F481139

General Info

Members Datasets Scaffolds Average Seq Length
795 246 1590 157

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10032731|Ga0207697_100327312
Length 184
Sequence MKRILSLLPAALTALLLTAAVFSAHHSFAMFDRTIEKVATGTVVRWTYNNPHSWLYMNVKDKDGSETLWSFEGSAPTALLQRGITGTTFEPGKTITVLYCPLKDGRPGGGLGWVRLPDGKFINPADGGCSPPRTSSNVLFPAPLPPAMATNSPGSIDSDSSWRICRAPTCWLTLTASTRPPAAC

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 30.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10032731 3300025315 Bacteria 2128
2 JGI24746J21847_1056048 3300001977 Bacteria 559
3 Ga0065714_10023432 3300005288 Bacteria 1262
4 Ga0065704_10339178 3300005289 Bacteria 826
5 Ga0065712_10208310 3300005290 Bacteria 1082
6 Ga0065715_10016496 3300005293 Bacteria 2109
7 Ga0065715_10216403 3300005293 Unclassified 1288
8 Ga0065707_10207455 3300005295 Bacteria 1272
9 Ga0070676_10039191 3300005328 Bacteria 2739
10 Ga0070676_10928700 3300005328 Bacteria 650
11 Ga0070690_100072515 3300005330 Bacteria 2239
12 Ga0070690_100386863 3300005330 Unclassified 1024
13 Ga0070690_100642066 3300005330 Bacteria 810
14 Ga0070690_101132632 3300005330 Unclassified 622
15 Ga0070670_100000843 3300005331 Bacteria 23971
16 Ga0070670_100006680 3300005331 Bacteria 9779
17 Ga0070670_100061567 3300005331 Bacteria 3221
18 Ga0070670_100918914 3300005331 Bacteria 794
19 Ga0070670_101241482 3300005331 Bacteria 682
20 Ga0070677_10011045 3300005333 Bacteria 3104
21 Ga0070677_10027880 3300005333 Unclassified 2129
22 Ga0070677_10039383 3300005333 Bacteria 1854
23 Ga0070677_10064434 3300005333 Bacteria 1522
24 Ga0068869_100004142 3300005334 Bacteria 8992
25 Ga0068869_100040032 3300005334 Bacteria 3349
26 Ga0068869_100078273 3300005334 Bacteria 2462
27 Ga0068869_100111682 3300005334 Bacteria 2080
28 Ga0068869_101099014 3300005334 Unclassified 696
29 Ga0070666_10037305 3300005335 Bacteria 3231
30 Ga0070666_10068865 3300005335 Unclassified 2405
31 Ga0070666_10074903 3300005335 Bacteria 2308
32 Ga0070666_10157066 3300005335 Bacteria 1589
33 Ga0070666_10275661 3300005335 Bacteria 1195
34 Ga0070680_100403350 3300005336 Unclassified 1165
35 Ga0070682_100785492 3300005337 Unclassified 772
36 Ga0070682_101888280 3300005337 Bacteria 523
37 Ga0068868_100003433 3300005338 Bacteria 11034
38 Ga0068868_100028383 3300005338 Bacteria 4278
39 Ga0070660_100207765 3300005339 Bacteria 1589
40 Ga0070689_100013164 3300005340 Bacteria 5980
41 Ga0070689_100024351 3300005340 Bacteria 4539
42 Ga0070689_100033157 3300005340 Bacteria 3933
43 Ga0070689_100188313 3300005340 Bacteria 1679
44 Ga0070689_100565390 3300005340 Unclassified 981
45 Ga0070691_10076225 3300005341 Unclassified 1634
46 Ga0070687_100070255 3300005343 Unclassified 1878
47 Ga0070687_100172358 3300005343 Bacteria 1289
48 Ga0070687_100372174 3300005343 Unclassified 928
49 Ga0070687_101471455 3300005343 Bacteria 511
50 Ga0070661_100017358 3300005344 Bacteria 5106
51 Ga0070661_100039135 3300005344 Unclassified 3454
52 Ga0070661_100278218 3300005344 Bacteria 1298
53 Ga0070661_100285786 3300005344 Bacteria 1281
54 Ga0070661_101520422 3300005344 Unclassified 565
55 Ga0070692_10034740 3300005345 Bacteria 2549
56 Ga0070668_100060467 3300005347 Unclassified 2934
57 Ga0070669_100019761 3300005353 Bacteria 4813
58 Ga0070669_100068380 3300005353 Unclassified 2622
59 Ga0070669_100275353 3300005353 Unclassified 1347
60 Ga0070669_100286814 3300005353 Bacteria 1320
61 Ga0070669_100301198 3300005353 Bacteria 1289
62 Ga0070669_100386094 3300005353 Bacteria 1143
63 Ga0070669_100769752 3300005353 Bacteria 816
64 Ga0070669_100926933 3300005353 Bacteria 745
65 Ga0070669_100937552 3300005353 Unclassified 741
66 Ga0070675_100002303 3300005354 Bacteria 14177
67 Ga0070675_100002853 3300005354 Bacteria 13030
68 Ga0070675_100006305 3300005354 Bacteria 9105
69 Ga0070675_100007497 3300005354 Bacteria 8432
70 Ga0070675_100016756 3300005354 Bacteria 5818
71 Ga0070675_100030785 3300005354 Bacteria 4334
72 Ga0070675_100043212 3300005354 Bacteria 3682
73 Ga0070675_100220656 3300005354 Bacteria 1651
74 Ga0070675_100236394 3300005354 Unclassified 1595
75 Ga0070675_100654183 3300005354 Unclassified 955
76 Ga0070675_100710798 3300005354 Bacteria 915
77 Ga0070675_100782036 3300005354 Bacteria 872
78 Ga0070671_100006870 3300005355 Bacteria 9111
79 Ga0070671_100017189 3300005355 Bacteria 5855
80 Ga0070671_100021188 3300005355 Bacteria 5307
81 Ga0070671_100098936 3300005355 Bacteria 2446
82 Ga0070671_100153190 3300005355 Bacteria 1947
83 Ga0070671_100192415 3300005355 Unclassified 1729
84 Ga0070671_100558070 3300005355 Bacteria 988
85 Ga0070671_100901224 3300005355 Unclassified 773
86 Ga0070674_100103190 3300005356 Bacteria 2081
87 Ga0070674_100148105 3300005356 Bacteria 1769
88 Ga0070674_100183585 3300005356 Bacteria 1604
89 Ga0070674_100347551 3300005356 Unclassified 1197
90 Ga0070673_100021514 3300005364 Unclassified 4677
91 Ga0070673_100036245 3300005364 Bacteria 3747
92 Ga0070673_100041898 3300005364 Bacteria 3525
93 Ga0070673_100048316 3300005364 Bacteria 3317
94 Ga0070673_100117312 3300005364 Bacteria 2215
95 Ga0070673_100123851 3300005364 Bacteria 2160
96 Ga0070673_100227779 3300005364 Bacteria 1616
97 Ga0070673_100489831 3300005364 Bacteria 1111
98 Ga0070673_101853581 3300005364 Bacteria 572
99 Ga0070688_100012074 3300005365 Bacteria 4826
100 Ga0070688_100021121 3300005365 Bacteria 3798
101 Ga0070688_100031670 3300005365 Unclassified 3183
102 Ga0070688_100140175 3300005365 Bacteria 1641
103 Ga0070688_100254526 3300005365 Unclassified 1252
104 Ga0070667_100024150 3300005367 Bacteria 5048
105 Ga0070667_100048177 3300005367 Bacteria 3586
106 Ga0070667_100572069 3300005367 Unclassified 1040
107 Ga0070667_100818876 3300005367 Bacteria 865
108 Ga0070667_100881606 3300005367 Unclassified 832
109 Ga0070701_10012292 3300005438 Bacteria 3855
110 Ga0070701_10243892 3300005438 Bacteria 1082
111 Ga0070701_10913437 3300005438 Unclassified 607
112 Ga0070705_100039714 3300005440 Bacteria 2672
113 Ga0070705_100350763 3300005440 Unclassified 1076
114 Ga0070700_100011177 3300005441 Bacteria 4968
115 Ga0070700_100017529 3300005441 Bacteria 4099
116 Ga0070700_100035848 3300005441 Bacteria 3005
117 Ga0070700_100063339 3300005441 Bacteria 2339
118 Ga0070694_100285104 3300005444 Bacteria 1260
119 Ga0070708_100702421 3300005445 Unclassified 952
120 Ga0070663_100546394 3300005455 Unclassified 968
121 Ga0070663_100667217 3300005455 Unclassified 881
122 Ga0070678_100049666 3300005456 Unclassified 3029
123 Ga0070678_100187893 3300005456 Unclassified 1696
124 Ga0070678_100189037 3300005456 Unclassified 1692
125 Ga0070678_100327391 3300005456 Unclassified 1310
126 Ga0070678_100454553 3300005456 Bacteria 1122
127 Ga0070662_100121102 3300005457 Unclassified 2006
128 Ga0070662_100266043 3300005457 Unclassified 1383
129 Ga0070662_100539591 3300005457 Unclassified 976
130 Ga0068867_100001370 3300005459 Bacteria 16828
131 Ga0068867_100289470 3300005459 Unclassified 1346
132 Ga0068867_100505019 3300005459 Unclassified 1040
133 Ga0068867_101782019 3300005459 Unclassified 579
134 Ga0070685_10012551 3300005466 Bacteria 4454
135 Ga0070685_10017221 3300005466 Bacteria 3864
136 Ga0070685_10035756 3300005466 Bacteria 2805
137 Ga0070685_10172456 3300005466 Unclassified 1387
138 Ga0070685_10604304 3300005466 Unclassified 790
139 Ga0070685_10742514 3300005466 Bacteria 719
140 Ga0070707_100629879 3300005468 Unclassified 1035
141 Ga0070707_100778968 3300005468 Bacteria 920
142 Ga0070698_100358460 3300005471 Bacteria 1390
143 Ga0070698_100418276 3300005471 Bacteria 1275
144 Ga0070672_100029951 3300005543 Bacteria 4085
