | 278 |
| 593 | 3300013104 | Ga0157370_10246344 | Ga0157370_102463442 | 278 |
| 594 | 3300013105 | Ga0157369_10233736 | Ga0157369_102337362 | 278 |
| 595 | 3300013105 | Ga0157369_10442104 | Ga0157369_104421042 | 278 |
| 596 | 3300013296 | Ga0157374_10049451 | Ga0157374_100494512 | 278 |
| 597 | 3300013296 | Ga0157374_10054530 | Ga0157374_100545304 | 278 |
| 598 | 3300013296 | Ga0157374_10054949 | Ga0157374_100549492 | 278 |
| 599 | 3300013296 | Ga0157374_10097876 | Ga0157374_100978762 | 278 |
| 600 | 3300013306 | Ga0163162_10001190 | Ga0163162_100011908 | 278 |
| 601 | 3300013306 | Ga0163162_10168586 | Ga0163162_101685862 | 278 |
| 602 | 3300013306 | Ga0163162_10369595 | Ga0163162_103695952 | 278 |
| 603 | 3300013307 | Ga0157372_10071025 | Ga0157372_100710253 | 278 |
| 604 | 3300013308 | Ga0157375_10133517 | Ga0157375_101335172 | 278 |
| 605 | 3300014325 | Ga0163163_10009781 | Ga0163163_100097818 | 278 |
| 606 | 3300014325 | Ga0163163_10486590 | Ga0163163_104865901 | 278 |
| 607 | 3300014745 | Ga0157377_10089056 | Ga0157377_100890562 | 278 |
| 608 | 3300017792 | Ga0163161_10056639 | Ga0163161_100566393 | 278 |
| 609 | 3300021384 | Ga0213876_10001384 | Ga0213876_100013843 | 278 |
| 610 | 3300025899 | Ga0207642_10056040 | Ga0207642_100560403 | 278 |
| 611 | 3300025903 | Ga0207680_10014750 | Ga0207680_100147504 | 278 |
| 612 | 3300025907 | Ga0207645_10012613 | Ga0207645_100126134 | 278 |
| 613 | 3300025907 | Ga0207645_10022921 | Ga0207645_100229214 | 278 |
| 614 | 3300025908 | Ga0207643_10036648 | Ga0207643_100366482 | 278 |
| 615 | 3300025909 | Ga0207705_10082373 | Ga0207705_100823733 | 278 |
| 616 | 3300025923 | Ga0207681_10024459 | Ga0207681_100244594 | 278 |
| 617 | 3300025925 | Ga0207650_10370276 | Ga0207650_103702762 | 278 |
| 618 | 3300025926 | Ga0207659_10102255 | Ga0207659_101022552 | 278 |
| 619 | 3300025931 | Ga0207644_10027242 | Ga0207644_100272422 | 278 |
| 620 | 3300025932 | Ga0207690_10227909 | Ga0207690_102279092 | 278 |
| 621 | 3300025933 | Ga0207706_10070718 | Ga0207706_100707184 | 278 |
| 622 | 3300025936 | Ga0207670_10011342 | Ga0207670_100113423 | 278 |
| 623 | 3300025938 | Ga0207704_10144453 | Ga0207704_101444531 | 278 |
| 624 | 3300025940 | Ga0207691_10026608 | Ga0207691_100266085 | 278 |
| 625 | 3300025942 | Ga0207689_10004266 | Ga0207689_1000426613 | 278 |
| 626 | 3300025942 | Ga0207689_10009367 | Ga0207689_100093678 | 278 |
| 627 | 3300025944 | Ga0207661_10223850 | Ga0207661_102238501 | 278 |
| 628 | 3300025945 | Ga0207679_10041221 | Ga0207679_100412213 | 278 |
| 629 | 3300025945 | Ga0207679_10051359 | Ga0207679_100513592 | 278 |
| 630 | 3300025945 | Ga0207679_10259786 | Ga0207679_102597862 | 278 |
| 631 | 3300025960 | Ga0207651_10005935 | Ga0207651_100059351 | 278 |
