F481236

General Info

Members Datasets Scaffolds Average Seq Length
797 336 742 290

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100024447|Ga0068853_1000244472
Length 329
Sequence VRSKWPFVDFFGLIMLPFLPYERDCGWRPIFASMKKALVQLHIAVFLAGFTAILGKLITLNEGLLVWFRLLITVVTLGAILFFKKQLLRIPVKDMFKIFGVGIIVAIHWVTFYGSVKYANVSVALVCFSATGFFTAFFEPLILKRKISWTEVGLGLIAICGIYIIFDFHPQYKLGIIFGIIAAIGSALFPIFNKRLLLIYSPKILTLYELGGGLLALTVLVPFYLMQFPAAYYLPTASDWLWLLILAWLCTVLSFDLQLNALKKISAFTANLTYNLEPVYGIILAFIFFKENENLNGAFYIGVLLILLAVVLQMLRIGRQHKQNTGQAN

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
23 2738541302 Pedobacter sp. CF074 Isolate Unclassified
24 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
25 2739367651 Pedobacter sp. OK291 Isolate Unclassified
26 2739367656 Pedobacter sp. CF523 Isolate Unclassified
27 2739367663 Pedobacter sp. YR510 Isolate Unclassified
28 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
29 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
30 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
31 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
32 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
33 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
34 2818991437 Pedobacter terrae 518 Isolate Unclassified
35 2818991444 Filimonas endophytica 3197 Isolate Unclassified
36 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
37 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
38 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
39 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
40 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
41 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
42 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
43 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
44 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
45 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
46 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
47 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
48 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
49 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
50 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
51 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
52 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
53 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
54 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
55 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
56 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
57 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
60 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
73 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
97 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
103 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
130 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
251 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
315 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
316 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
325 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
326 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 0
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 0.38
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003410 3300000041 Bacteria 1414
2 JGI24741J21665_1004867 3300001915 Bacteria 2902
3 JGI24740J21852_10048203 3300001979 Bacteria 1238
4 JGI25152J39213_1000228 3300002773 Bacteria 37959
5 JGI25150J39212_1000002 3300002774 Bacteria 537631
6 JGI25151J46595_10000003 3300003187 Bacteria 715330
7 JGI25406J46586_10003120 3300003203 Bacteria 7785
8 JGI25153J46596_10000003 3300003215 Bacteria 553253
9 rootH2_10053452 3300003320 Bacteria 3418
10 rootH2_10223400 3300003320 Bacteria 6000
11 rootL2_10074881 3300003322 Bacteria 2815
12 rootL2_10225493 3300003322 Bacteria 2010
13 rootL2_10292385 3300003322 Bacteria 1332
14 rootH1_10162953 3300003323 Bacteria 3353
15 rootH1_10215749 3300003323 Bacteria 1499
16 Ga0055536_1000007 3300003781 Bacteria 345133
17 Ga0055534_1005957 3300003784 Bacteria 3159
18 Ga0055530_10010824 3300003791 Bacteria 3330
19 Ga0065714_10067637 3300005288 Bacteria 5297
20 Ga0065714_10069057 3300005288 Bacteria 4407
21 Ga0065714_10069763 3300005288 Bacteria 4098
22 Ga0065714_10070648 3300005288 Bacteria 3805
23 Ga0065704_10071464 3300005289 Bacteria 11042
24 Ga0065704_10075289 3300005289 Bacteria 5678
25 Ga0065704_10082759 3300005289 Bacteria 3554
26 Ga0065712_10070399 3300005290 Bacteria 6043
27 Ga0065712_10071179 3300005290 Bacteria 5396
28 Ga0065707_10116229 3300005295 Bacteria 2244
29 Ga0070658_10005453 3300005327 Bacteria 10313
30 Ga0070658_10020168 3300005327 Bacteria 5340
31 Ga0070658_10169290 3300005327 Unclassified 1835
32 Ga0070658_10323119 3300005327 Bacteria 1318
33 Ga0070658_10337318 3300005327 Unclassified 1289
34 Ga0070658_10408721 3300005327 Bacteria 1166
35 Ga0070676_10010611 3300005328 Bacteria 4999
36 Ga0070676_10062169 3300005328 Unclassified 2221
37 Ga0070676_10093197 3300005328 Bacteria 1849
38 Ga0070683_100013965 3300005329 Bacteria 7016
39 Ga0070683_100044272 3300005329 Bacteria 4104
40 Ga0070683_100064309 3300005329 Bacteria 3415
41 Ga0070683_100440456 3300005329 Bacteria 1243
42 Ga0070690_100013620 3300005330 Bacteria 4810
43 Ga0070690_100116217 3300005330 Bacteria 1791
44 Ga0070670_100078484 3300005331 Bacteria 2836
45 Ga0070670_100110379 3300005331 Bacteria 2370
46 Ga0070670_100113164 3300005331 Bacteria 2339
47 Ga0068869_100001786 3300005334 Bacteria 12896
48 Ga0068869_100004205 3300005334 Bacteria 8936
49 Ga0068869_100022245 3300005334 Unclassified 4367
50 Ga0068869_100032502 3300005334 Bacteria 3677
51 Ga0068869_100044679 3300005334 Bacteria 3186
52 Ga0068869_100096449 3300005334 Bacteria 2232
53 Ga0068869_100109898 3300005334 Bacteria 2096
54 Ga0068869_100445585 3300005334 Bacteria 1072
55 Ga0070666_10000247 3300005335 Bacteria 36276
56 Ga0070666_10000885 3300005335 Bacteria 18201
57 Ga0070666_10030544 3300005335 Bacteria 3551
58 Ga0070666_10057807 3300005335 Bacteria 2621
59 Ga0070680_100029249 3300005336 Bacteria 4425
60 Ga0070682_100000173 3300005337 Bacteria 47981
61 Ga0070682_100008776 3300005337 Bacteria 5704
62 Ga0070682_100010074 3300005337 Bacteria 5357
63 Ga0070682_100236861 3300005337 Bacteria 1308
64 Ga0068868_100000075 3300005338 Bacteria 58452
65 Ga0068868_100017734 3300005338 Bacteria 5309
66 Ga0070660_100017556 3300005339 Bacteria 5217
67 Ga0070660_100075397 3300005339 Unclassified 2641
68 Ga0070689_100086903 3300005340 Bacteria 2459
69 Ga0070689_100133840 3300005340 Bacteria 1989
70 Ga0070689_100232037 3300005340 Unclassified 1517
71 Ga0070687_100103531 3300005343 Bacteria 1598
72 Ga0070687_100222134 3300005343 Bacteria 1158
73 Ga0070661_100083927 3300005344 Bacteria 2353
74 Ga0070668_100000859 3300005347 Bacteria 21121
75 Ga0070668_100015872 3300005347 Bacteria 5634
76 Ga0070668_100022201 3300005347 Bacteria 4798
77 Ga0070668_100105382 3300005347 Bacteria 2239
78 Ga0070668_100117342 3300005347 Bacteria 2123
79 Ga0070668_100134789 3300005347 Bacteria 1985
80 Ga0070669_100075392 3300005353 Bacteria 2501
81 Ga0070669_100154218 3300005353 Bacteria 1780
82 Ga0070669_100227247 3300005353 Bacteria 1477
83 Ga0070675_100009839 3300005354 Bacteria 7452
84 Ga0070675_100103762 3300005354 Bacteria 2398
85 Ga0070671_100027461 3300005355 Bacteria 4685
86 Ga0070671_100193944 3300005355 Bacteria 1722
87 Ga0070673_100000448 3300005364 Bacteria 21839
88 Ga0070673_100003108 3300005364 Bacteria 10282
89 Ga0070673_100006701 3300005364 Bacteria 7509
90 Ga0070673_100053248 3300005364 Bacteria 3177
91 Ga0070673_100291076 3300005364 Bacteria 1435
92 Ga0070673_100350115 3300005364 Bacteria 1311
93 Ga0070688_100173591 3300005365 Bacteria 1490
94 Ga0070659_100000828 3300005366 Bacteria 22546
95 Ga0070659_100001692 3300005366 Bacteria 15868
96 Ga0070659_100113125 3300005366 Bacteria 2192
97 Ga0070659_100220177 3300005366 Bacteria 1566
98 Ga0070667_100000482 3300005367 Bacteria 40557
99 Ga0070667_100071365 3300005367 Bacteria 2957
100 Ga0070667_100112829 3300005367 Bacteria 2358
101 Ga0070701_10008166 3300005438 Bacteria 4511
102 Ga0070700_100031346 3300005441 Unclassified 3185
103 Ga0070700_100326504 3300005441 Bacteria 1129
104 Ga0070663_100042799 3300005455 Bacteria 3184
105 Ga0070663_100115809 3300005455 Bacteria 2019
106 Ga0070663_100161486 3300005455 Bacteria 1725
107 Ga0070678_100123890 3300005456 Bacteria 2042
108 Ga0070678_100219591 3300005456 Unclassified 1579
109 Ga0070662_100002983 3300005457 Bacteria 10519
110 Ga0070662_100022405 3300005457 Bacteria 4325
111 Ga0070662_100025313 3300005457 Unclassified 4096
112 Ga0070662_100028485 3300005457 Bacteria 3887
113 Ga0070662_100029479 3300005457 Bacteria 3830
114 Ga0070662_100065057 3300005457 Bacteria 2672
115 Ga0068867_100005606 3300005459 Bacteria 8895
116 Ga0068867_100053168 3300005459 Bacteria 2991
117 Ga0068867_100106477 3300005459 Unclassified 2148
118 Ga0068867_100223718 3300005459 Bacteria 1518
119 Ga0068867_100297874 3300005459 Bacteria 1329
120 Ga0070685_10001175 3300005466 Bacteria 14009
121 Ga0070685_10215623 3300005466 Bacteria 1255
122 Ga0070698_100001454 3300005471 Bacteria 26303
123 Ga0070698_100021851 3300005471 Bacteria 6701
124 Ga0070698_100060779 3300005471 Unclassified 3812
125 Ga0070679_100015863 3300005530 Bacteria 7251
126 Ga0070679_100026151 3300005530 Bacteria 5729
127 Ga0070679_100322623 3300005530 Bacteria 1493
128 Ga0070684_100000417 3300005535 Bacteria 29183
129 Ga0070684_100000979 3300005535 Bacteria 20363
130 Ga0070684_100002647 3300005535 Bacteria 13212
131 Ga0070684_100007270 3300005535 Bacteria 8607
132 Ga0070684_100045521 3300005535 Bacteria 3799
133 Ga0070684_100051673 3300005535 Bacteria 3571
134 Ga0070684_100065031 3300005535 Unclassified 3201
135 Ga0068853_100003954 3300005539 Bacteria 11385
136 Ga0068853_100007967 3300005539 Bacteria 8495
137 Ga0068853_100024447 3300005539 Bacteria 5065
138 Ga0068853_100136790 3300005539 Unclassified 2197
139 Ga0068853_100152553 3300005539 Bacteria 2080
140 Ga0068853_100423920 3300005539 Unclassified 1248
141 Ga0070672_100000361 3300005543 Bacteria 26202
142 Ga0070686_100014169 3300005544 Bacteria 4589
143 Ga0070686_100060381 3300005544 Unclassified 2446
144 Ga0070696_100208976 3300005546 Bacteria 1460
145 Ga0070693_100115314 3300005547 Bacteria 1659
146 Ga0070665_100002163 3300005548 Bacteria 21925
147 Ga0070665_100072520 3300005548 Bacteria 3451
148 Ga0070704_100057017 3300005549 Bacteria 2776
149 Ga0068855_100018669 3300005563 Bacteria 8340
150 Ga0070664_100000487 3300005564 Bacteria 30067
151 Ga0070664_100017274 3300005564 Bacteria 5926
152 Ga0070664_100019108 3300005564 Bacteria 5634
153 Ga0070664_100021290 3300005564 Bacteria 5343
154 Ga0070664_100041612 3300005564 Bacteria 3878
155 Ga0070664_100058013 3300005564 Bacteria 3292
156 Ga0070664_100086494 3300005564 Bacteria 2709
157 Ga0070664_100098400 3300005564 Bacteria 2541
158 Ga0070664_100279874 3300005564 Bacteria 1504