145 Ga0070672_100032973 3300005543 Bacteria 3917
146 Ga0070672_100046977 3300005543 Bacteria 3348
147 Ga0070672_100069005 3300005543 Bacteria 2805
148 Ga0070672_100107235 3300005543 Unclassified 2273
149 Ga0070672_100143783 3300005543 Unclassified 1969
150 Ga0070672_100151338 3300005543 Unclassified 1920
151 Ga0070672_100973656 3300005543 Bacteria 751
152 Ga0070672_101038400 3300005543 Unclassified 727
153 Ga0070686_100031861 3300005544 Bacteria 3228
154 Ga0070686_100103021 3300005544 Bacteria 1931
155 Ga0070686_100150016 3300005544 Bacteria 1632
156 Ga0070686_100495892 3300005544 Unclassified 947
157 Ga0070686_101172256 3300005544 Unclassified 637
158 Ga0070686_101306813 3300005544 Unclassified 606
159 Ga0070695_100848996 3300005545 Unclassified 735
160 Ga0070696_100406045 3300005546 Bacteria 1067
161 Ga0070696_101174321 3300005546 Bacteria 648
162 Ga0070665_100010787 3300005548 Bacteria 9239
163 Ga0070665_100055988 3300005548 Bacteria 3954
164 Ga0070665_100425935 3300005548 Bacteria 1336
165 Ga0070704_100008307 3300005549 Bacteria 6218
166 Ga0070704_100380611 3300005549 Unclassified 1199
167 Ga0070704_100620302 3300005549 Bacteria 952
168 Ga0070664_100004268 3300005564 Bacteria 11490
169 Ga0070664_100012492 3300005564 Bacteria 6905
170 Ga0070664_100025298 3300005564 Unclassified 4919
171 Ga0070664_100059672 3300005564 Bacteria 3246
172 Ga0070664_100101985 3300005564 Bacteria 2496
173 Ga0070664_100111838 3300005564 Unclassified 2384
174 Ga0070664_100878867 3300005564 Unclassified 840
175 Ga0070664_101885278 3300005564 Bacteria 567
176 Ga0068857_100091032 3300005577 Bacteria 2730
177 Ga0068857_100311030 3300005577 Bacteria 1453
178 Ga0068857_101134771 3300005577 Bacteria 755
179 Ga0068854_101141884 3300005578 Unclassified 696
180 Ga0070702_100011887 3300005615 Bacteria 4342
181 Ga0070702_100460142 3300005615 Unclassified 925
182 Ga0068852_100084046 3300005616 Bacteria 2832
183 Ga0068852_101799431 3300005616 Bacteria 635
184 Ga0068859_100001352 3300005617 Bacteria 25017
185 Ga0068859_100005199 3300005617 Bacteria 13224
186 Ga0068859_100018930 3300005617 Bacteria 6917
187 Ga0068859_100028698 3300005617 Bacteria 5579
188 Ga0068859_100031350 3300005617 Bacteria 5338
189 Ga0068859_100035372 3300005617 Bacteria 5012
190 Ga0068859_100334405 3300005617 Bacteria 1609
191 Ga0068859_101245393 3300005617 Bacteria 820
192 Ga0068859_101782636 3300005617 Unclassified 680
193 Ga0068859_102050459 3300005617 Unclassified 632
194 Ga0068864_100011896 3300005618 Bacteria 7185
195 Ga0068864_100023353 3300005618 Bacteria 5193
196 Ga0068864_100068318 3300005618 Bacteria 3087
197 Ga0068864_100074796 3300005618 Bacteria 2956
198 Ga0068864_100303294 3300005618 Bacteria 1496
199 Ga0068864_100455668 3300005618 Bacteria 1224
200 Ga0068864_100565401 3300005618 Bacteria 1101
201 Ga0068864_100593079 3300005618 Bacteria 1074
202 Ga0068864_100947402 3300005618 Unclassified 852
203 Ga0068866_10008430 3300005718 Bacteria 4345
204 Ga0068866_11087563 3300005718 Bacteria 572
205 Ga0068861_100028197 3300005719 Bacteria 4097
206 Ga0068861_100044048 3300005719 Bacteria 3353
207 Ga0068861_100091078 3300005719 Bacteria 2407
208 Ga0068861_100127123 3300005719 Bacteria 2064
209 Ga0068861_100825286 3300005719 Bacteria 872
210 Ga0068851_10005482 3300005834 Bacteria 5755
211 Ga0068851_10298466 3300005834 Unclassified 926
212 Ga0068870_10009383 3300005840 Bacteria 4449
213 Ga0068870_10021357 3300005840 Bacteria 3165
214 Ga0068870_10043124 3300005840 Bacteria 2352
215 Ga0068870_10163739 3300005840 Bacteria 1321
216 Ga0068870_10369976 3300005840 Bacteria 925
217 Ga0068863_100000876 3300005841 Bacteria 30194
218 Ga0068863_100002471 3300005841 Bacteria 18373
219 Ga0068863_100096328 3300005841 Bacteria 2809
220 Ga0068863_100182959 3300005841 Bacteria 2012
221 Ga0068863_100398501 3300005841 Bacteria 1346
222 Ga0068863_100451969 3300005841 Bacteria 1261
223 Ga0068858_100010403 3300005842 Bacteria 8814
224 Ga0068858_100039184 3300005842 Bacteria 4395
225 Ga0068858_100082722 3300005842 Bacteria 2985
226 Ga0068858_100111701 3300005842 Bacteria 2552
227 Ga0068858_100630305 3300005842 Unclassified 1041
228 Ga0068858_100838194 3300005842 Unclassified 898
229 Ga0068860_100007682 3300005843 Bacteria 10779
230 Ga0068860_100133472 3300005843 Bacteria 2383
231 Ga0068860_100289010 3300005843 Unclassified 1604
232 Ga0068860_100502472 3300005843 Bacteria 1210
233 Ga0068862_100295164 3300005844 Unclassified 1490
234 Ga0068862_100307308 3300005844 Bacteria 1461
235 Ga0068862_100376575 3300005844 Unclassified 1323
236 Ga0068862_101288215 3300005844 Bacteria 732
237 Ga0068862_101799075 3300005844 Unclassified 622
238 Ga0081455_10154624 3300005937 Unclassified 1765
239 Ga0081539_10128344 3300005985 Unclassified 1249
240 Ga0075432_10131897 3300006058 Bacteria 947
241 Ga0070712_100907203 3300006175 Unclassified 760
242 Ga0097621_100001747 3300006237 Bacteria 14880
243 Ga0097621_100037747 3300006237 Bacteria 3873
244 Ga0097621_100041605 3300006237 Unclassified 3699
245 Ga0097621_100100124 3300006237 Unclassified 2438
246 Ga0097621_100754771 3300006237 Unclassified 899
247 Ga0097621_101751780 3300006237 Unclassified 592
248 Ga0068871_100006405 3300006358 Bacteria 8326
249 Ga0068871_100102254 3300006358 Unclassified 2402
250 Ga0068871_100352673 3300006358 Unclassified 1302
251 Ga0068871_100567732 3300006358 Unclassified 1029
252 Ga0075428_100011163 3300006844 Bacteria 9995
253 Ga0075428_100026402 3300006844 Bacteria 6429
254 Ga0075428_100141136 3300006844 Bacteria 2619
255 Ga0075428_100213365 3300006844 Unclassified 2086
256 Ga0075428_100772858 3300006844 Unclassified 1021
257 Ga0075430_100008293 3300006846 Bacteria 8776
258 Ga0075430_100017551 3300006846 Bacteria 6096
259 Ga0075430_100024111 3300006846 Bacteria 5180
260 Ga0075430_100267289 3300006846 Bacteria 1416
261 Ga0075430_101122015 3300006846 Unclassified 648
262 Ga0075431_100013133 3300006847 Bacteria 8371
263 Ga0075431_100014713 3300006847 Bacteria 7920
264 Ga0075431_100029184 3300006847 Bacteria 5674
265 Ga0075431_100401479 3300006847 Unclassified 1372
266 Ga0075431_101009179 3300006847 Bacteria 799
267 Ga0075431_101185493 3300006847 Unclassified 727
268 Ga0075433_10001501 3300006852 Bacteria 17236
269 Ga0075433_10012469 3300006852 Bacteria 6870
270 Ga0075433_10021617 3300006852 Bacteria 5397
271 Ga0075434_100003981 3300006871 Bacteria 13232
272 Ga0075434_100016158 3300006871 Bacteria 7173
273 Ga0075434_100038544 3300006871 Bacteria 4733
274 Ga0075434_100176228 3300006871 Bacteria 2158
275 Ga0075434_100224939 3300006871 Unclassified 1896
276 Ga0075434_100584040 3300006871 Unclassified 1136
277 Ga0075434_100850386 3300006871 Unclassified 928
278 Ga0075434_101263611 3300006871 Unclassified 750
279 Ga0075434_101760445 3300006871 Bacteria 627
280 Ga0075429_100005902 3300006880 Bacteria 10573
281 Ga0075429_100056586 3300006880 Bacteria 3414
282 Ga0075429_100167492 3300006880 Bacteria 1925
283 Ga0075429_100333023 3300006880 Bacteria 1329
284 Ga0075429_101563143 3300006880 Bacteria 574
285 Ga0068865_100077411 3300006881 Unclassified 2377
286 Ga0068865_100257710 3300006881 Unclassified 1379
287 Ga0097620_100001352 3300006931 Bacteria 25017
288 Ga0097620_100005199 3300006931 Bacteria 13224
289 Ga0097620_100018928 3300006931 Bacteria 6917
290 Ga0097620_100028700 3300006931 Bacteria 5579
291 Ga0097620_100031351 3300006931 Bacteria 5338
292 Ga0097620_100035372 3300006931 Bacteria 5012
293 Ga0097620_100334401 3300006931 Bacteria 1609
294 Ga0097620_101245397 3300006931 Bacteria 820
