F481110

General Info

Members Datasets Scaffolds Average Seq Length
794 432 655 112

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_000262|Ga0495591_000262_9304_9693
Length 129
Sequence VQSIHLHIHPPNKEQTAVDTLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVIPKKPIRTLNDLTEEDKGLAGHILFTAQRLAKELGCEDGFRVVMNCNELGGQTVYHIHMHVLGQRQMNWPPG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231011 Pseudomonas sp. GM30 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231023 Pseudomonas sp. GM80 Isolate Nodule
14 2511231031 Pseudomonas sp. GM16 Isolate Nodule
15 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
16 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
17 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
21 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
22 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
23 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
24 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
25 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
26 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
27 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
28 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
29 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
30 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
31 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
32 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
33 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
34 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
35 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
36 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
37 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
38 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
39 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
40 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
41 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
42 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
43 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
44 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
45 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
46 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
47 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
48 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
49 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
50 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
51 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
52 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
53 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
54 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
55 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
56 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
57 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
58 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
59 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
60 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
61 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
62 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
63 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
64 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
65 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
66 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
67 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
68 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
69 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
70 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
71 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
72 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
73 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
74 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
75 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
76 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
77 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
78 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
79 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
80 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
81 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
82 2773857673 Pseudomonas sp. 443 Isolate Unclassified
83 2784132063 Pseudomonas sp. 424 Isolate Unclassified
84 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
85 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
86 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
87 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
88 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
89 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
90 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
91 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
92 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
93 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
94 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
95 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
96 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
97 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
98 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
99 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
100 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
101 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
102 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
103 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
104 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
105 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
106 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
107 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
108 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
109 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
110 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
111 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
112 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
113 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
114 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
115 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
116 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
117 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
118 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
119 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
120 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
121 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
122 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
123 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
124 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
125 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
126 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
127 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
128 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
134 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
135 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
136 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
137 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
138 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
139 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
140 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
141 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
142 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
143 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
144 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
145 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
146 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
147 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
148 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
149 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
150 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
151 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
159 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
163 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
164 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
165 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
166 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
167 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
168 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
175 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
178 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
179 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
180 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
181 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
193 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
226 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
227 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
248 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
251 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
252 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
260 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
261 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
262 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
263 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
264 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
265 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
266 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
270 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
271 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
350 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
377 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
395 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
411 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
412 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
415 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
420 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
421 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
422 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
423 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
424 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
425 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
426 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
427 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
428 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
429 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
430 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
431 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
432 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.24
Metatranscriptomes 0.25
Isolates 17.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 2.02
Rhizoplane 6.05
Rhizosphere 78.09
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2079529 2162886011 Bacteria 2003
2 JGI26141J51220_1004726 3300003503 Bacteria 845
3 Ga0055536_1002226 3300003781 Bacteria 11039
4 Ga0055530_10000513 3300003791 Bacteria 33776
5 Ga0055530_10002706 3300003791 Bacteria 11022
6 Ga0055530_10057419 3300003791 Bacteria 879
7 Ga0055540_1000426 3300003792 Bacteria 33776
8 Ga0055540_1000516 3300003792 Bacteria 29231
9 Ga0065714_10003982 3300005288 Bacteria 10982
10 Ga0065714_10013467 3300005288 Bacteria 2440
11 Ga0065714_10018129 3300005288 Bacteria 1283
12 Ga0065714_10031746 3300005288 Bacteria 1316
13 Ga0065714_10088528 3300005288 Bacteria 2014
14 Ga0065714_10138835 3300005288 Bacteria 1187
15 Ga0065704_10016620 3300005289 Bacteria 2347
16 Ga0065704_10029536 3300005289 Bacteria 1511
17 Ga0065704_10070839 3300005289 Bacteria 15542
18 Ga0065704_10082761 3300005289 Bacteria 3554
19 Ga0065704_10107455 3300005289 Bacteria 2055
20 Ga0065712_10068271 3300005290 Bacteria 12282
21 Ga0070658_11068322 3300005327 Bacteria 702
22 Ga0070670_100055136 3300005331 Bacteria 3412
23 Ga0070670_100626199 3300005331 Bacteria 964
24 Ga0070677_10230730 3300005333 Bacteria 909
25 Ga0070677_10666426 3300005333 Bacteria 583
26 Ga0070680_100205125 3300005336 Bacteria 1663
27 Ga0070692_10122771 3300005345 Bacteria 1450
28 Ga0070668_100505535 3300005347 Bacteria 1047
29 Ga0070669_100521194 3300005353 Bacteria 988
30 Ga0070675_100506158 3300005354 Bacteria 1089
31 Ga0070671_101278119 3300005355 Bacteria 647
32 Ga0070674_100117082 3300005356 Bacteria 1967
33 Ga0070674_100429091 3300005356 Bacteria 1086
34 Ga0070673_101747872 3300005364 Bacteria 589
35 Ga0070700_100065764 3300005441 Bacteria 2300
36 Ga0070694_100092950 3300005444 Bacteria 2120
37 Ga0070694_101519785 3300005444 Bacteria 567
38 Ga0070663_101889510 3300005455 Bacteria 536
39 Ga0070678_100863396 3300005456 Bacteria 825
40 Ga0070672_100456423 3300005543 Bacteria 1101
41 Ga0070665_100969913 3300005548 Bacteria 862
42 Ga0068855_101599002 3300005563 Bacteria 667
43 Ga0068856_100571006 3300005614 Bacteria 1152
44 Ga0068864_100606555 3300005618 Bacteria 1063
45 Ga0068864_102122317 3300005618 Unclassified 568
46 Ga0068863_100587720 3300005841 Bacteria 1101
47 Ga0068863_101092414 3300005841 Bacteria 802
48 Ga0068863_101435572 3300005841 Unclassified 698
49 Ga0068862_100569153 3300005844 Bacteria 1084
50 Ga0075365_10325229 3300006038 Bacteria 1083
51 Ga0075364_10177853 3300006051 Bacteria 1439
52 Ga0075364_10247907 3300006051 Bacteria 1210
53 Ga0075364_11222676 3300006051 Bacteria 509
54 Ga0075432_10007357 3300006058 Bacteria 3749
55 Ga0075432_10036242 3300006058 Bacteria 1714
56 Ga0075432_10042415 3300006058 Bacteria 1592
57 Ga0075432_10069857 3300006058 Bacteria 1260
58 Ga0075432_10107019 3300006058 Bacteria 1039
59 Ga0075432_10364468 3300006058 Bacteria 615
60 Ga0075362_10162367 3300006177 Bacteria 1076
61 Ga0075362_10393227 3300006177 Bacteria 698
62 Ga0075366_10496181 3300006195 Bacteria 755
63 Ga0068871_101979739 3300006358 Bacteria 554
64 Ga0075428_100067243 3300006844 Bacteria 3923
65 Ga0075428_101071261 3300006844 Bacteria 852
66 Ga0075428_101099077 3300006844 Bacteria 840