159 Ga0068857_100021467 3300005577 Bacteria 5682
160 Ga0068857_100182834 3300005577 Bacteria 1908
161 Ga0068857_100248992 3300005577 Unclassified 1628
162 Ga0068854_100038025 3300005578 Bacteria 3382
163 Ga0068854_100062845 3300005578 Bacteria 2694
164 Ga0068854_100105771 3300005578 Bacteria 2116
165 Ga0068854_100120409 3300005578 Bacteria 1992
166 Ga0068854_100210067 3300005578 Bacteria 1535
167 Ga0068856_100003735 3300005614 Bacteria 15264
168 Ga0068856_100392121 3300005614 Bacteria 1408
169 Ga0068852_100019362 3300005616 Bacteria 5385
170 Ga0068852_100039630 3300005616 Bacteria 3968
171 Ga0068852_100051678 3300005616 Bacteria 3528
172 Ga0068852_100065791 3300005616 Bacteria 3164
173 Ga0068852_100140884 3300005616 Bacteria 2231
174 Ga0068852_100583615 3300005616 Bacteria 1121
175 Ga0068852_100715152 3300005616 Bacteria 1012
176 Ga0068859_100000012 3300005617 Bacteria 300376
177 Ga0068859_100001754 3300005617 Bacteria 22081
178 Ga0068859_100075852 3300005617 Bacteria 3403
179 Ga0068859_100185247 3300005617 Bacteria 2165
180 Ga0068859_100226136 3300005617 Bacteria 1959
181 Ga0068864_100000785 3300005618 Bacteria 26636
182 Ga0068864_100007484 3300005618 Bacteria 8996
183 Ga0068864_100073656 3300005618 Bacteria 2978
184 Ga0068864_100309994 3300005618 Bacteria 1480
185 Ga0068866_10046946 3300005718 Bacteria 2174
186 Ga0068866_10065300 3300005718 Unclassified 1903
187 Ga0068861_100002247 3300005719 Bacteria 12544
188 Ga0068861_100350129 3300005719 Bacteria 1295
189 Ga0068861_100516031 3300005719 Bacteria 1083
190 Ga0068851_10001706 3300005834 Bacteria 9614
191 Ga0068851_10008331 3300005834 Bacteria 4793
192 Ga0068851_10102878 3300005834 Bacteria 1517
193 Ga0068870_10013725 3300005840 Bacteria 3814
194 Ga0068870_10039800 3300005840 Bacteria 2434
195 Ga0068870_10104929 3300005840 Bacteria 1604
196 Ga0068870_10336288 3300005840 Bacteria 964
197 Ga0068863_100001993 3300005841 Bacteria 20286
198 Ga0068863_100017853 3300005841 Bacteria 6789
199 Ga0068863_100106750 3300005841 Bacteria 2665
200 Ga0068863_100225831 3300005841 Bacteria 1805
201 Ga0068863_100313814 3300005841 Bacteria 1522
202 Ga0068863_100322227 3300005841 Bacteria 1501
203 Ga0068858_100001413 3300005842 Bacteria 24658
204 Ga0068858_100009905 3300005842 Bacteria 9053
205 Ga0068858_100024399 3300005842 Bacteria 5634
206 Ga0068858_100216157 3300005842 Unclassified 1815
207 Ga0068860_100002836 3300005843 Bacteria 18019
208 Ga0068860_100005500 3300005843 Bacteria 12830
209 Ga0068860_100359213 3300005843 Bacteria 1435
210 Ga0068860_100435672 3300005843 Bacteria 1301
211 Ga0068862_100023039 3300005844 Bacteria 5215
212 Ga0068862_100144415 3300005844 Bacteria 2114
213 Ga0068862_100418849 3300005844 Bacteria 1256
214 Ga0081539_10000925 3300005985 Bacteria 55202
215 Ga0081539_10025637 3300005985 Bacteria 3790
216 Ga0070715_10006766 3300006163 Bacteria 3912
217 Ga0075366_10006993 3300006195 Bacteria 6209
218 Ga0075366_10054467 3300006195 Bacteria 2376
219 Ga0097621_100000063 3300006237 Bacteria 55571
220 Ga0097621_100003845 3300006237 Bacteria 10402
221 Ga0097621_100004135 3300006237 Bacteria 10062
222 Ga0097621_100031558 3300006237 Bacteria 4205
223 Ga0097621_100063054 3300006237 Bacteria 3045
224 Ga0097621_100083814 3300006237 Bacteria 2657
225 Ga0097621_100122957 3300006237 Bacteria 2203
226 Ga0097621_100325614 3300006237 Bacteria 1362
227 Ga0068871_100000952 3300006358 Bacteria 19348
228 Ga0068871_100000981 3300006358 Bacteria 19104
229 Ga0068871_100005200 3300006358 Bacteria 9099
230 Ga0068871_100010643 3300006358 Bacteria 6723
231 Ga0068871_100013193 3300006358 Bacteria 6128
232 Ga0068871_100107543 3300006358 Bacteria 2343
233 Ga0068871_100257638 3300006358 Bacteria 1521
234 Ga0075428_100269929 3300006844 Bacteria 1830
235 Ga0075428_100275229 3300006844 Bacteria 1811
236 Ga0075429_100004948 3300006880 Bacteria 11476
237 Ga0068865_100044565 3300006881 Bacteria 3037
238 Ga0068865_100146220 3300006881 Bacteria 1788
239 Ga0068865_100353480 3300006881 Bacteria 1191
240 Ga0097620_100000012 3300006931 Bacteria 300376
241 Ga0097620_100001754 3300006931 Bacteria 22081
242 Ga0097620_100075852 3300006931 Bacteria 3403
243 Ga0097620_100185237 3300006931 Bacteria 2165
244 Ga0097620_100226101 3300006931 Bacteria 1959
245 Ga0105244_10000018 3300009036 Bacteria 244992
246 Ga0111539_10005620 3300009094 Bacteria 16217
247 Ga0105245_10108552 3300009098 Bacteria 2578
248 Ga0105245_10296942 3300009098 Bacteria 1584
249 Ga0105247_10279429 3300009101 Bacteria 1151
250 Ga0114129_10634904 3300009147 Bacteria 1380
251 Ga0105243_10000089 3300009148 Bacteria 103761
252 Ga0105243_10199508 3300009148 Bacteria 1754
253 Ga0105241_10001370 3300009174 Bacteria 18574
254 Ga0105241_10260351 3300009174 Bacteria 1474
255 Ga0105241_10353892 3300009174 Unclassified 1276
256 Ga0105241_10400714 3300009174 Unclassified 1203
257 Ga0105242_10013371 3300009176 Bacteria 6341
258 Ga0105242_10025402 3300009176 Bacteria 4689
259 Ga0105242_10111369 3300009176 Unclassified 2334
260 Ga0105242_10111690 3300009176 Bacteria 2331
261 Ga0105248_10009934 3300009177 Bacteria 10475
262 Ga0105248_10431783 3300009177 Bacteria 1484
263 Ga0105237_10010659 3300009545 Bacteria 9766
264 Ga0105237_10033939 3300009545 Bacteria 5169
265 Ga0105237_10077957 3300009545 Bacteria 3303
266 Ga0105237_10709862 3300009545 Bacteria 1012
267 Ga0105249_10001749 3300009553 Bacteria 18941
268 Ga0105249_10003402 3300009553 Bacteria 13780
269 Ga0105249_10003442 3300009553 Bacteria 13704
270 Ga0105249_10028082 3300009553 Bacteria 5079
271 Ga0105249_10035804 3300009553 Bacteria 4501
272 Ga0105249_10055217 3300009553 Bacteria 3633
273 Ga0105249_10069050 3300009553 Bacteria 3261
274 Ga0105249_10087480 3300009553 Bacteria 2907
275 Ga0105239_10042858 3300010375 Bacteria 4959
276 Ga0105239_10231904 3300010375 Bacteria 2071
277 Ga0105246_10061186 3300011119 Bacteria 2619
278 Ga0157373_10000067 3300013100 Bacteria 92618
279 Ga0157373_10033227 3300013100 Bacteria 3712
280 Ga0157373_10122911 3300013100 Bacteria 1825
281 Ga0157371_10000036 3300013102 Bacteria 215191
282 Ga0157371_10000901 3300013102 Bacteria 33476
283 Ga0157371_10029931 3300013102 Bacteria 3930
284 Ga0157371_10056580 3300013102 Unclassified 2782
285 Ga0157371_10215458 3300013102 Bacteria 1378
286 Ga0157371_10412720 3300013102 Bacteria 989
287 Ga0157370_10001141 3300013104 Bacteria 33176
288 Ga0157370_10005003 3300013104 Bacteria 14995
289 Ga0157370_10013588 3300013104 Bacteria 8378
290 Ga0157370_10033216 3300013104 Bacteria 5030
291 Ga0157370_10042698 3300013104 Bacteria 4368
292 Ga0157370_10073252 3300013104 Bacteria 3231
293 Ga0157370_10246344 3300013104 Bacteria 1653
294 Ga0157369_10000015 3300013105 Bacteria 262917
295 Ga0157369_10000153 3300013105 Bacteria 97572
296 Ga0157369_10102782 3300013105 Bacteria 3044
297 Ga0157369_10212800 3300013105 Bacteria 2025
298 Ga0157369_10233736 3300013105 Bacteria 1921
299 Ga0157369_10313553 3300013105 Bacteria 1631
300 Ga0157369_10442104 3300013105 Bacteria 1347
301 Ga0157374_10002589 3300013296 Bacteria 15240
302 Ga0157374_10003428 3300013296 Bacteria 13327
303 Ga0157374_10049451 3300013296 Unclassified 3905
304 Ga0157374_10054530 3300013296 Bacteria 3729
305 Ga0157374_10054949 3300013296 Bacteria 3715
306 Ga0157374_10097876 3300013296 Bacteria 2808
307 Ga0157374_10198855 3300013296 Bacteria 1962
308 Ga0157378_10013496 3300013297 Bacteria 7144
309 Ga0157378_10033096 3300013297 Bacteria 4569
310 Ga0157378_10047281 3300013297 Bacteria 3825
311 Ga0157378_10114878 3300013297 Unclassified 2473
312 Ga0157378_10124762 3300013297 Bacteria 2378
313 Ga0157378_10250143 3300013297 Bacteria 1696
314 Ga0157378_10259627 3300013297 Unclassified 1666
315 Ga0157378_10435448 3300013297 Bacteria 1298
316 Ga0157378_10480459 3300013297 Bacteria 1238
317 Ga0163162_10000158 3300013306 Bacteria 62514
318 Ga0163162_10000377 3300013306 Bacteria 40533
319 Ga0163162_10000644 3300013306 Bacteria 32326
320 Ga0163162_10001190 3300013306 Bacteria 24282
321 Ga0163162_10018529 3300013306 Bacteria 6822
322 Ga0163162_10029831 3300013306 Bacteria 5399
323 Ga0163162_10037650 3300013306 Bacteria 4828
324 Ga0163162_10042883 3300013306 Bacteria 4529
325 Ga0163162_10047851 3300013306 Bacteria 4284
326 Ga0163162_10127457 3300013306 Bacteria 2653
327 Ga0163162_10168586 3300013306 Bacteria 2314
328 Ga0163162_10192926 3300013306 Bacteria 2165
329 Ga0163162_10216519 3300013306 Bacteria 2045
330 Ga0163162_10369595 3300013306 Bacteria 1567
331 Ga0163162_10468065 3300013306 Bacteria 1392
332 Ga0163162_10911951 3300013306 Bacteria 991
333 Ga0157372_10005409 3300013307 Bacteria 13572
334 Ga0157372_10027042 3300013307 Bacteria 6245
335 Ga0157372_10071025 3300013307 Bacteria 3919
336 Ga0157372_10142018 3300013307 Bacteria 2767
337 Ga0157372_10228455 3300013307 Bacteria 2157
338 Ga0157372_10571440 3300013307 Bacteria 1318
339 Ga0157375_10000228 3300013308 Bacteria 52278
340 Ga0157375_10001328 3300013308 Bacteria 21305
341 Ga0157375_10003748 3300013308 Bacteria 13182
342 Ga0157375_10004745 3300013308 Bacteria 11813
343 Ga0157375_10008382 3300013308 Bacteria 9053
344 Ga0157375_10049408 3300013308 Bacteria 4121
345 Ga0157375_10065222 3300013308 Bacteria 3629
346 Ga0157375_10069925 3300013308 Bacteria 3518
347 Ga0157375_10084393 3300013308 Bacteria 3225
348 Ga0157375_10133517 3300013308 Bacteria 2604
349 Ga0157375_10175021 3300013308 Bacteria 2295
350 Ga0157375_10442892 3300013308 Bacteria 1465
351 Ga0157375_10518120 3300013308 Bacteria 1356
352 Ga0163163_10000712 3300014325 Bacteria 28219
353 Ga0163163_10000752 3300014325 Bacteria 27543
354 Ga0163163_10009781 3300014325 Bacteria 8590
355 Ga0163163_10031622 3300014325 Bacteria 5109
356 Ga0163163_10119820 3300014325 Bacteria 2665
357 Ga0163163_10486590 3300014325 Bacteria 1295
358 Ga0157380_10004225 3300014326 Bacteria 9934
359 Ga0157380_10189598 3300014326 Bacteria 1814
360 Ga0182008_10000016 3300014497 Bacteria 241246
361 Ga0182008_10001316 3300014497 Bacteria 16944
362 Ga0157377_10006267 3300014745 Bacteria 5662
363 Ga0157377_10046320 3300014745 Bacteria 2432
364 Ga0157377_10071414 3300014745 Bacteria 2007
365 Ga0157377_10089056 3300014745 Bacteria 1819
366 Ga0157379_10000440 3300014968 Bacteria 33697
367 Ga0157379_10028369 3300014968 Bacteria 4979
368 Ga0157379_10049041 3300014968 Bacteria 3770
369 Ga0157379_10051640 3300014968 Bacteria 3672
370 Ga0157379_10113893 3300014968 Bacteria 2431
371 Ga0157379_10195491 3300014968 Bacteria 1828
372 Ga0157376_10000381 3300014969 Bacteria 28821
373 Ga0157376_10001773 3300014969 Bacteria 14357
374 Ga0157376_10003377 3300014969 Bacteria 10986
375 Ga0157376_10031463 3300014969 Bacteria 4250
376 Ga0157376_10048370 3300014969 Bacteria 3516
377 Ga0157376_10103570 3300014969 Unclassified 2492
378 Ga0157376_10109093 3300014969 Unclassified 2433
379 Ga0157376_10122083 3300014969 Bacteria 2311
380 Ga0182006_1000079 3300015261 Bacteria 122553
381 Ga0182006_1001053 3300015261 Bacteria 17809
382 Ga0182006_1001108 3300015261 Bacteria 17182