295 Ga0097620_101782659 3300006931 Unclassified 680
296 Ga0097620_102050632 3300006931 Unclassified 632
297 Ga0075435_100028898 3300007076 Unclassified 4350
298 Ga0075435_100278383 3300007076 Unclassified 1428
299 Ga0075435_100453654 3300007076 Unclassified 1106
300 Ga0105240_10090853 3300009093 Bacteria 3732
301 Ga0111539_10005636 3300009094 Bacteria 16190
302 Ga0111539_10007026 3300009094 Bacteria 14447
303 Ga0111539_10034841 3300009094 Bacteria 6099
304 Ga0111539_10064260 3300009094 Bacteria 4342
305 Ga0111539_10123667 3300009094 Bacteria 3032
306 Ga0111539_10130044 3300009094 Bacteria 2949
307 Ga0111539_10135362 3300009094 Bacteria 2885
308 Ga0111539_10151778 3300009094 Bacteria 2711
309 Ga0111539_10277202 3300009094 Unclassified 1951
310 Ga0111539_11256129 3300009094 Bacteria 860
311 Ga0105245_10298535 3300009098 Bacteria 1580
312 Ga0105245_11875473 3300009098 Unclassified 652
313 Ga0105247_10170328 3300009101 Bacteria 1447
314 Ga0105247_10878983 3300009101 Unclassified 690
315 Ga0114129_10000775 3300009147 Bacteria 40793
316 Ga0114129_10001971 3300009147 Bacteria 28062
317 Ga0114129_10111144 3300009147 Unclassified 3782
318 Ga0114129_10170228 3300009147 Unclassified 2970
319 Ga0114129_10225279 3300009147 Bacteria 2527
320 Ga0114129_10551965 3300009147 Unclassified 1498
321 Ga0114129_12262664 3300009147 Bacteria 653
322 Ga0105243_10014108 3300009148 Bacteria 6045
323 Ga0105243_10112531 3300009148 Bacteria 2281
324 Ga0105243_11658847 3300009148 Unclassified 667
325 Ga0105241_11086076 3300009174 Unclassified 753
326 Ga0105242_10003938 3300009176 Bacteria 11537
327 Ga0105242_10017227 3300009176 Bacteria 5625
328 Ga0105242_10871787 3300009176 Bacteria 898
329 Ga0105242_10905810 3300009176 Bacteria 882
330 Ga0105248_10000888 3300009177 Bacteria 33497
331 Ga0105248_10014741 3300009177 Bacteria 8606
332 Ga0105248_10177936 3300009177 Bacteria 2397
333 Ga0105248_10203456 3300009177 Bacteria 2231
334 Ga0105248_10213074 3300009177 Bacteria 2176
335 Ga0105248_10306282 3300009177 Unclassified 1789
336 Ga0105248_10560896 3300009177 Bacteria 1288
337 Ga0105237_11971927 3300009545 Unclassified 592
338 Ga0105238_10000968 3300009551 Bacteria 29356
339 Ga0105238_12334656 3300009551 Unclassified 570
340 Ga0105249_10020407 3300009553 Bacteria 5924
341 Ga0105249_10690986 3300009553 Bacteria 1080
342 Ga0105249_10771275 3300009553 Unclassified 1024
343 Ga0105249_11568375 3300009553 Unclassified 731
344 Ga0105249_11682609 3300009553 Bacteria 707
345 Ga0105239_10298730 3300010375 Bacteria 1813
346 Ga0105246_10012948 3300011119 Bacteria 5218
347 Ga0105246_10086586 3300011119 Bacteria 2247
348 Ga0105246_10426854 3300011119 Bacteria 1108
349 Ga0105246_11386791 3300011119 Unclassified 655
350 Ga0157371_10203579 3300013102 Bacteria 1419
351 Ga0157374_10012816 3300013296 Bacteria 7302
352 Ga0157378_10044833 3300013297 Bacteria 3928
353 Ga0157378_10335951 3300013297 Bacteria 1472
354 Ga0163162_10002089 3300013306 Bacteria 18753
355 Ga0163162_10108857 3300013306 Bacteria 2868
356 Ga0163162_10226083 3300013306 Unclassified 2001
357 Ga0163162_10423810 3300013306 Bacteria 1463
358 Ga0163162_10560824 3300013306 Bacteria 1270
359 Ga0163162_11732298 3300013306 Unclassified 714
360 Ga0157375_10001072 3300013308 Bacteria 23694
361 Ga0157375_10026319 3300013308 Bacteria 5419
362 Ga0157375_10124502 3300013308 Bacteria 2691
363 Ga0157375_10317252 3300013308 Bacteria 1723
364 Ga0157375_10372509 3300013308 Unclassified 1594
365 Ga0157375_11632579 3300013308 Bacteria 762
366 Ga0157375_11687027 3300013308 Bacteria 750
367 Ga0157375_13429629 3300013308 Unclassified 528
368 Ga0163163_10001788 3300014325 Bacteria 18118
369 Ga0163163_10003356 3300014325 Bacteria 13589
370 Ga0163163_10007729 3300014325 Bacteria 9499
371 Ga0163163_10015244 3300014325 Bacteria 7101
372 Ga0163163_10025943 3300014325 Bacteria 5594
373 Ga0163163_10083615 3300014325 Bacteria 3197
374 Ga0163163_10879280 3300014325 Unclassified 959
375 Ga0157380_10004650 3300014326 Bacteria 9549
376 Ga0157380_10080895 3300014326 Bacteria 2656
377 Ga0157380_10119499 3300014326 Unclassified 2229
378 Ga0157380_10161679 3300014326 Bacteria 1947
379 Ga0157380_10224796 3300014326 Unclassified 1682
380 Ga0157380_10259369 3300014326 Bacteria 1578
381 Ga0157380_10440655 3300014326 Unclassified 1248
382 Ga0157380_10454254 3300014326 Bacteria 1231
383 Ga0157380_10930607 3300014326 Bacteria 898
384 Ga0157377_10026456 3300014745 Bacteria 3105
385 Ga0157377_10061076 3300014745 Unclassified 2153
386 Ga0157377_10287816 3300014745 Bacteria 1080
387 Ga0157377_10561444 3300014745 Unclassified 808
388 Ga0157377_10642461 3300014745 Bacteria 763
389 Ga0157379_10004162 3300014968 Bacteria 12350
390 Ga0157379_10140108 3300014968 Bacteria 2180
391 Ga0157379_10324571 3300014968 Unclassified 1406
392 Ga0157379_10701288 3300014968 Bacteria 950
393 Ga0157376_10125025 3300014969 Bacteria 2286
394 Ga0157376_10463910 3300014969 Bacteria 1238
395 Ga0157376_11579021 3300014969 Unclassified 690
396 Ga0163161_10018807 3300017792 Bacteria 4842
397 Ga0163161_10301816 3300017792 Bacteria 1261
398 Ga0163161_10311443 3300017792 Bacteria 1242
399 Ga0163161_10815355 3300017792 Unclassified 785
400 Ga0207673_1045190 3300025290 Unclassified 621
401 Ga0207697_10001180 3300025315 Bacteria 14351
402 Ga0207656_10015977 3300025321 Unclassified 2914
403 Ga0207653_10163480 3300025885 Bacteria 825
404 Ga0207682_10001934 3300025893 Bacteria 9413
405 Ga0207682_10030727 3300025893 Bacteria 2153
406 Ga0207682_10042257 3300025893 Bacteria 1862
407 Ga0207682_10116542 3300025893 Bacteria 1181
408 Ga0207642_10058373 3300025899 Bacteria 1780
409 Ga0207642_10262593 3300025899 Unclassified 985
410 Ga0207642_10572988 3300025899 Unclassified 700
411 Ga0207710_10264978 3300025900 Unclassified 862
412 Ga0207710_10386735 3300025900 Unclassified 717
413 Ga0207688_10087687 3300025901 Bacteria 1784
414 Ga0207680_10023192 3300025903 Bacteria 3385
415 Ga0207680_10025944 3300025903 Bacteria 3240
416 Ga0207680_10043712 3300025903 Bacteria 2629
417 Ga0207680_10096308 3300025903 Bacteria 1893
418 Ga0207680_10146229 3300025903 Unclassified 1571
419 Ga0207680_10296428 3300025903 Unclassified 1126
420 Ga0207645_10005081 3300025907 Bacteria 9632
421 Ga0207645_10023418 3300025907 Bacteria 4015
422 Ga0207645_10853045 3300025907 Unclassified 619
423 Ga0207643_10000159 3300025908 Bacteria 46587
424 Ga0207643_10200765 3300025908 Unclassified 1214
425 Ga0207643_10262277 3300025908 Bacteria 1067
426 Ga0207643_10360628 3300025908 Bacteria 914
427 Ga0207643_10985073 3300025908 Bacteria 545
428 Ga0207707_10738960 3300025912 Bacteria 824
429 Ga0207660_11306840 3300025917 Unclassified 589
430 Ga0207662_10003427 3300025918 Bacteria 8160
431 Ga0207662_10126910 3300025918 Bacteria 1605
432 Ga0207662_10207591 3300025918 Bacteria 1270
433 Ga0207662_10233624 3300025918 Bacteria 1202
434 Ga0207662_10242525 3300025918 Bacteria 1180
435 Ga0207662_10317952 3300025918 Unclassified 1039
436 Ga0207657_10794306 3300025919 Bacteria 732
437 Ga0207649_10010328 3300025920 Bacteria 5127
438 Ga0207649_10056867 3300025920 Bacteria 2444
439 Ga0207646_10050750 3300025922 Unclassified 3712
440 Ga0207646_10743404 3300025922 Bacteria 875
441 Ga0207681_10034947 3300025923 Bacteria 3309
442 Ga0207681_10056688 3300025923 Unclassified 2673
443 Ga0207681_10315021 3300025923 Bacteria 1242
444 Ga0207681_10401729 3300025923 Unclassified 1107
445 Ga0207681_10621720 3300025923 Bacteria 894
446 Ga0207681_10660491 3300025923 Unclassified 867
447 Ga0207694_10021205 3300025924 Bacteria 4921
448 Ga0207694_11119653 3300025924 Bacteria 666