67 Ga0075430_100427646 3300006846 Bacteria 1093
68 Ga0075433_10172749 3300006852 Unclassified 1923
69 Ga0075429_101026141 3300006880 Bacteria 721
70 Ga0068865_100249172 3300006881 Bacteria 1401
71 Ga0075436_100463883 3300006914 Bacteria 923
72 Ga0079104_1002096 3300006946 Bacteria 11432
73 Ga0105251_10000322 3300009011 Bacteria 48000
74 Ga0105251_10001209 3300009011 Bacteria 22310
75 Ga0105251_10004229 3300009011 Bacteria 9919
76 Ga0105251_10025863 3300009011 Bacteria 2995
77 Ga0105251_10150016 3300009011 Bacteria 1053
78 Ga0105251_10254405 3300009011 Bacteria 792
79 Ga0105251_10264450 3300009011 Bacteria 776
80 Ga0105244_10001414 3300009036 Bacteria 19428
81 Ga0105244_10099039 3300009036 Bacteria 1427
82 Ga0105244_10132498 3300009036 Bacteria 1202
83 Ga0105244_10136140 3300009036 Bacteria 1183
84 Ga0105244_10239977 3300009036 Bacteria 847
85 Ga0105244_10365250 3300009036 Bacteria 665
86 Ga0105250_10000708 3300009092 Bacteria 20546
87 Ga0105250_10013410 3300009092 Bacteria 3376
88 Ga0105250_10067548 3300009092 Bacteria 1442
89 Ga0105240_10374631 3300009093 Bacteria 1609
90 Ga0111539_10199037 3300009094 Bacteria 2336
91 Ga0111539_10460265 3300009094 Bacteria 1481
92 Ga0111539_10776502 3300009094 Bacteria 1115
93 Ga0111539_11137655 3300009094 Bacteria 907
94 Ga0105243_10016043 3300009148 Bacteria 5667
95 Ga0105243_10068135 3300009148 Bacteria 2868
96 Ga0105243_10069695 3300009148 Bacteria 2837
97 Ga0105243_10095786 3300009148 Bacteria 2454
98 Ga0105243_10190332 3300009148 Bacteria 1792
99 Ga0105243_10476606 3300009148 Bacteria 1177
100 Ga0105242_10445872 3300009176 Bacteria 1219
101 Ga0105246_10005186 3300011119 Bacteria 7919
102 Ga0105246_10596506 3300011119 Bacteria 954
103 Ga0157345_1000309 3300012498 Bacteria 6249
104 Ga0157313_1002555 3300012503 Bacteria 1101
105 Ga0157373_10273837 3300013100 Bacteria 1195
106 Ga0157371_10000536 3300013102 Bacteria 45189
107 Ga0157370_10196235 3300013104 Bacteria 1873
108 Ga0157370_11589889 3300013104 Bacteria 587
109 Ga0157369_10394127 3300013105 Bacteria 1437
110 Ga0157374_10904200 3300013296 Bacteria 900
111 Ga0163162_10545464 3300013306 Bacteria 1288
112 Ga0163162_10761676 3300013306 Bacteria 1087
113 Ga0157372_10012166 3300013307 Bacteria 9167
114 Ga0157372_10162967 3300013307 Bacteria 2577
115 Ga0157375_10806812 3300013308 Bacteria 1087
116 Ga0157375_11424709 3300013308 Bacteria 816
117 Ga0163163_10009963 3300014325 Bacteria 8522
118 Ga0157380_10128497 3300014326 Bacteria 2158
119 Ga0157380_10216934 3300014326 Bacteria 1709
120 Ga0157380_10370482 3300014326 Bacteria 1348
121 Ga0157380_10466189 3300014326 Bacteria 1217
122 Ga0157380_12866217 3300014326 Bacteria 549
123 Ga0182008_10009603 3300014497 Bacteria 5211
124 Ga0182008_10011766 3300014497 Bacteria 4643
125 Ga0182008_10037144 3300014497 Bacteria 2437
126 Ga0157379_10233215 3300014968 Bacteria 1669
127 Ga0157376_10346479 3300014969 Bacteria 1420
128 Ga0182006_1002602 3300015261 Bacteria 9753
129 Ga0182006_1018853 3300015261 Bacteria 2911
130 Ga0182006_1069548 3300015261 Bacteria 1309
131 Ga0182005_1017317 3300015265 Bacteria 1995
132 Ga0163161_10014054 3300017792 Bacteria 5574
133 Ga0163161_10017026 3300017792 Bacteria 5083
134 Ga0163161_10172271 3300017792 Bacteria 1655
135 Ga0163161_10986452 3300017792 Bacteria 718
136 Ga0163161_11403819 3300017792 Bacteria 610
137 Ga0209676_1000668 3300025292 Bacteria 48922
138 Ga0209676_1001477 3300025292 Bacteria 21754
139 Ga0209676_1008998 3300025292 Bacteria 4370
140 Ga0209050_1000024 3300025298 Bacteria 533389
141 Ga0209050_1000128 3300025298 Bacteria 187432
142 Ga0209050_1005862 3300025298 Bacteria 7521
143 Ga0209051_1000023 3300025303 Bacteria 437371
144 Ga0209051_1000791 3300025303 Bacteria 33280
145 Ga0209051_1015706 3300025303 Bacteria 3469
146 Ga0209257_1011030 3300025304 Bacteria 4433
147 Ga0207696_1000064 3300025711 Bacteria 238379
148 Ga0207696_1000094 3300025711 Bacteria 184065
149 Ga0207696_1005907 3300025711 Bacteria 5006
150 Ga0207696_1006396 3300025711 Bacteria 4753
151 Ga0207655_1000598 3300025728 Bacteria 44045
152 Ga0207655_1001446 3300025728 Bacteria 21992
153 Ga0207655_1004682 3300025728 Bacteria 9594
154 Ga0207655_1004949 3300025728 Bacteria 9241
155 Ga0207655_1010242 3300025728 Bacteria 5704
156 Ga0207655_1016556 3300025728 Bacteria 4024
157 Ga0207655_1214563 3300025728 Bacteria 565
158 Ga0207655_1239797 3300025728 Bacteria 519
159 Ga0207713_1000010 3300025735 Bacteria 528374
160 Ga0207713_1001149 3300025735 Bacteria 22401
161 Ga0207713_1002491 3300025735 Bacteria 13380
162 Ga0207713_1005765 3300025735 Bacteria 7672
163 Ga0207713_1006592 3300025735 Bacteria 7046
164 Ga0207713_1009458 3300025735 Bacteria 5491
165 Ga0207713_1170096 3300025735 Bacteria 688
166 Ga0207713_1193285 3300025735 Bacteria 628
167 Ga0207695_11157143 3300025913 Unclassified 654
168 Ga0207660_11505875 3300025917 Bacteria 544
169 Ga0207650_10000591 3300025925 Bacteria 29057
170 Ga0207709_10007973 3300025935 Bacteria 5866
171 Ga0207709_10135427 3300025935 Bacteria 1685
172 Ga0207709_10656677 3300025935 Bacteria 835
173 Ga0207709_10973257 3300025935 Bacteria 693
174 Ga0207711_10022622 3300025941 Bacteria 5259
175 Ga0207668_10184618 3300025972 Bacteria 1648
176 Ga0207639_12187292 3300026041 Bacteria 514
177 Ga0207708_10190301 3300026075 Bacteria 1633
178 Ga0207702_10488514 3300026078 Bacteria 1199
179 Ga0207702_11500637 3300026078 Bacteria 668
180 Ga0207641_11054096 3300026088 Bacteria 811
181 Ga0207641_11402164 3300026088 Bacteria 700
182 Ga0207641_11912810 3300026088 Bacteria 595
183 Ga0207648_11494309 3300026089 Bacteria 635
184 Ga0207676_10210411 3300026095 Unclassified 1725
185 Ga0207683_10171205 3300026121 Bacteria 1967
186 Ga0209281_1000016 3300027111 Bacteria 588107
187 Ga0209371_1043794 3300027312 Bacteria 893
188 Ga0209981_1011386 3300027378 Bacteria 1226
189 Ga0209995_1015309 3300027471 Bacteria 1258
190 Ga0209983_1000782 3300027665 Bacteria 6913
191 Ga0209971_1000459 3300027682 Bacteria 10808
192 Ga0209974_10001088 3300027876 Bacteria 9626
193 Ga0207428_10001453 3300027907 Bacteria 24796
194 Ga0207428_10045203 3300027907 Bacteria 3548
195 Ga0207428_10350211 3300027907 Bacteria 1087
196 Ga0207428_10714540 3300027907 Bacteria 716
197 Ga0268265_10516484 3300028380 Bacteria 1128
198 Ga0268256_1016622 3300030500 Bacteria 2101
199 Ga0316177_1039133 3300030731 Bacteria 1431
200 Ga0314311_1171705 3300030733 Bacteria 3858
201 Ga0316181_1230923 3300030744 Bacteria 1551
202 Ga0265332_10240885 3300031238 Bacteria 749
203 Ga0265327_10000050 3300031251 Bacteria 266536
204 Ga0265316_10105543 3300031344 Bacteria 2137
205 Ga0307408_100004188 3300031548 Bacteria 9830
206 Ga0307408_100412081 3300031548 Bacteria 1163
207 Ga0307408_101594883 3300031548 Bacteria 619
208 Ga0307508_10002430 3300031616 Bacteria 19641
209 Ga0307516_10230890 3300031730 Bacteria 1554
210 Ga0307516_10264213 3300031730 Bacteria 1410
211 Ga0307405_10012759 3300031731 Bacteria 4462
212 Ga0307405_10081139 3300031731 Bacteria 2119
213 Ga0307413_10108728 3300031824 Bacteria 1851
214 Ga0307413_10309152 3300031824 Bacteria 1202
215 Ga0307406_10018460 3300031901 Bacteria 4076
216 Ga0307412_10013027 3300031911 Bacteria 4861
217 Ga0307412_10027025 3300031911 Bacteria 3573
218 Ga0307412_11340905 3300031911 Bacteria 645
219 Ga0307412_11679614 3300031911 Bacteria 582
220 Ga0307409_101959451 3300031995 Unclassified 615
221 Ga0307416_100238893 3300032002 Bacteria 1759
222 Ga0307414_10051516 3300032004 Bacteria 2858
223 Ga0307414_11700222 3300032004 Bacteria 588
224 Ga0307411_10046127 3300032005 Bacteria 2807
225 Ga0307510_10364876 3300033180 Bacteria 892
226 Ga0373933_1144682 3300035724 Bacteria 513
227 Ga0373947_0653781 3300035725 Bacteria 717
228 Ga0395900_0049625 3300037418 Bacteria 4324
229 Ga0436362_0459754 3300039453 Bacteria 1187
230 Ga0439438_000617 3300041405 Bacteria 16040
231 Ga0439438_001709 3300041405 Bacteria 9660
232 Ga0439438_005876 3300041405 Bacteria 4439
233 Ga0439438_015441 3300041405 Bacteria 2247
234 Ga0439438_019173 3300041405 Bacteria 1936
235 Ga0439447_004863 3300041407 Bacteria 4556
236 Ga0439447_006699 3300041407 Bacteria 3712
237 Ga0439447_019050 3300041407 Bacteria 1836
238 Ga0439466_0000656 3300041411 Bacteria 13021
239 Ga0439466_0013218 3300041411 Bacteria 3024
240 Ga0439466_0031810 3300041411 Bacteria 1802
241 Ga0439466_0068474 3300041411 Bacteria 1134
242 Ga0451797_0571604 3300041453 Bacteria 665
243 Ga0451800_1249912 3300041459 Bacteria 1039
244 Ga0451802_0143070 3300041460 Bacteria 585
245 Ga0451853_3562112 3300041512 Bacteria 510
246 Ga0439431_0000429 3300041997 Bacteria 8934
247 Ga0439445_0005090 3300042004 Bacteria 2988
248 Ga0439432_000568 3300042006 Bacteria 13848
249 Ga0439432_001884 3300042006 Bacteria 7897
250 Ga0439432_064942 3300042006 Bacteria 1119
251 Ga0439432_076187 3300042006 Bacteria 1019
252 Ga0439451_008450 3300042009 Bacteria 2087
253 Ga0439451_008701 3300042009 Bacteria 2056
254 Ga0439452_000363 3300042010 Bacteria 27675
255 Ga0439452_004175 3300042010 Bacteria 4897
256 Ga0439452_010976 3300042010 Bacteria 2616
257 Ga0439452_016863 3300042010 Bacteria 1976
258 Ga0439452_054732 3300042010 Bacteria 905
259 Ga0439456_000065 3300042013 Bacteria 37775
260 Ga0439456_010172 3300042013 Bacteria 1943
261 Ga0439456_010707 3300042013 Bacteria 1896
262 Ga0439456_014475 3300042013 Bacteria 1645
263 Ga0439456_031273 3300042013 Bacteria 1140
264 Ga0439463_000583 3300042016 Bacteria 10213
265 Ga0450911_002207 3300042115 Bacteria 3933
266 Ga0450919_002101 3300042121 Bacteria 2587
267 Ga0450922_000436 3300042124 Bacteria 4468
268 Ga0450902_000111 3300042137 Bacteria 8401
269 Ga0450903_005870 3300042138 Bacteria 2049
270 Ga0450910_000249 3300042147 Bacteria 6166
271 Ga0450910_023484 3300042147 Bacteria 943
272 Ga0439446_0022272 3300042156 Bacteria 1795
273 Ga0439446_0036404 3300042156 Bacteria 1438
274 Ga0450908_108599 3300042184 Bacteria 511
275 Ga0439460_0068732 3300042461 Bacteria 1093
276 Ga0450918_086231 3300042531 Bacteria 603
277 Ga0450893_0000768 3300042532 Bacteria 4686
278 Ga0450893_0015117 3300042532 Bacteria 1299
279 Ga0451577_0011709 3300042876 Bacteria 8280
280 Ga0439440_0003338 3300042993 Bacteria 3090
281 Ga0453683_0012263 3300044673 Bacteria 5621
282 Ga0466963_0844041 3300044694 Bacteria 646
283 Ga0453684_0031986 3300044712 Bacteria 7377
284 Ga0451576_0037783 3300045051 Bacteria 5113
285 Ga0451576_0217822 3300045051 Bacteria 1993
286 Ga0495617_001780 3300046452 Bacteria 9191
287 Ga0495617_005964 3300046452 Bacteria 4298
288 Ga0495617_027610 3300046452 Bacteria 1909
289 Ga0495627_000236 3300046453 Bacteria 58365
290 Ga0495627_000913 3300046453 Bacteria 20472
291 Ga0495627_004413 3300046453 Bacteria 5893
292 Ga0495627_019803 3300046453 Bacteria 2251
293 Ga0495627_024631 3300046453 Bacteria 1960
294 Ga0495627_033993 3300046453 Bacteria 1595
295 Ga0495592_0596636 3300046454 Bacteria 674
296 Ga0495603_0127894 3300046455 Bacteria 1480
297 Ga0495590_0004856 3300046457 Bacteria 5378
298 Ga0495590_0006830 3300046457 Bacteria 4434
299 Ga0495590_0019724 3300046457 Bacteria 2399
300 Ga0495590_0328322 3300046457 Bacteria 579
301 Ga0495590_0351324 3300046457 Bacteria 560
302 Ga0495591_000262 3300046458 Bacteria 50259
303 Ga0495591_000908 3300046458 Bacteria 20592
304 Ga0495591_005704 3300046458 Bacteria 5686
305 Ga0495591_062845 3300046458 Bacteria 982
306 Ga0495591_077494 3300046458 Bacteria 852
307 Ga0495591_149772 3300046458 Bacteria 560
308 Ga0495629_0017879 3300046459 Bacteria 5081
309 Ga0495629_0536684 3300046459 Bacteria 786
310 Ga0495638_0017189 3300046460 Bacteria 4829
311 Ga0495638_0019683 3300046460 Bacteria 4463
312 Ga0495638_0033102 3300046460 Bacteria 3306
313 Ga0495638_0059044 3300046460 Bacteria 2376
314 Ga0495638_0364930 3300046460 Bacteria 758
315 Ga0495653_0003057 3300046463 Bacteria 13431
316 Ga0495653_0022711 3300046463 Bacteria 5075
317 Ga0495653_0023453 3300046463 Bacteria 4983
318 Ga0495653_0078617 3300046463 Bacteria 2445
319 Ga0495650_0001753 3300046471 Bacteria 19743
320 Ga0495650_0011649 3300046471 Bacteria 4795
321 Ga0495650_0015510 3300046471 Bacteria 3904
322 Ga0495650_0041618 3300046471 Bacteria 1963
323 Ga0495582_0012439 3300046473 Bacteria 4689
324 Ga0495605_0000305 3300046474 Bacteria 52699
325 Ga0495605_0004768 3300046474 Bacteria 7927
326 Ga0495605_0300191 3300046474 Bacteria 679
327 Ga0495639_0004444 3300046475 Bacteria 6012
328 Ga0495664_0063537 3300046477 Bacteria 2201
329 Ga0495584_0001213 3300046491 Bacteria 15750
330 Ga0495584_0056028 3300046491 Bacteria 1983
331 Ga0495584_0179772 3300046491 Bacteria 1075
332 Ga0495585_0002376 3300046492 Bacteria 13510
333 Ga0495585_0004001 3300046492 Bacteria 9711
334 Ga0495585_0007958 3300046492 Bacteria 6443
335 Ga0495585_0114194 3300046492 Bacteria 1433
336 Ga0495594_0313651 3300046499 Bacteria 893
337 Ga0495607_0001512 3300046501 Bacteria 20500
338 Ga0495607_0001663 3300046501 Bacteria 19235
339 Ga0495607_0001685 3300046501 Bacteria 19046
340 Ga0495607_0001747 3300046501 Bacteria 18602
341 Ga0495607_0002473 3300046501 Bacteria 14994
342 Ga0495607_0047403 3300046501 Bacteria 2518
343 Ga0495607_0050932 3300046501 Bacteria 2407
344 Ga0495607_0104096 3300046501 Bacteria 1515
345 Ga0495607_0163611 3300046501 Bacteria 1128
346 Ga0495607_0251164 3300046501 Bacteria 851
347 Ga0495607_0507291 3300046501 Bacteria 534
348 Ga0495583_0002263 3300046506 Bacteria 16900
349 Ga0495583_0003780 3300046506 Bacteria 11247
350 Ga0495583_0006029 3300046506 Bacteria 8032
351 Ga0495583_0273942 3300046506 Bacteria 673
352 Ga0495606_0000785 3300046507 Bacteria 48544
353 Ga0495606_0003478 3300046507 Bacteria 16690
354 Ga0495606_0023130 3300046507 Bacteria 4512
355 Ga0495606_0069559 3300046507 Bacteria 2222
356 Ga0495610_0010636 3300046512 Bacteria 5698
357 Ga0495610_0038056 3300046512 Bacteria 2443
358 Ga0495616_0001961 3300046513 Bacteria 13850
359 Ga0495616_0163522 3300046513 Bacteria 999
360 Ga0495616_0194365 3300046513 Bacteria 895