383 Ga0182007_10000010 3300015262 Bacteria 286070
384 Ga0183373_1005 3300015682 Bacteria 351562
385 Ga0163161_10000206 3300017792 Bacteria 54119
386 Ga0163161_10000729 3300017792 Bacteria 25879
387 Ga0163161_10002605 3300017792 Bacteria 12857
388 Ga0163161_10005480 3300017792 Bacteria 8809
389 Ga0163161_10016285 3300017792 Bacteria 5189
390 Ga0163161_10018054 3300017792 Bacteria 4944
391 Ga0163161_10027223 3300017792 Bacteria 4055
392 Ga0163161_10043480 3300017792 Bacteria 3234
393 Ga0163161_10056639 3300017792 Bacteria 2847
394 Ga0163161_10071466 3300017792 Bacteria 2539
395 Ga0163161_10136713 3300017792 Bacteria 1853
396 Ga0163161_10304949 3300017792 Bacteria 1255
397 Ga0213876_10001384 3300021384 Bacteria 15141
398 Ga0207425_1000004 3300025245 Bacteria 1092421
399 Ga0209129_1000005 3300025258 Bacteria 777812
400 Ga0209675_1000159 3300025291 Bacteria 87316
401 Ga0209676_1000058 3300025292 Bacteria 345185
402 Ga0209025_1000009 3300025294 Bacteria 1092561
403 Ga0209758_1000010 3300025297 Bacteria 1092782
404 Ga0209050_1000054 3300025298 Bacteria 345186
405 Ga0207656_10000424 3300025321 Bacteria 14223
406 Ga0207656_10007438 3300025321 Bacteria 3988
407 Ga0207655_1000058 3300025728 Bacteria 267656
408 Ga0207682_10060158 3300025893 Bacteria 1588
409 Ga0207642_10056040 3300025899 Unclassified 1806
410 Ga0207642_10073459 3300025899 Bacteria 1636
411 Ga0207688_10017118 3300025901 Bacteria 3939
412 Ga0207680_10000031 3300025903 Bacteria 77871
413 Ga0207680_10001363 3300025903 Bacteria 11575
414 Ga0207680_10014750 3300025903 Bacteria 4057
415 Ga0207680_10056804 3300025903 Bacteria 2366
416 Ga0207647_10000045 3300025904 Bacteria 90413
417 Ga0207647_10064758 3300025904 Bacteria 2220
418 Ga0207645_10000949 3300025907 Bacteria 24072
419 Ga0207645_10012613 3300025907 Bacteria 5730
420 Ga0207645_10022921 3300025907 Bacteria 4057
421 Ga0207645_10098705 3300025907 Bacteria 1883
422 Ga0207645_10218429 3300025907 Unclassified 1256
423 Ga0207643_10020523 3300025908 Unclassified 3627
424 Ga0207643_10036648 3300025908 Bacteria 2751
425 Ga0207705_10023675 3300025909 Bacteria 4381
426 Ga0207705_10082373 3300025909 Unclassified 2346
427 Ga0207705_10331340 3300025909 Bacteria 1171
428 Ga0207654_10008187 3300025911 Bacteria 5272
429 Ga0207707_10108650 3300025912 Bacteria 2425
430 Ga0207671_10000981 3300025914 Bacteria 35291
431 Ga0207660_10075317 3300025917 Bacteria 2465
432 Ga0207662_10062623 3300025918 Bacteria 2236
433 Ga0207657_10027098 3300025919 Bacteria 5254
434 Ga0207657_10085559 3300025919 Unclassified 2641
435 Ga0207657_10089214 3300025919 Bacteria 2576
436 Ga0207649_10115826 3300025920 Bacteria 1799
437 Ga0207649_10268265 3300025920 Bacteria 1236
438 Ga0207652_10193262 3300025921 Bacteria 1830
439 Ga0207652_10221839 3300025921 Bacteria 1703
440 Ga0207681_10024459 3300025923 Bacteria 3877
441 Ga0207681_10039482 3300025923 Bacteria 3135
442 Ga0207650_10036624 3300025925 Bacteria 3570
443 Ga0207650_10038496 3300025925 Bacteria 3493
444 Ga0207650_10086550 3300025925 Bacteria 2386
445 Ga0207650_10370276 3300025925 Unclassified 1182
446 Ga0207659_10028881 3300025926 Bacteria 3773
447 Ga0207659_10075294 3300025926 Bacteria 2476
448 Ga0207659_10102255 3300025926 Bacteria 2163
449 Ga0207659_10161286 3300025926 Bacteria 1761
450 Ga0207659_10590876 3300025926 Unclassified 946
451 Ga0207644_10027242 3300025931 Bacteria 3948
452 Ga0207644_10028317 3300025931 Bacteria 3878
453 Ga0207690_10013214 3300025932 Bacteria 4957
454 Ga0207690_10018625 3300025932 Bacteria 4259
455 Ga0207690_10119886 3300025932 Bacteria 1909
456 Ga0207690_10227909 3300025932 Bacteria 1429
457 Ga0207690_10312143 3300025932 Bacteria 1233
458 Ga0207706_10002788 3300025933 Bacteria 16975
459 Ga0207706_10002868 3300025933 Bacteria 16715
460 Ga0207706_10011186 3300025933 Bacteria 8182
461 Ga0207706_10022975 3300025933 Bacteria 5600
462 Ga0207706_10070718 3300025933 Bacteria 3069
463 Ga0207706_10108753 3300025933 Unclassified 2440
464 Ga0207686_10001258 3300025934 Bacteria 14622
465 Ga0207686_10006783 3300025934 Bacteria 6168
466 Ga0207686_10068276 3300025934 Bacteria 2277
467 Ga0207709_10000136 3300025935 Bacteria 106728
468 Ga0207709_10548042 3300025935 Bacteria 909
469 Ga0207670_10011342 3300025936 Bacteria 5169
470 Ga0207670_10217576 3300025936 Unclassified 1460
471 Ga0207669_10187252 3300025937 Bacteria 1490
472 Ga0207704_10144453 3300025938 Bacteria 1669
473 Ga0207704_10399812 3300025938 Bacteria 1084
474 Ga0207691_10000037 3300025940 Bacteria 108385
475 Ga0207691_10026608 3300025940 Bacteria 5428
476 Ga0207691_10028848 3300025940 Bacteria 5193
477 Ga0207691_10045817 3300025940 Bacteria 4020
478 Ga0207691_10150951 3300025940 Bacteria 2043
479 Ga0207711_10018774 3300025941 Bacteria 5750
480 Ga0207711_10255548 3300025941 Bacteria 1610
481 Ga0207689_10002661 3300025942 Bacteria 16517
482 Ga0207689_10004266 3300025942 Bacteria 13005
483 Ga0207689_10009367 3300025942 Bacteria 8462
484 Ga0207689_10014782 3300025942 Bacteria 6627
485 Ga0207689_10031238 3300025942 Unclassified 4436
486 Ga0207689_10039483 3300025942 Bacteria 3907
487 Ga0207689_10129456 3300025942 Bacteria 2077
488 Ga0207689_10507142 3300025942 Bacteria 1011
489 Ga0207661_10014437 3300025944 Bacteria 5790
490 Ga0207661_10109119 3300025944 Bacteria 2337
491 Ga0207661_10223850 3300025944 Unclassified 1664
492 Ga0207661_10515098 3300025944 Bacteria 1094
493 Ga0207679_10000462 3300025945 Bacteria 28637
494 Ga0207679_10013882 3300025945 Bacteria 5281
495 Ga0207679_10041221 3300025945 Bacteria 3309
496 Ga0207679_10051359 3300025945 Bacteria 3018
497 Ga0207679_10057339 3300025945 Bacteria 2880
498 Ga0207679_10161812 3300025945 Bacteria 1833
499 Ga0207679_10259786 3300025945 Bacteria 1481
500 Ga0207667_10045413 3300025949 Bacteria 4653
501 Ga0207667_10238556 3300025949 Bacteria 1861
502 Ga0207651_10000443 3300025960 Bacteria 17529
503 Ga0207651_10005935 3300025960 Bacteria 6325
504 Ga0207651_10077324 3300025960 Unclassified 2382
505 Ga0207651_10093422 3300025960 Bacteria 2209
506 Ga0207651_10117000 3300025960 Bacteria 2013
507 Ga0207651_10543021 3300025960 Bacteria 1010
508 Ga0207712_10004607 3300025961 Bacteria 8711
509 Ga0207712_10005091 3300025961 Bacteria 8312
510 Ga0207712_10025168 3300025961 Bacteria 3952
511 Ga0207712_10093866 3300025961 Bacteria 2215
512 Ga0207712_10096509 3300025961 Bacteria 2188
513 Ga0207712_10114190 3300025961 Bacteria 2031
514 Ga0207668_10001307 3300025972 Bacteria 14792
515 Ga0207668_10010481 3300025972 Bacteria 5601
516 Ga0207668_10081464 3300025972 Bacteria 2348
517 Ga0207668_10083349 3300025972 Bacteria 2326
518 Ga0207668_10223360 3300025972 Bacteria 1514
519 Ga0207640_10012183 3300025981 Bacteria 4892
520 Ga0207640_10048817 3300025981 Bacteria 2738
521 Ga0207640_10063567 3300025981 Bacteria 2453
522 Ga0207658_10000629 3300025986 Bacteria 31155
523 Ga0207658_10043522 3300025986 Bacteria 3264
524 Ga0207658_10091991 3300025986 Unclassified 2355
525 Ga0207658_10105837 3300025986 Bacteria 2213
526 Ga0207658_10396142 3300025986 Bacteria 1213
527 Ga0207677_10005907 3300026023 Bacteria 6662
528 Ga0207677_10033369 3300026023 Bacteria 3321
529 Ga0207677_10085822 3300026023 Unclassified 2273
530 Ga0207677_10119795 3300026023 Bacteria 1977
531 Ga0207677_10164327 3300026023 Bacteria 1728
532 Ga0207677_10391670 3300026023 Bacteria 1176
533 Ga0207703_10004145 3300026035 Bacteria 11957
534 Ga0207703_10009241 3300026035 Bacteria 7751
535 Ga0207703_10122825 3300026035 Bacteria 2231
536 Ga0207703_10128071 3300026035 Bacteria 2188
537 Ga0207703_10209649 3300026035 Bacteria 1736
538 Ga0207703_10332514 3300026035 Bacteria 1394
539 Ga0207639_10016412 3300026041 Bacteria 5239
540 Ga0207639_10045458 3300026041 Bacteria 3307
541 Ga0207639_10380015 3300026041 Bacteria 1268
542 Ga0207678_10419337 3300026067 Bacteria 1160
543 Ga0207708_10073106 3300026075 Unclassified 2628
544 Ga0207702_10137748 3300026078 Bacteria 2204
545 Ga0207641_10000048 3300026088 Bacteria 178206
546 Ga0207641_10000253 3300026088 Bacteria 67848
547 Ga0207641_10092372 3300026088 Bacteria 2650
548 Ga0207641_10263783 3300026088 Bacteria 1614
549 Ga0207641_10295421 3300026088 Bacteria 1528
550 Ga0207641_10368936 3300026088 Bacteria 1372
551 Ga0207641_10657973 3300026088 Bacteria 1029
552 Ga0207648_10001276 3300026089 Bacteria 28144
553 Ga0207648_10002983 3300026089 Bacteria 17886
554 Ga0207648_10006182 3300026089 Bacteria 11925
555 Ga0207648_10009426 3300026089 Bacteria 9354
556 Ga0207648_10014222 3300026089 Bacteria 7360
557 Ga0207648_10029826 3300026089 Bacteria 4837
558 Ga0207648_10046709 3300026089 Bacteria 3796
559 Ga0207648_10047918 3300026089 Bacteria 3744
560 Ga0207648_10063228 3300026089 Bacteria 3226
561 Ga0207648_10123232 3300026089 Bacteria 2279
562 Ga0207648_10469249 3300026089 Bacteria 1148
563 Ga0207676_10002535 3300026095 Bacteria 13033
564 Ga0207676_10013593 3300026095 Bacteria 5842
565 Ga0207676_10023708 3300026095 Bacteria 4533
566 Ga0207676_10140043 3300026095 Bacteria 2070
567 Ga0207676_10271657 3300026095 Bacteria 1535
568 Ga0207674_10010902 3300026116 Bacteria 10234
569 Ga0207674_10011266 3300026116 Bacteria 10051
570 Ga0207674_10020174 3300026116 Bacteria 7208
571 Ga0207674_10122461 3300026116 Bacteria 2567
572 Ga0207674_10142993 3300026116 Bacteria 2352
573 Ga0207675_100000304 3300026118 Bacteria 47181
574 Ga0207675_100023895 3300026118 Bacteria 5685
575 Ga0207675_100034036 3300026118 Bacteria 4748
576 Ga0207675_100077897 3300026118 Bacteria 3106
577 Ga0207675_100297918 3300026118 Viruses 1570
578 Ga0207675_100647957 3300026118 Viruses 1062
579 Ga0207683_10004127 3300026121 Bacteria 12564
580 Ga0207683_10010066 3300026121 Bacteria 8066
581 Ga0207698_10004963 3300026142 Bacteria 8157
582 Ga0207698_10038652 3300026142 Bacteria 3528
583 Ga0207698_10066040 3300026142 Bacteria 2846
584 Ga0207698_10284271 3300026142 Bacteria 1532
585 Ga0268266_10004818 3300028379 Bacteria 12818
586 Ga0268265_10486649 3300028380 Unclassified 1160
587 Ga0268264_10001271 3300028381 Bacteria 23942
588 Ga0268264_10008067 3300028381 Bacteria 8759
589 Ga0307515_10000001 3300028794 Bacteria 4259510
590 Ga0307515_10000076 3300028794 Bacteria 228736
591 Ga0265327_10000051 3300031251 Bacteria 257963
592 Ga0265327_10000192 3300031251 Bacteria 129439
593 Ga0307513_10084237 3300031456 Bacteria 3266
594 Ga0307509_10025206 3300031507 Bacteria 6645
595 Ga0307509_10053235 3300031507 Bacteria 4317
596 Ga0307405_10000035 3300031731 Bacteria 92134
597 Ga0307407_10000005 3300031903 Bacteria 233125
598 Ga0307412_10000640 3300031911 Bacteria 20375
599 Ga0307412_10001858 3300031911 Bacteria 11683
600 Ga0307412_10002518 3300031911 Bacteria 10189
601 Ga0307409_100015519 3300031995 Bacteria 5003
602 Ga0307416_100000001 3300032002 Bacteria 515017
603 Ga0307416_100000020 3300032002 Bacteria 192862
604 Ga0307414_10000041 3300032004 Bacteria 144783
605 Ga0307414_10067446 3300032004 Bacteria 2563
606 Ga0307414_10079185 3300032004 Unclassified 2398
607 Ga0307414_10099280 3300032004 Bacteria 2187