| 632 | 3300025960 | Ga0207651_10117000 | Ga0207651_101170002 | 278 |
| 633 | 3300025981 | Ga0207640_10048817 | Ga0207640_100488172 | 278 |
| 634 | 3300026023 | Ga0207677_10085822 | Ga0207677_100858221 | 278 |
| 635 | 3300026067 | Ga0207678_10419337 | Ga0207678_104193372 | 278 |
| 636 | 3300026088 | Ga0207641_10295421 | Ga0207641_102954212 | 278 |
| 637 | 3300026088 | Ga0207641_10368936 | Ga0207641_103689362 | 278 |
| 638 | 3300026089 | Ga0207648_10002983 | Ga0207648_100029839 | 278 |
| 639 | 3300026089 | Ga0207648_10006182 | Ga0207648_1000618210 | 278 |
| 640 | 3300026089 | Ga0207648_10009426 | Ga0207648_100094265 | 278 |
| 641 | 3300026095 | Ga0207676_10271657 | Ga0207676_102716572 | 278 |
| 642 | 3300026118 | Ga0207675_100077897 | Ga0207675_1000778971 | 278 |
| 643 | 3300026118 | Ga0207675_100297918 | Ga0207675_1002979181 | 278 |
| 644 | 3300026121 | Ga0207683_10004127 | Ga0207683_100041276 | 278 |
| 645 | 3300028380 | Ga0268265_10486649 | Ga0268265_104866492 | 278 |
| 646 | 3300037471 | Ga0395905_0481311 | Ga0395905_0481311_156_1043 | 278 |
| 647 | 3300039437 | Ga0436365_0502188 | Ga0436365_0502188_6343_7233 | 278 |
| 648 | 3300042002 | Ga0439442_033746 | Ga0439442_033746_13_909 | 278 |
| 649 | 3300042004 | Ga0439445_0048892 | Ga0439445_0048892_127_1023 | 278 |
| 650 | 3300044658 | Ga0466972_0115267 | Ga0466972_0115267_16_903 | 278 |
| 651 | 3300046529 | Ga0495652_0324197 | Ga0495652_0324197_192_1082 | 278 |
| 652 | 3300046616 | Ga0495668_0000878 | Ga0495668_0000878_25891_26781 | 278 |
| 653 | 3300047472 | Ga0495686_0008687 | Ga0495686_0008687_3683_4585 | 278 |
| 654 | 3300048913 | Ga0496110_0032664 | Ga0496110_0032664_2919_3809 | 278 |
| 655 | 3300049571 | Ga0501034_0442694 | Ga0501034_0442694_167_1087 | 278 |
| 656 | 3300049572 | Ga0501036_0008882 | Ga0501036_0008882_6394_7290 | 278 |
| 657 | 3300049573 | Ga0501037_0100092 | Ga0501037_0100092_799_1695 | 278 |
| 658 | 3300049575 | Ga0501039_0010851 | Ga0501039_0010851_2724_3620 | 278 |
| 659 | 3300049579 | Ga0501043_0008369 | Ga0501043_0008369_3385_4281 | 278 |
| 660 | 3300049580 | Ga0501046_0111537 | Ga0501046_0111537_12_908 | 278 |
| 661 | 3300049581 | Ga0501047_0258657 | Ga0501047_0258657_587_1483 | 278 |
| 662 | 3300049586 | Ga0501070_0157057 | Ga0501070_0157057_815_1735 | 278 |
| 663 | 3300049822 | Ga0501035_0175310 | Ga0501035_0175310_223_1119 | 278 |
| 664 | 3300049823 | Ga0501044_0056273 | Ga0501044_0056273_852_1748 | 278 |
| 665 | 3300049823 | Ga0501044_0547834 | Ga0501044_0547834_19_909 | 278 |
| 666 | 3300050493 | nmdc:mga0k408_216379_c1 | nmdc:mga0k408_216379_c1_133_1035 | 278 |
| 667 | 3300050493 | nmdc:mga0k408_25445_c2 | nmdc:mga0k408_25445_c2_539_1441 | 278 |