361 Ga0495620_0000033 3300046515 Bacteria 118157
362 Ga0495620_0014188 3300046515 Bacteria 4057
363 Ga0495620_0033940 3300046515 Bacteria 2310
364 Ga0495628_0502412 3300046516 Bacteria 875
365 Ga0495630_0019938 3300046517 Bacteria 4936
366 Ga0495630_0028337 3300046517 Bacteria 4162
367 Ga0495631_0001408 3300046518 Bacteria 14633
368 Ga0495631_0006806 3300046518 Bacteria 5867
369 Ga0495631_0044439 3300046518 Bacteria 1957
370 Ga0495632_0000399 3300046519 Bacteria 40815
371 Ga0495632_0001643 3300046519 Bacteria 18317
372 Ga0495632_0004604 3300046519 Bacteria 9341
373 Ga0495632_0006335 3300046519 Bacteria 7634
374 Ga0495632_0008067 3300046519 Bacteria 6525
375 Ga0495632_0012185 3300046519 Bacteria 4969
376 Ga0495632_0022973 3300046519 Bacteria 3336
377 Ga0495632_0030851 3300046519 Bacteria 2777
378 Ga0495632_0059406 3300046519 Bacteria 1860
379 Ga0495632_0060365 3300046519 Bacteria 1842
380 Ga0495632_0089548 3300046519 Bacteria 1460
381 Ga0495632_0160037 3300046519 Bacteria 1037
382 Ga0495637_0001314 3300046520 Bacteria 14925
383 Ga0495637_0002210 3300046520 Bacteria 10867
384 Ga0495637_0002604 3300046520 Bacteria 9906
385 Ga0495637_0011937 3300046520 Bacteria 4163
386 Ga0495637_0012382 3300046520 Bacteria 4080
387 Ga0495637_0015609 3300046520 Bacteria 3563
388 Ga0495637_0017272 3300046520 Bacteria 3366
389 Ga0495637_0025612 3300046520 Bacteria 2656
390 Ga0495637_0065262 3300046520 Bacteria 1482
391 Ga0495637_0110850 3300046520 Bacteria 1063
392 Ga0495643_0001356 3300046522 Bacteria 22936
393 Ga0495643_0004576 3300046522 Bacteria 9629
394 Ga0495643_0029284 3300046522 Bacteria 3082
395 Ga0495644_0003429 3300046523 Bacteria 6275
396 Ga0495648_0002328 3300046524 Bacteria 17684
397 Ga0495648_0002836 3300046524 Bacteria 15600
398 Ga0495648_0009421 3300046524 Bacteria 7574
399 Ga0495648_0012155 3300046524 Bacteria 6440
400 Ga0495648_0071018 3300046524 Bacteria 2020
401 Ga0495648_0100587 3300046524 Bacteria 1596
402 Ga0495648_0160601 3300046524 Bacteria 1162
403 Ga0495666_0009296 3300046526 Bacteria 4914
404 Ga0495666_0009803 3300046526 Bacteria 4786
405 Ga0495666_0021846 3300046526 Bacteria 3167
406 Ga0495666_0376683 3300046526 Bacteria 639
407 Ga0495642_0000910 3300046528 Bacteria 13902
408 Ga0495652_1114907 3300046529 Bacteria 512
409 Ga0495654_0001804 3300046530 Bacteria 14270
410 Ga0495654_0003274 3300046530 Bacteria 9985
411 Ga0495654_0007411 3300046530 Bacteria 6130
412 Ga0495654_0009251 3300046530 Bacteria 5402
413 Ga0495654_0020033 3300046530 Bacteria 3492
414 Ga0495654_0028422 3300046530 Bacteria 2859
415 Ga0495654_0040865 3300046530 Bacteria 2308
416 Ga0495654_0123134 3300046530 Bacteria 1171
417 Ga0495654_0303987 3300046530 Bacteria 650
418 Ga0495586_0149539 3300046535 Bacteria 1313
419 Ga0495586_0469407 3300046535 Bacteria 726
420 Ga0495587_0010198 3300046536 Bacteria 5991
421 Ga0495587_0259213 3300046536 Bacteria 977
422 Ga0495587_0358227 3300046536 Bacteria 812
423 Ga0495609_0000226 3300046538 Bacteria 55095
424 Ga0495609_0005057 3300046538 Bacteria 7036
425 Ga0495609_0005960 3300046538 Bacteria 6299
426 Ga0495609_0025842 3300046538 Bacteria 2689
427 Ga0495609_0026423 3300046538 Bacteria 2658
428 Ga0495609_0058308 3300046538 Bacteria 1707
429 Ga0495609_0070746 3300046538 Bacteria 1533
430 Ga0495621_0003005 3300046539 Bacteria 4600
431 Ga0495597_0000235 3300046542 Bacteria 49912
432 Ga0495597_0006339 3300046542 Bacteria 6129
433 Ga0495597_0009917 3300046542 Bacteria 4681
434 Ga0495597_0016368 3300046542 Bacteria 3500
435 Ga0495645_0035434 3300046543 Bacteria 3638
436 Ga0495645_0037736 3300046543 Bacteria 3523
437 Ga0495645_0192699 3300046543 Bacteria 1388
438 Ga0495645_0295460 3300046543 Unclassified 1060
439 Ga0495645_0493087 3300046543 Bacteria 767
440 Ga0495622_0005622 3300046557 Bacteria 5812
441 Ga0495622_0093996 3300046557 Bacteria 1376
442 Ga0495633_0040855 3300046558 Bacteria 2207
443 Ga0495668_0015584 3300046616 Bacteria 4435
444 Ga0495668_0192940 3300046616 Bacteria 1115
445 Ga0495634_0017298 3300046642 Bacteria 5147
446 Ga0495634_0026732 3300046642 Bacteria 4025
447 Ga0495611_0115710 3300046648 Bacteria 1249
448 Ga0495625_0012667 3300046660 Bacteria 6823
449 Ga0495625_0340579 3300046660 Bacteria 950
450 Ga0495635_0018083 3300046663 Bacteria 4922
451 Ga0495635_0021873 3300046663 Bacteria 4457
452 Ga0495635_0044488 3300046663 Unclassified 3063
453 Ga0495661_0000320 3300046665 Bacteria 53065
454 Ga0495661_0000340 3300046665 Bacteria 51118
455 Ga0495661_0004957 3300046665 Bacteria 9520
456 Ga0495661_0144767 3300046665 Bacteria 1289
457 Ga0495661_0276123 3300046665 Bacteria 848
458 Ga0495657_0069879 3300046675 Bacteria 2296
459 Ga0495657_0104099 3300046675 Bacteria 1805
460 Ga0495599_0013493 3300046678 Bacteria 5048
461 Ga0495623_0005830 3300046679 Bacteria 8034
462 Ga0495623_0022106 3300046679 Bacteria 4107
463 Ga0495646_0077615 3300046680 Bacteria 1942
464 Ga0495646_0114860 3300046680 Bacteria 1529
465 Ga0495669_0053917 3300046684 Bacteria 1809
466 Ga0495613_0012188 3300046689 Bacteria 6390
467 Ga0495613_0251426 3300046689 Bacteria 1233
468 Ga0495670_0008703 3300046691 Bacteria 4996
469 Ga0495670_0227285 3300046691 Bacteria 992
470 Ga0495670_0310492 3300046691 Bacteria 846
471 Ga0495670_0322910 3300046691 Bacteria 829
472 Ga0495670_0483248 3300046691 Bacteria 672
473 Ga0495671_0001637 3300046692 Bacteria 14695
474 Ga0495671_0012382 3300046692 Bacteria 4661
475 Ga0495671_0016806 3300046692 Bacteria 3901
476 Ga0495671_0027263 3300046692 Bacteria 2951
477 Ga0495671_0084299 3300046692 Bacteria 1557
478 Ga0495671_0117479 3300046692 Bacteria 1298
479 Ga0495671_0515418 3300046692 Bacteria 570
480 Ga0495649_0001345 3300046694 Bacteria 18678
481 Ga0495649_0001639 3300046694 Bacteria 16650
482 Ga0495649_0035144 3300046694 Bacteria 2756
483 Ga0495649_0129357 3300046694 Bacteria 1332
484 Ga0495649_0188277 3300046694 Bacteria 1075
485 Ga0495589_0000890 3300046794 Bacteria 18550
486 Ga0495589_0080322 3300046794 Bacteria 1587
487 Ga0495600_0087300 3300046809 Bacteria 2035
488 Ga0495600_0444657 3300046809 Bacteria 802
489 Ga0495660_0004190 3300046810 Bacteria 8763
490 Ga0495660_0010112 3300046810 Bacteria 5485
491 Ga0495660_0012324 3300046810 Bacteria 4960
492 Ga0495660_0059096 3300046810 Bacteria 2063
493 Ga0495660_0127326 3300046810 Bacteria 1281
494 Ga0495660_0138648 3300046810 Bacteria 1212
495 Ga0495660_0380900 3300046810 Bacteria 621
496 Ga0495581_0022649 3300047315 Bacteria 3639
497 Ga0495604_0009657 3300047317 Bacteria 7627
498 Ga0495604_0085571 3300047317 Unclassified 2352
499 Ga0495636_0015323 3300047318 Bacteria 3055
500 Ga0495636_0148566 3300047318 Bacteria 1050
501 Ga0495674_0042227 3300047319 Bacteria 4069
502 Ga0495672_0001307 3300047320 Bacteria 24818
503 Ga0495672_0003882 3300047320 Bacteria 12563
504 Ga0495672_0008309 3300047320 Bacteria 7686
505 Ga0495672_0013691 3300047320 Bacteria 5582
506 Ga0495672_0019008 3300047320 Bacteria 4544
507 Ga0495672_0048088 3300047320 Bacteria 2531
508 Ga0495672_0122800 3300047320 Bacteria 1378
509 Ga0495672_0139526 3300047320 Bacteria 1267
510 Ga0495676_0359831 3300047321 Bacteria 971
511 Ga0495676_0398924 3300047321 Bacteria 913
512 Ga0495680_0023663 3300047322 Bacteria 5104
513 Ga0495680_0027415 3300047322 Bacteria 4681
514 Ga0495680_0064963 3300047322 Bacteria 2796
515 Ga0495680_0116414 3300047322 Bacteria 1976
516 Ga0495680_0702293 3300047322 Unclassified 668
517 Ga0495683_0000016 3300047323 Bacteria 191396
518 Ga0495683_0005198 3300047323 Bacteria 7250
519 Ga0495683_0006784 3300047323 Bacteria 6224
520 Ga0495687_003652 3300047443 Bacteria 10959
521 Ga0495675_0013899 3300047444 Bacteria 5090
522 Ga0495675_0025502 3300047444 Bacteria 3769
523 Ga0495675_0041542 3300047444 Bacteria 2931
524 Ga0495675_0057262 3300047444 Bacteria 2471
525 Ga0495675_0171216 3300047444 Bacteria 1333
526 Ga0495685_002011 3300047447 Bacteria 6312
527 Ga0495673_0000789 3300047469 Bacteria 29813
528 Ga0495673_0002977 3300047469 Bacteria 11414
529 Ga0495673_0008171 3300047469 Bacteria 5917
530 Ga0495673_0009275 3300047469 Bacteria 5458
531 Ga0495673_0009999 3300047469 Bacteria 5195
532 Ga0495673_0249402 3300047469 Bacteria 648
533 Ga0495681_0008902 3300047470 Bacteria 6235
534 Ga0495681_0009457 3300047470 Bacteria 6001
535 Ga0495681_0014126 3300047470 Bacteria 4597
536 Ga0495681_0047354 3300047470 Bacteria 2045
537 Ga0495681_0078697 3300047470 Bacteria 1476
538 Ga0495681_0219869 3300047470 Bacteria 762
539 Ga0495684_0025570 3300047471 Bacteria 4535
540 Ga0495686_0011284 3300047472 Bacteria 6298
541 Ga0495686_0489003 3300047472 Bacteria 649
542 Ga0495593_0082409 3300047673 Bacteria 1662
543 Ga0495593_0169587 3300047673 Bacteria 1100
544 Ga0495602_0258216 3300048088 Bacteria 1294
545 Ga0495602_0316823 3300048088 Bacteria 1136
546 Ga0495626_0004436 3300048091 Bacteria 8614
547 Ga0495626_0010993 3300048091 Bacteria 4802
548 Ga0495626_0036093 3300048091 Bacteria 2356
549 Ga0495626_0085196 3300048091 Bacteria 1397
550 Ga0496102_0003362 3300048905 Bacteria 13560
551 Ga0496103_0011982 3300048906 Bacteria 5149
552 Ga0496110_0082470 3300048913 Bacteria 2868
553 Ga0496111_0606560 3300048914 Bacteria 801
554 Ga0496112_0189050 3300048915 Bacteria 2022
555 Ga0496114_0842127 3300048917 Bacteria 797
556 Ga0496116_0006223 3300048919 Bacteria 10895
557 Ga0496116_0030580 3300048919 Bacteria 3865
558 Ga0496116_0116898 3300048919 Bacteria 1553
559 Ga0496117_0003735 3300048920 Bacteria 17441
560 Ga0496117_0010816 3300048920 Bacteria 8237
561 Ga0496117_0023680 3300048920 Bacteria 4882
562 Ga0496117_0059992 3300048920 Bacteria 2625
563 Ga0496117_0078071 3300048920 Bacteria 2188
564 Ga0496117_0116907 3300048920 Bacteria 1647
565 Ga0496118_0002905 3300048921 Bacteria 22275
566 Ga0496118_0034166 3300048921 Bacteria 4155
567 Ga0496118_0034853 3300048921 Bacteria 4098
568 Ga0496119_0000071 3300048922 Bacteria 153652
569 Ga0496119_0052534 3300048922 Bacteria 2495
570 Ga0496120_0004847 3300048923 Bacteria 11002
571 Ga0496121_0065402 3300048924 Bacteria 2959
572 Ga0496121_0157986 3300048924 Bacteria 1661
573 Ga0496121_0162368 3300048924 Bacteria 1632
574 Ga0496121_0339995 3300048924 Bacteria 1003
575 Ga0496121_0887112 3300048924 Bacteria 514
576 Ga0496122_0003639 3300048925 Bacteria 20044
577 Ga0496122_0204105 3300048925 Bacteria 1152
578 Ga0496123_0002904 3300048926 Bacteria 20054
579 Ga0496123_0219271 3300048926 Bacteria 961
580 Ga0496123_0254352 3300048926 Bacteria 864
581 Ga0496124_0000730 3300048927 Bacteria 53903
582 Ga0496124_0014510 3300048927 Bacteria 7614
583 Ga0496124_0052285 3300048927 Bacteria 3470
584 Ga0496124_0087764 3300048927 Bacteria 2544
585 Ga0496124_0168466 3300048927 Bacteria 1699
586 Ga0496125_0001109 3300048928 Bacteria 41385
587 Ga0496126_0167444 3300048929 Bacteria 1874
588 Ga0496126_0255649 3300048929 Bacteria 1458
589 Ga0496126_0255673 3300048929 Bacteria 1458
590 Ga0495678_001974 3300049459 Bacteria 14782
591 Ga0495678_002020 3300049459 Bacteria 14560
592 Ga0495678_010151 3300049459 Bacteria 4591
593 Ga0495678_021034 3300049459 Bacteria 2879
594 Ga0495682_0000198 3300049460 Bacteria 48570
595 Ga0495682_0004844 3300049460 Bacteria 5680
596 Ga0495682_0023086 3300049460 Bacteria 2324
597 Ga0501291_126640 3300049514 Bacteria 559
598 Ga0501314_025131 3300049530 Bacteria 639
599 Ga0501323_000644 3300049539 Bacteria 2688
600 Ga0501031_0810835 3300049568 Bacteria 600
601 Ga0501036_0107811 3300049572 Bacteria 2355
602 Ga0501036_0247379 3300049572 Bacteria 1495
603 Ga0501039_1480782 3300049575 Bacteria 522
604 Ga0501040_0803102 3300049576 Bacteria 681
605 Ga0501041_0748277 3300049577 Bacteria 626
606 Ga0501042_0391007 3300049578 Bacteria 1007
607 Ga0501042_0403516 3300049578 Bacteria 990
608 Ga0501046_0280040 3300049580 Bacteria 1222
609 Ga0501048_0610428 3300049582 Bacteria 783
610 Ga0501048_1164066 3300049582 Bacteria 555
611 Ga0501067_0014698 3300049583 Bacteria 4331
612 Ga0501068_0148253 3300049584 Bacteria 1473
613 Ga0501069_0143596 3300049585 Bacteria 1370
614 Ga0501072_0033268 3300049588 Bacteria 4040
615 Ga0501073_0308941 3300049589 Bacteria 1091
616 Ga0501075_0033022 3300049591 Bacteria 3849
617 Ga0501075_0691062 3300049591 Bacteria 777
618 Ga0501076_0380884 3300049592 Bacteria 1160
619 Ga0501227_018988 3300049665 Bacteria 1564
620 Ga0501250_098197 3300049680 Bacteria 518
621 Ga0501079_0291187 3300049741 Unclassified 1277
622 Ga0501079_0899878 3300049741 Bacteria 697
623 Ga0501080_0427819 3300049742 Bacteria 1189
624 Ga0501080_0939664 3300049742 Bacteria 752
625 Ga0501080_1125694 3300049742 Bacteria 677
626 Ga0501081_0398870 3300049743 Bacteria 1018
627 Ga0501081_0591366 3300049743 Bacteria 830
628 Ga0501081_1491515 3300049743 Bacteria 514
629 Ga0501269_005839 3300049766 Bacteria 1481
630 Ga0501035_0858132 3300049822 Bacteria 722
631 Ga0501035_0990611 3300049822 Unclassified 661
632 Ga0501045_0130958 3300049824 Bacteria 1864
633 Ga0501226_001532 3300049853 Bacteria 2948
634 nmdc:mga03683_73603_c1 3300050489 Bacteria 1465
635 nmdc:mga03683_98987_c1 3300050489 Bacteria 1280
636 nmdc:mga00v17_279842_c1 3300050491 Bacteria 1083
637 nmdc:mga0k408_498873_c1 3300050493 Bacteria 721
638 nmdc:mga09592_1340675_c1 3300050508 Bacteria 587
639 nmdc:mga0qj67_721125_c1 3300050509 Bacteria 792
640 nmdc:mga08y16_1231_c1 3300050511 Bacteria 25326
641 nmdc:mga08y16_139190_c1 3300050511 Bacteria 2523
642 nmdc:mga08y16_226260_c1 3300050511 Bacteria 1936
643 nmdc:mga08y16_597470_c1 3300050511 Bacteria 1113
644 nmdc:mga0a205_67097_c1 3300050515 Bacteria 2699
645 Ga0500555_010659 3300053103 Bacteria 2639
646 Ga0500572_001757 3300053111 Bacteria 5590
647 Ga0500564_104323 3300053138 Bacteria 1250
648 Ga0500573_0044851 3300053140 Bacteria 2549
649 Ga0500577_0118775 3300053142 Bacteria 1099
650 Ga0500586_168579 3300053145 Bacteria 738
651 Ga0501084_0061070 3300054114 Bacteria 3155
652 Ga0501084_0394814 3300054114 Bacteria 1169
653 Ga0501082_0795640 3300060353 Bacteria 827
654 Ga0501082_1154840 3300060353 Bacteria 677
655 Ga0530510_0057468 3300061734 Bacteria 2811