608 Ga0373944_0076323 3300035089 Bacteria 1100
609 Ga0373954_0165959 3300035118 Bacteria 1081
610 Ga0373943_0116184 3300035170 Bacteria 1417
611 Ga0373955_0112840 3300035172 Unclassified 1573
612 Ga0373924_0139268 3300035410 Bacteria 1058
613 Ga0395905_0002094 3300037471 Bacteria 22677
614 Ga0395905_0048344 3300037471 Bacteria 3987
615 Ga0395905_0481311 3300037471 Bacteria 1141
616 Ga0400483_199042 3300039062 Bacteria 39689
617 Ga0400483_249684 3300039062 Bacteria 1494
618 Ga0400489_32343 3300039093 Bacteria 2468
619 Ga0436365_0502188 3300039437 Bacteria 16571
620 Ga0439465_0000489 3300041413 Bacteria 11781
621 Ga0439442_033746 3300042002 Bacteria 1070
622 Ga0439445_0000605 3300042004 Bacteria 7352
623 Ga0439445_0048892 3300042004 Unclassified 1138
624 Ga0450903_024675 3300042138 Bacteria 922
625 Ga0451577_0000599 3300042876 Bacteria 57951
626 Ga0451577_0114052 3300042876 Bacteria 2419
627 Ga0466972_0115267 3300044658 Bacteria 1269
628 Ga0453683_0000311 3300044673 Bacteria 61262
629 Ga0453683_0016047 3300044673 Bacteria 4839
630 Ga0453683_0082057 3300044673 Bacteria 2020
631 Ga0453683_0210088 3300044673 Bacteria 1236
632 Ga0466966_0009648 3300044684 Bacteria 6388
633 Ga0453684_0001039 3300044712 Bacteria 88840
634 Ga0453684_0050317 3300044712 Bacteria 5484
635 Ga0451576_0001077 3300045051 Bacteria 50060
636 Ga0451576_0018027 3300045051 Bacteria 7746
637 Ga0495627_000029 3300046453 Bacteria 232349
638 Ga0495627_007357 3300046453 Bacteria 4226
639 Ga0495592_0041234 3300046454 Bacteria 3460
640 Ga0495638_0055927 3300046460 Bacteria 2449
641 Ga0495638_0114161 3300046460 Bacteria 1602
642 Ga0495580_0324771 3300046472 Unclassified 1046
643 Ga0495596_0011828 3300046500 Bacteria 3747
644 Ga0495606_0003913 3300046507 Bacteria 15321
645 Ga0495610_0000001 3300046512 Bacteria 1620061
646 Ga0495610_0000405 3300046512 Bacteria 44184
647 Ga0495610_0000441 3300046512 Bacteria 42808
648 Ga0495632_0006192 3300046519 Bacteria 7746
649 Ga0495663_0000243 3300046525 Bacteria 21677
650 Ga0495663_0003226 3300046525 Bacteria 4743
651 Ga0495652_0324197 3300046529 Bacteria 1112
652 Ga0495654_0000008 3300046530 Bacteria 398340
653 Ga0495586_0073546 3300046535 Bacteria 1870
654 Ga0495587_0023999 3300046536 Bacteria 3743
655 Ga0495587_0174795 3300046536 Bacteria 1219
656 Ga0495609_0000010 3300046538 Bacteria 342605
657 Ga0495621_0077088 3300046539 Bacteria 1237
658 Ga0495645_0221546 3300046543 Bacteria 1272
659 Ga0495633_0000163 3300046558 Bacteria 87285
660 Ga0495633_0003132 3300046558 Bacteria 11208
661 Ga0495633_0030156 3300046558 Bacteria 2636
662 Ga0495668_0000878 3300046616 Bacteria 33873
663 Ga0495668_0002497 3300046616 Bacteria 15047
664 Ga0495635_0098756 3300046663 Bacteria 1996
665 Ga0495661_0001581 3300046665 Bacteria 18761
666 Ga0495657_0064417 3300046675 Bacteria 2415
667 Ga0495658_0148905 3300046683 Bacteria 1436
668 Ga0495604_0246748 3300047317 Bacteria 1219
669 Ga0495672_0014449 3300047320 Bacteria 5407
670 Ga0495676_0085516 3300047321 Unclassified 2376
671 Ga0495684_0114416 3300047471 Bacteria 2034
672 Ga0495686_0000153 3300047472 Bacteria 133256
673 Ga0495686_0008687 3300047472 Bacteria 7416
674 Ga0495686_0009346 3300047472 Bacteria 7069
675 Ga0496100_0079254 3300048903 Bacteria 2213
676 Ga0496102_0008085 3300048905 Bacteria 8999
677 Ga0496110_0032664 3300048913 Bacteria 4498
678 Ga0496116_0000037 3300048919 Bacteria 374675
679 Ga0496117_0000086 3300048920 Bacteria 212331
680 Ga0496118_0000284 3300048921 Bacteria 88966
681 Ga0496118_0040654 3300048921 Bacteria 3694
682 Ga0496119_0000037 3300048922 Bacteria 210912
683 Ga0496122_0000389 3300048925 Bacteria 93538
684 Ga0496122_0000489 3300048925 Bacteria 82241
685 Ga0496122_0004673 3300048925 Bacteria 16820
686 Ga0496122_0013915 3300048925 Bacteria 7825
687 Ga0496122_0019795 3300048925 Bacteria 6129
688 Ga0496123_0000739 3300048926 Bacteria 52947
689 Ga0496123_0050450 3300048926 Bacteria 2780
690 Ga0496124_0006053 3300048927 Bacteria 13321
691 Ga0496125_0000685 3300048928 Bacteria 56407
692 Ga0496125_0009248 3300048928 Bacteria 10176
693 Ga0496125_0011751 3300048928 Bacteria 8727
694 Ga0496126_0002873 3300048929 Bacteria 22479
695 Ga0501034_0000225 3300049571 Bacteria 107163
696 Ga0501034_0039704 3300049571 Bacteria 4767
697 Ga0501034_0442694 3300049571 Unclassified 1218
698 Ga0501036_0006194 3300049572 Bacteria 9707
699 Ga0501036_0008882 3300049572 Bacteria 8253
700 Ga0501037_0100092 3300049573 Bacteria 2093
701 Ga0501037_0151126 3300049573 Bacteria 1659
702 Ga0501038_0050525 3300049574 Bacteria 3592
703 Ga0501039_0010851 3300049575 Bacteria 6942
704 Ga0501043_0008369 3300049579 Bacteria 8144
705 Ga0501043_0016758 3300049579 Bacteria 5742
706 Ga0501046_0005502 3300049580 Bacteria 11314
707 Ga0501046_0111537 3300049580 Bacteria 2089
708 Ga0501047_0258657 3300049581 Bacteria 1589
709 Ga0501067_0103081 3300049583 Bacteria 1585
710 Ga0501070_0157057 3300049586 Unclassified 1876
711 Ga0501073_0010728 3300049589 Bacteria 6709
712 Ga0501074_0003026 3300049590 Bacteria 11842
713 Ga0501235_024453 3300049669 Unclassified 1349
714 Ga0501242_004828 3300049674 Unclassified 1504
715 Ga0501251_009533 3300049681 Unclassified 1121
716 Ga0501257_041941 3300049686 Bacteria 1125
717 Ga0501259_005848 3300049688 Bacteria 1951
718 Ga0501225_0033622 3300049705 Unclassified 1411
719 Ga0501245_004916 3300049708 Unclassified 1844
720 Ga0501079_0054375 3300049741 Bacteria 3088
721 Ga0501080_0021495 3300049742 Bacteria 5971
722 Ga0501083_0011009 3300049744 Bacteria 6357
723 Ga0501241_000009 3300049758 Bacteria 128695
724 Ga0501266_008295 3300049763 Unclassified 1307
725 Ga0501269_000196 3300049766 Bacteria 18180
726 Ga0501035_0122673 3300049822 Bacteria 2270
727 Ga0501035_0175310 3300049822 Bacteria 1850
728 Ga0501035_0370589 3300049822 Bacteria 1195
729 Ga0501044_0056273 3300049823 Bacteria 4038
730 Ga0501044_0105161 3300049823 Bacteria 2836
731 Ga0501044_0119141 3300049823 Bacteria 2642
732 Ga0501044_0547834 3300049823 Unclassified 1054
733 nmdc:mga0k408_216379_c1 3300050493 Bacteria 1144
734 nmdc:mga0k408_25445_c2 3300050493 Bacteria 1797
735 nmdc:mga0k408_6569_c1 3300050493 Bacteria 6195
736 nmdc:mga09592_67026_c1 3300050508 Bacteria 3044
737 nmdc:mga08y16_118242_c1 3300050511 Bacteria 2758
738 nmdc:mga0n895_624793_c1 3300050512 Bacteria 1078
739 Ga0500641_0012237 3300053096 Bacteria 3130
740 Ga0500588_0000578 3300053146 Bacteria 5997
741 Ga0500616_0019994 3300053153 Unclassified 3765
742 Ga0500611_000022 3300053727 Bacteria 102349

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100322227 Ga0068863_1003222272 233
2 3300009101 Ga0105247_10279429 Ga0105247_102794292 236
3 3300025926 Ga0207659_10590876 Ga0207659_105908762 236
4 3300042138 Ga0450903_024675 Ga0450903_024675_43_810 237
5 3300013297 Ga0157378_10047281 Ga0157378_100472813 248
6 3300017792 Ga0163161_10136713 Ga0163161_101367131 249
7 3300049571 Ga0501034_0000225 Ga0501034_0000225_9734_10636 252
8 3300005288 Ga0065714_10069763 Ga0065714_100697634 253
9 3300031911 Ga0307412_10001858 Ga0307412_100018583 253
10 3300049758 Ga0501241_000009 Ga0501241_000009_2258_3136 253
11 3300046500 Ga0495596_0011828 Ga0495596_0011828_2331_3209 255
12 3300050493 nmdc:mga0k408_6569_c1 nmdc:mga0k408_6569_c1_842_1744 255
13 3300006195 Ga0075366_10054467 Ga0075366_100544672 256
14 3300013104 Ga0157370_10073252 Ga0157370_100732523 256
15 3300013308 Ga0157375_10069925 Ga0157375_100699252 256
16 3300017792 Ga0163161_10005480 Ga0163161_100054804 256
17 3300025972 Ga0207668_10083349 Ga0207668_100833492 256
18 3300046538 Ga0495609_0000010 Ga0495609_0000010_3202_4080 256
19 3300001915 JGI24741J21665_1004867 JGI24741J21665_10048672 257
20 3300005289 Ga0065704_10071464 Ga0065704_100714643 257
21 3300005337 Ga0070682_100008776 Ga0070682_1000087763 257
22 3300048905 Ga0496102_0008085 Ga0496102_0008085_2621_3499 257
23 3300048919 Ga0496116_0000037 Ga0496116_0000037_2294_3172 257
24 3300048920 Ga0496117_0000086 Ga0496117_0000086_2775_3653 257
25 3300048921 Ga0496118_0000284 Ga0496118_0000284_85315_86193 257
26 3300048922 Ga0496119_0000037 Ga0496119_0000037_2831_3709 257
27 3300048925 Ga0496122_0013915 Ga0496122_0013915_2831_3709 257
28 3300048926 Ga0496123_0000739 Ga0496123_0000739_2831_3709 257
29 3300048927 Ga0496124_0006053 Ga0496124_0006053_10178_11056 257
30 3300048928 Ga0496125_0011751 Ga0496125_0011751_2803_3681 257
31 3300005535 Ga0070684_100000979 Ga0070684_1000009793 258
32 3300014968 Ga0157379_10051640 Ga0157379_100516402 258
33 3300003323 rootH1_10215749 rootH1_102157492 260
34 3300039062 Ga0400483_199042 Ga0400483_199042_27690_28571 261
35 3300048921 Ga0496118_0040654 Ga0496118_0040654_1549_2391 261
36 3300017792 Ga0163161_10043480 Ga0163161_100434802 262
37 3300005617 Ga0068859_100001754 Ga0068859_10000175410 263
38 3300006931 Ga0097620_100001754 Ga0097620_1000017548 263
39 3300013308 Ga0157375_10049408 Ga0157375_100494084 263
40 3300031251 Ga0265327_10000192 Ga0265327_100001922 263
41 3300039062 Ga0400483_249684 Ga0400483_249684_184_1068 263
42 3300050512 nmdc:mga0n895_624793_c1 nmdc:mga0n895_624793_c1_106_1005 263
43 3300003323 rootH1_10162953 rootH1_101629532 264
44 3300005327 Ga0070658_10169290 Ga0070658_101692902 264
45 3300009036 Ga0105244_10000018 Ga0105244_100000184 264
46 3300013104 Ga0157370_10013588 Ga0157370_100135881 264
47 3300013105 Ga0157369_10102782 Ga0157369_101027822 264
48 3300025728 Ga0207655_1000058 Ga0207655_1000058262 264
49 3300009553 Ga0105249_10028082 Ga0105249_100280824 265
50 3300025961 Ga0207712_10025168 Ga0207712_100251682 265
51 3300044673 Ga0453683_0210088 Ga0453683_0210088_253_1125 265
52 3300044712 Ga0453684_0050317 Ga0453684_0050317_1059_1931 265
53 3300005327 Ga0070658_10323119 Ga0070658_103231192 266
54 3300005366 Ga0070659_100113125 Ga0070659_1001131252 266
55 3300005530 Ga0070679_100015863 Ga0070679_1000158632 266
56 3300013100 Ga0157373_10033227 Ga0157373_100332272 266
57 3300025912 Ga0207707_10108650 Ga0207707_101086502 266
58 3300025917 Ga0207660_10075317 Ga0207660_100753172 266
59 3300025921 Ga0207652_10221839 Ga0207652_102218392 266
60 3300025932 Ga0207690_10018625 Ga0207690_100186257 266
61 3300025949 Ga0207667_10045413 Ga0207667_100454137 266
62 3300028794 Ga0307515_10000076 Ga0307515_10000076107 266
63 3300048929 Ga0496126_0002873 Ga0496126_0002873_18399_19277 266
64 3300044684 Ga0466966_0009648 Ga0466966_0009648_2882_3784 267
65 3300005327 Ga0070658_10020168 Ga0070658_100201682 268
66 3300005329 Ga0070683_100013965 Ga0070683_1000139656 268
67 3300005335 Ga0070666_10057807 Ga0070666_100578072 268
68 3300005336 Ga0070680_100029249 Ga0070680_1000292492 268
69 3300005337 Ga0070682_100010074 Ga0070682_1000100744 268
70 3300005339 Ga0070660_100017556 Ga0070660_1000175562 268
71 3300005344 Ga0070661_100083927 Ga0070661_1000839272 268
72 3300005366 Ga0070659_100001692 Ga0070659_10000169211 268
73 3300005457 Ga0070662_100002983 Ga0070662_10000298311 268
74 3300005530 Ga0070679_100026151 Ga0070679_1000261515 268