| 668 | 3300053096 | Ga0500641_0012237 | Ga0500641_0012237_2011_2913 | 278 |
| 669 | 3300053727 | Ga0500611_000022 | Ga0500611_000022_78713_79615 | 278 |
| 670 | 3300000041 | ARcpr5oldR_c003410 | ARcpr5oldR_0034102 | 279 |
| 671 | 3300003322 | rootL2_10074881 | rootL2_100748813 | 279 |
| 672 | 3300005290 | Ga0065712_10071179 | Ga0065712_100711792 | 279 |
| 673 | 3300005327 | Ga0070658_10337318 | Ga0070658_103373181 | 279 |
| 674 | 3300005329 | Ga0070683_100064309 | Ga0070683_1000643093 | 279 |
| 675 | 3300005331 | Ga0070670_100110379 | Ga0070670_1001103791 | 279 |
| 676 | 3300005334 | Ga0068869_100022245 | Ga0068869_1000222452 | 279 |
| 677 | 3300005334 | Ga0068869_100096449 | Ga0068869_1000964492 | 279 |
| 678 | 3300005335 | Ga0070666_10030544 | Ga0070666_100305443 | 279 |
| 679 | 3300005339 | Ga0070660_100075397 | Ga0070660_1000753974 | 279 |
| 680 | 3300005347 | Ga0070668_100015872 | Ga0070668_1000158722 | 279 |
| 681 | 3300005347 | Ga0070668_100134789 | Ga0070668_1001347892 | 279 |
| 682 | 3300005353 | Ga0070669_100154218 | Ga0070669_1001542182 | 279 |
| 683 | 3300005354 | Ga0070675_100009839 | Ga0070675_1000098399 | 279 |
| 684 | 3300005364 | Ga0070673_100291076 | Ga0070673_1002910762 | 279 |
| 685 | 3300005365 | Ga0070688_100173591 | Ga0070688_1001735911 | 279 |
| 686 | 3300005367 | Ga0070667_100071365 | Ga0070667_1000713652 | 279 |
| 687 | 3300005438 | Ga0070701_10008166 | Ga0070701_100081662 | 279 |
| 688 | 3300005441 | Ga0070700_100031346 | Ga0070700_1000313462 | 279 |
| 689 | 3300005455 | Ga0070663_100115809 | Ga0070663_1001158092 | 279 |
| 690 | 3300005455 | Ga0070663_100161486 | Ga0070663_1001614862 | 279 |
| 691 | 3300005457 | Ga0070662_100025313 | Ga0070662_1000253132 | 279 |
| 692 | 3300005457 | Ga0070662_100028485 | Ga0070662_1000284853 | 279 |
| 693 | 3300005459 | Ga0068867_100106477 | Ga0068867_1001064772 | 279 |
| 694 | 3300005466 | Ga0070685_10215623 | Ga0070685_102156232 | 279 |
| 695 | 3300005535 | Ga0070684_100000417 | Ga0070684_10000041711 | 279 |
| 696 | 3300005535 | Ga0070684_100065031 | Ga0070684_1000650314 | 279 |
| 697 | 3300005539 | Ga0068853_100003954 | Ga0068853_1000039549 | 279 |
| 698 | 3300005539 | Ga0068853_100024447 | Ga0068853_1000244472 | 279 |
| 699 | 3300005539 | Ga0068853_100136790 | Ga0068853_1001367903 | 279 |
| 700 | 3300005547 | Ga0070693_100115314 | Ga0070693_1001153141 | 279 |
| 701 | 3300005548 | Ga0070665_100072520 | Ga0070665_1000725203 | 279 |
| 702 | 3300005564 | Ga0070664_100000487 | Ga0070664_10000048727 | 279 |
| 703 | 3300005564 | Ga0070664_100086494 | Ga0070664_1000864943 | 279 |
| 704 | 3300005564 | Ga0070664_100279874 | Ga0070664_1002798742 | 279 |
| 705 | 3300005577 | Ga0068857_100021467 | Ga0068857_1000214672 | 279 |