449 Ga0207650_10006071 3300025925 Bacteria 8240
450 Ga0207650_10065366 3300025925 Unclassified 2725
451 Ga0207650_10117417 3300025925 Unclassified 2067
452 Ga0207650_10192340 3300025925 Bacteria 1631
453 Ga0207650_10441484 3300025925 Bacteria 1082
454 Ga0207659_10000841 3300025926 Bacteria 18164
455 Ga0207659_10001555 3300025926 Bacteria 13627
456 Ga0207659_10002425 3300025926 Bacteria 11112
457 Ga0207659_10012937 3300025926 Bacteria 5329
458 Ga0207659_10038635 3300025926 Bacteria 3322
459 Ga0207659_10052256 3300025926 Bacteria 2910
460 Ga0207659_10107464 3300025926 Unclassified 2115
461 Ga0207659_10213242 3300025926 Bacteria 1549
462 Ga0207659_10327064 3300025926 Bacteria 1266
463 Ga0207659_10353834 3300025926 Bacteria 1219
464 Ga0207659_11183555 3300025926 Unclassified 657
465 Ga0207659_11274742 3300025926 Bacteria 631
466 Ga0207687_10027739 3300025927 Bacteria 3801
467 Ga0207687_10345528 3300025927 Bacteria 1211
468 Ga0207687_10481723 3300025927 Unclassified 1033
469 Ga0207644_10049043 3300025931 Bacteria 3021
470 Ga0207644_10075379 3300025931 Bacteria 2479
471 Ga0207644_10115534 3300025931 Bacteria 2035
472 Ga0207644_10163414 3300025931 Unclassified 1732
473 Ga0207644_10384891 3300025931 Bacteria 1144
474 Ga0207644_10828425 3300025931 Unclassified 774
475 Ga0207706_10012348 3300025933 Bacteria 7780
476 Ga0207706_10032713 3300025933 Bacteria 4629
477 Ga0207706_10074978 3300025933 Unclassified 2975
478 Ga0207706_10148201 3300025933 Unclassified 2064
479 Ga0207706_10185466 3300025933 Bacteria 1827
480 Ga0207706_11202096 3300025933 Unclassified 630
481 Ga0207706_11256033 3300025933 Bacteria 613
482 Ga0207686_10006258 3300025934 Bacteria 6402
483 Ga0207686_10093069 3300025934 Unclassified 1995
484 Ga0207686_11369746 3300025934 Bacteria 582
485 Ga0207709_10011184 3300025935 Bacteria 4951
486 Ga0207709_10119618 3300025935 Bacteria 1776
487 Ga0207709_10542341 3300025935 Unclassified 914
488 Ga0207670_10006408 3300025936 Bacteria 6524
489 Ga0207670_10016964 3300025936 Unclassified 4391
490 Ga0207670_10083075 3300025936 Bacteria 2246
491 Ga0207670_10091067 3300025936 Bacteria 2156
492 Ga0207670_10364193 3300025936 Bacteria 1148
493 Ga0207670_11094792 3300025936 Bacteria 672
494 Ga0207669_10033107 3300025937 Bacteria 2912
495 Ga0207669_10097317 3300025937 Unclassified 1935
496 Ga0207704_10005025 3300025938 Bacteria 6083
497 Ga0207704_10272432 3300025938 Unclassified 1282
498 Ga0207704_10394290 3300025938 Bacteria 1090
499 Ga0207704_10457940 3300025938 Bacteria 1019
500 Ga0207691_10016674 3300025940 Bacteria 6976
501 Ga0207691_10018555 3300025940 Bacteria 6593
502 Ga0207691_10024688 3300025940 Bacteria 5652
503 Ga0207691_10034073 3300025940 Bacteria 4739
504 Ga0207691_10086049 3300025940 Bacteria 2821
505 Ga0207691_10140733 3300025940 Unclassified 2127
506 Ga0207691_10221724 3300025940 Bacteria 1639
507 Ga0207691_10366993 3300025940 Bacteria 1230
508 Ga0207691_10682971 3300025940 Bacteria 866
509 Ga0207711_10004134 3300025941 Bacteria 12428
510 Ga0207711_10004332 3300025941 Bacteria 12120
511 Ga0207711_10005773 3300025941 Bacteria 10453
512 Ga0207711_10035359 3300025941 Bacteria 4234
513 Ga0207711_10114843 3300025941 Unclassified 2398
514 Ga0207711_10433922 3300025941 Bacteria 1222
515 Ga0207689_10001069 3300025942 Bacteria 26389
516 Ga0207689_10046884 3300025942 Bacteria 3570
517 Ga0207689_10122265 3300025942 Bacteria 2141
518 Ga0207689_10138431 3300025942 Bacteria 2005
519 Ga0207689_10828071 3300025942 Bacteria 781
520 Ga0207689_10829261 3300025942 Unclassified 780
521 Ga0207689_10839630 3300025942 Unclassified 775
522 Ga0207661_10062871 3300025944 Bacteria 3005
523 Ga0207679_10043077 3300025945 Unclassified 3248
524 Ga0207679_10070833 3300025945 Bacteria 2628
525 Ga0207679_10121602 3300025945 Unclassified 2079
526 Ga0207679_10186587 3300025945 Bacteria 1720
527 Ga0207679_10192612 3300025945 Bacteria 1696
528 Ga0207679_10873758 3300025945 Unclassified 822
529 Ga0207679_11022766 3300025945 Unclassified 757
530 Ga0207651_10012391 3300025960 Bacteria 4825
531 Ga0207651_10019054 3300025960 Bacteria 4102
532 Ga0207651_10033604 3300025960 Bacteria 3310
533 Ga0207651_10256556 3300025960 Unclassified 1433
534 Ga0207651_10296132 3300025960 Unclassified 1343
535 Ga0207651_10329420 3300025960 Bacteria 1279
536 Ga0207651_10531554 3300025960 Bacteria 1020
537 Ga0207651_10673610 3300025960 Unclassified 909
538 Ga0207712_10483712 3300025961 Bacteria 1056
539 Ga0207712_10835288 3300025961 Bacteria 811
540 Ga0207712_10886565 3300025961 Unclassified 788
541 Ga0207668_10182663 3300025972 Bacteria 1656
542 Ga0207640_10260390 3300025981 Bacteria 1351
543 Ga0207658_10023628 3300025986 Bacteria 4293
544 Ga0207658_10092188 3300025986 Bacteria 2353
545 Ga0207703_10030776 3300026035 Bacteria 4241
546 Ga0207703_10042288 3300026035 Bacteria 3654
547 Ga0207703_10069257 3300026035 Bacteria 2909
548 Ga0207703_10266861 3300026035 Bacteria 1549
549 Ga0207703_10430225 3300026035 Bacteria 1230
550 Ga0207703_10584675 3300026035 Bacteria 1055
551 Ga0207703_10651309 3300026035 Unclassified 999
552 Ga0207678_11708868 3300026067 Bacteria 552
553 Ga0207708_10017715 3300026075 Bacteria 5361
554 Ga0207708_10048558 3300026075 Bacteria 3231
555 Ga0207708_10084282 3300026075 Bacteria 2444
556 Ga0207708_10159206 3300026075 Bacteria 1782
557 Ga0207708_10269995 3300026075 Unclassified 1376
558 Ga0207708_10358712 3300026075 Bacteria 1198
559 Ga0207708_10382588 3300026075 Bacteria 1161
560 Ga0207641_10002879 3300026088 Bacteria 15594
561 Ga0207641_10069452 3300026088 Bacteria 3024
562 Ga0207641_10090150 3300026088 Bacteria 2680
563 Ga0207641_10368006 3300026088 Bacteria 1374
564 Ga0207641_10425827 3300026088 Bacteria 1279
565 Ga0207641_10433338 3300026088 Unclassified 1268
566 Ga0207641_10474880 3300026088 Unclassified 1211
567 Ga0207641_10826429 3300026088 Unclassified 917
568 Ga0207641_11193649 3300026088 Unclassified 760
569 Ga0207648_10000144 3300026089 Bacteria 70822
570 Ga0207648_10061191 3300026089 Unclassified 3283
571 Ga0207648_10097393 3300026089 Bacteria 2574
572 Ga0207648_10363647 3300026089 Bacteria 1306
573 Ga0207648_10603230 3300026089 Unclassified 1012
574 Ga0207676_10007263 3300026095 Bacteria 7848
575 Ga0207676_10018703 3300026095 Bacteria 5043
576 Ga0207676_10064138 3300026095 Bacteria 2920
577 Ga0207676_10064898 3300026095 Bacteria 2905
578 Ga0207676_10246104 3300026095 Unclassified 1607
579 Ga0207676_10285976 3300026095 Bacteria 1499
580 Ga0207676_10997987 3300026095 Bacteria 825
581 Ga0207674_10033506 3300026116 Bacteria 5377
582 Ga0207674_10394720 3300026116 Unclassified 1337
583 Ga0207674_10467137 3300026116 Bacteria 1219
584 Ga0207675_100001527 3300026118 Bacteria 23210
585 Ga0207675_100005366 3300026118 Bacteria 12304
586 Ga0207675_100135999 3300026118 Bacteria 2332
587 Ga0207675_100218627 3300026118 Bacteria 1835
588 Ga0207675_100276428 3300026118 Bacteria 1631
589 Ga0207675_100393007 3300026118 Bacteria 1365
590 Ga0207675_102407935 3300026118 Unclassified 539
591 Ga0207683_10066511 3300026121 Bacteria 3178
592 Ga0207683_10162619 3300026121 Unclassified 2019
593 Ga0207683_10175307 3300026121 Unclassified 1943
594 Ga0207683_10183766 3300026121 Unclassified 1896
595 Ga0207683_10208162 3300026121 Unclassified 1779
596 Ga0207683_10209605 3300026121 Bacteria 1773
597 Ga0207683_10346977 3300026121 Bacteria 1362
598 Ga0207683_10423277 3300026121 Bacteria 1226
599 Ga0207698_10050207 3300026142 Unclassified 3181
600 Ga0209968_1019649 3300027526 Unclassified 1088
601 Ga0209966_1010278 3300027695 Unclassified 1684