75 3300005535 Ga0070684_100002647 Ga0070684_1000026473 268
76 3300005539 Ga0068853_100007967 Ga0068853_1000079674 268
77 3300005563 Ga0068855_100018669 Ga0068855_1000186693 268
78 3300005564 Ga0070664_100058013 Ga0070664_1000580132 268
79 3300005578 Ga0068854_100120409 Ga0068854_1001204092 268
80 3300005614 Ga0068856_100003735 Ga0068856_10000373511 268
81 3300005616 Ga0068852_100039630 Ga0068852_1000396302 268
82 3300005834 Ga0068851_10008331 Ga0068851_100083316 268
83 3300006237 Ga0097621_100031558 Ga0097621_1000315583 268
84 3300009553 Ga0105249_10055217 Ga0105249_100552172 268
85 3300013100 Ga0157373_10122911 Ga0157373_101229111 268
86 3300013102 Ga0157371_10215458 Ga0157371_102154582 268
87 3300013105 Ga0157369_10313553 Ga0157369_103135532 268
88 3300013296 Ga0157374_10003428 Ga0157374_1000342812 268
89 3300013297 Ga0157378_10013496 Ga0157378_100134961 268
90 3300013306 Ga0163162_10018529 Ga0163162_100185292 268
91 3300013306 Ga0163162_10216519 Ga0163162_102165191 268
92 3300014745 Ga0157377_10071414 Ga0157377_100714142 268
93 3300014968 Ga0157379_10195491 Ga0157379_101954912 268
94 3300014969 Ga0157376_10109093 Ga0157376_101090932 268
95 3300017792 Ga0163161_10016285 Ga0163161_100162852 268
96 3300025321 Ga0207656_10007438 Ga0207656_100074381 268
97 3300025903 Ga0207680_10056804 Ga0207680_100568042 268
98 3300025904 Ga0207647_10064758 Ga0207647_100647582 268
99 3300025919 Ga0207657_10027098 Ga0207657_100270984 268
100 3300025921 Ga0207652_10193262 Ga0207652_101932622 268
101 3300025932 Ga0207690_10119886 Ga0207690_101198862 268
102 3300025933 Ga0207706_10002788 Ga0207706_100027889 268
103 3300025944 Ga0207661_10109119 Ga0207661_101091193 268
104 3300025945 Ga0207679_10161812 Ga0207679_101618122 268
105 3300025949 Ga0207667_10238556 Ga0207667_102385562 268
106 3300025981 Ga0207640_10012183 Ga0207640_100121832 268
107 3300026023 Ga0207677_10164327 Ga0207677_101643271 268
108 3300026041 Ga0207639_10045458 Ga0207639_100454582 268
109 3300026078 Ga0207702_10137748 Ga0207702_101377482 268
110 3300005347 Ga0070668_100022201 Ga0070668_1000222014 269
111 3300005539 Ga0068853_100423920 Ga0068853_1004239201 269
112 3300009148 Ga0105243_10000089 Ga0105243_1000008992 269
113 3300013307 Ga0157372_10005409 Ga0157372_1000540911 269
114 3300025935 Ga0207709_10000136 Ga0207709_1000013696 269
115 3300025972 Ga0207668_10223360 Ga0207668_102233602 269
116 3300048925 Ga0496122_0000389 Ga0496122_0000389_89268_90146 269
117 iso_pu_bacteria 2511231000 2511234417 269
118 iso_pu_bacteria 2582581281 2585159918 269
119 iso_pu_bacteria 2582581282 2585164133 269
120 iso_pu_bacteria 2739367663 2739644319 269
121 iso_pu_bacteria 2751185877 2753675035 269
122 3300005366 Ga0070659_100000828 Ga0070659_1000008286 270
123 3300005616 Ga0068852_100051678 Ga0068852_1000516782 270
124 3300026088 Ga0207641_10657973 Ga0207641_106579731 270
125 3300026142 Ga0207698_10038652 Ga0207698_100386522 270
126 iso_pu_bacteria 2582581278 2585142356 270
127 iso_pu_bacteria 2582581873 2585426726 270
128 iso_pu_bacteria 2585428045 2587680712 270
129 iso_pu_bacteria 2585428061 2587752732 270
130 iso_pu_bacteria 2585428095 2587868559 270
131 iso_pu_bacteria 2585428115 2587942598 270
132 iso_pu_bacteria 2585428182 2588211835 270
133 iso_pu_bacteria 2585428183 2588216498 270
134 iso_pu_bacteria 2585428184 2588217694 270
135 iso_pu_bacteria 2585428185 2588225868 270
136 iso_pu_bacteria 2585428187 2588230932 270
137 iso_pu_bacteria 2588254255 2590603690 270
138 iso_pu_bacteria 2739367874 2740060635 270
139 iso_pu_bacteria 2765235839 2765575902 270
140 iso_pu_bacteria 2772190705 2772606622 270
141 iso_pu_bacteria 2775506739 2775674141 270
142 iso_pu_bacteria 2816332188 2816875610 270
143 iso_pu_bacteria 2842083920 2842087775 270
144 iso_pu_bacteria 2889290771 2889293606 270
145 iso_pu_bacteria 2905999023 2906002840 270
146 iso_pu_bacteria 2919097161 2919099902 270
147 iso_pu_bacteria 2945924605 2945928719 270
148 iso_pu_bacteria 2977243572 2977247571 270
149 iso_pu_bacteria 2993372514 2993374895 270
150 iso_pu_bacteria 2993480792 2993481750 270
151 3300013307 Ga0157372_10142018 Ga0157372_101420182 271
152 3300039093 Ga0400489_32343 Ga0400489_32343_765_1658 271
153 3300046665 Ga0495661_0001581 Ga0495661_0001581_1675_2580 271
154 iso_pu_bacteria 2585427687 2586208502 271
155 iso_pu_bacteria 2738541302 2738856650 271
156 iso_pu_bacteria 2739367651 2739590121 271
157 iso_pu_bacteria 2739367656 2739615351 271
158 iso_pu_bacteria 2818991437 2819548494 271
159 iso_pu_bacteria 2842722452 2842722933 271
160 iso_pu_bacteria 2842909656 2842913325 271
161 iso_pu_bacteria 2849281842 2849286651 271
162 iso_pu_bacteria 2857627736 2857631188 271
163 iso_pu_bacteria 2904445276 2904448500 271
164 iso_pu_bacteria 2919509842 2919512770 271
165 iso_pu_bacteria 2945997725 2945999895 271
166 iso_pu_bacteria 2954016120 2954016509 271
167 iso_pu_bacteria 2984572630 2984574640 271
168 iso_pu_bacteria 2984606641 2984608091 271
169 3300002773 JGI25152J39213_1000228 JGI25152J39213_10002283 272
170 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002192 272
171 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003466 272
172 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003298 272
173 3300003781 Ga0055536_1000007 Ga0055536_100000726 272
174 3300003791 Ga0055530_10010824 Ga0055530_100108244 272
175 3300005288 Ga0065714_10067637 Ga0065714_100676373 272
176 3300005327 Ga0070658_10005453 Ga0070658_100054538 272
177 3300005334 Ga0068869_100109898 Ga0068869_1001098982 272
178 3300005335 Ga0070666_10000885 Ga0070666_100008857 272
179 3300005338 Ga0068868_100000075 Ga0068868_10000007512 272
180 3300005347 Ga0070668_100000859 Ga0070668_10000085911 272
181 3300005364 Ga0070673_100000448 Ga0070673_1000004489 272
182 3300005367 Ga0070667_100000482 Ga0070667_10000048229 272
183 3300005455 Ga0070663_100042799 Ga0070663_1000427991 272
184 3300005457 Ga0070662_100029479 Ga0070662_1000294793 272
185 3300005543 Ga0070672_100000361 Ga0070672_10000036122 272
186 3300005548 Ga0070665_100002163 Ga0070665_1000021639 272
187 3300005617 Ga0068859_100075852 Ga0068859_1000758522 272
188 3300005618 Ga0068864_100000785 Ga0068864_1000007854 272
189 3300005834 Ga0068851_10001706 Ga0068851_100017068 272
190 3300005841 Ga0068863_100017853 Ga0068863_1000178534 272
191 3300005842 Ga0068858_100001413 Ga0068858_10000141320 272
192 3300005843 Ga0068860_100002836 Ga0068860_10000283613 272
193 3300006237 Ga0097621_100004135 Ga0097621_1000041356 272
194 3300006237 Ga0097621_100122957 Ga0097621_1001229572 272
195 3300006358 Ga0068871_100000981 Ga0068871_1000009814 272
196 3300006358 Ga0068871_100005200 Ga0068871_1000052009 272
197 3300006931 Ga0097620_100075852 Ga0097620_1000758524 272
198 3300009098 Ga0105245_10108552 Ga0105245_101085522 272
199 3300009174 Ga0105241_10353892 Ga0105241_103538922 272
200 3300009176 Ga0105242_10111690 Ga0105242_101116903 272
201 3300009545 Ga0105237_10077957 Ga0105237_100779573 272
202 3300009553 Ga0105249_10003402 Ga0105249_1000340211 272
203 3300010375 Ga0105239_10042858 Ga0105239_100428582 272
204 3300013102 Ga0157371_10000901 Ga0157371_1000090119 272
205 3300013104 Ga0157370_10005003 Ga0157370_100050039 272
206 3300013104 Ga0157370_10042698 Ga0157370_100426981 272
207 3300013105 Ga0157369_10000015 Ga0157369_1000001514 272
208 3300013105 Ga0157369_10212800 Ga0157369_102128002 272
209 3300013296 Ga0157374_10002589 Ga0157374_100025899 272
210 3300013297 Ga0157378_10114878 Ga0157378_101148783 272
211 3300013297 Ga0157378_10124762 Ga0157378_101247622 272
212 3300013297 Ga0157378_10250143 Ga0157378_102501433 272
213 3300013306 Ga0163162_10000377 Ga0163162_100003779 272
214 3300013306 Ga0163162_10000644 Ga0163162_100006445 272
215 3300013307 Ga0157372_10228455 Ga0157372_102284552 272
216 3300013308 Ga0157375_10004745 Ga0157375_1000474510 272
217 3300013308 Ga0157375_10518120 Ga0157375_105181201 272
218 3300014325 Ga0163163_10000752 Ga0163163_1000075213 272
219 3300014497 Ga0182008_10001316 Ga0182008_1000131614 272
220 3300014968 Ga0157379_10000440 Ga0157379_100004408 272
221 3300014969 Ga0157376_10000381 Ga0157376_100003819 272
222 3300014969 Ga0157376_10003377 Ga0157376_100033774 272
223 3300014969 Ga0157376_10048370 Ga0157376_100483703 272
224 3300015261 Ga0182006_1001053 Ga0182006_100105315 272
225 3300015261 Ga0182006_1001108 Ga0182006_100110816 272
226 3300015262 Ga0182007_10000010 Ga0182007_10000010201 272
227 3300015682 Ga0183373_1005 Ga0183373_1005217 272
228 3300017792 Ga0163161_10000206 Ga0163161_1000020624 272
229 3300017792 Ga0163161_10000729 Ga0163161_100007299 272
230 3300017792 Ga0163161_10018054 Ga0163161_100180543 272
231 3300017792 Ga0163161_10071466 Ga0163161_100714663 272
232 3300025245 Ga0207425_1000004 Ga0207425_1000004751 272
233 3300025258 Ga0209129_1000005 Ga0209129_1000005191 272
234 3300025292 Ga0209676_1000058 Ga0209676_100005825 272
235 3300025294 Ga0209025_1000009 Ga0209025_1000009751 272
236 3300025297 Ga0209758_1000010 Ga0209758_1000010752 272
237 3300025298 Ga0209050_1000054 Ga0209050_100005425 272
238 3300025321 Ga0207656_10000424 Ga0207656_100004248 272
239 3300025903 Ga0207680_10001363 Ga0207680_1000136310 272
240 3300025907 Ga0207645_10000949 Ga0207645_1000094914 272
241 3300025909 Ga0207705_10023675 Ga0207705_100236754 272
242 3300025933 Ga0207706_10011186 Ga0207706_100111867 272
243 3300025934 Ga0207686_10068276 Ga0207686_100682763 272
244 3300025940 Ga0207691_10000037 Ga0207691_1000003784 272
245 3300025960 Ga0207651_10000443 Ga0207651_100004435 272
246 3300025961 Ga0207712_10114190 Ga0207712_101141903 272
247 3300025972 Ga0207668_10001307 Ga0207668_100013075 272
248 3300025986 Ga0207658_10000629 Ga0207658_1000062910 272
249 3300026023 Ga0207677_10005907 Ga0207677_100059077 272
250 3300026035 Ga0207703_10004145 Ga0207703_1000414510 272
251 3300026088 Ga0207641_10092372 Ga0207641_100923722 272
252 3300026095 Ga0207676_10002535 Ga0207676_1000253510 272
253 3300026142 Ga0207698_10066040 Ga0207698_100660403 272
254 3300028379 Ga0268266_10004818 Ga0268266_100048189 272
255 3300031731 Ga0307405_10000035 Ga0307405_1000003524 272
256 3300031903 Ga0307407_10000005 Ga0307407_1000000545 272
257 3300031995 Ga0307409_100015519 Ga0307409_1000155193 272
258 3300032002 Ga0307416_100000001 Ga0307416_100000001403 272
259 3300032004 Ga0307414_10067446 Ga0307414_100674462 272
260 3300042876 Ga0451577_0000599 Ga0451577_0000599_34171_35076 272
261 3300044712 Ga0453684_0001039 Ga0453684_0001039_65396_66301 272
262 3300045051 Ga0451576_0001077 Ga0451576_0001077_14985_15890 272
263 3300046512 Ga0495610_0000405 Ga0495610_0000405_23806_24684 272
264 3300046512 Ga0495610_0000441 Ga0495610_0000441_8267_9145 272
265 3300046558 Ga0495633_0030156 Ga0495633_0030156_1441_2319 272
266 3300048925 Ga0496122_0019795 Ga0496122_0019795_2369_3244 272
267 iso_pu_bacteria 2585428060 2587748831 272
268 iso_pu_bacteria 2588253712 2588447767 272
269 3300003203 JGI25406J46586_10003120 JGI25406J46586_100031206 273