| 706 | 3300005577 | Ga0068857_100182834 | Ga0068857_1001828342 | 279 |
| 707 | 3300005577 | Ga0068857_100248992 | Ga0068857_1002489921 | 279 |
| 708 | 3300005616 | Ga0068852_100065791 | Ga0068852_1000657913 | 279 |
| 709 | 3300005616 | Ga0068852_100715152 | Ga0068852_1007151521 | 279 |
| 710 | 3300005618 | Ga0068864_100073656 | Ga0068864_1000736564 | 279 |
| 711 | 3300005618 | Ga0068864_100309994 | Ga0068864_1003099942 | 279 |
| 712 | 3300005719 | Ga0068861_100002247 | Ga0068861_1000022477 | 279 |
| 713 | 3300005834 | Ga0068851_10102878 | Ga0068851_101028781 | 279 |
| 714 | 3300005840 | Ga0068870_10013725 | Ga0068870_100137251 | 279 |
| 715 | 3300005842 | Ga0068858_100024399 | Ga0068858_1000243994 | 279 |
| 716 | 3300005843 | Ga0068860_100435672 | Ga0068860_1004356722 | 279 |
| 717 | 3300005844 | Ga0068862_100023039 | Ga0068862_1000230392 | 279 |
| 718 | 3300009094 | Ga0111539_10005620 | Ga0111539_1000562017 | 279 |
| 719 | 3300009176 | Ga0105242_10025402 | Ga0105242_100254023 | 279 |
| 720 | 3300009177 | Ga0105248_10431783 | Ga0105248_104317832 | 279 |
| 721 | 3300009553 | Ga0105249_10087480 | Ga0105249_100874804 | 279 |
| 722 | 3300013296 | Ga0157374_10198855 | Ga0157374_101988552 | 279 |
| 723 | 3300013297 | Ga0157378_10435448 | Ga0157378_104354482 | 279 |
| 724 | 3300013306 | Ga0163162_10037650 | Ga0163162_100376502 | 279 |
| 725 | 3300013306 | Ga0163162_10042883 | Ga0163162_100428835 | 279 |
| 726 | 3300013308 | Ga0157375_10003748 | Ga0157375_100037489 | 279 |
| 727 | 3300013308 | Ga0157375_10175021 | Ga0157375_101750213 | 279 |
| 728 | 3300014326 | Ga0157380_10004225 | Ga0157380_100042258 | 279 |
| 729 | 3300014745 | Ga0157377_10006267 | Ga0157377_100062672 | 279 |
| 730 | 3300014968 | Ga0157379_10113893 | Ga0157379_101138932 | 279 |
| 731 | 3300014969 | Ga0157376_10103570 | Ga0157376_101035703 | 279 |
| 732 | 3300017792 | Ga0163161_10304949 | Ga0163161_103049492 | 279 |
| 733 | 3300025919 | Ga0207657_10085559 | Ga0207657_100855594 | 279 |
| 734 | 3300025925 | Ga0207650_10036624 | Ga0207650_100366243 | 279 |
| 735 | 3300025925 | Ga0207650_10086550 | Ga0207650_100865503 | 279 |
| 736 | 3300025926 | Ga0207659_10028881 | Ga0207659_100288812 | 279 |
| 737 | 3300025932 | Ga0207690_10312143 | Ga0207690_103121432 | 279 |
| 738 | 3300025933 | Ga0207706_10022975 | Ga0207706_100229754 | 279 |
| 739 | 3300025933 | Ga0207706_10108753 | Ga0207706_101087532 | 279 |
| 740 | 3300025934 | Ga0207686_10001258 | Ga0207686_100012589 | 279 |
| 741 | 3300025940 | Ga0207691_10150951 | Ga0207691_101509511 | 279 |
| 742 | 3300025941 | Ga0207711_10255548 | Ga0207711_102555482 | 279 |
| 743 | 3300025942 | Ga0207689_10031238 | Ga0207689_100312382 | 279 |