602 Ga0209974_10098630 3300027876 Bacteria 1019
603 Ga0209974_10385263 3300027876 Unclassified 548
604 Ga0207428_10001804 3300027907 Bacteria 21928
605 Ga0207428_10003100 3300027907 Bacteria 16343
606 Ga0207428_10003706 3300027907 Bacteria 14677
607 Ga0207428_10008705 3300027907 Bacteria 9157
608 Ga0207428_10009673 3300027907 Bacteria 8638
609 Ga0207428_10034008 3300027907 Bacteria 4180
610 Ga0207428_10589839 3300027907 Unclassified 801
611 Ga0268266_10056441 3300028379 Bacteria 3379
612 Ga0268266_10062923 3300028379 Bacteria 3203
613 Ga0268266_11699810 3300028379 Unclassified 606
614 Ga0268265_10259330 3300028380 Bacteria 1544
615 Ga0268265_10262907 3300028380 Unclassified 1535
616 Ga0268265_10758723 3300028380 Bacteria 942
617 Ga0268265_11101317 3300028380 Bacteria 788
618 Ga0268265_11107209 3300028380 Unclassified 786
619 Ga0268265_11562481 3300028380 Unclassified 664
620 Ga0268265_11598026 3300028380 Unclassified 657
621 Ga0268265_11619829 3300028380 Bacteria 652
622 Ga0268265_12039332 3300028380 Unclassified 581
623 Ga0268264_10002648 3300028381 Bacteria 15644
624 Ga0268264_10049790 3300028381 Bacteria 3487
625 Ga0268264_10091534 3300028381 Bacteria 2623
626 Ga0307408_100059564 3300031548 Unclassified 2779
627 Ga0307408_100339364 3300031548 Bacteria 1271
628 Ga0307408_100739832 3300031548 Bacteria 887
629 Ga0307408_102025303 3300031548 Bacteria 554
630 Ga0307405_10000362 3300031731 Bacteria 16968
631 Ga0307405_10904754 3300031731 Unclassified 747
632 Ga0307405_11626558 3300031731 Bacteria 571
633 Ga0307413_10069812 3300031824 Bacteria 2206
634 Ga0307413_10397458 3300031824 Bacteria 1079
635 Ga0307410_10034733 3300031852 Unclassified 3269
636 Ga0307407_10000549 3300031903 Bacteria 11742
637 Ga0307407_10916426 3300031903 Bacteria 673
638 Ga0307412_10325888 3300031911 Bacteria 1224
639 Ga0307412_10573174 3300031911 Bacteria 951
640 Ga0307409_100223976 3300031995 Bacteria 1700
641 Ga0307416_100001556 3300032002 Bacteria 12557
642 Ga0307416_100620374 3300032002 Bacteria 1163
643 Ga0307416_101127962 3300032002 Bacteria 889
644 Ga0307416_102547687 3300032002 Unclassified 610
645 Ga0307414_10256487 3300032004 Bacteria 1457
646 Ga0307414_10280768 3300032004 Bacteria 1399
647 Ga0307414_10623570 3300032004 Unclassified 970
648 Ga0307411_10001978 3300032005 Bacteria 8793
649 Ga0307411_10353872 3300032005 Bacteria 1198
650 Ga0307411_10890869 3300032005 Bacteria 790
651 Ga0307411_11091091 3300032005 Unclassified 719
652 Ga0307415_100025855 3300032126 Bacteria 3694
653 Ga0307415_100640715 3300032126 Bacteria 951
654 Ga0373949_0013453 3300035090 Bacteria 1814
655 Ga0373951_0033828 3300035091 Bacteria 1213
656 Ga0373945_0288721 3300035116 Bacteria 700
657 Ga0373946_0408235 3300035171 Bacteria 686
658 Ga0373955_0762071 3300035172 Unclassified 595
659 Ga0373961_0055751 3300035241 Bacteria 1185
660 Ga0373931_0078371 3300035691 Bacteria 1818
661 Ga0373931_0237493 3300035691 Unclassified 1104
662 Ga0373927_0801258 3300035695 Unclassified 622
663 Ga0373933_1039189 3300035724 Unclassified 540
664 Ga0373947_0277460 3300035725 Bacteria 1114
665 Ga0373937_0027789 3300036401 Bacteria 5118
666 Ga0373937_0752773 3300036401 Bacteria 922
667 Ga0373925_0998657 3300037068 Bacteria 689
668 Ga0439461_0067284 3300041410 Unclassified 824
669 Ga0439441_054748 3300042001 Bacteria 829
670 Ga0439455_0128002 3300042012 Unclassified 715
671 Ga0439435_0009690 3300042436 Unclassified 2266
672 Ga0439444_0173600 3300042437 Unclassified 532
673 Ga0439440_0025192 3300042993 Bacteria 1369
674 Ga0439440_0047967 3300042993 Bacteria 1060
675 Ga0451576_0280304 3300045051 Bacteria 1743
676 Ga0495603_0228679 3300046455 Bacteria 1072
677 Ga0495653_0606899 3300046463 Unclassified 672
678 Ga0495582_0103558 3300046473 Unclassified 1595
679 Ga0495639_0231743 3300046475 Unclassified 910
680 Ga0495639_0439441 3300046475 Bacteria 662
681 Ga0495608_0009454 3300046511 Bacteria 6814
682 Ga0495618_0597780 3300046514 Bacteria 657
683 Ga0495630_0554468 3300046517 Bacteria 881
684 Ga0495666_0254939 3300046526 Bacteria 799
685 Ga0495598_0020219 3300046537 Bacteria 1756
686 Ga0495598_0106928 3300046537 Unclassified 933
687 Ga0495621_0020244 3300046539 Bacteria 2182
688 Ga0495667_0006407 3300046559 Bacteria 7981
689 Ga0495634_0164550 3300046642 Bacteria 1397
690 Ga0495657_0067792 3300046675 Bacteria 2340
691 Ga0495658_0023121 3300046683 Unclassified 3297
692 Ga0495658_0085324 3300046683 Unclassified 1861
693 Ga0495658_0303928 3300046683 Unclassified 1009
694 Ga0495669_0243147 3300046684 Bacteria 864
695 Ga0495613_0450685 3300046689 Unclassified 872
696 Ga0495670_0149919 3300046691 Bacteria 1223
697 Ga0495636_0115748 3300047318 Bacteria 1183
698 Ga0495636_0292867 3300047318 Bacteria 760
699 Ga0495674_0404716 3300047319 Bacteria 1101
700 Ga0495676_0678716 3300047321 Bacteria 667
701 Ga0495675_0403556 3300047444 Unclassified 797
702 Ga0496104_0069923 3300048907 Bacteria 3337
703 Ga0496106_0225901 3300048909 Unclassified 1494
704 Ga0496106_0797927 3300048909 Bacteria 749
705 Ga0496109_0007083 3300048912 Bacteria 9465
706 Ga0496109_0441780 3300048912 Bacteria 1229
707 Ga0496110_0188477 3300048913 Bacteria 1873
708 Ga0496112_0009935 3300048915 Bacteria 8609
709 Ga0496113_0115016 3300048916 Unclassified 2098
710 Ga0496113_0217235 3300048916 Archaea 1523
711 Ga0496114_0011037 3300048917 Bacteria 7205
712 Ga0496115_0055264 3300048918 Bacteria 3189
713 Ga0501036_0201897 3300049572 Unclassified 1672
714 Ga0501037_0127783 3300049573 Unclassified 1824
715 Ga0501038_0212235 3300049574 Bacteria 1548
716 Ga0501039_0194353 3300049575 Bacteria 1595
717 Ga0501039_0735558 3300049575 Unclassified 771
718 Ga0501040_0105348 3300049576 Bacteria 1970
719 Ga0501041_0125685 3300049577 Bacteria 1596
720 Ga0501041_0695235 3300049577 Unclassified 651
721 Ga0501042_0472146 3300049578 Unclassified 910
722 Ga0501046_0149016 3300049580 Bacteria 1766
723 Ga0501071_0056096 3300049587 Unclassified 2845
724 Ga0501072_0123086 3300049588 Bacteria 2066
725 Ga0501072_0160873 3300049588 Bacteria 1791
726 Ga0501074_0047194 3300049590 Unclassified 3114
727 Ga0501075_0029509 3300049591 Bacteria 4057
728 Ga0501075_0188127 3300049591 Bacteria 1575
729 Ga0501075_0400040 3300049591 Bacteria 1047
730 Ga0501075_0497307 3300049591 Bacteria 930
731 Ga0501076_0310784 3300049592 Bacteria 1292
732 Ga0501077_0500568 3300049593 Bacteria 779
733 Ga0501223_118002 3300049663 Bacteria 559
734 Ga0501079_0235809 3300049741 Bacteria 1429
735 Ga0501079_1221342 3300049741 Bacteria 592
736 Ga0501080_0281980 3300049742 Bacteria 1510
737 nmdc:mga05p37_103911_c1 3300050507 Unclassified 3496
738 nmdc:mga05p37_117462_c1 3300050507 Bacteria 3269
739 nmdc:mga05p37_272284_c1 3300050507 Unclassified 2022
740 nmdc:mga05p37_28105_c1 3300050507 Bacteria 6855
741 nmdc:mga05p37_3734_c1 3300050507 Bacteria 17818
742 nmdc:mga05p37_41181_c1 3300050507 Bacteria 5672
743 nmdc:mga05p37_425599_c1 3300050507 Unclassified 1544
744 nmdc:mga05p37_7210_c1 3300050507 Bacteria 13118
745 nmdc:mga09592_1137663_c1 3300050508 Bacteria 647
746 nmdc:mga09592_115975_c1 3300050508 Unclassified 2298
747 nmdc:mga09592_142784_c1 3300050508 Bacteria 2064
748 nmdc:mga09592_28488_c1 3300050508 Bacteria 4640
749 nmdc:mga09592_309188_c1 3300050508 Bacteria 1370
750 nmdc:mga09592_382097_c1 3300050508 Bacteria 1218
751 nmdc:mga09592_487168_c1 3300050508 Bacteria 1062
752 nmdc:mga09592_861953_c1 3300050508 Unclassified 763
753 nmdc:mga0qj67_101340_c1 3300050509 Bacteria 2321
754 nmdc:mga0qj67_11290_c1 3300050509 Bacteria 6690
755 nmdc:mga0qj67_1929_c1 3300050509 Bacteria 14733