270 3300003320 rootH2_10053452 rootH2_100534524 273
271 3300003784 Ga0055534_1005957 Ga0055534_10059573 273
272 3300005288 Ga0065714_10069057 Ga0065714_100690573 273
273 3300005289 Ga0065704_10075289 Ga0065704_100752895 273
274 3300005327 Ga0070658_10408721 Ga0070658_104087212 273
275 3300005364 Ga0070673_100053248 Ga0070673_1000532485 273
276 3300005367 Ga0070667_100112829 Ga0070667_1001128292 273
277 3300005616 Ga0068852_100140884 Ga0068852_1001408842 273
278 3300005985 Ga0081539_10000925 Ga0081539_1000092527 273
279 3300006237 Ga0097621_100000063 Ga0097621_10000006322 273
280 3300006358 Ga0068871_100000952 Ga0068871_1000009521 273
281 3300006881 Ga0068865_100044565 Ga0068865_1000445651 273
282 3300009174 Ga0105241_10260351 Ga0105241_102603512 273
283 3300009177 Ga0105248_10009934 Ga0105248_100099349 273
284 3300013100 Ga0157373_10000067 Ga0157373_1000006787 273
285 3300013102 Ga0157371_10029931 Ga0157371_100299312 273
286 3300013297 Ga0157378_10033096 Ga0157378_100330962 273
287 3300013297 Ga0157378_10480459 Ga0157378_104804592 273
288 3300013306 Ga0163162_10000158 Ga0163162_1000015831 273
289 3300013307 Ga0157372_10571440 Ga0157372_105714402 273
290 3300013308 Ga0157375_10000228 Ga0157375_1000022831 273
291 3300013308 Ga0157375_10001328 Ga0157375_1000132816 273
292 3300013308 Ga0157375_10442892 Ga0157375_104428921 273
293 3300014497 Ga0182008_10000016 Ga0182008_100000163 273
294 3300014969 Ga0157376_10001773 Ga0157376_100017734 273
295 3300015261 Ga0182006_1000079 Ga0182006_1000079120 273
296 3300017792 Ga0163161_10002605 Ga0163161_100026054 273
297 3300025291 Ga0209675_1000159 Ga0209675_100015973 273
298 3300025909 Ga0207705_10331340 Ga0207705_103313401 273
299 3300025931 Ga0207644_10028317 Ga0207644_100283174 273
300 3300025935 Ga0207709_10548042 Ga0207709_105480421 273
301 3300025941 Ga0207711_10018774 Ga0207711_100187741 273
302 3300025960 Ga0207651_10543021 Ga0207651_105430211 273
303 3300025986 Ga0207658_10105837 Ga0207658_101058372 273
304 3300026088 Ga0207641_10263783 Ga0207641_102637832 273
305 3300026089 Ga0207648_10046709 Ga0207648_100467092 273
306 3300026118 Ga0207675_100647957 Ga0207675_1006479571 273
307 3300031456 Ga0307513_10084237 Ga0307513_100842372 273
308 3300031507 Ga0307509_10025206 Ga0307509_100252066 273
309 3300031507 Ga0307509_10053235 Ga0307509_100532352 273
310 3300031911 Ga0307412_10000640 Ga0307412_1000064015 273
311 3300031911 Ga0307412_10002518 Ga0307412_100025187 273
312 3300032002 Ga0307416_100000020 Ga0307416_100000020195 273
313 3300032004 Ga0307414_10000041 Ga0307414_10000041134 273
314 3300032004 Ga0307414_10099280 Ga0307414_100992801 273
315 3300041413 Ga0439465_0000489 Ga0439465_0000489_5639_6517 273
316 3300042004 Ga0439445_0000605 Ga0439445_0000605_2176_3054 273
317 3300046453 Ga0495627_000029 Ga0495627_000029_3272_4150 273
318 3300046453 Ga0495627_007357 Ga0495627_007357_785_1663 273
319 3300046460 Ga0495638_0055927 Ga0495638_0055927_542_1420 273
320 3300046460 Ga0495638_0114161 Ga0495638_0114161_47_919 273
321 3300046507 Ga0495606_0003913 Ga0495606_0003913_13896_14774 273
322 3300046512 Ga0495610_0000001 Ga0495610_0000001_5062_5940 273
323 3300046519 Ga0495632_0006192 Ga0495632_0006192_5402_6280 273
324 3300046525 Ga0495663_0000243 Ga0495663_0000243_17388_18266 273
325 3300046525 Ga0495663_0003226 Ga0495663_0003226_2051_2929 273
326 3300046530 Ga0495654_0000008 Ga0495654_0000008_394108_394986 273
327 3300046558 Ga0495633_0000163 Ga0495633_0000163_83418_84296 273
328 3300046558 Ga0495633_0003132 Ga0495633_0003132_5062_5940 273
329 3300047472 Ga0495686_0000153 Ga0495686_0000153_5380_6258 273
330 3300047472 Ga0495686_0009346 Ga0495686_0009346_27_905 273
331 3300048903 Ga0496100_0079254 Ga0496100_0079254_573_1451 273
332 3300048925 Ga0496122_0000489 Ga0496122_0000489_77681_78559 273
333 3300048925 Ga0496122_0004673 Ga0496122_0004673_8941_9819 273
334 3300048926 Ga0496123_0050450 Ga0496123_0050450_384_1262 273
335 3300048928 Ga0496125_0000685 Ga0496125_0000685_46485_47363 273
336 3300048928 Ga0496125_0009248 Ga0496125_0009248_2196_3074 273
337 3300049766 Ga0501269_000196 Ga0501269_000196_5275_6153 273
338 3300053146 Ga0500588_0000578 Ga0500588_0000578_3619_4491 273
339 iso_pu_bacteria 2523533629 2524006768 273
340 iso_pu_bacteria 2588254257 2590610412 273
341 iso_pu_bacteria 2728369107 2729202551 273
342 iso_pu_bacteria 2946019816 2946019832 273
343 3300005355 Ga0070671_100027461 Ga0070671_1000274614 274
344 3300005456 Ga0070678_100219591 Ga0070678_1002195911 274
345 3300005544 Ga0070686_100060381 Ga0070686_1000603812 274
346 3300005564 Ga0070664_100017274 Ga0070664_1000172743 274
347 3300005719 Ga0068861_100350129 Ga0068861_1003501291 274
348 3300005841 Ga0068863_100225831 Ga0068863_1002258312 274
349 3300005985 Ga0081539_10025637 Ga0081539_100256371 274
350 3300006844 Ga0075428_100275229 Ga0075428_1002752291 274
351 3300009176 Ga0105242_10111369 Ga0105242_101113692 274
352 3300025901 Ga0207688_10017118 Ga0207688_100171184 274
353 3300025907 Ga0207645_10218429 Ga0207645_102184292 274
354 3300025926 Ga0207659_10161286 Ga0207659_101612863 274
355 3300025936 Ga0207670_10217576 Ga0207670_102175762 274
356 3300025940 Ga0207691_10045817 Ga0207691_100458172 274
357 3300025945 Ga0207679_10013882 Ga0207679_100138824 274
358 3300025960 Ga0207651_10093422 Ga0207651_100934222 274
359 3300026089 Ga0207648_10047918 Ga0207648_100479183 274
360 3300026118 Ga0207675_100034036 Ga0207675_1000340367 274
361 3300028381 Ga0268264_10008067 Ga0268264_100080676 274
362 3300037471 Ga0395905_0048344 Ga0395905_0048344_2687_3583 274
363 3300045051 Ga0451576_0018027 Ga0451576_0018027_1678_2583 274
364 iso_pu_bacteria 2818991444 2819586717 274
365 3300005337 Ga0070682_100000173 Ga0070682_1000001738 275
366 3300005471 Ga0070698_100001454 Ga0070698_1000014544 275
367 3300005546 Ga0070696_100208976 Ga0070696_1002089761 275
368 3300005616 Ga0068852_100583615 Ga0068852_1005836151 275
369 3300013102 Ga0157371_10056580 Ga0157371_100565802 275
370 3300013306 Ga0163162_10192926 Ga0163162_101929262 275
371 3300014325 Ga0163163_10000712 Ga0163163_100007125 275
372 3300026089 Ga0207648_10001276 Ga0207648_1000127611 275
373 3300037471 Ga0395905_0002094 Ga0395905_0002094_5035_5931 275
374 3300046535 Ga0495586_0073546 Ga0495586_0073546_687_1574 275
375 3300046536 Ga0495587_0174795 Ga0495587_0174795_13_900 275
376 3300046663 Ga0495635_0098756 Ga0495635_0098756_547_1434 275
377 3300046683 Ga0495658_0148905 Ga0495658_0148905_50_937 275
378 3300047321 Ga0495676_0085516 Ga0495676_0085516_1325_2212 275
379 3300049822 Ga0501035_0370589 Ga0501035_0370589_33_965 275
380 iso_pu_bacteria 2738541273 2738699628 275
381 iso_pu_bacteria 2738543014 2739253377 275
382 iso_pu_bacteria 2881955468 2881956688 275
383 3300003320 rootH2_10223400 rootH2_102234003 276
384 3300003322 rootL2_10225493 rootL2_102254933 276
385 3300005290 Ga0065712_10070399 Ga0065712_100703993 276
386 3300005295 Ga0065707_10116229 Ga0065707_101162293 276
387 3300005331 Ga0070670_100078484 Ga0070670_1000784843 276
388 3300005334 Ga0068869_100032502 Ga0068869_1000325022 276
389 3300005334 Ga0068869_100044679 Ga0068869_1000446793 276
390 3300005334 Ga0068869_100445585 Ga0068869_1004455851 276
391 3300005335 Ga0070666_10000247 Ga0070666_100002477 276
392 3300005337 Ga0070682_100236861 Ga0070682_1002368611 276
393 3300005340 Ga0070689_100232037 Ga0070689_1002320372 276
394 3300005343 Ga0070687_100222134 Ga0070687_1002221341 276
395 3300005459 Ga0068867_100223718 Ga0068867_1002237182 276
396 3300005466 Ga0070685_10001175 Ga0070685_1000117512 276
397 3300005471 Ga0070698_100021851 Ga0070698_1000218514 276
398 3300005471 Ga0070698_100060779 Ga0070698_1000607793 276
399 3300005549 Ga0070704_100057017 Ga0070704_1000570172 276
400 3300005578 Ga0068854_100210067 Ga0068854_1002100672 276
401 3300005616 Ga0068852_100019362 Ga0068852_1000193625 276
402 3300005617 Ga0068859_100000012 Ga0068859_1000000125 276
403 3300005617 Ga0068859_100185247 Ga0068859_1001852473 276
404 3300005618 Ga0068864_100007484 Ga0068864_1000074845 276
405 3300005840 Ga0068870_10336288 Ga0068870_103362881 276
406 3300005841 Ga0068863_100001993 Ga0068863_10000199319 276
407 3300005842 Ga0068858_100009905 Ga0068858_10000990513 276
408 3300005843 Ga0068860_100005500 Ga0068860_1000055002 276
409 3300005843 Ga0068860_100359213 Ga0068860_1003592132 276
410 3300005844 Ga0068862_100418849 Ga0068862_1004188492 276
411 3300006237 Ga0097621_100063054 Ga0097621_1000630542 276
412 3300006237 Ga0097621_100083814 Ga0097621_1000838142 276
413 3300006358 Ga0068871_100107543 Ga0068871_1001075433 276
414 3300006358 Ga0068871_100257638 Ga0068871_1002576382 276
415 3300006880 Ga0075429_100004948 Ga0075429_1000049483 276
416 3300006881 Ga0068865_100146220 Ga0068865_1001462202 276
417 3300006881 Ga0068865_100353480 Ga0068865_1003534802 276
418 3300006931 Ga0097620_100000012 Ga0097620_1000000125 276
419 3300006931 Ga0097620_100185237 Ga0097620_1001852373 276
420 3300009098 Ga0105245_10296942 Ga0105245_102969421 276
421 3300009174 Ga0105241_10001370 Ga0105241_1000137016 276
422 3300009545 Ga0105237_10010659 Ga0105237_100106599 276
423 3300009553 Ga0105249_10001749 Ga0105249_100017494 276
424 3300009553 Ga0105249_10003442 Ga0105249_1000344210 276
425 3300009553 Ga0105249_10035804 Ga0105249_100358044 276
426 3300011119 Ga0105246_10061186 Ga0105246_100611863 276
427 3300013102 Ga0157371_10000036 Ga0157371_1000003651 276
428 3300013104 Ga0157370_10001141 Ga0157370_1000114119 276
429 3300013104 Ga0157370_10033216 Ga0157370_100332164 276
430 3300013105 Ga0157369_10000153 Ga0157369_1000015352 276
431 3300013306 Ga0163162_10047851 Ga0163162_100478516 276
432 3300013306 Ga0163162_10468065 Ga0163162_104680652 276
433 3300013306 Ga0163162_10911951 Ga0163162_109119511 276
434 3300013307 Ga0157372_10027042 Ga0157372_100270423 276
435 3300013308 Ga0157375_10065222 Ga0157375_100652224 276
436 3300013308 Ga0157375_10084393 Ga0157375_100843934 276
437 3300014325 Ga0163163_10031622 Ga0163163_100316224 276
438 3300014326 Ga0157380_10189598 Ga0157380_101895982 276
439 3300014968 Ga0157379_10028369 Ga0157379_100283694 276
440 3300014969 Ga0157376_10031463 Ga0157376_100314634 276
441 3300025893 Ga0207682_10060158 Ga0207682_100601582 276
442 3300025899 Ga0207642_10073459 Ga0207642_100734591 276
443 3300025903 Ga0207680_10000031 Ga0207680_1000003150 276
444 3300025911 Ga0207654_10008187 Ga0207654_100081874 276
445 3300025914 Ga0207671_10000981 Ga0207671_100009815 276
446 3300025918 Ga0207662_10062623 Ga0207662_100626232 276
447 3300025919 Ga0207657_10089214 Ga0207657_100892142 276
448 3300025925 Ga0207650_10038496 Ga0207650_100384962 276
449 3300025926 Ga0207659_10075294 Ga0207659_100752943 276
450 3300025937 Ga0207669_10187252 Ga0207669_101872522 276
451 3300025942 Ga0207689_10014782 Ga0207689_100147824 276
452 3300025942 Ga0207689_10039483 Ga0207689_100394833 276
453 3300025942 Ga0207689_10507142 Ga0207689_105071421 276
454 3300025961 Ga0207712_10004607 Ga0207712_100046078 276
455 3300025961 Ga0207712_10005091 Ga0207712_100050913 276
456 3300025961 Ga0207712_10093866 Ga0207712_100938663 276
457 3300025972 Ga0207668_10081464 Ga0207668_100814643 276
458 3300025986 Ga0207658_10043522 Ga0207658_100435222 276
459 3300025986 Ga0207658_10396142 Ga0207658_103961421 276
460 3300026023 Ga0207677_10391670 Ga0207677_103916702 276
461 3300026035 Ga0207703_10009241 Ga0207703_100092417 276
462 3300026088 Ga0207641_10000048 Ga0207641_10000048142 276
463 3300026088 Ga0207641_10000253 Ga0207641_1000025317 276
464 3300026089 Ga0207648_10029826 Ga0207648_100298265 276
465 3300026089 Ga0207648_10469249 Ga0207648_104692491 276
466 3300026095 Ga0207676_10013593 Ga0207676_100135933 276
467 3300026095 Ga0207676_10023708 Ga0207676_100237084 276
468 3300026095 Ga0207676_10140043 Ga0207676_101400434 276
469 3300026116 Ga0207674_10020174 Ga0207674_100201747 276
470 3300026142 Ga0207698_10004963 Ga0207698_100049637 276
471 3300028381 Ga0268264_10001271 Ga0268264_1000127115 276
472 3300046539 Ga0495621_0077088 Ga0495621_0077088_147_1052 276
473 3300049669 Ga0501235_024453 Ga0501235_024453_171_1058 276
474 3300049674 Ga0501242_004828 Ga0501242_004828_260_1147 276
475 3300049681 Ga0501251_009533 Ga0501251_009533_175_1062 276
476 3300049686 Ga0501257_041941 Ga0501257_041941_177_1064 276
477 3300049688 Ga0501259_005848 Ga0501259_005848_52_939 276
478 3300049705 Ga0501225_0033622 Ga0501225_0033622_117_1004 276
479 3300049708 Ga0501245_004916 Ga0501245_004916_725_1612 276
480 3300049763 Ga0501266_008295 Ga0501266_008295_177_1064 276
481 3300050508 nmdc:mga09592_67026_c1 nmdc:mga09592_67026_c1_1173_2210 276
482 3300053153 Ga0500616_0019994 Ga0500616_0019994_2202_3086 276
483 3300001979 JGI24740J21852_10048203 JGI24740J21852_100482031 277
484 3300005288 Ga0065714_10070648 Ga0065714_100706483 277
485 3300005289 Ga0065704_10082759 Ga0065704_100827593 277
486 3300005328 Ga0070676_10093197 Ga0070676_100931971 277
487 3300005330 Ga0070690_100013620 Ga0070690_1000136203 277
488 3300005334 Ga0068869_100001786 Ga0068869_10000178610 277
489 3300005347 Ga0070668_100117342 Ga0070668_1001173421 277
490 3300005353 Ga0070669_100227247 Ga0070669_1002272472 277
491 3300005364 Ga0070673_100003108 Ga0070673_1000031088 277
492 3300005456 Ga0070678_100123890 Ga0070678_1001238901 277
493 3300005457 Ga0070662_100022405 Ga0070662_1000224053 277
494 3300005457 Ga0070662_100065057 Ga0070662_1000650573 277
495 3300005459 Ga0068867_100053168 Ga0068867_1000531683 277
496 3300005459 Ga0068867_100297874 Ga0068867_1002978741 277
497 3300005544 Ga0070686_100014169 Ga0070686_1000141694 277
498 3300005564 Ga0070664_100041612 Ga0070664_1000416124 277
499 3300005578 Ga0068854_100105771 Ga0068854_1001057711 277
500 3300005614 Ga0068856_100392121 Ga0068856_1003921211 277
501 3300005617 Ga0068859_100226136 Ga0068859_1002261362 277
502 3300005718 Ga0068866_10046946 Ga0068866_100469461 277
503 3300005840 Ga0068870_10104929 Ga0068870_101049292 277
504 3300005841 Ga0068863_100106750 Ga0068863_1001067502 277
505 3300005842 Ga0068858_100216157 Ga0068858_1002161571 277
506 3300006163 Ga0070715_10006766 Ga0070715_100067663 277
507 3300006237 Ga0097621_100003845 Ga0097621_1000038458 277
508 3300006358 Ga0068871_100013193 Ga0068871_1000131936 277
509 3300006844 Ga0075428_100269929 Ga0075428_1002699292 277
510 3300006931 Ga0097620_100226101 Ga0097620_1002261012 277
511 3300009147 Ga0114129_10634904 Ga0114129_106349042 277
512 3300009176 Ga0105242_10013371 Ga0105242_100133716 277
513 3300009545 Ga0105237_10033939 Ga0105237_100339392 277
514 3300009545 Ga0105237_10709862 Ga0105237_107098621 277
515 3300009553 Ga0105249_10069050 Ga0105249_100690502 277
516 3300010375 Ga0105239_10231904 Ga0105239_102319042 277
517 3300013297 Ga0157378_10259627 Ga0157378_102596272 277
518 3300013306 Ga0163162_10029831 Ga0163162_100298313 277
519 3300013306 Ga0163162_10127457 Ga0163162_101274572 277
520 3300013308 Ga0157375_10008382 Ga0157375_100083825 277
521 3300014325 Ga0163163_10119820 Ga0163163_101198203 277
522 3300014745 Ga0157377_10046320 Ga0157377_100463202 277
523 3300014968 Ga0157379_10049041 Ga0157379_100490412 277
524 3300014969 Ga0157376_10122083 Ga0157376_101220831 277
525 3300017792 Ga0163161_10027223 Ga0163161_100272233 277
526 3300025904 Ga0207647_10000045 Ga0207647_1000004568 277
527 3300025907 Ga0207645_10098705 Ga0207645_100987051 277
528 3300025908 Ga0207643_10020523 Ga0207643_100205232 277
529 3300025920 Ga0207649_10115826 Ga0207649_101158261 277
530 3300025920 Ga0207649_10268265 Ga0207649_102682651 277
531 3300025923 Ga0207681_10039482 Ga0207681_100394823 277
532 3300025932 Ga0207690_10013214 Ga0207690_100132146 277
533 3300025933 Ga0207706_10002868 Ga0207706_1000286814 277
534 3300025934 Ga0207686_10006783 Ga0207686_100067833 277
535 3300025938 Ga0207704_10399812 Ga0207704_103998121 277
536 3300025940 Ga0207691_10028848 Ga0207691_100288483 277
537 3300025942 Ga0207689_10002661 Ga0207689_100026619 277
538 3300025944 Ga0207661_10515098 Ga0207661_105150981 277
539 3300025945 Ga0207679_10057339 Ga0207679_100573394 277
540 3300025961 Ga0207712_10096509 Ga0207712_100965092 277
541 3300025981 Ga0207640_10063567 Ga0207640_100635673 277
542 3300026023 Ga0207677_10119795 Ga0207677_101197952 277
543 3300026035 Ga0207703_10128071 Ga0207703_101280713 277
544 3300026035 Ga0207703_10209649 Ga0207703_102096492 277
545 3300026035 Ga0207703_10332514 Ga0207703_103325141 277
546 3300026089 Ga0207648_10014222 Ga0207648_100142225 277
547 3300026089 Ga0207648_10063228 Ga0207648_100632285 277
548 3300026118 Ga0207675_100023895 Ga0207675_1000238952 277
549 3300026121 Ga0207683_10010066 Ga0207683_100100666 277
550 3300047320 Ga0495672_0014449 Ga0495672_0014449_983_1867 277
551 3300003322 rootL2_10292385 rootL2_102923852 278
552 3300005328 Ga0070676_10010611 Ga0070676_100106112 278
553 3300005328 Ga0070676_10062169 Ga0070676_100621693 278
554 3300005329 Ga0070683_100044272 Ga0070683_1000442723 278
555 3300005329 Ga0070683_100440456 Ga0070683_1004404562 278
556 3300005330 Ga0070690_100116217 Ga0070690_1001162172 278
557 3300005331 Ga0070670_100113164 Ga0070670_1001131642 278
558 3300005334 Ga0068869_100004205 Ga0068869_1000042052 278
559 3300005338 Ga0068868_100017734 Ga0068868_1000177343 278
560 3300005340 Ga0070689_100086903 Ga0070689_1000869033 278
561 3300005340 Ga0070689_100133840 Ga0070689_1001338402 278
562 3300005343 Ga0070687_100103531 Ga0070687_1001035313 278
563 3300005347 Ga0070668_100105382 Ga0070668_1001053823 278
564 3300005353 Ga0070669_100075392 Ga0070669_1000753922 278
565 3300005354 Ga0070675_100103762 Ga0070675_1001037622 278
566 3300005355 Ga0070671_100193944 Ga0070671_1001939442 278
567 3300005364 Ga0070673_100006701 Ga0070673_1000067017 278
568 3300005364 Ga0070673_100350115 Ga0070673_1003501152 278
569 3300005366 Ga0070659_100220177 Ga0070659_1002201771 278
570 3300005441 Ga0070700_100326504 Ga0070700_1003265042 278
571 3300005459 Ga0068867_100005606 Ga0068867_1000056065 278
572 3300005530 Ga0070679_100322623 Ga0070679_1003226231 278
573 3300005535 Ga0070684_100007270 Ga0070684_1000072708 278
574 3300005535 Ga0070684_100045521 Ga0070684_1000455211 278
575 3300005535 Ga0070684_100051673 Ga0070684_1000516734 278
576 3300005539 Ga0068853_100152553 Ga0068853_1001525531 278
577 3300005564 Ga0070664_100019108 Ga0070664_1000191082 278
578 3300005564 Ga0070664_100021290 Ga0070664_1000212902 278
579 3300005564 Ga0070664_100098400 Ga0070664_1000984002 278
580 3300005578 Ga0068854_100038025 Ga0068854_1000380252 278
581 3300005578 Ga0068854_100062845 Ga0068854_1000628452 278
582 3300005718 Ga0068866_10065300 Ga0068866_100653001 278
583 3300005719 Ga0068861_100516031 Ga0068861_1005160311 278
584 3300005840 Ga0068870_10039800 Ga0068870_100398003 278
585 3300005841 Ga0068863_100313814 Ga0068863_1003138142 278
586 3300005844 Ga0068862_100144415 Ga0068862_1001444152 278
587 3300006195 Ga0075366_10006993 Ga0075366_100069933 278
588 3300006237 Ga0097621_100325614 Ga0097621_1003256142 278
589 3300006358 Ga0068871_100010643 Ga0068871_1000106432 278
590 3300009148 Ga0105243_10199508 Ga0105243_101995083 278
591 3300009174 Ga0105241_10400714 Ga0105241_104007142 278
592 3300013102 Ga0157371_10412720 Ga0157371_104127201 278
593 3300013104 Ga0157370_10246344 Ga0157370_102463442 278
594 3300013105 Ga0157369_10233736 Ga0157369_102337362 278
595 3300013105 Ga0157369_10442104 Ga0157369_104421042 278
596 3300013296 Ga0157374_10049451 Ga0157374_100494512 278
597 3300013296 Ga0157374_10054530 Ga0157374_100545304 278
598 3300013296 Ga0157374_10054949 Ga0157374_100549492 278
599 3300013296 Ga0157374_10097876 Ga0157374_100978762 278
600 3300013306 Ga0163162_10001190 Ga0163162_100011908 278
601 3300013306 Ga0163162_10168586 Ga0163162_101685862 278
602 3300013306 Ga0163162_10369595 Ga0163162_103695952 278
603 3300013307 Ga0157372_10071025 Ga0157372_100710253 278
604 3300013308 Ga0157375_10133517 Ga0157375_101335172 278
605 3300014325 Ga0163163_10009781 Ga0163163_100097818 278
606 3300014325 Ga0163163_10486590 Ga0163163_104865901 278
607 3300014745 Ga0157377_10089056 Ga0157377_100890562 278
608 3300017792 Ga0163161_10056639 Ga0163161_100566393 278
609 3300021384 Ga0213876_10001384 Ga0213876_100013843 278
610 3300025899 Ga0207642_10056040 Ga0207642_100560403 278
611 3300025903 Ga0207680_10014750 Ga0207680_100147504 278
612 3300025907 Ga0207645_10012613 Ga0207645_100126134 278
613 3300025907 Ga0207645_10022921 Ga0207645_100229214 278
614 3300025908 Ga0207643_10036648 Ga0207643_100366482 278
615 3300025909 Ga0207705_10082373 Ga0207705_100823733 278
616 3300025923 Ga0207681_10024459 Ga0207681_100244594 278
617 3300025925 Ga0207650_10370276 Ga0207650_103702762 278
618 3300025926 Ga0207659_10102255 Ga0207659_101022552 278
619 3300025931 Ga0207644_10027242 Ga0207644_100272422 278
620 3300025932 Ga0207690_10227909 Ga0207690_102279092 278
621 3300025933 Ga0207706_10070718 Ga0207706_100707184 278
622 3300025936 Ga0207670_10011342 Ga0207670_100113423 278
623 3300025938 Ga0207704_10144453 Ga0207704_101444531 278
624 3300025940 Ga0207691_10026608 Ga0207691_100266085 278
625 3300025942 Ga0207689_10004266 Ga0207689_1000426613 278
626 3300025942 Ga0207689_10009367 Ga0207689_100093678 278
627 3300025944 Ga0207661_10223850 Ga0207661_102238501 278
628 3300025945 Ga0207679_10041221 Ga0207679_100412213 278
629 3300025945 Ga0207679_10051359 Ga0207679_100513592 278
630 3300025945 Ga0207679_10259786 Ga0207679_102597862 278
631 3300025960 Ga0207651_10005935 Ga0207651_100059351 278
632 3300025960 Ga0207651_10117000 Ga0207651_101170002 278
633 3300025981 Ga0207640_10048817 Ga0207640_100488172 278
634 3300026023 Ga0207677_10085822 Ga0207677_100858221 278
635 3300026067 Ga0207678_10419337 Ga0207678_104193372 278
636 3300026088 Ga0207641_10295421 Ga0207641_102954212 278
637 3300026088 Ga0207641_10368936 Ga0207641_103689362 278
638 3300026089 Ga0207648_10002983 Ga0207648_100029839 278
639 3300026089 Ga0207648_10006182 Ga0207648_1000618210 278