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_101278119 Ga0070671_1012781192 96
2 3300005455 Ga0070663_101889510 Ga0070663_1018895101 96
3 3300005618 Ga0068864_100606555 Ga0068864_1006065552 96
4 3300049822 Ga0501035_0990611 Ga0501035_0990611_19_312 96
5 3300009094 Ga0111539_10460265 Ga0111539_104602653 103
6 3300050508 nmdc:mga09592_1340675_c1 nmdc:mga09592_1340675_c1_18_371 103
7 3300050511 nmdc:mga08y16_139190_c1 nmdc:mga08y16_139190_c1_498_851 103
8 3300005441 Ga0070700_100065764 Ga0070700_1000657643 106
9 iso_pu_bacteria 2511231006 2511267855 108
10 iso_pu_bacteria 2511231008 2511279723 108
11 iso_pu_bacteria 2511231011 2511296879 108
12 iso_pu_bacteria 2511231012 2511304583 108
13 iso_pu_bacteria 2511231014 2511313563 108
14 iso_pu_bacteria 2511231015 2511318341 108
15 iso_pu_bacteria 2511231017 2511331348 108
16 iso_pu_bacteria 2511231018 2511337418 108
17 iso_pu_bacteria 2511231019 2511341781 108
18 iso_pu_bacteria 2511231020 2511351444 108
19 iso_pu_bacteria 2511231021 2511357688 108
20 iso_pu_bacteria 2511231023 2511367040 108
21 iso_pu_bacteria 2511231031 2511415806 108
22 iso_pu_bacteria 2511231156 2511827329 108
23 iso_pu_bacteria 2512047018 2512329517 108
24 iso_pu_bacteria 2554235231 2555246731 108
25 iso_pu_bacteria 2582580891 2583795016 108
26 iso_pu_bacteria 2597489887 2597860578 108
27 iso_pu_bacteria 2597489888 2597866329 108
28 iso_pu_bacteria 2597489889 2597872174 108
29 iso_pu_bacteria 2599185155 2599330862 108
30 iso_pu_bacteria 2599185185 2599486185 108
31 iso_pu_bacteria 2599185188 2599502348 108
32 iso_pu_bacteria 2599185189 2599505461 108
33 iso_pu_bacteria 2599185212 2599616959 108
34 iso_pu_bacteria 2599185248 2599768484 108
35 iso_pu_bacteria 2599185257 2599804968 108
36 iso_pu_bacteria 2599185289 2599885904 108
37 iso_pu_bacteria 2599185291 2599897618 108
38 iso_pu_bacteria 2599185300 2599933954 108
39 iso_pu_bacteria 2599185302 2599945768 108
40 iso_pu_bacteria 2599185303 2599951122 108
41 iso_pu_bacteria 2599185304 2599956762 108
42 iso_pu_bacteria 2599185305 2599961475 108
43 iso_pu_bacteria 2599185306 2599965748 108
44 iso_pu_bacteria 2599185308 2599978578 108
45 iso_pu_bacteria 2599185309 2599984853 108
46 iso_pu_bacteria 2599185310 2599988062 108
47 iso_pu_bacteria 2599185311 2599993717 108
48 iso_pu_bacteria 2599185312 2599998852 108
49 iso_pu_bacteria 2599185313 2600008543 108
50 iso_pu_bacteria 2599185314 2600012645 108
51 iso_pu_bacteria 2599185315 2600018724 108
52 iso_pu_bacteria 2599185316 2600025129 108
53 iso_pu_bacteria 2599185317 2600030014 108
54 iso_pu_bacteria 2599185318 2600036599 108
55 iso_pu_bacteria 2599185319 2600041908 108
56 iso_pu_bacteria 2599185320 2600046390 108
57 iso_pu_bacteria 2599185321 2600053104 108
58 iso_pu_bacteria 2599185322 2600062812 108
59 iso_pu_bacteria 2599185323 2600066093 108
60 iso_pu_bacteria 2599185324 2600073671 108
61 iso_pu_bacteria 2599185325 2600079634 108
62 iso_pu_bacteria 2600254930 2600359701 108
63 iso_pu_bacteria 2600254931 2600366235 108
64 iso_pu_bacteria 2600255296 2601693737 108
65 iso_pu_bacteria 2619619299 2621297140 108
66 iso_pu_bacteria 2643221565 2643842337 108
67 iso_pu_bacteria 2643221589 2643955946 108
68 iso_pu_bacteria 2643221602 2644020740 108
69 iso_pu_bacteria 2643221650 2644283364 108
70 iso_pu_bacteria 2643221713 2644620675 108
71 iso_pu_bacteria 2651869719 2652545982 108
72 iso_pu_bacteria 2667528170 2671089229 108
73 iso_pu_bacteria 2667528176 2671128733 108
74 iso_pu_bacteria 2671180172 2671771974 108
75 iso_pu_bacteria 2675903420 2677901299 108
76 iso_pu_bacteria 2675903515 2678265841 108
77 iso_pu_bacteria 2721755607 2723251065 108
78 iso_pu_bacteria 2728369097 2729146142 108
79 iso_pu_bacteria 2738541265 2738671959 108
80 iso_pu_bacteria 2738541271 2738690349 108
81 iso_pu_bacteria 2738541282 2738750353 108
82 iso_pu_bacteria 2738541303 2738859393 108
83 iso_pu_bacteria 2738543004 2739198753 108
84 iso_pu_bacteria 2738543015 2739261480 108
85 iso_pu_bacteria 2738543016 2739266123 108
86 iso_pu_bacteria 2738543025 2739312818 108
87 iso_pu_bacteria 2740892503 2743740129 108
88 iso_pu_bacteria 2744054620 2745007073 108
89 iso_pu_bacteria 2773857673 2774135873 108
90 iso_pu_bacteria 2784132063 2784262127 108
91 iso_pu_bacteria 2791355520 2794598533 108
92 iso_pu_bacteria 2808606377 2808932282 108
93 iso_pu_bacteria 2808606381 2808954403 108
94 iso_pu_bacteria 2808606382 2808960831 108
95 iso_pu_bacteria 2808606385 2808975839 108
96 iso_pu_bacteria 2808606388 2808992948 108
97 iso_pu_bacteria 2816332298 2817493747 108
98 iso_pu_bacteria 2818991456 2819654825 108
99 iso_pu_bacteria 2825651385 2825655408 108
100 iso_pu_bacteria 2826581358 2826582164 108
101 iso_pu_bacteria 2842815866 2842821159 108
102 iso_pu_bacteria 2842826826 2842829307 108
103 iso_pu_bacteria 2842837860 2842842156 108
104 iso_pu_bacteria 2842849001 2842852490 108
105 iso_pu_bacteria 2842854478 2842855313 108
106 iso_pu_bacteria 2852612431 2852616028 108
107 iso_pu_bacteria 2852657418 2852662553 108
108 iso_pu_bacteria 2852667396 2852670996 108
109 iso_pu_bacteria 2860339153 2860341408 108
110 iso_pu_bacteria 2860867994 2860872726 108
111 iso_pu_bacteria 2880230671 2880235683 108
112 iso_pu_bacteria 2904518522 2904519257 108
113 iso_pu_bacteria 2904550169 2904555450 108
114 iso_pu_bacteria 2908446538 2908452265 108
115 iso_pu_bacteria 2912963787 2912968595 108
116 iso_pu_bacteria 2913036834 2913042251 108
117 iso_pu_bacteria 2919155634 2919155641 108
118 iso_pu_bacteria 2919456309 2919457247 108
119 iso_pu_bacteria 2923153595 2923159221 108
120 iso_pu_bacteria 2923586266 2923591921 108
121 iso_pu_bacteria 2929144301 2929149637 108
122 iso_pu_bacteria 2931369376 2931372957 108
123 iso_pu_bacteria 2939636861 2939642180 108
124 iso_pu_bacteria 2939651529 2939653935 108
125 iso_pu_bacteria 2945928738 2945931217 108
126 iso_pu_bacteria 2945961074 2945966487 108
127 iso_pu_bacteria 2946006987 2946007253 108
128 iso_pu_bacteria 2969304461 2969309869 108
129 iso_pu_bacteria 2984286254 2984286926 108
130 iso_pu_bacteria 3007395558 3007398869 108
131 iso_pu_bacteria 3007419365 3007425409 108
132 iso_pu_bacteria 3007619802 3007622256 108
133 iso_pu_bacteria 3007718800 3007720034 108
134 iso_pu_bacteria 651053060 651174558 108
135 iso_pu_bacteria 8015687852 8015693310 108
136 iso_pu_bacteria 8054285046 8054291435 108
137 iso_pu_bacteria 8054347763 8054349875 108
138 iso_pu_bacteria 8054503363 8054508615 108
139 iso_pu_bacteria 8054929484 8054934286 108
140 iso_pu_bacteria 8055770955 8055776560 108
141 iso_pu_bacteria 8055878733 8055879300 108
142 iso_pu_bacteria 8056125926 8056131302 108
143 iso_pu_bacteria 8056131705 8056137019 108
144 iso_pu_bacteria 8056143049 8056148460 108
145 iso_pu_bacteria 8056161164 8056163315 108
146 iso_pu_bacteria 8056172158 8056177717 108
147 iso_pu_bacteria 8056177738 8056181697 108
148 3300005327 Ga0070658_11068322 Ga0070658_110683222 109
149 3300012503 Ga0157313_1002555 Ga0157313_10025552 109
150 3300046458 Ga0495591_062845 Ga0495591_062845_200_529 109
151 3300014326 Ga0157380_10128497 Ga0157380_101284971 110
152 3300014968 Ga0157379_10233215 Ga0157379_102332152 110
153 3300041453 Ga0451797_0571604 Ga0451797_0571604_294_632 110
154 3300046529 Ga0495652_1114907 Ga0495652_1114907_58_405 110
155 3300046543 Ga0495645_0035434 Ga0495645_0035434_45_392 110
156 3300046678 Ga0495599_0013493 Ga0495599_0013493_1942_2289 110
157 3300053103 Ga0500555_010659 Ga0500555_010659_582_923 110
158 3300005331 Ga0070670_100626199 Ga0070670_1006261992 111
159 3300005333 Ga0070677_10230730 Ga0070677_102307301 111
160 3300005333 Ga0070677_10666426 Ga0070677_106664262 111
161 3300005336 Ga0070680_100205125 Ga0070680_1002051252 111
162 3300005345 Ga0070692_10122771 Ga0070692_101227711 111
163 3300005354 Ga0070675_100506158 Ga0070675_1005061581 111
164 3300005356 Ga0070674_100117082 Ga0070674_1001170823 111
165 3300005364 Ga0070673_101747872 Ga0070673_1017478721 111
166 3300005444 Ga0070694_100092950 Ga0070694_1000929503 111
167 3300005444 Ga0070694_101519785 Ga0070694_1015197852 111
168 3300005543 Ga0070672_100456423 Ga0070672_1004564232 111
169 3300005614 Ga0068856_100571006 Ga0068856_1005710063 111
170 3300005618 Ga0068864_102122317 Ga0068864_1021223171 111
171 3300005841 Ga0068863_100587720 Ga0068863_1005877202 111
172 3300005841 Ga0068863_101435572 Ga0068863_1014355721 111
173 3300005844 Ga0068862_100569153 Ga0068862_1005691532 111
174 3300006051 Ga0075364_11222676 Ga0075364_112226762 111
175 3300006058 Ga0075432_10107019 Ga0075432_101070192 111
176 3300006195 Ga0075366_10496181 Ga0075366_104961812 111
177 3300006844 Ga0075428_100067243 Ga0075428_1000672434 111
178 3300006844 Ga0075428_101071261 Ga0075428_1010712612 111
179 3300006846 Ga0075430_100427646 Ga0075430_1004276462 111
180 3300006880 Ga0075429_101026141 Ga0075429_1010261411 111
181 3300009094 Ga0111539_10199037 Ga0111539_101990371 111
182 3300009094 Ga0111539_11137655 Ga0111539_111376552 111
183 3300011119 Ga0105246_10596506 Ga0105246_105965062 111
184 3300013296 Ga0157374_10904200 Ga0157374_109042002 111
185 3300013308 Ga0157375_10806812 Ga0157375_108068122 111
186 3300013308 Ga0157375_11424709 Ga0157375_114247092 111
187 3300014325 Ga0163163_10009963 Ga0163163_100099633 111
188 3300014326 Ga0157380_10370482 Ga0157380_103704822 111
189 3300014326 Ga0157380_10466189 Ga0157380_104661892 111
190 3300014326 Ga0157380_12866217 Ga0157380_128662172 111
191 3300014969 Ga0157376_10346479 Ga0157376_103464793 111
192 3300025917 Ga0207660_11505875 Ga0207660_115058752 111
193 3300025941 Ga0207711_10022622 Ga0207711_100226222 111
194 3300026041 Ga0207639_12187292 Ga0207639_121872922 111
195 3300026075 Ga0207708_10190301 Ga0207708_101903011 111
196 3300026078 Ga0207702_10488514 Ga0207702_104885143 111
197 3300026088 Ga0207641_11402164 Ga0207641_114021642 111
198 3300026088 Ga0207641_11912810 Ga0207641_119128101 111
199 3300026095 Ga0207676_10210411 Ga0207676_102104113 111
200 3300026121 Ga0207683_10171205 Ga0207683_101712052 111
201 3300027907 Ga0207428_10001453 Ga0207428_1000145320 111
202 3300027907 Ga0207428_10045203 Ga0207428_100452034 111
203 3300027907 Ga0207428_10714540 Ga0207428_107145402 111
204 3300028380 Ga0268265_10516484 Ga0268265_105164842 111
205 3300031911 Ga0307412_11679614 Ga0307412_116796142 111
206 3300031995 Ga0307409_101959451 Ga0307409_1019594512 111
207 3300041459 Ga0451800_1249912 Ga0451800_1249912_384_725 111
208 3300041512 Ga0451853_3562112 Ga0451853_3562112_61_402 111
209 3300042156 Ga0439446_0036404 Ga0439446_0036404_1020_1361 111
210 3300044694 Ga0466963_0844041 Ga0466963_0844041_41_385 111
211 3300046459 Ga0495629_0536684 Ga0495629_0536684_184_528 111
212 3300046477 Ga0495664_0063537 Ga0495664_0063537_853_1191 111
213 3300046536 Ga0495587_0259213 Ga0495587_0259213_573_911 111
214 3300046539 Ga0495621_0003005 Ga0495621_0003005_4127_4474 111
215 3300046543 Ga0495645_0037736 Ga0495645_0037736_2408_2746 111
216 3300046543 Ga0495645_0295460 Ga0495645_0295460_11_349 111
217 3300046663 Ga0495635_0044488 Ga0495635_0044488_1490_1828 111
218 3300046675 Ga0495657_0104099 Ga0495657_0104099_318_656 111
219 3300046679 Ga0495623_0005830 Ga0495623_0005830_3190_3528 111
220 3300046684 Ga0495669_0053917 Ga0495669_0053917_1138_1476 111
221 3300046691 Ga0495670_0310492 Ga0495670_0310492_206_550 111
222 3300046691 Ga0495670_0322910 Ga0495670_0322910_399_746 111
223 3300046809 Ga0495600_0444657 Ga0495600_0444657_185_523 111
224 3300047317 Ga0495604_0085571 Ga0495604_0085571_1964_2302 111
225 3300047318 Ga0495636_0148566 Ga0495636_0148566_685_1023 111
226 3300047321 Ga0495676_0398924 Ga0495676_0398924_180_524 111
227 3300047322 Ga0495680_0702293 Ga0495680_0702293_51_389 111
228 3300047444 Ga0495675_0013899 Ga0495675_0013899_2772_3110 111
229 3300047444 Ga0495675_0057262 Ga0495675_0057262_917_1255 111