756 nmdc:mga0qj67_384085_c1 3300050509 Unclassified 1134
757 nmdc:mga06r32_1971_c2 3300050510 Bacteria 13750
758 nmdc:mga06r32_30791_c1 3300050510 Bacteria 5035
759 nmdc:mga06r32_62226_c1 3300050510 Plasmid 3595
760 nmdc:mga06r32_666882_c1 3300050510 Unclassified 1007
761 nmdc:mga06r32_90276_c1 3300050510 Bacteria 2993
762 nmdc:mga08y16_10271_c1 3300050511 Bacteria 9826
763 nmdc:mga08y16_1141_c1 3300050511 Bacteria 26134
764 nmdc:mga08y16_1330447_c1 3300050511 Bacteria 684
765 nmdc:mga08y16_142722_c1 3300050511 Unclassified 2490
766 nmdc:mga08y16_219670_c1 3300050511 Bacteria 1968
767 nmdc:mga08y16_23495_c1 3300050511 Bacteria 6514
768 nmdc:mga08y16_300989_c1 3300050511 Unclassified 1653
769 nmdc:mga08y16_375939_c1 3300050511 Bacteria 1457
770 nmdc:mga08y16_65000_c1 3300050511 Bacteria 3808
771 nmdc:mga08y16_85570_c1 3300050511 Bacteria 3286
772 nmdc:mga08y16_929415_c1 3300050511 Bacteria 854
773 nmdc:mga08y16_946364_c1 3300050511 Bacteria 845
774 nmdc:mga08y16_969_c1 3300050511 Bacteria 27918
775 nmdc:mga0n895_1245229_c1 3300050512 Unclassified 717
776 nmdc:mga0n895_17462_c1 3300050512 Bacteria 6611
777 nmdc:mga0n895_2115636_c1 3300050512 Bacteria 519
778 nmdc:mga0n895_286284_c1 3300050512 Unclassified 1671
779 nmdc:mga0n895_610537_c1 3300050512 Archaea 1092
780 nmdc:mga0n895_61759_c1 3300050512 Unclassified 3701
781 nmdc:mga0n895_641982_c1 3300050512 Bacteria 1061
782 nmdc:mga0n895_67776_c1 3300050512 Bacteria 3534
783 nmdc:mga0n895_9826_c1 3300050512 Bacteria 8410
784 nmdc:mga0rr50_25471_c1 3300050513 Unclassified 4113
785 nmdc:mga0rr50_306233_c1 3300050513 Unclassified 1330
786 nmdc:mga0a205_1063_c1 3300050515 Bacteria 22834
787 nmdc:mga0a205_17812_c1 3300050515 Bacteria 6666
788 nmdc:mga0a205_192_c1 3300050515 Bacteria 42287
789 nmdc:mga0a205_205489_c1 3300050515 Unclassified 1859
790 nmdc:mga0a205_34247_c1 3300050515 Bacteria 4873
791 nmdc:mga0a205_400873_c1 3300050515 Unclassified 1236
792 Ga0495601_0302189 3300053077 Bacteria 1042
793 Ga0495619_0054270 3300053085 Bacteria 2652
794 Ga0501084_0103107 3300054114 Bacteria 2396
795 Ga0530510_0294990 3300061734 Bacteria 1213
796 Ga0207697_10032731
797 JGI24746J21847_1056048
798 Ga0065714_10023432
799 Ga0065704_10339178
800 Ga0065712_10208310
801 Ga0065715_10016496
802 Ga0065715_10216403
803 Ga0065707_10207455
804 Ga0070676_10039191
805 Ga0070676_10928700
806 Ga0070690_100072515
807 Ga0070690_100386863
808 Ga0070690_100642066
809 Ga0070690_101132632
810 Ga0070670_100000843
811 Ga0070670_100006680
812 Ga0070670_100061567
813 Ga0070670_100918914
814 Ga0070670_101241482
815 Ga0070677_10011045
816 Ga0070677_10027880
817 Ga0070677_10039383
818 Ga0070677_10064434
819 Ga0068869_100004142
820 Ga0068869_100040032
821 Ga0068869_100078273
822 Ga0068869_100111682
823 Ga0068869_101099014
824 Ga0070666_10037305
825 Ga0070666_10068865
826 Ga0070666_10074903
827 Ga0070666_10157066
828 Ga0070666_10275661
829 Ga0070680_100403350
830 Ga0070682_100785492
831 Ga0070682_101888280
832 Ga0068868_100003433
833 Ga0068868_100028383
834 Ga0070660_100207765
835 Ga0070689_100013164
836 Ga0070689_100024351
837 Ga0070689_100033157
838 Ga0070689_100188313
839 Ga0070689_100565390
840 Ga0070691_10076225
841 Ga0070687_100070255
842 Ga0070687_100172358
843 Ga0070687_100372174
844 Ga0070687_101471455
845 Ga0070661_100017358
846 Ga0070661_100039135
847 Ga0070661_100278218
848 Ga0070661_100285786
849 Ga0070661_101520422
850 Ga0070692_10034740
851 Ga0070668_100060467
852 Ga0070669_100019761
853 Ga0070669_100068380
854 Ga0070669_100275353
855 Ga0070669_100286814
856 Ga0070669_100301198
857 Ga0070669_100386094
858 Ga0070669_100769752
859 Ga0070669_100926933
860 Ga0070669_100937552
861 Ga0070675_100002303
862 Ga0070675_100002853
863 Ga0070675_100006305
864 Ga0070675_100007497
865 Ga0070675_100016756
866 Ga0070675_100030785
867 Ga0070675_100043212
868 Ga0070675_100220656
869 Ga0070675_100236394
870 Ga0070675_100654183
871 Ga0070675_100710798
872 Ga0070675_100782036
873 Ga0070671_100006870
874 Ga0070671_100017189
875 Ga0070671_100021188
876 Ga0070671_100098936
877 Ga0070671_100153190
878 Ga0070671_100192415
879 Ga0070671_100558070
880 Ga0070671_100901224
881 Ga0070674_100103190
882 Ga0070674_100148105
883 Ga0070674_100183585
884 Ga0070674_100347551
885 Ga0070673_100021514
886 Ga0070673_100036245
887 Ga0070673_100041898
888 Ga0070673_100048316
889 Ga0070673_100117312
890 Ga0070673_100123851
891 Ga0070673_100227779
892 Ga0070673_100489831
893 Ga0070673_101853581
894 Ga0070688_100012074
895 Ga0070688_100021121
896 Ga0070688_100031670
897 Ga0070688_100140175
898 Ga0070688_100254526
899 Ga0070667_100024150
900 Ga0070667_100048177
901 Ga0070667_100572069
902 Ga0070667_100818876
903 Ga0070667_100881606
904 Ga0070701_10012292
905 Ga0070701_10243892
906 Ga0070701_10913437
907 Ga0070705_100039714
908 Ga0070705_100350763
909 Ga0070700_100011177
910 Ga0070700_100017529
911 Ga0070700_100035848
912 Ga0070700_100063339
913 Ga0070694_100285104
914 Ga0070708_100702421
915 Ga0070663_100546394
916 Ga0070663_100667217
917 Ga0070678_100049666
918 Ga0070678_100187893
919 Ga0070678_100189037
920 Ga0070678_100327391
921 Ga0070678_100454553
922 Ga0070662_100121102
923 Ga0070662_100266043
924 Ga0070662_100539591
925 Ga0068867_100001370
926 Ga0068867_100289470
927 Ga0068867_100505019
928 Ga0068867_101782019
929 Ga0070685_10012551
930 Ga0070685_10017221
931 Ga0070685_10035756
932 Ga0070685_10172456
933 Ga0070685_10604304
934 Ga0070685_10742514
935 Ga0070707_100629879
936 Ga0070707_100778968
937 Ga0070698_100358460
938 Ga0070698_100418276
939 Ga0070672_100029951
940 Ga0070672_100032973
941 Ga0070672_100046977
942 Ga0070672_100069005
943 Ga0070672_100107235
944 Ga0070672_100143783
945 Ga0070672_100151338
946 Ga0070672_100973656
947 Ga0070672_101038400
948 Ga0070686_100031861
949 Ga0070686_100103021
950 Ga0070686_100150016
951 Ga0070686_100495892
952 Ga0070686_101172256
953 Ga0070686_101306813
954 Ga0070695_100848996
955 Ga0070696_100406045
956 Ga0070696_101174321
957 Ga0070665_100010787
958 Ga0070665_100055988
959 Ga0070665_100425935
960 Ga0070704_100008307
961 Ga0070704_100380611
962 Ga0070704_100620302
963 Ga0070664_100004268
964 Ga0070664_100012492
965 Ga0070664_100025298
966 Ga0070664_100059672
967 Ga0070664_100101985
968 Ga0070664_100111838
969 Ga0070664_100878867
970 Ga0070664_101885278
971 Ga0068857_100091032
972 Ga0068857_100311030
973 Ga0068857_101134771
974 Ga0068854_101141884
975 Ga0070702_100011887
976 Ga0070702_100460142
977 Ga0068852_100084046
978 Ga0068852_101799431
979 Ga0068859_100001352
980 Ga0068859_100005199
981 Ga0068859_100018930
982 Ga0068859_100028698
983 Ga0068859_100031350
984 Ga0068859_100035372
985 Ga0068859_100334405
986 Ga0068859_101245393
987 Ga0068859_101782636
988 Ga0068859_102050459
989 Ga0068864_100011896
990 Ga0068864_100023353
991 Ga0068864_100068318
992 Ga0068864_100074796
993 Ga0068864_100303294
994 Ga0068864_100455668
995 Ga0068864_100565401
996 Ga0068864_100593079
997 Ga0068864_100947402
998 Ga0068866_10008430
999 Ga0068866_11087563
1000 Ga0068861_100028197
1001 Ga0068861_100044048
1002 Ga0068861_100091078
1003 Ga0068861_100127123
1004 Ga0068861_100825286
1005 Ga0068851_10005482
1006 Ga0068851_10298466
1007 Ga0068870_10009383
1008 Ga0068870_10021357
1009 Ga0068870_10043124
1010 Ga0068870_10163739
1011 Ga0068870_10369976
1012 Ga0068863_100000876
1013 Ga0068863_100002471
1014 Ga0068863_100096328
1015 Ga0068863_100182959
1016 Ga0068863_100398501
1017 Ga0068863_100451969
1018 Ga0068858_100010403
1019 Ga0068858_100039184
1020 Ga0068858_100082722
1021 Ga0068858_100111701