640 3300026089 Ga0207648_10009426 Ga0207648_100094265 278
641 3300026095 Ga0207676_10271657 Ga0207676_102716572 278
642 3300026118 Ga0207675_100077897 Ga0207675_1000778971 278
643 3300026118 Ga0207675_100297918 Ga0207675_1002979181 278
644 3300026121 Ga0207683_10004127 Ga0207683_100041276 278
645 3300028380 Ga0268265_10486649 Ga0268265_104866492 278
646 3300037471 Ga0395905_0481311 Ga0395905_0481311_156_1043 278
647 3300039437 Ga0436365_0502188 Ga0436365_0502188_6343_7233 278
648 3300042002 Ga0439442_033746 Ga0439442_033746_13_909 278
649 3300042004 Ga0439445_0048892 Ga0439445_0048892_127_1023 278
650 3300044658 Ga0466972_0115267 Ga0466972_0115267_16_903 278
651 3300046529 Ga0495652_0324197 Ga0495652_0324197_192_1082 278
652 3300046616 Ga0495668_0000878 Ga0495668_0000878_25891_26781 278
653 3300047472 Ga0495686_0008687 Ga0495686_0008687_3683_4585 278
654 3300048913 Ga0496110_0032664 Ga0496110_0032664_2919_3809 278
655 3300049571 Ga0501034_0442694 Ga0501034_0442694_167_1087 278
656 3300049572 Ga0501036_0008882 Ga0501036_0008882_6394_7290 278
657 3300049573 Ga0501037_0100092 Ga0501037_0100092_799_1695 278
658 3300049575 Ga0501039_0010851 Ga0501039_0010851_2724_3620 278
659 3300049579 Ga0501043_0008369 Ga0501043_0008369_3385_4281 278
660 3300049580 Ga0501046_0111537 Ga0501046_0111537_12_908 278
661 3300049581 Ga0501047_0258657 Ga0501047_0258657_587_1483 278
662 3300049586 Ga0501070_0157057 Ga0501070_0157057_815_1735 278
663 3300049822 Ga0501035_0175310 Ga0501035_0175310_223_1119 278
664 3300049823 Ga0501044_0056273 Ga0501044_0056273_852_1748 278
665 3300049823 Ga0501044_0547834 Ga0501044_0547834_19_909 278
666 3300050493 nmdc:mga0k408_216379_c1 nmdc:mga0k408_216379_c1_133_1035 278
667 3300050493 nmdc:mga0k408_25445_c2 nmdc:mga0k408_25445_c2_539_1441 278
668 3300053096 Ga0500641_0012237 Ga0500641_0012237_2011_2913 278
669 3300053727 Ga0500611_000022 Ga0500611_000022_78713_79615 278
670 3300000041 ARcpr5oldR_c003410 ARcpr5oldR_0034102 279
671 3300003322 rootL2_10074881 rootL2_100748813 279
672 3300005290 Ga0065712_10071179 Ga0065712_100711792 279
673 3300005327 Ga0070658_10337318 Ga0070658_103373181 279
674 3300005329 Ga0070683_100064309 Ga0070683_1000643093 279
675 3300005331 Ga0070670_100110379 Ga0070670_1001103791 279
676 3300005334 Ga0068869_100022245 Ga0068869_1000222452 279
677 3300005334 Ga0068869_100096449 Ga0068869_1000964492 279
678 3300005335 Ga0070666_10030544 Ga0070666_100305443 279
679 3300005339 Ga0070660_100075397 Ga0070660_1000753974 279
680 3300005347 Ga0070668_100015872 Ga0070668_1000158722 279
681 3300005347 Ga0070668_100134789 Ga0070668_1001347892 279
682 3300005353 Ga0070669_100154218 Ga0070669_1001542182 279
683 3300005354 Ga0070675_100009839 Ga0070675_1000098399 279
684 3300005364 Ga0070673_100291076 Ga0070673_1002910762 279
685 3300005365 Ga0070688_100173591 Ga0070688_1001735911 279
686 3300005367 Ga0070667_100071365 Ga0070667_1000713652 279
687 3300005438 Ga0070701_10008166 Ga0070701_100081662 279
688 3300005441 Ga0070700_100031346 Ga0070700_1000313462 279
689 3300005455 Ga0070663_100115809 Ga0070663_1001158092 279
690 3300005455 Ga0070663_100161486 Ga0070663_1001614862 279
691 3300005457 Ga0070662_100025313 Ga0070662_1000253132 279
692 3300005457 Ga0070662_100028485 Ga0070662_1000284853 279
693 3300005459 Ga0068867_100106477 Ga0068867_1001064772 279
694 3300005466 Ga0070685_10215623 Ga0070685_102156232 279
695 3300005535 Ga0070684_100000417 Ga0070684_10000041711 279
696 3300005535 Ga0070684_100065031 Ga0070684_1000650314 279
697 3300005539 Ga0068853_100003954 Ga0068853_1000039549 279
698 3300005539 Ga0068853_100024447 Ga0068853_1000244472 279
699 3300005539 Ga0068853_100136790 Ga0068853_1001367903 279
700 3300005547 Ga0070693_100115314 Ga0070693_1001153141 279
701 3300005548 Ga0070665_100072520 Ga0070665_1000725203 279
702 3300005564 Ga0070664_100000487 Ga0070664_10000048727 279
703 3300005564 Ga0070664_100086494 Ga0070664_1000864943 279
704 3300005564 Ga0070664_100279874 Ga0070664_1002798742 279
705 3300005577 Ga0068857_100021467 Ga0068857_1000214672 279
706 3300005577 Ga0068857_100182834 Ga0068857_1001828342 279
707 3300005577 Ga0068857_100248992 Ga0068857_1002489921 279
708 3300005616 Ga0068852_100065791 Ga0068852_1000657913 279
709 3300005616 Ga0068852_100715152 Ga0068852_1007151521 279
710 3300005618 Ga0068864_100073656 Ga0068864_1000736564 279
711 3300005618 Ga0068864_100309994 Ga0068864_1003099942 279
712 3300005719 Ga0068861_100002247 Ga0068861_1000022477 279
713 3300005834 Ga0068851_10102878 Ga0068851_101028781 279
714 3300005840 Ga0068870_10013725 Ga0068870_100137251 279
715 3300005842 Ga0068858_100024399 Ga0068858_1000243994 279
716 3300005843 Ga0068860_100435672 Ga0068860_1004356722 279
717 3300005844 Ga0068862_100023039 Ga0068862_1000230392 279
718 3300009094 Ga0111539_10005620 Ga0111539_1000562017 279
719 3300009176 Ga0105242_10025402 Ga0105242_100254023 279
720 3300009177 Ga0105248_10431783 Ga0105248_104317832 279
721 3300009553 Ga0105249_10087480 Ga0105249_100874804 279
722 3300013296 Ga0157374_10198855 Ga0157374_101988552 279
723 3300013297 Ga0157378_10435448 Ga0157378_104354482 279
724 3300013306 Ga0163162_10037650 Ga0163162_100376502 279
725 3300013306 Ga0163162_10042883 Ga0163162_100428835 279
726 3300013308 Ga0157375_10003748 Ga0157375_100037489 279
727 3300013308 Ga0157375_10175021 Ga0157375_101750213 279
728 3300014326 Ga0157380_10004225 Ga0157380_100042258 279
729 3300014745 Ga0157377_10006267 Ga0157377_100062672 279
730 3300014968 Ga0157379_10113893 Ga0157379_101138932 279
731 3300014969 Ga0157376_10103570 Ga0157376_101035703 279
732 3300017792 Ga0163161_10304949 Ga0163161_103049492 279
733 3300025919 Ga0207657_10085559 Ga0207657_100855594 279
734 3300025925 Ga0207650_10036624 Ga0207650_100366243 279
735 3300025925 Ga0207650_10086550 Ga0207650_100865503 279
736 3300025926 Ga0207659_10028881 Ga0207659_100288812 279
737 3300025932 Ga0207690_10312143 Ga0207690_103121432 279
738 3300025933 Ga0207706_10022975 Ga0207706_100229754 279
739 3300025933 Ga0207706_10108753 Ga0207706_101087532 279
740 3300025934 Ga0207686_10001258 Ga0207686_100012589 279
741 3300025940 Ga0207691_10150951 Ga0207691_101509511 279
742 3300025941 Ga0207711_10255548 Ga0207711_102555482 279
743 3300025942 Ga0207689_10031238 Ga0207689_100312382 279
744 3300025942 Ga0207689_10129456 Ga0207689_101294563 279
745 3300025944 Ga0207661_10014437 Ga0207661_100144372 279
746 3300025945 Ga0207679_10000462 Ga0207679_100004624 279
747 3300025960 Ga0207651_10077324 Ga0207651_100773242 279
748 3300025972 Ga0207668_10010481 Ga0207668_100104815 279
749 3300025986 Ga0207658_10091991 Ga0207658_100919913 279
750 3300026023 Ga0207677_10033369 Ga0207677_100333692 279
751 3300026035 Ga0207703_10122825 Ga0207703_101228252 279
752 3300026041 Ga0207639_10016412 Ga0207639_100164123 279
753 3300026041 Ga0207639_10380015 Ga0207639_103800152 279
754 3300026075 Ga0207708_10073106 Ga0207708_100731062 279
755 3300026089 Ga0207648_10123232 Ga0207648_101232322 279
756 3300026116 Ga0207674_10010902 Ga0207674_100109024 279
757 3300026116 Ga0207674_10011266 Ga0207674_100112669 279
758 3300026116 Ga0207674_10122461 Ga0207674_101224613 279
759 3300026116 Ga0207674_10142993 Ga0207674_101429932 279
760 3300026118 Ga0207675_100000304 Ga0207675_10000030414 279
761 3300026142 Ga0207698_10284271 Ga0207698_102842712 279
762 3300028794 Ga0307515_10000001 Ga0307515_10000001891 279
763 3300031251 Ga0265327_10000051 Ga0265327_10000051125 279
764 3300032004 Ga0307414_10079185 Ga0307414_100791851 279
765 3300035089 Ga0373944_0076323 Ga0373944_0076323_133_1023 279
766 3300035118 Ga0373954_0165959 Ga0373954_0165959_77_970 279
767 3300035170 Ga0373943_0116184 Ga0373943_0116184_70_963 279
768 3300035172 Ga0373955_0112840 Ga0373955_0112840_335_1228 279
769 3300035410 Ga0373924_0139268 Ga0373924_0139268_41_934 279
770 3300042876 Ga0451577_0114052 Ga0451577_0114052_961_1896 279
771 3300044673 Ga0453683_0000311 Ga0453683_0000311_56658_57593 279
772 3300044673 Ga0453683_0016047 Ga0453683_0016047_3691_4626 279
773 3300044673 Ga0453683_0082057 Ga0453683_0082057_770_1690 279
774 3300046454 Ga0495592_0041234 Ga0495592_0041234_2115_3008 279
775 3300046472 Ga0495580_0324771 Ga0495580_0324771_59_949 279
776 3300046536 Ga0495587_0023999 Ga0495587_0023999_2245_3138 279
777 3300046543 Ga0495645_0221546 Ga0495645_0221546_250_1143 279
778 3300046616 Ga0495668_0002497 Ga0495668_0002497_12997_13893 279
779 3300046675 Ga0495657_0064417 Ga0495657_0064417_791_1684 279
780 3300047317 Ga0495604_0246748 Ga0495604_0246748_218_1111 279
781 3300047471 Ga0495684_0114416 Ga0495684_0114416_85_978 279
782 3300049571 Ga0501034_0039704 Ga0501034_0039704_1308_2201 279
783 3300049572 Ga0501036_0006194 Ga0501036_0006194_4997_5890 279
784 3300049573 Ga0501037_0151126 Ga0501037_0151126_492_1385 279
785 3300049574 Ga0501038_0050525 Ga0501038_0050525_2198_3091 279
786 3300049579 Ga0501043_0016758 Ga0501043_0016758_1568_2461 279
787 3300049580 Ga0501046_0005502 Ga0501046_0005502_3224_4117 279
788 3300049583 Ga0501067_0103081 Ga0501067_0103081_418_1311 279
789 3300049589 Ga0501073_0010728 Ga0501073_0010728_5474_6367 279
790 3300049590 Ga0501074_0003026 Ga0501074_0003026_7166_8059 279
791 3300049741 Ga0501079_0054375 Ga0501079_0054375_506_1399 279
792 3300049742 Ga0501080_0021495 Ga0501080_0021495_3305_4198 279
793 3300049744 Ga0501083_0011009 Ga0501083_0011009_2152_3045 279
794 3300049822 Ga0501035_0122673 Ga0501035_0122673_928_1821 279
795 3300049823 Ga0501044_0105161 Ga0501044_0105161_267_1181 279
796 3300049823 Ga0501044_0119141 Ga0501044_0119141_1508_2401 279
797 3300050511 nmdc:mga08y16_118242_c1 nmdc:mga08y16_118242_c1_437_1342 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

35

167

0.95

PF00892

EamA

EamA-like transporter family

173

315

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7277 3 262
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.6813 3 262
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.65 8 260
5ogk-assembly2.cif.gz_C crystal structure of a nucleotide sugar transporter with bound nucleotide sugar. 0.6459 11 275
5i20-assembly1.cif.gz_A crystal structure of protein 0.6338 1 263
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7029 4 265 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6838 4 261 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6636 4 265 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6478 4 262 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6383 4 261 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2Z6I9T6-F1-model_v4 Permease 0.8896 1 278 GO:0016020
AF-A0A2Z6I9T6-F1-model_v4 Permease 0.8835 1 278 GO:0016020
AF-A0A7Y4T5K4-F1-model_v4 DMT family transporter 0.8798 2 260 GO:0016020
AF-G8R0N4-F1-model_v4 Putative permease 0.876 2 272 GO:0016020
AF-A0A353YYM1-F1-model_v4 EamA family transporter 0.8683 1 270 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.28 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map