| 744 | 3300025942 | Ga0207689_10129456 | Ga0207689_101294563 | 279 |
| 745 | 3300025944 | Ga0207661_10014437 | Ga0207661_100144372 | 279 |
| 746 | 3300025945 | Ga0207679_10000462 | Ga0207679_100004624 | 279 |
| 747 | 3300025960 | Ga0207651_10077324 | Ga0207651_100773242 | 279 |
| 748 | 3300025972 | Ga0207668_10010481 | Ga0207668_100104815 | 279 |
| 749 | 3300025986 | Ga0207658_10091991 | Ga0207658_100919913 | 279 |
| 750 | 3300026023 | Ga0207677_10033369 | Ga0207677_100333692 | 279 |
| 751 | 3300026035 | Ga0207703_10122825 | Ga0207703_101228252 | 279 |
| 752 | 3300026041 | Ga0207639_10016412 | Ga0207639_100164123 | 279 |
| 753 | 3300026041 | Ga0207639_10380015 | Ga0207639_103800152 | 279 |
| 754 | 3300026075 | Ga0207708_10073106 | Ga0207708_100731062 | 279 |
| 755 | 3300026089 | Ga0207648_10123232 | Ga0207648_101232322 | 279 |
| 756 | 3300026116 | Ga0207674_10010902 | Ga0207674_100109024 | 279 |
| 757 | 3300026116 | Ga0207674_10011266 | Ga0207674_100112669 | 279 |
| 758 | 3300026116 | Ga0207674_10122461 | Ga0207674_101224613 | 279 |
| 759 | 3300026116 | Ga0207674_10142993 | Ga0207674_101429932 | 279 |
| 760 | 3300026118 | Ga0207675_100000304 | Ga0207675_10000030414 | 279 |
| 761 | 3300026142 | Ga0207698_10284271 | Ga0207698_102842712 | 279 |
| 762 | 3300028794 | Ga0307515_10000001 | Ga0307515_10000001891 | 279 |
| 763 | 3300031251 | Ga0265327_10000051 | Ga0265327_10000051125 | 279 |
| 764 | 3300032004 | Ga0307414_10079185 | Ga0307414_100791851 | 279 |
| 765 | 3300035089 | Ga0373944_0076323 | Ga0373944_0076323_133_1023 | 279 |
| 766 | 3300035118 | Ga0373954_0165959 | Ga0373954_0165959_77_970 | 279 |
| 767 | 3300035170 | Ga0373943_0116184 | Ga0373943_0116184_70_963 | 279 |
| 768 | 3300035172 | Ga0373955_0112840 | Ga0373955_0112840_335_1228 | 279 |
| 769 | 3300035410 | Ga0373924_0139268 | Ga0373924_0139268_41_934 | 279 |
| 770 | 3300042876 | Ga0451577_0114052 | Ga0451577_0114052_961_1896 | 279 |
| 771 | 3300044673 | Ga0453683_0000311 | Ga0453683_0000311_56658_57593 | 279 |
| 772 | 3300044673 | Ga0453683_0016047 | Ga0453683_0016047_3691_4626 | 279 |
| 773 | 3300044673 | Ga0453683_0082057 | Ga0453683_0082057_770_1690 | 279 |
| 774 | 3300046454 | Ga0495592_0041234 | Ga0495592_0041234_2115_3008 | 279 |
| 775 | 3300046472 | Ga0495580_0324771 | Ga0495580_0324771_59_949 | 279 |
| 776 | 3300046536 | Ga0495587_0023999 | Ga0495587_0023999_2245_3138 | 279 |
| 777 | 3300046543 | Ga0495645_0221546 | Ga0495645_0221546_250_1143 | 279 |
| 778 | 3300046616 | Ga0495668_0002497 | Ga0495668_0002497_12997_13893 | 279 |
| 779 | 3300046675 | Ga0495657_0064417 | Ga0495657_0064417_791_1684 | 279 |
| 780 | 3300047317 | Ga0495604_0246748 | Ga0495604_0246748_218_1111 | 279 |