1022 Ga0068858_100630305
1023 Ga0068858_100838194
1024 Ga0068860_100007682
1025 Ga0068860_100133472
1026 Ga0068860_100289010
1027 Ga0068860_100502472
1028 Ga0068862_100295164
1029 Ga0068862_100307308
1030 Ga0068862_100376575
1031 Ga0068862_101288215
1032 Ga0068862_101799075
1033 Ga0081455_10154624
1034 Ga0081539_10128344
1035 Ga0075432_10131897
1036 Ga0070712_100907203
1037 Ga0097621_100001747
1038 Ga0097621_100037747
1039 Ga0097621_100041605
1040 Ga0097621_100100124
1041 Ga0097621_100754771
1042 Ga0097621_101751780
1043 Ga0068871_100006405
1044 Ga0068871_100102254
1045 Ga0068871_100352673
1046 Ga0068871_100567732
1047 Ga0075428_100011163
1048 Ga0075428_100026402
1049 Ga0075428_100141136
1050 Ga0075428_100213365
1051 Ga0075428_100772858
1052 Ga0075430_100008293
1053 Ga0075430_100017551
1054 Ga0075430_100024111
1055 Ga0075430_100267289
1056 Ga0075430_101122015
1057 Ga0075431_100013133
1058 Ga0075431_100014713
1059 Ga0075431_100029184
1060 Ga0075431_100401479
1061 Ga0075431_101009179
1062 Ga0075431_101185493
1063 Ga0075433_10001501
1064 Ga0075433_10012469
1065 Ga0075433_10021617
1066 Ga0075434_100003981
1067 Ga0075434_100016158
1068 Ga0075434_100038544
1069 Ga0075434_100176228
1070 Ga0075434_100224939
1071 Ga0075434_100584040
1072 Ga0075434_100850386
1073 Ga0075434_101263611
1074 Ga0075434_101760445
1075 Ga0075429_100005902
1076 Ga0075429_100056586
1077 Ga0075429_100167492
1078 Ga0075429_100333023
1079 Ga0075429_101563143
1080 Ga0068865_100077411
1081 Ga0068865_100257710
1082 Ga0097620_100001352
1083 Ga0097620_100005199
1084 Ga0097620_100018928
1085 Ga0097620_100028700
1086 Ga0097620_100031351
1087 Ga0097620_100035372
1088 Ga0097620_100334401
1089 Ga0097620_101245397
1090 Ga0097620_101782659
1091 Ga0097620_102050632
1092 Ga0075435_100028898
1093 Ga0075435_100278383
1094 Ga0075435_100453654
1095 Ga0105240_10090853
1096 Ga0111539_10005636
1097 Ga0111539_10007026
1098 Ga0111539_10034841
1099 Ga0111539_10064260
1100 Ga0111539_10123667
1101 Ga0111539_10130044
1102 Ga0111539_10135362
1103 Ga0111539_10151778
1104 Ga0111539_10277202
1105 Ga0111539_11256129
1106 Ga0105245_10298535
1107 Ga0105245_11875473
1108 Ga0105247_10170328
1109 Ga0105247_10878983
1110 Ga0114129_10000775
1111 Ga0114129_10001971
1112 Ga0114129_10111144
1113 Ga0114129_10170228
1114 Ga0114129_10225279
1115 Ga0114129_10551965
1116 Ga0114129_12262664
1117 Ga0105243_10014108
1118 Ga0105243_10112531
1119 Ga0105243_11658847
1120 Ga0105241_11086076
1121 Ga0105242_10003938
1122 Ga0105242_10017227
1123 Ga0105242_10871787
1124 Ga0105242_10905810
1125 Ga0105248_10000888
1126 Ga0105248_10014741
1127 Ga0105248_10177936
1128 Ga0105248_10203456
1129 Ga0105248_10213074
1130 Ga0105248_10306282
1131 Ga0105248_10560896
1132 Ga0105237_11971927
1133 Ga0105238_10000968
1134 Ga0105238_12334656
1135 Ga0105249_10020407
1136 Ga0105249_10690986
1137 Ga0105249_10771275
1138 Ga0105249_11568375
1139 Ga0105249_11682609
1140 Ga0105239_10298730
1141 Ga0105246_10012948
1142 Ga0105246_10086586
1143 Ga0105246_10426854
1144 Ga0105246_11386791
1145 Ga0157371_10203579
1146 Ga0157374_10012816
1147 Ga0157378_10044833
1148 Ga0157378_10335951
1149 Ga0163162_10002089
1150 Ga0163162_10108857
1151 Ga0163162_10226083
1152 Ga0163162_10423810
1153 Ga0163162_10560824
1154 Ga0163162_11732298
1155 Ga0157375_10001072
1156 Ga0157375_10026319
1157 Ga0157375_10124502
1158 Ga0157375_10317252
1159 Ga0157375_10372509
1160 Ga0157375_11632579
1161 Ga0157375_11687027
1162 Ga0157375_13429629
1163 Ga0163163_10001788
1164 Ga0163163_10003356
1165 Ga0163163_10007729
1166 Ga0163163_10015244
1167 Ga0163163_10025943
1168 Ga0163163_10083615
1169 Ga0163163_10879280
1170 Ga0157380_10004650
1171 Ga0157380_10080895
1172 Ga0157380_10119499
1173 Ga0157380_10161679
1174 Ga0157380_10224796
1175 Ga0157380_10259369
1176 Ga0157380_10440655
1177 Ga0157380_10454254
1178 Ga0157380_10930607
1179 Ga0157377_10026456
1180 Ga0157377_10061076
1181 Ga0157377_10287816
1182 Ga0157377_10561444
1183 Ga0157377_10642461
1184 Ga0157379_10004162
1185 Ga0157379_10140108
1186 Ga0157379_10324571
1187 Ga0157379_10701288
1188 Ga0157376_10125025
1189 Ga0157376_10463910
1190 Ga0157376_11579021
1191 Ga0163161_10018807
1192 Ga0163161_10301816
1193 Ga0163161_10311443
1194 Ga0163161_10815355
1195 Ga0207673_1045190
1196 Ga0207697_10001180
1197 Ga0207656_10015977
1198 Ga0207653_10163480
1199 Ga0207682_10001934
1200 Ga0207682_10030727
1201 Ga0207682_10042257
1202 Ga0207682_10116542
1203 Ga0207642_10058373
1204 Ga0207642_10262593
1205 Ga0207642_10572988
1206 Ga0207710_10264978
1207 Ga0207710_10386735
1208 Ga0207688_10087687
1209 Ga0207680_10023192
1210 Ga0207680_10025944
1211 Ga0207680_10043712
1212 Ga0207680_10096308
1213 Ga0207680_10146229
1214 Ga0207680_10296428
1215 Ga0207645_10005081
1216 Ga0207645_10023418
1217 Ga0207645_10853045
1218 Ga0207643_10000159
1219 Ga0207643_10200765
1220 Ga0207643_10262277
1221 Ga0207643_10360628
1222 Ga0207643_10985073
1223 Ga0207707_10738960
1224 Ga0207660_11306840
1225 Ga0207662_10003427
1226 Ga0207662_10126910
1227 Ga0207662_10207591
1228 Ga0207662_10233624
1229 Ga0207662_10242525
1230 Ga0207662_10317952
1231 Ga0207657_10794306
1232 Ga0207649_10010328
1233 Ga0207649_10056867
1234 Ga0207646_10050750
1235 Ga0207646_10743404
1236 Ga0207681_10034947
1237 Ga0207681_10056688
1238 Ga0207681_10315021
1239 Ga0207681_10401729
1240 Ga0207681_10621720
1241 Ga0207681_10660491
1242 Ga0207694_10021205
1243 Ga0207694_11119653
1244 Ga0207650_10006071
1245 Ga0207650_10065366
1246 Ga0207650_10117417
1247 Ga0207650_10192340
1248 Ga0207650_10441484
1249 Ga0207659_10000841
1250 Ga0207659_10001555
1251 Ga0207659_10002425
1252 Ga0207659_10012937
1253 Ga0207659_10038635
1254 Ga0207659_10052256
1255 Ga0207659_10107464
1256 Ga0207659_10213242
1257 Ga0207659_10327064
1258 Ga0207659_10353834
1259 Ga0207659_11183555
1260 Ga0207659_11274742
1261 Ga0207687_10027739
1262 Ga0207687_10345528
1263 Ga0207687_10481723
1264 Ga0207644_10049043
1265 Ga0207644_10075379
1266 Ga0207644_10115534
1267 Ga0207644_10163414
1268 Ga0207644_10384891
1269 Ga0207644_10828425
1270 Ga0207706_10012348
1271 Ga0207706_10032713
1272 Ga0207706_10074978
1273 Ga0207706_10148201
1274 Ga0207706_10185466
1275 Ga0207706_11202096
1276 Ga0207706_11256033
1277 Ga0207686_10006258
1278 Ga0207686_10093069
1279 Ga0207686_11369746
1280 Ga0207709_10011184
1281 Ga0207709_10119618
1282 Ga0207709_10542341
1283 Ga0207670_10006408
1284 Ga0207670_10016964
1285 Ga0207670_10083075
1286 Ga0207670_10091067
1287 Ga0207670_10364193
1288 Ga0207670_11094792
1289 Ga0207669_10033107
1290 Ga0207669_10097317
1291 Ga0207704_10005025
1292 Ga0207704_10272432
1293 Ga0207704_10394290
1294 Ga0207704_10457940
1295 Ga0207691_10016674
1296 Ga0207691_10018555
1297 Ga0207691_10024688
1298 Ga0207691_10034073
1299 Ga0207691_10086049
1300 Ga0207691_10140733
1301 Ga0207691_10221724
1302 Ga0207691_10366993
1303 Ga0207691_10682971
1304 Ga0207711_10004134
1305 Ga0207711_10004332
1306 Ga0207711_10005773
1307 Ga0207711_10035359
1308 Ga0207711_10114843
1309 Ga0207711_10433922
1310 Ga0207689_10001069
1311 Ga0207689_10046884
1312 Ga0207689_10122265
1313 Ga0207689_10138431
1314 Ga0207689_10828071
1315 Ga0207689_10829261
1316 Ga0207689_10839630
1317 Ga0207661_10062871
1318 Ga0207679_10043077
1319 Ga0207679_10070833
1320 Ga0207679_10121602
1321 Ga0207679_10186587
1322 Ga0207679_10192612
1323 Ga0207679_10873758
1324 Ga0207679_11022766
1325 Ga0207651_10012391
1326 Ga0207651_10019054
1327 Ga0207651_10033604
1328 Ga0207651_10256556
1329 Ga0207651_10296132
1330 Ga0207651_10329420
1331 Ga0207651_10531554
1332 Ga0207651_10673610
1333 Ga0207712_10483712
1334 Ga0207712_10835288
1335 Ga0207712_10886565
1336 Ga0207668_10182663
1337 Ga0207640_10260390
1338 Ga0207658_10023628
1339 Ga0207658_10092188
1340 Ga0207703_10030776
1341 Ga0207703_10042288
1342 Ga0207703_10069257
1343 Ga0207703_10266861
1344 Ga0207703_10430225
1345 Ga0207703_10584675
1346 Ga0207703_10651309
1347 Ga0207678_11708868
1348 Ga0207708_10017715
1349 Ga0207708_10048558
1350 Ga0207708_10084282
1351 Ga0207708_10159206
1352 Ga0207708_10269995
1353 Ga0207708_10358712
1354 Ga0207708_10382588
1355 Ga0207641_10002879
1356 Ga0207641_10069452
1357 Ga0207641_10090150
1358 Ga0207641_10368006
1359 Ga0207641_10425827
1360 Ga0207641_10433338
1361 Ga0207641_10474880
1362 Ga0207641_10826429
1363 Ga0207641_11193649
1364 Ga0207648_10000144
1365 Ga0207648_10061191
1366 Ga0207648_10097393
1367 Ga0207648_10363647
1368 Ga0207648_10603230
1369 Ga0207676_10007263
1370 Ga0207676_10018703
1371 Ga0207676_10064138
1372 Ga0207676_10064898
1373 Ga0207676_10246104
1374 Ga0207676_10285976
1375 Ga0207676_10997987
1376 Ga0207674_10033506
1377 Ga0207674_10394720
1378 Ga0207674_10467137
1379 Ga0207675_100001527
1380 Ga0207675_100005366
1381 Ga0207675_100135999
1382 Ga0207675_100218627
1383 Ga0207675_100276428
1384 Ga0207675_100393007
1385 Ga0207675_102407935
1386 Ga0207683_10066511
1387 Ga0207683_10162619
1388 Ga0207683_10175307
1389 Ga0207683_10183766
1390 Ga0207683_10208162
1391 Ga0207683_10209605
1392 Ga0207683_10346977
1393 Ga0207683_10423277
1394 Ga0207698_10050207
1395 Ga0209968_1019649
1396 Ga0209966_1010278
1397 Ga0209974_10098630
1398 Ga0209974_10385263
1399 Ga0207428_10001804
1400 Ga0207428_10003100
1401 Ga0207428_10003706
1402 Ga0207428_10008705
1403 Ga0207428_10009673
1404 Ga0207428_10034008
1405 Ga0207428_10589839
1406 Ga0268266_10056441
1407 Ga0268266_10062923
1408 Ga0268266_11699810
1409 Ga0268265_10259330
1410 Ga0268265_10262907
1411 Ga0268265_10758723
1412 Ga0268265_11101317
1413 Ga0268265_11107209
1414 Ga0268265_11562481
1415 Ga0268265_11598026
1416 Ga0268265_11619829
1417 Ga0268265_12039332
1418 Ga0268264_10002648
1419 Ga0268264_10049790
1420 Ga0268264_10091534
1421 Ga0307408_100059564
1422 Ga0307408_100339364
1423 Ga0307408_100739832
1424 Ga0307408_102025303
1425 Ga0307405_10000362
1426 Ga0307405_10904754
1427 Ga0307405_11626558
1428 Ga0307413_10069812
1429 Ga0307413_10397458
1430 Ga0307410_10034733
1431 Ga0307407_10000549
1432 Ga0307407_10916426
1433 Ga0307412_10325888
1434 Ga0307412_10573174
1435 Ga0307409_100223976
1436 Ga0307416_100001556
1437 Ga0307416_100620374
1438 Ga0307416_101127962
1439 Ga0307416_102547687
1440 Ga0307414_10256487
1441 Ga0307414_10280768
1442 Ga0307414_10623570
1443 Ga0307411_10001978
1444 Ga0307411_10353872
1445 Ga0307411_10890869
1446 Ga0307411_11091091
1447 Ga0307415_100025855
1448 Ga0307415_100640715
1449 Ga0373949_0013453
1450 Ga0373951_0033828
1451 Ga0373945_0288721
1452 Ga0373946_0408235
1453 Ga0373955_0762071
1454 Ga0373961_0055751
1455 Ga0373931_0078371
1456 Ga0373931_0237493
1457 Ga0373927_0801258
1458 Ga0373933_1039189
1459 Ga0373947_0277460
1460 Ga0373937_0027789
1461 Ga0373937_0752773
1462 Ga0373925_0998657
1463 Ga0439461_0067284
1464 Ga0439441_054748
1465 Ga0439455_0128002
1466 Ga0439435_0009690
1467 Ga0439444_0173600
1468 Ga0439440_0025192
1469 Ga0439440_0047967
1470 Ga0451576_0280304
1471 Ga0495603_0228679
1472 Ga0495653_0606899
1473 Ga0495582_0103558
1474 Ga0495639_0231743
1475 Ga0495639_0439441
1476 Ga0495608_0009454
1477 Ga0495618_0597780
1478 Ga0495630_0554468
1479 Ga0495666_0254939
1480 Ga0495598_0020219
1481 Ga0495598_0106928
1482 Ga0495621_0020244
1483 Ga0495667_0006407
1484 Ga0495634_0164550
1485 Ga0495657_0067792
1486 Ga0495658_0023121
1487 Ga0495658_0085324
1488 Ga0495658_0303928
1489 Ga0495669_0243147
1490 Ga0495613_0450685
1491 Ga0495670_0149919
1492 Ga0495636_0115748
1493 Ga0495636_0292867
1494 Ga0495674_0404716
1495 Ga0495676_0678716
1496 Ga0495675_0403556
1497 Ga0496104_0069923
1498 Ga0496106_0225901
1499 Ga0496106_0797927
1500 Ga0496109_0007083
1501 Ga0496109_0441780
1502 Ga0496110_0188477
1503 Ga0496112_0009935
1504 Ga0496113_0115016
1505 Ga0496113_0217235
1506 Ga0496114_0011037
1507 Ga0496115_0055264
1508 Ga0501036_0201897
1509 Ga0501037_0127783
1510 Ga0501038_0212235
1511 Ga0501039_0194353
1512 Ga0501039_0735558
1513 Ga0501040_0105348
1514 Ga0501041_0125685
1515 Ga0501041_0695235
1516 Ga0501042_0472146
1517 Ga0501046_0149016
1518 Ga0501071_0056096
1519 Ga0501072_0123086
1520 Ga0501072_0160873
1521 Ga0501074_0047194
1522 Ga0501075_0029509
1523 Ga0501075_0188127
1524 Ga0501075_0400040
1525 Ga0501075_0497307
1526 Ga0501076_0310784
1527 Ga0501077_0500568
1528 Ga0501223_118002
1529 Ga0501079_0235809
1530 Ga0501079_1221342
1531 Ga0501080_0281980
1532 nmdc:mga05p37_103911_c1
1533 nmdc:mga05p37_117462_c1
1534 nmdc:mga05p37_272284_c1
1535 nmdc:mga05p37_28105_c1
1536 nmdc:mga05p37_3734_c1
1537 nmdc:mga05p37_41181_c1
1538 nmdc:mga05p37_425599_c1
1539 nmdc:mga05p37_7210_c1
1540 nmdc:mga09592_1137663_c1
1541 nmdc:mga09592_115975_c1
1542 nmdc:mga09592_142784_c1
1543 nmdc:mga09592_28488_c1
1544 nmdc:mga09592_309188_c1
1545 nmdc:mga09592_382097_c1
1546 nmdc:mga09592_487168_c1
1547 nmdc:mga09592_861953_c1
1548 nmdc:mga0qj67_101340_c1
1549 nmdc:mga0qj67_11290_c1
1550 nmdc:mga0qj67_1929_c1
1551 nmdc:mga0qj67_384085_c1
1552 nmdc:mga06r32_1971_c2
1553 nmdc:mga06r32_30791_c1
1554 nmdc:mga06r32_62226_c1
1555 nmdc:mga06r32_666882_c1
1556 nmdc:mga06r32_90276_c1
1557 nmdc:mga08y16_10271_c1
1558 nmdc:mga08y16_1141_c1
1559 nmdc:mga08y16_1330447_c1
1560 nmdc:mga08y16_142722_c1
1561 nmdc:mga08y16_219670_c1
1562 nmdc:mga08y16_23495_c1
1563 nmdc:mga08y16_300989_c1
1564 nmdc:mga08y16_375939_c1
1565 nmdc:mga08y16_65000_c1
1566 nmdc:mga08y16_85570_c1
1567 nmdc:mga08y16_929415_c1
1568 nmdc:mga08y16_946364_c1
1569 nmdc:mga08y16_969_c1
1570 nmdc:mga0n895_1245229_c1
1571 nmdc:mga0n895_17462_c1
1572 nmdc:mga0n895_2115636_c1
1573 nmdc:mga0n895_286284_c1
1574 nmdc:mga0n895_610537_c1
1575 nmdc:mga0n895_61759_c1
1576 nmdc:mga0n895_641982_c1
1577 nmdc:mga0n895_67776_c1
1578 nmdc:mga0n895_9826_c1
1579 nmdc:mga0rr50_25471_c1
1580 nmdc:mga0rr50_306233_c1
1581 nmdc:mga0a205_1063_c1
1582 nmdc:mga0a205_17812_c1
1583 nmdc:mga0a205_192_c1
1584 nmdc:mga0a205_205489_c1
1585 nmdc:mga0a205_34247_c1
1586 nmdc:mga0a205_400873_c1
1587 Ga0495601_0302189
1588 Ga0495619_0054270
1589 Ga0501084_0103107
1590 Ga0530510_0294990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

13

111

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8417 52 72
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7589 52 72
1sru-assembly1.cif.gz_C crystal structure of full length e. coli ssb protein 0.7548 36 100
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7427 39 72
4ywk-assembly3.cif.gz_B pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7411 36 100
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8847 42 72 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8018 42 76 2.30.29.30
af_Q9TZG4_240_302_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8012 38 72 2.60.40.1180
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7951 42 74 2.130.10.10
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7642 42 70 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A524HRQ9-F1-model_v4 Uncharacterized protein 0.9826 30 123
AF-A0A4Q6B4C5-F1-model_v4 Uncharacterized protein 0.9808 30 124
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9771 30 123
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.967 30 123
AF-A0A2T5GGJ4-F1-model_v4 Uncharacterized protein 0.9599 36 127

Map