230 3300048088 Ga0495602_0258216 Ga0495602_0258216_639_977 111
231 3300049514 Ga0501291_126640 Ga0501291_126640_67_411 111
232 3300049572 Ga0501036_0107811 Ga0501036_0107811_446_787 111
233 3300049575 Ga0501039_1480782 Ga0501039_1480782_94_435 111
234 3300049577 Ga0501041_0748277 Ga0501041_0748277_52_393 111
235 3300049578 Ga0501042_0391007 Ga0501042_0391007_603_944 111
236 3300049578 Ga0501042_0403516 Ga0501042_0403516_567_908 111
237 3300049580 Ga0501046_0280040 Ga0501046_0280040_201_542 111
238 3300049582 Ga0501048_0610428 Ga0501048_0610428_92_433 111
239 3300049582 Ga0501048_1164066 Ga0501048_1164066_132_473 111
240 3300049588 Ga0501072_0033268 Ga0501072_0033268_1886_2227 111
241 3300049589 Ga0501073_0308941 Ga0501073_0308941_420_761 111
242 3300049591 Ga0501075_0033022 Ga0501075_0033022_903_1244 111
243 3300049591 Ga0501075_0691062 Ga0501075_0691062_164_505 111
244 3300049592 Ga0501076_0380884 Ga0501076_0380884_730_1071 111
245 3300049741 Ga0501079_0291187 Ga0501079_0291187_299_637 111
246 3300049742 Ga0501080_0427819 Ga0501080_0427819_98_439 111
247 3300049742 Ga0501080_0939664 Ga0501080_0939664_98_439 111
248 3300049742 Ga0501080_1125694 Ga0501080_1125694_49_387 111
249 3300049743 Ga0501081_0398870 Ga0501081_0398870_398_739 111
250 3300049743 Ga0501081_0591366 Ga0501081_0591366_264_602 111
251 3300049822 Ga0501035_0858132 Ga0501035_0858132_47_388 111
252 3300049824 Ga0501045_0130958 Ga0501045_0130958_182_523 111
253 3300050493 nmdc:mga0k408_498873_c1 nmdc:mga0k408_498873_c1_46_387 111
254 3300050509 nmdc:mga0qj67_721125_c1 nmdc:mga0qj67_721125_c1_162_503 111
255 3300050511 nmdc:mga08y16_1231_c1 nmdc:mga08y16_1231_c1_15045_15386 111
256 3300050511 nmdc:mga08y16_226260_c1 nmdc:mga08y16_226260_c1_937_1278 111
257 3300050511 nmdc:mga08y16_597470_c1 nmdc:mga08y16_597470_c1_115_456 111
258 3300054114 Ga0501084_0061070 Ga0501084_0061070_790_1131 111
259 3300054114 Ga0501084_0394814 Ga0501084_0394814_793_1134 111
260 3300060353 Ga0501082_0795640 Ga0501082_0795640_365_706 111
261 3300060353 Ga0501082_1154840 Ga0501082_1154840_208_549 111
262 3300061734 Ga0530510_0057468 Ga0530510_0057468_205_546 111
263 2162886011 MRS1b_contig_2079529 MRS1b_0524.00001140 112
264 3300003503 JGI26141J51220_1004726 JGI26141J51220_10047262 112
265 3300003781 Ga0055536_1002226 Ga0055536_10022265 112
266 3300003791 Ga0055530_10000513 Ga0055530_1000051323 112
267 3300003791 Ga0055530_10002706 Ga0055530_100027065 112
268 3300003791 Ga0055530_10057419 Ga0055530_100574191 112
269 3300003792 Ga0055540_1000426 Ga0055540_100042623 112
270 3300003792 Ga0055540_1000516 Ga0055540_100051617 112
271 3300005288 Ga0065714_10003982 Ga0065714_100039823 112
272 3300005288 Ga0065714_10013467 Ga0065714_100134672 112
273 3300005288 Ga0065714_10018129 Ga0065714_100181292 112
274 3300005288 Ga0065714_10031746 Ga0065714_100317461 112
275 3300005288 Ga0065714_10088528 Ga0065714_100885282 112
276 3300005288 Ga0065714_10138835 Ga0065714_101388351 112
277 3300005289 Ga0065704_10016620 Ga0065704_100166203 112
278 3300005289 Ga0065704_10029536 Ga0065704_100295363 112
279 3300005289 Ga0065704_10070839 Ga0065704_100708399 112
280 3300005289 Ga0065704_10082761 Ga0065704_100827612 112
281 3300005289 Ga0065704_10107455 Ga0065704_101074552 112
282 3300005290 Ga0065712_10068271 Ga0065712_100682716 112
283 3300005331 Ga0070670_100055136 Ga0070670_1000551361 112
284 3300005347 Ga0070668_100505535 Ga0070668_1005055352 112
285 3300005353 Ga0070669_100521194 Ga0070669_1005211942 112
286 3300005356 Ga0070674_100429091 Ga0070674_1004290912 112
287 3300005456 Ga0070678_100863396 Ga0070678_1008633962 112
288 3300005548 Ga0070665_100969913 Ga0070665_1009699132 112
289 3300005563 Ga0068855_101599002 Ga0068855_1015990021 112
290 3300005841 Ga0068863_101092414 Ga0068863_1010924142 112
291 3300006038 Ga0075365_10325229 Ga0075365_103252292 112
292 3300006051 Ga0075364_10177853 Ga0075364_101778533 112
293 3300006051 Ga0075364_10247907 Ga0075364_102479072 112
294 3300006058 Ga0075432_10007357 Ga0075432_100073571 112
295 3300006058 Ga0075432_10036242 Ga0075432_100362422 112
296 3300006058 Ga0075432_10042415 Ga0075432_100424152 112
297 3300006058 Ga0075432_10069857 Ga0075432_100698572 112
298 3300006058 Ga0075432_10364468 Ga0075432_103644682 112
299 3300006177 Ga0075362_10162367 Ga0075362_101623672 112
300 3300006177 Ga0075362_10393227 Ga0075362_103932272 112
301 3300006358 Ga0068871_101979739 Ga0068871_1019797391 112
302 3300006844 Ga0075428_101099077 Ga0075428_1010990772 112
303 3300006852 Ga0075433_10172749 Ga0075433_101727492 112
304 3300006881 Ga0068865_100249172 Ga0068865_1002491721 112
305 3300006914 Ga0075436_100463883 Ga0075436_1004638832 112
306 3300006946 Ga0079104_1002096 Ga0079104_10020963 112
307 3300009011 Ga0105251_10000322 Ga0105251_1000032238 112
308 3300009011 Ga0105251_10001209 Ga0105251_1000120915 112
309 3300009011 Ga0105251_10004229 Ga0105251_100042293 112
310 3300009011 Ga0105251_10025863 Ga0105251_100258635 112
311 3300009011 Ga0105251_10150016 Ga0105251_101500161 112
312 3300009011 Ga0105251_10254405 Ga0105251_102544052 112
313 3300009011 Ga0105251_10264450 Ga0105251_102644502 112
314 3300009036 Ga0105244_10001414 Ga0105244_1000141415 112
315 3300009036 Ga0105244_10099039 Ga0105244_100990392 112
316 3300009036 Ga0105244_10132498 Ga0105244_101324982 112
317 3300009036 Ga0105244_10136140 Ga0105244_101361402 112
318 3300009036 Ga0105244_10239977 Ga0105244_102399772 112
319 3300009036 Ga0105244_10365250 Ga0105244_103652501 112
320 3300009092 Ga0105250_10000708 Ga0105250_1000070810 112
321 3300009092 Ga0105250_10013410 Ga0105250_100134103 112
322 3300009092 Ga0105250_10067548 Ga0105250_100675482 112
323 3300009093 Ga0105240_10374631 Ga0105240_103746312 112
324 3300009094 Ga0111539_10776502 Ga0111539_107765022 112
325 3300009148 Ga0105243_10016043 Ga0105243_100160437 112
326 3300009148 Ga0105243_10068135 Ga0105243_100681354 112
327 3300009148 Ga0105243_10069695 Ga0105243_100696954 112
328 3300009148 Ga0105243_10095786 Ga0105243_100957861 112
329 3300009148 Ga0105243_10190332 Ga0105243_101903323 112
330 3300009148 Ga0105243_10476606 Ga0105243_104766062 112
331 3300009176 Ga0105242_10445872 Ga0105242_104458723 112
332 3300011119 Ga0105246_10005186 Ga0105246_100051865 112
333 3300012498 Ga0157345_1000309 Ga0157345_10003096 112
334 3300013100 Ga0157373_10273837 Ga0157373_102738372 112
335 3300013102 Ga0157371_10000536 Ga0157371_1000053637 112
336 3300013104 Ga0157370_10196235 Ga0157370_101962353 112
337 3300013104 Ga0157370_11589889 Ga0157370_115898892 112
338 3300013105 Ga0157369_10394127 Ga0157369_103941272 112
339 3300013306 Ga0163162_10545464 Ga0163162_105454642 112
340 3300013306 Ga0163162_10761676 Ga0163162_107616761 112
341 3300013307 Ga0157372_10012166 Ga0157372_100121666 112
342 3300013307 Ga0157372_10162967 Ga0157372_101629672 112
343 3300014326 Ga0157380_10216934 Ga0157380_102169342 112
344 3300014497 Ga0182008_10009603 Ga0182008_100096035 112
345 3300014497 Ga0182008_10011766 Ga0182008_100117665 112
346 3300014497 Ga0182008_10037144 Ga0182008_100371442 112
347 3300015261 Ga0182006_1002602 Ga0182006_10026025 112
348 3300015261 Ga0182006_1018853 Ga0182006_10188532 112
349 3300015261 Ga0182006_1069548 Ga0182006_10695482 112
350 3300015265 Ga0182005_1017317 Ga0182005_10173173 112
351 3300017792 Ga0163161_10014054 Ga0163161_100140544 112
352 3300017792 Ga0163161_10017026 Ga0163161_100170262 112
353 3300017792 Ga0163161_10172271 Ga0163161_101722712 112
354 3300017792 Ga0163161_10986452 Ga0163161_109864522 112
355 3300017792 Ga0163161_11403819 Ga0163161_114038192 112
356 3300025292 Ga0209676_1000668 Ga0209676_100066810 112
357 3300025292 Ga0209676_1001477 Ga0209676_100147714 112
358 3300025292 Ga0209676_1008998 Ga0209676_10089986 112
359 3300025298 Ga0209050_1000024 Ga0209050_1000024481 112
360 3300025298 Ga0209050_1000128 Ga0209050_100012810 112
361 3300025298 Ga0209050_1005862 Ga0209050_10058626 112
362 3300025303 Ga0209051_1000023 Ga0209051_1000023397 112
363 3300025303 Ga0209051_1000791 Ga0209051_100079110 112
364 3300025303 Ga0209051_1015706 Ga0209051_10157063 112
365 3300025304 Ga0209257_1011030 Ga0209257_10110305 112
366 3300025711 Ga0207696_1000064 Ga0207696_1000064203 112
367 3300025711 Ga0207696_1000094 Ga0207696_100009410 112
368 3300025711 Ga0207696_1005907 Ga0207696_10059076 112
369 3300025711 Ga0207696_1006396 Ga0207696_10063962 112
370 3300025728 Ga0207655_1000598 Ga0207655_100059835 112
371 3300025728 Ga0207655_1001446 Ga0207655_100144622 112
372 3300025728 Ga0207655_1004682 Ga0207655_10046823 112
373 3300025728 Ga0207655_1004949 Ga0207655_10049496 112
374 3300025728 Ga0207655_1010242 Ga0207655_10102422 112
375 3300025728 Ga0207655_1016556 Ga0207655_10165566 112
376 3300025728 Ga0207655_1214563 Ga0207655_12145632 112
377 3300025728 Ga0207655_1239797 Ga0207655_12397971 112
378 3300025735 Ga0207713_1000010 Ga0207713_100001010 112
379 3300025735 Ga0207713_1001149 Ga0207713_10011499 112
380 3300025735 Ga0207713_1002491 Ga0207713_10024917 112
381 3300025735 Ga0207713_1005765 Ga0207713_10057655 112
382 3300025735 Ga0207713_1006592 Ga0207713_10065923 112
383 3300025735 Ga0207713_1009458 Ga0207713_10094585 112
384 3300025735 Ga0207713_1170096 Ga0207713_11700961 112
385 3300025735 Ga0207713_1193285 Ga0207713_11932851 112
386 3300025913 Ga0207695_11157143 Ga0207695_111571432 112
387 3300025925 Ga0207650_10000591 Ga0207650_100005919 112
388 3300025935 Ga0207709_10007973 Ga0207709_100079738 112
389 3300025935 Ga0207709_10135427 Ga0207709_101354271 112
390 3300025935 Ga0207709_10656677 Ga0207709_106566772 112
391 3300025935 Ga0207709_10973257 Ga0207709_109732572 112
392 3300025972 Ga0207668_10184618 Ga0207668_101846183 112
393 3300026078 Ga0207702_11500637 Ga0207702_115006371 112
394 3300026088 Ga0207641_11054096 Ga0207641_110540962 112
395 3300026089 Ga0207648_11494309 Ga0207648_114943091 112
396 3300027111 Ga0209281_1000016 Ga0209281_100001610 112
397 3300027312 Ga0209371_1043794 Ga0209371_10437941 112
398 3300027378 Ga0209981_1011386 Ga0209981_10113862 112
399 3300027471 Ga0209995_1015309 Ga0209995_10153092 112
400 3300027665 Ga0209983_1000782 Ga0209983_10007825 112
401 3300027682 Ga0209971_1000459 Ga0209971_10004595 112
402 3300027876 Ga0209974_10001088 Ga0209974_100010888 112
403 3300027907 Ga0207428_10350211 Ga0207428_103502112 112
404 3300030500 Ga0268256_1016622 Ga0268256_10166222 112
405 3300030731 Ga0316177_1039133 Ga0316177_10391332 112
406 3300030733 Ga0314311_1171705 Ga0314311_11717052 112
407 3300030744 Ga0316181_1230923 Ga0316181_12309232 112
408 3300031238 Ga0265332_10240885 Ga0265332_102408851 112
409 3300031251 Ga0265327_10000050 Ga0265327_10000050153 112
410 3300031344 Ga0265316_10105543 Ga0265316_101055433 112
411 3300031548 Ga0307408_100004188 Ga0307408_1000041887 112
412 3300031548 Ga0307408_100412081 Ga0307408_1004120812 112
413 3300031548 Ga0307408_101594883 Ga0307408_1015948832 112
414 3300031616 Ga0307508_10002430 Ga0307508_100024309 112
415 3300031730 Ga0307516_10230890 Ga0307516_102308903 112
416 3300031730 Ga0307516_10264213 Ga0307516_102642131 112
417 3300031731 Ga0307405_10012759 Ga0307405_100127594 112
418 3300031731 Ga0307405_10081139 Ga0307405_100811392 112
419 3300031824 Ga0307413_10108728 Ga0307413_101087283 112
420 3300031824 Ga0307413_10309152 Ga0307413_103091522 112
421 3300031901 Ga0307406_10018460 Ga0307406_100184603 112
422 3300031911 Ga0307412_10013027 Ga0307412_100130273 112
423 3300031911 Ga0307412_10027025 Ga0307412_100270253 112
424 3300031911 Ga0307412_11340905 Ga0307412_113409051 112
425 3300032002 Ga0307416_100238893 Ga0307416_1002388933 112
426 3300032004 Ga0307414_10051516 Ga0307414_100515162 112
427 3300032004 Ga0307414_11700222 Ga0307414_117002221 112
428 3300032005 Ga0307411_10046127 Ga0307411_100461274 112
429 3300033180 Ga0307510_10364876 Ga0307510_103648762 112
430 3300035724 Ga0373933_1144682 Ga0373933_1144682_107_451 112
431 3300035725 Ga0373947_0653781 Ga0373947_0653781_71_415 112
432 3300037418 Ga0395900_0049625 Ga0395900_0049625_2229_2570 112
433 3300039453 Ga0436362_0459754 Ga0436362_0459754_48_389 112
434 3300041405 Ga0439438_000617 Ga0439438_000617_7459_7797 112
435 3300041405 Ga0439438_001709 Ga0439438_001709_7855_8193 112
436 3300041405 Ga0439438_005876 Ga0439438_005876_2551_2889 112
437 3300041405 Ga0439438_015441 Ga0439438_015441_1193_1531 112
438 3300041405 Ga0439438_019173 Ga0439438_019173_1278_1616 112
439 3300041407 Ga0439447_004863 Ga0439447_004863_2874_3212 112
440 3300041407 Ga0439447_006699 Ga0439447_006699_2551_2889 112
441 3300041407 Ga0439447_019050 Ga0439447_019050_811_1149 112
442 3300041411 Ga0439466_0000656 Ga0439466_0000656_9123_9461 112
443 3300041411 Ga0439466_0013218 Ga0439466_0013218_2610_2948 112
444 3300041411 Ga0439466_0031810 Ga0439466_0031810_301_639 112
445 3300041411 Ga0439466_0068474 Ga0439466_0068474_660_998 112
446 3300041460 Ga0451802_0143070 Ga0451802_0143070_226_564 112
447 3300041997 Ga0439431_0000429 Ga0439431_0000429_5064_5402 112
448 3300042004 Ga0439445_0005090 Ga0439445_0005090_1395_1733 112
449 3300042006 Ga0439432_000568 Ga0439432_000568_4061_4399 112
450 3300042006 Ga0439432_001884 Ga0439432_001884_6387_6725 112
451 3300042006 Ga0439432_064942 Ga0439432_064942_176_514 112
452 3300042006 Ga0439432_076187 Ga0439432_076187_36_374 112
453 3300042009 Ga0439451_008450 Ga0439451_008450_1130_1468 112
454 3300042009 Ga0439451_008701 Ga0439451_008701_1081_1419 112
455 3300042010 Ga0439452_000363 Ga0439452_000363_23781_24119 112
456 3300042010 Ga0439452_004175 Ga0439452_004175_2039_2377 112
457 3300042010 Ga0439452_010976 Ga0439452_010976_1416_1754 112
458 3300042010 Ga0439452_016863 Ga0439452_016863_861_1199 112
459 3300042010 Ga0439452_054732 Ga0439452_054732_469_846 112
460 3300042013 Ga0439456_000065 Ga0439456_000065_8908_9246 112
461 3300042013 Ga0439456_010172 Ga0439456_010172_1022_1360 112
462 3300042013 Ga0439456_010707 Ga0439456_010707_1109_1447 112
463 3300042013 Ga0439456_014475 Ga0439456_014475_1148_1486 112
464 3300042013 Ga0439456_031273 Ga0439456_031273_441_779 112
465 3300042016 Ga0439463_000583 Ga0439463_000583_3555_3893 112
466 3300042115 Ga0450911_002207 Ga0450911_002207_289_627 112
467 3300042121 Ga0450919_002101 Ga0450919_002101_2107_2445 112
468 3300042124 Ga0450922_000436 Ga0450922_000436_1298_1636 112
469 3300042137 Ga0450902_000111 Ga0450902_000111_1815_2153 112
470 3300042138 Ga0450903_005870 Ga0450903_005870_1166_1504 112
471 3300042147 Ga0450910_000249 Ga0450910_000249_4077_4415 112
472 3300042147 Ga0450910_023484 Ga0450910_023484_70_408 112
473 3300042156 Ga0439446_0022272 Ga0439446_0022272_973_1311 112
474 3300042184 Ga0450908_108599 Ga0450908_108599_45_383 112
475 3300042461 Ga0439460_0068732 Ga0439460_0068732_284_622 112
476 3300042531 Ga0450918_086231 Ga0450918_086231_100_438 112
477 3300042532 Ga0450893_0000768 Ga0450893_0000768_3243_3581 112
478 3300042532 Ga0450893_0015117 Ga0450893_0015117_857_1195 112
479 3300042876 Ga0451577_0011709 Ga0451577_0011709_1261_1605 112
480 3300042993 Ga0439440_0003338 Ga0439440_0003338_453_791 112
481 3300044673 Ga0453683_0012263 Ga0453683_0012263_4005_4349 112
482 3300044712 Ga0453684_0031986 Ga0453684_0031986_1290_1634 112
483 3300045051 Ga0451576_0037783 Ga0451576_0037783_3137_3487 112
484 3300045051 Ga0451576_0217822 Ga0451576_0217822_183_527 112
485 3300046452 Ga0495617_001780 Ga0495617_001780_4102_4440 112
486 3300046452 Ga0495617_005964 Ga0495617_005964_1091_1429 112
487 3300046452 Ga0495617_027610 Ga0495617_027610_1137_1475 112
488 3300046453 Ga0495627_000236 Ga0495627_000236_48799_49137 112
489 3300046453 Ga0495627_000913 Ga0495627_000913_8129_8467 112
490 3300046453 Ga0495627_004413 Ga0495627_004413_3531_3869 112
491 3300046453 Ga0495627_019803 Ga0495627_019803_689_1027 112
492 3300046453 Ga0495627_024631 Ga0495627_024631_607_945 112
493 3300046453 Ga0495627_033993 Ga0495627_033993_1170_1508 112
494 3300046454 Ga0495592_0596636 Ga0495592_0596636_108_488 112
495 3300046455 Ga0495603_0127894 Ga0495603_0127894_612_950 112
496 3300046457 Ga0495590_0004856 Ga0495590_0004856_3190_3528 112
497 3300046457 Ga0495590_0006830 Ga0495590_0006830_2903_3241 112
498 3300046457 Ga0495590_0019724 Ga0495590_0019724_2027_2365 112
499 3300046457 Ga0495590_0328322 Ga0495590_0328322_121_459 112
500 3300046457 Ga0495590_0351324 Ga0495590_0351324_194_532 112
501 3300046458 Ga0495591_000262 Ga0495591_000262_9304_9693 112
502 3300046458 Ga0495591_000908 Ga0495591_000908_5669_6007 112
503 3300046458 Ga0495591_005704 Ga0495591_005704_1172_1510 112
504 3300046458 Ga0495591_077494 Ga0495591_077494_206_544 112
505 3300046458 Ga0495591_149772 Ga0495591_149772_38_376 112
506 3300046459 Ga0495629_0017879 Ga0495629_0017879_4372_4752 112
507 3300046460 Ga0495638_0017189 Ga0495638_0017189_3267_3605 112
508 3300046460 Ga0495638_0019683 Ga0495638_0019683_3551_3889 112
509 3300046460 Ga0495638_0033102 Ga0495638_0033102_937_1275 112
510 3300046460 Ga0495638_0059044 Ga0495638_0059044_846_1184 112
511 3300046460 Ga0495638_0364930 Ga0495638_0364930_385_723 112
512 3300046463 Ga0495653_0003057 Ga0495653_0003057_660_998 112
513 3300046463 Ga0495653_0022711 Ga0495653_0022711_1085_1465 112
514 3300046463 Ga0495653_0023453 Ga0495653_0023453_1270_1608 112
515 3300046463 Ga0495653_0078617 Ga0495653_0078617_2075_2413 112
516 3300046471 Ga0495650_0001753 Ga0495650_0001753_8145_8483 112
517 3300046471 Ga0495650_0011649 Ga0495650_0011649_3708_4046 112
518 3300046471 Ga0495650_0015510 Ga0495650_0015510_3103_3441 112
519 3300046471 Ga0495650_0041618 Ga0495650_0041618_470_808 112
520 3300046473 Ga0495582_0012439 Ga0495582_0012439_3180_3560 112
521 3300046474 Ga0495605_0000305 Ga0495605_0000305_43992_44330 112
522 3300046474 Ga0495605_0004768 Ga0495605_0004768_2828_3166 112
523 3300046474 Ga0495605_0300191 Ga0495605_0300191_267_605 112
524 3300046475 Ga0495639_0004444 Ga0495639_0004444_1406_1786 112
525 3300046491 Ga0495584_0001213 Ga0495584_0001213_10637_10975 112
526 3300046491 Ga0495584_0056028 Ga0495584_0056028_809_1147 112
527 3300046491 Ga0495584_0179772 Ga0495584_0179772_11_349 112
528 3300046492 Ga0495585_0002376 Ga0495585_0002376_8398_8736 112
529 3300046492 Ga0495585_0004001 Ga0495585_0004001_1488_1826 112
530 3300046492 Ga0495585_0007958 Ga0495585_0007958_4784_5122 112
531 3300046492 Ga0495585_0114194 Ga0495585_0114194_718_1056 112
532 3300046499 Ga0495594_0313651 Ga0495594_0313651_32_412 112
533 3300046501 Ga0495607_0001512 Ga0495607_0001512_8209_8547 112
534 3300046501 Ga0495607_0001663 Ga0495607_0001663_12386_12724 112
535 3300046501 Ga0495607_0001685 Ga0495607_0001685_9553_9942 112
536 3300046501 Ga0495607_0001747 Ga0495607_0001747_4757_5095 112
537 3300046501 Ga0495607_0002473 Ga0495607_0002473_7791_8129 112
538 3300046501 Ga0495607_0047403 Ga0495607_0047403_962_1300 112
539 3300046501 Ga0495607_0050932 Ga0495607_0050932_1927_2265 112
540 3300046501 Ga0495607_0104096 Ga0495607_0104096_80_418 112
541 3300046501 Ga0495607_0163611 Ga0495607_0163611_272_610 112
542 3300046501 Ga0495607_0251164 Ga0495607_0251164_298_636 112
543 3300046501 Ga0495607_0507291 Ga0495607_0507291_123_461 112
544 3300046506 Ga0495583_0002263 Ga0495583_0002263_8263_8601 112
545 3300046506 Ga0495583_0003780 Ga0495583_0003780_2153_2512 112
546 3300046506 Ga0495583_0006029 Ga0495583_0006029_3802_4140 112
547 3300046506 Ga0495583_0273942 Ga0495583_0273942_22_360 112
548 3300046507 Ga0495606_0000785 Ga0495606_0000785_39961_40299 112
549 3300046507 Ga0495606_0003478 Ga0495606_0003478_12598_12936 112
550 3300046507 Ga0495606_0023130 Ga0495606_0023130_3080_3418 112
551 3300046507 Ga0495606_0069559 Ga0495606_0069559_720_1058 112
552 3300046512 Ga0495610_0010636 Ga0495610_0010636_3766_4104 112
553 3300046512 Ga0495610_0038056 Ga0495610_0038056_1172_1510 112
554 3300046513 Ga0495616_0001961 Ga0495616_0001961_4753_5091 112
555 3300046513 Ga0495616_0163522 Ga0495616_0163522_471_809 112
556 3300046513 Ga0495616_0194365 Ga0495616_0194365_97_435 112
557 3300046515 Ga0495620_0000033 Ga0495620_0000033_8312_8650 112
558 3300046515 Ga0495620_0014188 Ga0495620_0014188_2575_2913 112
559 3300046515 Ga0495620_0033940 Ga0495620_0033940_814_1152 112
560 3300046516 Ga0495628_0502412 Ga0495628_0502412_318_656 112
561 3300046517 Ga0495630_0019938 Ga0495630_0019938_1022_1360 112
562 3300046517 Ga0495630_0028337 Ga0495630_0028337_3515_3895 112
563 3300046518 Ga0495631_0001408 Ga0495631_0001408_11938_12276 112
564 3300046518 Ga0495631_0006806 Ga0495631_0006806_1155_1493 112
565 3300046518 Ga0495631_0044439 Ga0495631_0044439_1607_1945 112
566 3300046519 Ga0495632_0000399 Ga0495632_0000399_8316_8654 112
567 3300046519 Ga0495632_0001643 Ga0495632_0001643_13211_13549 112
568 3300046519 Ga0495632_0004604 Ga0495632_0004604_748_1086 112
569 3300046519 Ga0495632_0006335 Ga0495632_0006335_1985_2323 112
570 3300046519 Ga0495632_0008067 Ga0495632_0008067_853_1191 112
571 3300046519 Ga0495632_0012185 Ga0495632_0012185_3779_4117 112
572 3300046519 Ga0495632_0022973 Ga0495632_0022973_2689_3027 112
573 3300046519 Ga0495632_0030851 Ga0495632_0030851_1528_1866 112
574 3300046519 Ga0495632_0059406 Ga0495632_0059406_36_374 112
575 3300046519 Ga0495632_0060365 Ga0495632_0060365_376_714 112
576 3300046519 Ga0495632_0089548 Ga0495632_0089548_36_374 112
577 3300046519 Ga0495632_0160037 Ga0495632_0160037_213_551 112
578 3300046520 Ga0495637_0001314 Ga0495637_0001314_6696_7034 112
579 3300046520 Ga0495637_0002210 Ga0495637_0002210_2339_2677 112
580 3300046520 Ga0495637_0002604 Ga0495637_0002604_8547_8936 112
581 3300046520 Ga0495637_0011937 Ga0495637_0011937_2673_3011 112
582 3300046520 Ga0495637_0012382 Ga0495637_0012382_2426_2764 112
583 3300046520 Ga0495637_0015609 Ga0495637_0015609_1921_2259 112
584 3300046520 Ga0495637_0017272 Ga0495637_0017272_1444_1782 112
585 3300046520 Ga0495637_0025612 Ga0495637_0025612_2087_2425 112
586 3300046520 Ga0495637_0065262 Ga0495637_0065262_71_409 112
587 3300046520 Ga0495637_0110850 Ga0495637_0110850_28_366 112
588 3300046522 Ga0495643_0001356 Ga0495643_0001356_14151_14489 112
589 3300046522 Ga0495643_0004576 Ga0495643_0004576_4807_5145 112
590 3300046522 Ga0495643_0029284 Ga0495643_0029284_1906_2244 112
591 3300046523 Ga0495644_0003429 Ga0495644_0003429_4971_5309 112
592 3300046524 Ga0495648_0002328 Ga0495648_0002328_8160_8498 112
593 3300046524 Ga0495648_0002836 Ga0495648_0002836_6837_7175 112
594 3300046524 Ga0495648_0009421 Ga0495648_0009421_4750_5088 112
595 3300046524 Ga0495648_0012155 Ga0495648_0012155_1457_1795 112
596 3300046524 Ga0495648_0071018 Ga0495648_0071018_1249_1587 112
597 3300046524 Ga0495648_0100587 Ga0495648_0100587_1171_1509 112
598 3300046524 Ga0495648_0160601 Ga0495648_0160601_93_431 112
599 3300046526 Ga0495666_0009296 Ga0495666_0009296_1355_1735 112
600 3300046526 Ga0495666_0009803 Ga0495666_0009803_3471_3809 112
601 3300046526 Ga0495666_0021846 Ga0495666_0021846_2203_2541 112
602 3300046526 Ga0495666_0376683 Ga0495666_0376683_90_428 112
603 3300046528 Ga0495642_0000910 Ga0495642_0000910_4616_4954 112
604 3300046530 Ga0495654_0001804 Ga0495654_0001804_5920_6258 112
605 3300046530 Ga0495654_0003274 Ga0495654_0003274_182_520 112
606 3300046530 Ga0495654_0007411 Ga0495654_0007411_4710_5048 112
607 3300046530 Ga0495654_0009251 Ga0495654_0009251_3279_3617 112
608 3300046530 Ga0495654_0020033 Ga0495654_0020033_1109_1447 112
609 3300046530 Ga0495654_0028422 Ga0495654_0028422_1286_1624 112
610 3300046530 Ga0495654_0040865 Ga0495654_0040865_1006_1344 112
611 3300046530 Ga0495654_0123134 Ga0495654_0123134_280_618 112
612 3300046530 Ga0495654_0303987 Ga0495654_0303987_54_392 112
613 3300046535 Ga0495586_0149539 Ga0495586_0149539_393_773 112
614 3300046535 Ga0495586_0469407 Ga0495586_0469407_374_712 112
615 3300046536 Ga0495587_0010198 Ga0495587_0010198_2075_2413 112
616 3300046536 Ga0495587_0358227 Ga0495587_0358227_288_668 112
617 3300046538 Ga0495609_0000226 Ga0495609_0000226_46539_46877 112
618 3300046538 Ga0495609_0005057 Ga0495609_0005057_4765_5103 112
619 3300046538 Ga0495609_0005960 Ga0495609_0005960_4771_5109 112
620 3300046538 Ga0495609_0025842 Ga0495609_0025842_1561_1899 112
621 3300046538 Ga0495609_0026423 Ga0495609_0026423_462_800 112
622 3300046538 Ga0495609_0058308 Ga0495609_0058308_35_373 112
623 3300046538 Ga0495609_0070746 Ga0495609_0070746_434_772 112
624 3300046542 Ga0495597_0000235 Ga0495597_0000235_9186_9575 112
625 3300046542 Ga0495597_0006339 Ga0495597_0006339_3717_4055 112
626 3300046542 Ga0495597_0009917 Ga0495597_0009917_4205_4543 112
627 3300046542 Ga0495597_0016368 Ga0495597_0016368_2295_2633 112
628 3300046543 Ga0495645_0192699 Ga0495645_0192699_302_682 112
629 3300046543 Ga0495645_0493087 Ga0495645_0493087_18_356 112
630 3300046557 Ga0495622_0005622 Ga0495622_0005622_1157_1495 112
631 3300046557 Ga0495622_0093996 Ga0495622_0093996_406_744 112
632 3300046558 Ga0495633_0040855 Ga0495633_0040855_1132_1470 112
633 3300046616 Ga0495668_0015584 Ga0495668_0015584_2940_3278 112
634 3300046616 Ga0495668_0192940 Ga0495668_0192940_224_562 112
635 3300046642 Ga0495634_0017298 Ga0495634_0017298_1182_1520 112
636 3300046642 Ga0495634_0026732 Ga0495634_0026732_2934_3314 112
637 3300046648 Ga0495611_0115710 Ga0495611_0115710_314_652 112
638 3300046660 Ga0495625_0012667 Ga0495625_0012667_828_1166 112
639 3300046660 Ga0495625_0340579 Ga0495625_0340579_131_475 112
640 3300046663 Ga0495635_0018083 Ga0495635_0018083_1014_1352 112
641 3300046663 Ga0495635_0021873 Ga0495635_0021873_2737_3117 112
642 3300046665 Ga0495661_0000320 Ga0495661_0000320_8213_8551 112
643 3300046665 Ga0495661_0000340 Ga0495661_0000340_42921_43259 112
644 3300046665 Ga0495661_0004957 Ga0495661_0004957_2440_2778 112
645 3300046665 Ga0495661_0144767 Ga0495661_0144767_257_595 112
646 3300046665 Ga0495661_0276123 Ga0495661_0276123_71_409 112
647 3300046675 Ga0495657_0069879 Ga0495657_0069879_1310_1648 112
648 3300046679 Ga0495623_0022106 Ga0495623_0022106_155_493 112
649 3300046680 Ga0495646_0077615 Ga0495646_0077615_275_655 112
650 3300046680 Ga0495646_0114860 Ga0495646_0114860_33_371 112
651 3300046689 Ga0495613_0012188 Ga0495613_0012188_1217_1597 112
652 3300046689 Ga0495613_0251426 Ga0495613_0251426_377_715 112
653 3300046691 Ga0495670_0008703 Ga0495670_0008703_4613_4951 112
654 3300046691 Ga0495670_0227285 Ga0495670_0227285_156_494 112
655 3300046691 Ga0495670_0483248 Ga0495670_0483248_244_582 112
656 3300046692 Ga0495671_0001637 Ga0495671_0001637_9421_9759 112
657 3300046692 Ga0495671_0012382 Ga0495671_0012382_2525_2863 112
658 3300046692 Ga0495671_0016806 Ga0495671_0016806_1136_1474 112
659 3300046692 Ga0495671_0027263 Ga0495671_0027263_334_672 112
660 3300046692 Ga0495671_0084299 Ga0495671_0084299_110_448 112
661 3300046692 Ga0495671_0117479 Ga0495671_0117479_173_511 112
662 3300046692 Ga0495671_0515418 Ga0495671_0515418_77_415 112
663 3300046694 Ga0495649_0001345 Ga0495649_0001345_13572_13910 112
664 3300046694 Ga0495649_0001639 Ga0495649_0001639_8400_8738 112
665 3300046694 Ga0495649_0035144 Ga0495649_0035144_2368_2706 112
666 3300046694 Ga0495649_0129357 Ga0495649_0129357_255_593 112
667 3300046694 Ga0495649_0188277 Ga0495649_0188277_464_802 112
668 3300046794 Ga0495589_0000890 Ga0495589_0000890_13421_13759 112
669 3300046794 Ga0495589_0080322 Ga0495589_0080322_93_431 112
670 3300046809 Ga0495600_0087300 Ga0495600_0087300_538_876 112
671 3300046810 Ga0495660_0004190 Ga0495660_0004190_6546_6935 112
672 3300046810 Ga0495660_0010112 Ga0495660_0010112_486_824 112
673 3300046810 Ga0495660_0012324 Ga0495660_0012324_1152_1490 112
674 3300046810 Ga0495660_0059096 Ga0495660_0059096_882_1220 112
675 3300046810 Ga0495660_0127326 Ga0495660_0127326_869_1207 112
676 3300046810 Ga0495660_0138648 Ga0495660_0138648_154_492 112
677 3300046810 Ga0495660_0380900 Ga0495660_0380900_213_551 112
678 3300047315 Ga0495581_0022649 Ga0495581_0022649_266_646 112
679 3300047317 Ga0495604_0009657 Ga0495604_0009657_1340_1678 112
680 3300047318 Ga0495636_0015323 Ga0495636_0015323_793_1131 112
681 3300047319 Ga0495674_0042227 Ga0495674_0042227_145_483 112
682 3300047320 Ga0495672_0001307 Ga0495672_0001307_4209_4547 112
683 3300047320 Ga0495672_0003882 Ga0495672_0003882_7464_7802 112
684 3300047320 Ga0495672_0008309 Ga0495672_0008309_3794_4249 112
685 3300047320 Ga0495672_0013691 Ga0495672_0013691_895_1233 112
686 3300047320 Ga0495672_0019008 Ga0495672_0019008_1696_2085 112
687 3300047320 Ga0495672_0048088 Ga0495672_0048088_1254_1592 112
688 3300047320 Ga0495672_0122800 Ga0495672_0122800_66_404 112
689 3300047320 Ga0495672_0139526 Ga0495672_0139526_915_1253 112
690 3300047321 Ga0495676_0359831 Ga0495676_0359831_563_901 112
691 3300047322 Ga0495680_0023663 Ga0495680_0023663_3544_3882 112
692 3300047322 Ga0495680_0027415 Ga0495680_0027415_856_1236 112
693 3300047322 Ga0495680_0064963 Ga0495680_0064963_2047_2385 112
694 3300047322 Ga0495680_0116414 Ga0495680_0116414_1251_1589 112
695 3300047323 Ga0495683_0000016 Ga0495683_0000016_8257_8595 112
696 3300047323 Ga0495683_0005198 Ga0495683_0005198_3470_3808 112
697 3300047323 Ga0495683_0006784 Ga0495683_0006784_4804_5142 112
698 3300047443 Ga0495687_003652 Ga0495687_003652_5874_6212 112
699 3300047444 Ga0495675_0025502 Ga0495675_0025502_1027_1365 112
700 3300047444 Ga0495675_0041542 Ga0495675_0041542_908_1246 112
701 3300047444 Ga0495675_0171216 Ga0495675_0171216_496_876 112
702 3300047447 Ga0495685_002011 Ga0495685_002011_4659_4997 112
703 3300047469 Ga0495673_0000789 Ga0495673_0000789_20162_20500 112
704 3300047469 Ga0495673_0002977 Ga0495673_0002977_3684_4022 112
705 3300047469 Ga0495673_0008171 Ga0495673_0008171_1184_1522 112
706 3300047469 Ga0495673_0009275 Ga0495673_0009275_3136_3474 112
707 3300047469 Ga0495673_0009999 Ga0495673_0009999_1817_2155 112
708 3300047469 Ga0495673_0249402 Ga0495673_0249402_135_473 112
709 3300047470 Ga0495681_0008902 Ga0495681_0008902_1158_1496 112
710 3300047470 Ga0495681_0009457 Ga0495681_0009457_882_1262 112
711 3300047470 Ga0495681_0014126 Ga0495681_0014126_3100_3438 112
712 3300047470 Ga0495681_0047354 Ga0495681_0047354_1265_1603 112
713 3300047470 Ga0495681_0078697 Ga0495681_0078697_1125_1463 112
714 3300047470 Ga0495681_0219869 Ga0495681_0219869_411_749 112
715 3300047471 Ga0495684_0025570 Ga0495684_0025570_2999_3337 112
716 3300047472 Ga0495686_0011284 Ga0495686_0011284_1192_1530 112
717 3300047472 Ga0495686_0489003 Ga0495686_0489003_77_466 112
718 3300047673 Ga0495593_0082409 Ga0495593_0082409_1216_1554 112
719 3300047673 Ga0495593_0169587 Ga0495593_0169587_550_888 112
720 3300048088 Ga0495602_0316823 Ga0495602_0316823_676_1014 112
721 3300048091 Ga0495626_0004436 Ga0495626_0004436_4749_5087 112
722 3300048091 Ga0495626_0010993 Ga0495626_0010993_1149_1487 112
723 3300048091 Ga0495626_0036093 Ga0495626_0036093_1932_2270 112
724 3300048091 Ga0495626_0085196 Ga0495626_0085196_915_1253 112
725 3300048905 Ga0496102_0003362 Ga0496102_0003362_9559_9897 112
726 3300048906 Ga0496103_0011982 Ga0496103_0011982_1226_1564 112
727 3300048913 Ga0496110_0082470 Ga0496110_0082470_1014_1352 112
728 3300048914 Ga0496111_0606560 Ga0496111_0606560_162_500 112
729 3300048915 Ga0496112_0189050 Ga0496112_0189050_433_771 112
730 3300048917 Ga0496114_0842127 Ga0496114_0842127_426_764 112
731 3300048919 Ga0496116_0006223 Ga0496116_0006223_1186_1524 112
732 3300048919 Ga0496116_0030580 Ga0496116_0030580_2463_2801 112
733 3300048919 Ga0496116_0116898 Ga0496116_0116898_452_790 112
734 3300048920 Ga0496117_0003735 Ga0496117_0003735_1970_2308 112
735 3300048920 Ga0496117_0010816 Ga0496117_0010816_1938_2276 112
736 3300048920 Ga0496117_0023680 Ga0496117_0023680_3557_3895 112
737 3300048920 Ga0496117_0059992 Ga0496117_0059992_1221_1559 112
738 3300048920 Ga0496117_0078071 Ga0496117_0078071_1836_2174 112
739 3300048920 Ga0496117_0116907 Ga0496117_0116907_274_612 112
740 3300048921 Ga0496118_0002905 Ga0496118_0002905_13160_13498 112
741 3300048921 Ga0496118_0034166 Ga0496118_0034166_3466_3804 112
742 3300048921 Ga0496118_0034853 Ga0496118_0034853_155_493 112
743 3300048922 Ga0496119_0000071 Ga0496119_0000071_7605_7943 112
744 3300048922 Ga0496119_0052534 Ga0496119_0052534_1813_2151 112
745 3300048923 Ga0496120_0004847 Ga0496120_0004847_7240_7578 112
746 3300048924 Ga0496121_0065402 Ga0496121_0065402_1524_1862 112
747 3300048924 Ga0496121_0157986 Ga0496121_0157986_611_949 112
748 3300048924 Ga0496121_0162368 Ga0496121_0162368_386_724 112
749 3300048924 Ga0496121_0339995 Ga0496121_0339995_412_750 112
750 3300048924 Ga0496121_0887112 Ga0496121_0887112_109_447 112
751 3300048925 Ga0496122_0003639 Ga0496122_0003639_11457_11795 112
752 3300048925 Ga0496122_0204105 Ga0496122_0204105_170_508 112
753 3300048926 Ga0496123_0002904 Ga0496123_0002904_11467_11805 112
754 3300048926 Ga0496123_0219271 Ga0496123_0219271_336_674 112
755 3300048926 Ga0496123_0254352 Ga0496123_0254352_355_693 112
756 3300048927 Ga0496124_0000730 Ga0496124_0000730_45323_45661 112
757 3300048927 Ga0496124_0014510 Ga0496124_0014510_2793_3131 112
758 3300048927 Ga0496124_0052285 Ga0496124_0052285_658_996 112
759 3300048927 Ga0496124_0087764 Ga0496124_0087764_1978_2316 112
760 3300048927 Ga0496124_0168466 Ga0496124_0168466_1021_1359 112
761 3300048928 Ga0496125_0001109 Ga0496125_0001109_8393_8731 112
762 3300048929 Ga0496126_0167444 Ga0496126_0167444_379_717 112
763 3300048929 Ga0496126_0255649 Ga0496126_0255649_865_1203 112
764 3300048929 Ga0496126_0255673 Ga0496126_0255673_614_952 112
765 3300049459 Ga0495678_001974 Ga0495678_001974_8246_8584 112
766 3300049459 Ga0495678_002020 Ga0495678_002020_9444_9782 112
767 3300049459 Ga0495678_010151 Ga0495678_010151_1174_1512 112
768 3300049459 Ga0495678_021034 Ga0495678_021034_1804_2142 112
769 3300049460 Ga0495682_0000198 Ga0495682_0000198_40102_40440 112
770 3300049460 Ga0495682_0004844 Ga0495682_0004844_1185_1523 112
771 3300049460 Ga0495682_0023086 Ga0495682_0023086_1570_1908 112
772 3300049530 Ga0501314_025131 Ga0501314_025131_202_540 112
773 3300049539 Ga0501323_000644 Ga0501323_000644_2071_2409 112
774 3300049568 Ga0501031_0810835 Ga0501031_0810835_93_437 112
775 3300049572 Ga0501036_0247379 Ga0501036_0247379_783_1133 112
776 3300049576 Ga0501040_0803102 Ga0501040_0803102_122_472 112
777 3300049583 Ga0501067_0014698 Ga0501067_0014698_1846_2190 112
778 3300049584 Ga0501068_0148253 Ga0501068_0148253_246_590 112
779 3300049585 Ga0501069_0143596 Ga0501069_0143596_228_572 112
780 3300049665 Ga0501227_018988 Ga0501227_018988_758_1096 112
781 3300049680 Ga0501250_098197 Ga0501250_098197_152_490 112
782 3300049741 Ga0501079_0899878 Ga0501079_0899878_327_671 112
783 3300049743 Ga0501081_1491515 Ga0501081_1491515_81_425 112
784 3300049766 Ga0501269_005839 Ga0501269_005839_473_811 112
785 3300049853 Ga0501226_001532 Ga0501226_001532_1075_1413 112
786 3300050489 nmdc:mga03683_73603_c1 nmdc:mga03683_73603_c1_579_917 112
787 3300050489 nmdc:mga03683_98987_c1 nmdc:mga03683_98987_c1_15_353 112
788 3300050491 nmdc:mga00v17_279842_c1 nmdc:mga00v17_279842_c1_32_370 112
789 3300050515 nmdc:mga0a205_67097_c1 nmdc:mga0a205_67097_c1_1870_2214 112
790 3300053111 Ga0500572_001757 Ga0500572_001757_4106_4444 112
791 3300053138 Ga0500564_104323 Ga0500564_104323_283_624 112
792 3300053140 Ga0500573_0044851 Ga0500573_0044851_1417_1755 112
793 3300053142 Ga0500577_0118775 Ga0500577_0118775_457_795 112
794 3300053145 Ga0500586_168579 Ga0500586_168579_68_412 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

19

126

0.95

PF01230

HIT

HIT domain

27

124

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9735 2 108
3o1c-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine 0.9699 1 112
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9696 1 112
6j65-assembly1.cif.gz_B crystal structure of human hint1 mutant complexing with ap4a ii 0.9696 1 112
3o1x-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c84a mutant from rabbit complexed with adenosine 0.969 1 112
ID Description Score Start End Superfamily
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9699 2 112 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9684 2 108 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9633 2 112 3.30.428.10
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9594 1 112 3.30.428.10
3n1sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9584 1 108 3.30.428.10
ID Description Score Start End GO Terms
AF-Q08JU7-F1-model_v4 Protein kinase c inhibitor 0.9939 13 103 GO:0016301
AF-A0A5F4VTR7-F1-model_v4 HIT domain-containing protein 0.988 1 108 GO:0000166
GO:0003824
AF-A0A5S9PID5-F1-model_v4 Purine nucleoside phosphoramidase (EC 3.9.1.-) 0.9869 1 109 GO:0016787
AF-A0A7W0JED7-F1-model_v4 Histidine triad nucleotide-binding protein 0.9865 2 108 GO:0003824
AF-A0A2K6V7R2-F1-model_v4 HIT domain-containing protein 0.9863 5 101 GO:0003824

Feature Viewer

pLDDT pTM Quality
94.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map