| 781 | 3300047471 | Ga0495684_0114416 | Ga0495684_0114416_85_978 | 279 |
| 782 | 3300049571 | Ga0501034_0039704 | Ga0501034_0039704_1308_2201 | 279 |
| 783 | 3300049572 | Ga0501036_0006194 | Ga0501036_0006194_4997_5890 | 279 |
| 784 | 3300049573 | Ga0501037_0151126 | Ga0501037_0151126_492_1385 | 279 |
| 785 | 3300049574 | Ga0501038_0050525 | Ga0501038_0050525_2198_3091 | 279 |
| 786 | 3300049579 | Ga0501043_0016758 | Ga0501043_0016758_1568_2461 | 279 |
| 787 | 3300049580 | Ga0501046_0005502 | Ga0501046_0005502_3224_4117 | 279 |
| 788 | 3300049583 | Ga0501067_0103081 | Ga0501067_0103081_418_1311 | 279 |
| 789 | 3300049589 | Ga0501073_0010728 | Ga0501073_0010728_5474_6367 | 279 |
| 790 | 3300049590 | Ga0501074_0003026 | Ga0501074_0003026_7166_8059 | 279 |
| 791 | 3300049741 | Ga0501079_0054375 | Ga0501079_0054375_506_1399 | 279 |
| 792 | 3300049742 | Ga0501080_0021495 | Ga0501080_0021495_3305_4198 | 279 |
| 793 | 3300049744 | Ga0501083_0011009 | Ga0501083_0011009_2152_3045 | 279 |
| 794 | 3300049822 | Ga0501035_0122673 | Ga0501035_0122673_928_1821 | 279 |
| 795 | 3300049823 | Ga0501044_0105161 | Ga0501044_0105161_267_1181 | 279 |
| 796 | 3300049823 | Ga0501044_0119141 | Ga0501044_0119141_1508_2401 | 279 |
| 797 | 3300050511 | nmdc:mga08y16_118242_c1 | nmdc:mga08y16_118242_c1_437_1342 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5y79-assembly1.cif.gz_B | crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate | 0.7277 | 3 | 262 |
| 5y79-assembly1.cif.gz_B | crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate | 0.6813 | 3 | 262 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.65 | 8 | 260 |
| 5ogk-assembly2.cif.gz_C | crystal structure of a nucleotide sugar transporter with bound nucleotide sugar. | 0.6459 | 11 | 275 |
| 5i20-assembly1.cif.gz_A | crystal structure of protein | 0.6338 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7029 | 4 | 265 | 1.20.1740.10 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6838 | 4 | 261 | 1.20.1740.10 |
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6636 | 4 | 265 | 1.20.1740.10 |
| af_A0A0P0YAS8_28_439_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6478 | 4 | 262 | 1.20.1740.10 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6383 | 4 | 261 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z6I9T6-F1-model_v4 | Permease | 0.8896 | 1 | 278 |
GO:0016020
|
| AF-A0A2Z6I9T6-F1-model_v4 | Permease | 0.8835 | 1 | 278 |
GO:0016020
|
| AF-A0A7Y4T5K4-F1-model_v4 | DMT family transporter | 0.8798 | 2 | 260 |
GO:0016020
|
| AF-G8R0N4-F1-model_v4 | Putative permease | 0.876 | 2 | 272 |
GO:0016020
|
| AF-A0A353YYM1-F1-model_v4 | EamA family transporter | 0.8683 | 1 | 270 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar