F481110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 794 | 432 | 655 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300046458|Ga0495591_000262|Ga0495591_000262_9304_9693 |
| Length | 129 |
| Sequence | VQSIHLHIHPPNKEQTAVDTLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVIPKKPIRTLNDLTEEDKGLAGHILFTAQRLAKELGCEDGFRVVMNCNELGGQTVYHIHMHVLGQRQMNWPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 4 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 5 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 6 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 7 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 8 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 9 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 10 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 11 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 12 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 13 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 14 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 15 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 16 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 17 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 18 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 19 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 20 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 21 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 22 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 23 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 24 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 25 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 26 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 27 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 28 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 29 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 30 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 31 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 32 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 33 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 34 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 35 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 36 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 37 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 38 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 39 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 40 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 41 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 42 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 43 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 44 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 45 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 46 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 47 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 48 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 49 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 50 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 51 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 52 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 53 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 54 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 55 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 56 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 57 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 58 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 59 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 60 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 61 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 62 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 63 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 64 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 65 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 66 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 67 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 68 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 69 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 70 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 71 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 72 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 73 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 74 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 75 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 76 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 77 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 78 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 79 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 80 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 81 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 82 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 83 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 84 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 85 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 86 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 87 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 88 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 89 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 90 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 91 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 92 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 93 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 94 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 95 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 96 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 97 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 98 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 99 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 100 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 101 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 102 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 103 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 104 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 105 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 106 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 107 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 108 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 109 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 110 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 111 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 112 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 113 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 114 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 115 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 116 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 117 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 118 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 119 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 120 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 121 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 122 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 123 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 124 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 125 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 126 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 127 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 128 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 129 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 130 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 131 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 134 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 138 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 152 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 153 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 154 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 155 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 156 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 157 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 158 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 159 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 160 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 161 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 162 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 163 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 164 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 165 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 166 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 167 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 168 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 169 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 178 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 179 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 194 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 226 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 227 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 228 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 248 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 260 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 261 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 262 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 263 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 264 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 265 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 266 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 270 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 271 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 367 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 377 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 414 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 419 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 420 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 421 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 422 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 423 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 424 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 425 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 426 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 427 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 428 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 429 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 430 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 431 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 432 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.24 |
| Metatranscriptomes | 0.25 |
| Isolates | 17.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.16 |
| Nodule | 2.02 |
| Rhizoplane | 6.05 |
| Rhizosphere | 78.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2079529 | 2162886011 | Bacteria | 2003 |
| 2 | JGI26141J51220_1004726 | 3300003503 | Bacteria | 845 |
| 3 | Ga0055536_1002226 | 3300003781 | Bacteria | 11039 |
| 4 | Ga0055530_10000513 | 3300003791 | Bacteria | 33776 |
| 5 | Ga0055530_10002706 | 3300003791 | Bacteria | 11022 |
| 6 | Ga0055530_10057419 | 3300003791 | Bacteria | 879 |
| 7 | Ga0055540_1000426 | 3300003792 | Bacteria | 33776 |
| 8 | Ga0055540_1000516 | 3300003792 | Bacteria | 29231 |
| 9 | Ga0065714_10003982 | 3300005288 | Bacteria | 10982 |
| 10 | Ga0065714_10013467 | 3300005288 | Bacteria | 2440 |
| 11 | Ga0065714_10018129 | 3300005288 | Bacteria | 1283 |
| 12 | Ga0065714_10031746 | 3300005288 | Bacteria | 1316 |
| 13 | Ga0065714_10088528 | 3300005288 | Bacteria | 2014 |
| 14 | Ga0065714_10138835 | 3300005288 | Bacteria | 1187 |
| 15 | Ga0065704_10016620 | 3300005289 | Bacteria | 2347 |
| 16 | Ga0065704_10029536 | 3300005289 | Bacteria | 1511 |
| 17 | Ga0065704_10070839 | 3300005289 | Bacteria | 15542 |
| 18 | Ga0065704_10082761 | 3300005289 | Bacteria | 3554 |
| 19 | Ga0065704_10107455 | 3300005289 | Bacteria | 2055 |
| 20 | Ga0065712_10068271 | 3300005290 | Bacteria | 12282 |
| 21 | Ga0070658_11068322 | 3300005327 | Bacteria | 702 |
| 22 | Ga0070670_100055136 | 3300005331 | Bacteria | 3412 |
| 23 | Ga0070670_100626199 | 3300005331 | Bacteria | 964 |
| 24 | Ga0070677_10230730 | 3300005333 | Bacteria | 909 |
| 25 | Ga0070677_10666426 | 3300005333 | Bacteria | 583 |
| 26 | Ga0070680_100205125 | 3300005336 | Bacteria | 1663 |
| 27 | Ga0070692_10122771 | 3300005345 | Bacteria | 1450 |
| 28 | Ga0070668_100505535 | 3300005347 | Bacteria | 1047 |
| 29 | Ga0070669_100521194 | 3300005353 | Bacteria | 988 |
| 30 | Ga0070675_100506158 | 3300005354 | Bacteria | 1089 |
| 31 | Ga0070671_101278119 | 3300005355 | Bacteria | 647 |
| 32 | Ga0070674_100117082 | 3300005356 | Bacteria | 1967 |
| 33 | Ga0070674_100429091 | 3300005356 | Bacteria | 1086 |
| 34 | Ga0070673_101747872 | 3300005364 | Bacteria | 589 |
| 35 | Ga0070700_100065764 | 3300005441 | Bacteria | 2300 |
| 36 | Ga0070694_100092950 | 3300005444 | Bacteria | 2120 |
| 37 | Ga0070694_101519785 | 3300005444 | Bacteria | 567 |
| 38 | Ga0070663_101889510 | 3300005455 | Bacteria | 536 |
| 39 | Ga0070678_100863396 | 3300005456 | Bacteria | 825 |
| 40 | Ga0070672_100456423 | 3300005543 | Bacteria | 1101 |
| 41 | Ga0070665_100969913 | 3300005548 | Bacteria | 862 |
| 42 | Ga0068855_101599002 | 3300005563 | Bacteria | 667 |
| 43 | Ga0068856_100571006 | 3300005614 | Bacteria | 1152 |
| 44 | Ga0068864_100606555 | 3300005618 | Bacteria | 1063 |
| 45 | Ga0068864_102122317 | 3300005618 | Unclassified | 568 |
| 46 | Ga0068863_100587720 | 3300005841 | Bacteria | 1101 |
| 47 | Ga0068863_101092414 | 3300005841 | Bacteria | 802 |
| 48 | Ga0068863_101435572 | 3300005841 | Unclassified | 698 |
| 49 | Ga0068862_100569153 | 3300005844 | Bacteria | 1084 |
| 50 | Ga0075365_10325229 | 3300006038 | Bacteria | 1083 |
| 51 | Ga0075364_10177853 | 3300006051 | Bacteria | 1439 |
| 52 | Ga0075364_10247907 | 3300006051 | Bacteria | 1210 |
| 53 | Ga0075364_11222676 | 3300006051 | Bacteria | 509 |
| 54 | Ga0075432_10007357 | 3300006058 | Bacteria | 3749 |
| 55 | Ga0075432_10036242 | 3300006058 | Bacteria | 1714 |
| 56 | Ga0075432_10042415 | 3300006058 | Bacteria | 1592 |
| 57 | Ga0075432_10069857 | 3300006058 | Bacteria | 1260 |
| 58 | Ga0075432_10107019 | 3300006058 | Bacteria | 1039 |
| 59 | Ga0075432_10364468 | 3300006058 | Bacteria | 615 |
| 60 | Ga0075362_10162367 | 3300006177 | Bacteria | 1076 |
| 61 | Ga0075362_10393227 | 3300006177 | Bacteria | 698 |
| 62 | Ga0075366_10496181 | 3300006195 | Bacteria | 755 |
| 63 | Ga0068871_101979739 | 3300006358 | Bacteria | 554 |
| 64 | Ga0075428_100067243 | 3300006844 | Bacteria | 3923 |
| 65 | Ga0075428_101071261 | 3300006844 | Bacteria | 852 |
| 66 | Ga0075428_101099077 | 3300006844 | Bacteria | 840 |
| 67 | Ga0075430_100427646 | 3300006846 | Bacteria | 1093 |
| 68 | Ga0075433_10172749 | 3300006852 | Unclassified | 1923 |
| 69 | Ga0075429_101026141 | 3300006880 | Bacteria | 721 |
| 70 | Ga0068865_100249172 | 3300006881 | Bacteria | 1401 |
| 71 | Ga0075436_100463883 | 3300006914 | Bacteria | 923 |
| 72 | Ga0079104_1002096 | 3300006946 | Bacteria | 11432 |
| 73 | Ga0105251_10000322 | 3300009011 | Bacteria | 48000 |
| 74 | Ga0105251_10001209 | 3300009011 | Bacteria | 22310 |
| 75 | Ga0105251_10004229 | 3300009011 | Bacteria | 9919 |
| 76 | Ga0105251_10025863 | 3300009011 | Bacteria | 2995 |
| 77 | Ga0105251_10150016 | 3300009011 | Bacteria | 1053 |
| 78 | Ga0105251_10254405 | 3300009011 | Bacteria | 792 |
| 79 | Ga0105251_10264450 | 3300009011 | Bacteria | 776 |
| 80 | Ga0105244_10001414 | 3300009036 | Bacteria | 19428 |
| 81 | Ga0105244_10099039 | 3300009036 | Bacteria | 1427 |
| 82 | Ga0105244_10132498 | 3300009036 | Bacteria | 1202 |
| 83 | Ga0105244_10136140 | 3300009036 | Bacteria | 1183 |
| 84 | Ga0105244_10239977 | 3300009036 | Bacteria | 847 |
| 85 | Ga0105244_10365250 | 3300009036 | Bacteria | 665 |
| 86 | Ga0105250_10000708 | 3300009092 | Bacteria | 20546 |
| 87 | Ga0105250_10013410 | 3300009092 | Bacteria | 3376 |
| 88 | Ga0105250_10067548 | 3300009092 | Bacteria | 1442 |
| 89 | Ga0105240_10374631 | 3300009093 | Bacteria | 1609 |
| 90 | Ga0111539_10199037 | 3300009094 | Bacteria | 2336 |
| 91 | Ga0111539_10460265 | 3300009094 | Bacteria | 1481 |
| 92 | Ga0111539_10776502 | 3300009094 | Bacteria | 1115 |
| 93 | Ga0111539_11137655 | 3300009094 | Bacteria | 907 |
| 94 | Ga0105243_10016043 | 3300009148 | Bacteria | 5667 |
| 95 | Ga0105243_10068135 | 3300009148 | Bacteria | 2868 |
| 96 | Ga0105243_10069695 | 3300009148 | Bacteria | 2837 |
| 97 | Ga0105243_10095786 | 3300009148 | Bacteria | 2454 |
| 98 | Ga0105243_10190332 | 3300009148 | Bacteria | 1792 |
| 99 | Ga0105243_10476606 | 3300009148 | Bacteria | 1177 |
| 100 | Ga0105242_10445872 | 3300009176 | Bacteria | 1219 |
| 101 | Ga0105246_10005186 | 3300011119 | Bacteria | 7919 |
| 102 | Ga0105246_10596506 | 3300011119 | Bacteria | 954 |
| 103 | Ga0157345_1000309 | 3300012498 | Bacteria | 6249 |
| 104 | Ga0157313_1002555 | 3300012503 | Bacteria | 1101 |
| 105 | Ga0157373_10273837 | 3300013100 | Bacteria | 1195 |
| 106 | Ga0157371_10000536 | 3300013102 | Bacteria | 45189 |
| 107 | Ga0157370_10196235 | 3300013104 | Bacteria | 1873 |
| 108 | Ga0157370_11589889 | 3300013104 | Bacteria | 587 |
| 109 | Ga0157369_10394127 | 3300013105 | Bacteria | 1437 |
| 110 | Ga0157374_10904200 | 3300013296 | Bacteria | 900 |
| 111 | Ga0163162_10545464 | 3300013306 | Bacteria | 1288 |
| 112 | Ga0163162_10761676 | 3300013306 | Bacteria | 1087 |
| 113 | Ga0157372_10012166 | 3300013307 | Bacteria | 9167 |
| 114 | Ga0157372_10162967 | 3300013307 | Bacteria | 2577 |
| 115 | Ga0157375_10806812 | 3300013308 | Bacteria | 1087 |
| 116 | Ga0157375_11424709 | 3300013308 | Bacteria | 816 |
| 117 | Ga0163163_10009963 | 3300014325 | Bacteria | 8522 |
| 118 | Ga0157380_10128497 | 3300014326 | Bacteria | 2158 |
| 119 | Ga0157380_10216934 | 3300014326 | Bacteria | 1709 |
| 120 | Ga0157380_10370482 | 3300014326 | Bacteria | 1348 |
| 121 | Ga0157380_10466189 | 3300014326 | Bacteria | 1217 |
| 122 | Ga0157380_12866217 | 3300014326 | Bacteria | 549 |
| 123 | Ga0182008_10009603 | 3300014497 | Bacteria | 5211 |
| 124 | Ga0182008_10011766 | 3300014497 | Bacteria | 4643 |
| 125 | Ga0182008_10037144 | 3300014497 | Bacteria | 2437 |
| 126 | Ga0157379_10233215 | 3300014968 | Bacteria | 1669 |
| 127 | Ga0157376_10346479 | 3300014969 | Bacteria | 1420 |
| 128 | Ga0182006_1002602 | 3300015261 | Bacteria | 9753 |
| 129 | Ga0182006_1018853 | 3300015261 | Bacteria | 2911 |
| 130 | Ga0182006_1069548 | 3300015261 | Bacteria | 1309 |
| 131 | Ga0182005_1017317 | 3300015265 | Bacteria | 1995 |
| 132 | Ga0163161_10014054 | 3300017792 | Bacteria | 5574 |
| 133 | Ga0163161_10017026 | 3300017792 | Bacteria | 5083 |
| 134 | Ga0163161_10172271 | 3300017792 | Bacteria | 1655 |
| 135 | Ga0163161_10986452 | 3300017792 | Bacteria | 718 |
| 136 | Ga0163161_11403819 | 3300017792 | Bacteria | 610 |
| 137 | Ga0209676_1000668 | 3300025292 | Bacteria | 48922 |
| 138 | Ga0209676_1001477 | 3300025292 | Bacteria | 21754 |
| 139 | Ga0209676_1008998 | 3300025292 | Bacteria | 4370 |
| 140 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 141 | Ga0209050_1000128 | 3300025298 | Bacteria | 187432 |
| 142 | Ga0209050_1005862 | 3300025298 | Bacteria | 7521 |
| 143 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 144 | Ga0209051_1000791 | 3300025303 | Bacteria | 33280 |
| 145 | Ga0209051_1015706 | 3300025303 | Bacteria | 3469 |
| 146 | Ga0209257_1011030 | 3300025304 | Bacteria | 4433 |
| 147 | Ga0207696_1000064 | 3300025711 | Bacteria | 238379 |
| 148 | Ga0207696_1000094 | 3300025711 | Bacteria | 184065 |
| 149 | Ga0207696_1005907 | 3300025711 | Bacteria | 5006 |
| 150 | Ga0207696_1006396 | 3300025711 | Bacteria | 4753 |
| 151 | Ga0207655_1000598 | 3300025728 | Bacteria | 44045 |
| 152 | Ga0207655_1001446 | 3300025728 | Bacteria | 21992 |
| 153 | Ga0207655_1004682 | 3300025728 | Bacteria | 9594 |
| 154 | Ga0207655_1004949 | 3300025728 | Bacteria | 9241 |
| 155 | Ga0207655_1010242 | 3300025728 | Bacteria | 5704 |
| 156 | Ga0207655_1016556 | 3300025728 | Bacteria | 4024 |
| 157 | Ga0207655_1214563 | 3300025728 | Bacteria | 565 |
| 158 | Ga0207655_1239797 | 3300025728 | Bacteria | 519 |
| 159 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 160 | Ga0207713_1001149 | 3300025735 | Bacteria | 22401 |
| 161 | Ga0207713_1002491 | 3300025735 | Bacteria | 13380 |
| 162 | Ga0207713_1005765 | 3300025735 | Bacteria | 7672 |
| 163 | Ga0207713_1006592 | 3300025735 | Bacteria | 7046 |
| 164 | Ga0207713_1009458 | 3300025735 | Bacteria | 5491 |
| 165 | Ga0207713_1170096 | 3300025735 | Bacteria | 688 |
| 166 | Ga0207713_1193285 | 3300025735 | Bacteria | 628 |
| 167 | Ga0207695_11157143 | 3300025913 | Unclassified | 654 |
| 168 | Ga0207660_11505875 | 3300025917 | Bacteria | 544 |
| 169 | Ga0207650_10000591 | 3300025925 | Bacteria | 29057 |
| 170 | Ga0207709_10007973 | 3300025935 | Bacteria | 5866 |
| 171 | Ga0207709_10135427 | 3300025935 | Bacteria | 1685 |
| 172 | Ga0207709_10656677 | 3300025935 | Bacteria | 835 |
| 173 | Ga0207709_10973257 | 3300025935 | Bacteria | 693 |
| 174 | Ga0207711_10022622 | 3300025941 | Bacteria | 5259 |
| 175 | Ga0207668_10184618 | 3300025972 | Bacteria | 1648 |
| 176 | Ga0207639_12187292 | 3300026041 | Bacteria | 514 |
| 177 | Ga0207708_10190301 | 3300026075 | Bacteria | 1633 |
| 178 | Ga0207702_10488514 | 3300026078 | Bacteria | 1199 |
| 179 | Ga0207702_11500637 | 3300026078 | Bacteria | 668 |
| 180 | Ga0207641_11054096 | 3300026088 | Bacteria | 811 |
| 181 | Ga0207641_11402164 | 3300026088 | Bacteria | 700 |
| 182 | Ga0207641_11912810 | 3300026088 | Bacteria | 595 |
| 183 | Ga0207648_11494309 | 3300026089 | Bacteria | 635 |
| 184 | Ga0207676_10210411 | 3300026095 | Unclassified | 1725 |
| 185 | Ga0207683_10171205 | 3300026121 | Bacteria | 1967 |
| 186 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 187 | Ga0209371_1043794 | 3300027312 | Bacteria | 893 |
| 188 | Ga0209981_1011386 | 3300027378 | Bacteria | 1226 |
| 189 | Ga0209995_1015309 | 3300027471 | Bacteria | 1258 |
| 190 | Ga0209983_1000782 | 3300027665 | Bacteria | 6913 |
| 191 | Ga0209971_1000459 | 3300027682 | Bacteria | 10808 |
| 192 | Ga0209974_10001088 | 3300027876 | Bacteria | 9626 |
| 193 | Ga0207428_10001453 | 3300027907 | Bacteria | 24796 |
| 194 | Ga0207428_10045203 | 3300027907 | Bacteria | 3548 |
| 195 | Ga0207428_10350211 | 3300027907 | Bacteria | 1087 |
| 196 | Ga0207428_10714540 | 3300027907 | Bacteria | 716 |
| 197 | Ga0268265_10516484 | 3300028380 | Bacteria | 1128 |
| 198 | Ga0268256_1016622 | 3300030500 | Bacteria | 2101 |
| 199 | Ga0316177_1039133 | 3300030731 | Bacteria | 1431 |
| 200 | Ga0314311_1171705 | 3300030733 | Bacteria | 3858 |
| 201 | Ga0316181_1230923 | 3300030744 | Bacteria | 1551 |
| 202 | Ga0265332_10240885 | 3300031238 | Bacteria | 749 |
| 203 | Ga0265327_10000050 | 3300031251 | Bacteria | 266536 |
| 204 | Ga0265316_10105543 | 3300031344 | Bacteria | 2137 |
| 205 | Ga0307408_100004188 | 3300031548 | Bacteria | 9830 |
| 206 | Ga0307408_100412081 | 3300031548 | Bacteria | 1163 |
| 207 | Ga0307408_101594883 | 3300031548 | Bacteria | 619 |
| 208 | Ga0307508_10002430 | 3300031616 | Bacteria | 19641 |
| 209 | Ga0307516_10230890 | 3300031730 | Bacteria | 1554 |
| 210 | Ga0307516_10264213 | 3300031730 | Bacteria | 1410 |
| 211 | Ga0307405_10012759 | 3300031731 | Bacteria | 4462 |
| 212 | Ga0307405_10081139 | 3300031731 | Bacteria | 2119 |
| 213 | Ga0307413_10108728 | 3300031824 | Bacteria | 1851 |
| 214 | Ga0307413_10309152 | 3300031824 | Bacteria | 1202 |
| 215 | Ga0307406_10018460 | 3300031901 | Bacteria | 4076 |
| 216 | Ga0307412_10013027 | 3300031911 | Bacteria | 4861 |
| 217 | Ga0307412_10027025 | 3300031911 | Bacteria | 3573 |
| 218 | Ga0307412_11340905 | 3300031911 | Bacteria | 645 |
| 219 | Ga0307412_11679614 | 3300031911 | Bacteria | 582 |
| 220 | Ga0307409_101959451 | 3300031995 | Unclassified | 615 |
| 221 | Ga0307416_100238893 | 3300032002 | Bacteria | 1759 |
| 222 | Ga0307414_10051516 | 3300032004 | Bacteria | 2858 |
| 223 | Ga0307414_11700222 | 3300032004 | Bacteria | 588 |
| 224 | Ga0307411_10046127 | 3300032005 | Bacteria | 2807 |
| 225 | Ga0307510_10364876 | 3300033180 | Bacteria | 892 |
| 226 | Ga0373933_1144682 | 3300035724 | Bacteria | 513 |
| 227 | Ga0373947_0653781 | 3300035725 | Bacteria | 717 |
| 228 | Ga0395900_0049625 | 3300037418 | Bacteria | 4324 |
| 229 | Ga0436362_0459754 | 3300039453 | Bacteria | 1187 |
| 230 | Ga0439438_000617 | 3300041405 | Bacteria | 16040 |
| 231 | Ga0439438_001709 | 3300041405 | Bacteria | 9660 |
| 232 | Ga0439438_005876 | 3300041405 | Bacteria | 4439 |
| 233 | Ga0439438_015441 | 3300041405 | Bacteria | 2247 |
| 234 | Ga0439438_019173 | 3300041405 | Bacteria | 1936 |
| 235 | Ga0439447_004863 | 3300041407 | Bacteria | 4556 |
| 236 | Ga0439447_006699 | 3300041407 | Bacteria | 3712 |
| 237 | Ga0439447_019050 | 3300041407 | Bacteria | 1836 |
| 238 | Ga0439466_0000656 | 3300041411 | Bacteria | 13021 |
| 239 | Ga0439466_0013218 | 3300041411 | Bacteria | 3024 |
| 240 | Ga0439466_0031810 | 3300041411 | Bacteria | 1802 |
| 241 | Ga0439466_0068474 | 3300041411 | Bacteria | 1134 |
| 242 | Ga0451797_0571604 | 3300041453 | Bacteria | 665 |
| 243 | Ga0451800_1249912 | 3300041459 | Bacteria | 1039 |
| 244 | Ga0451802_0143070 | 3300041460 | Bacteria | 585 |
| 245 | Ga0451853_3562112 | 3300041512 | Bacteria | 510 |
| 246 | Ga0439431_0000429 | 3300041997 | Bacteria | 8934 |
| 247 | Ga0439445_0005090 | 3300042004 | Bacteria | 2988 |
| 248 | Ga0439432_000568 | 3300042006 | Bacteria | 13848 |
| 249 | Ga0439432_001884 | 3300042006 | Bacteria | 7897 |
| 250 | Ga0439432_064942 | 3300042006 | Bacteria | 1119 |
| 251 | Ga0439432_076187 | 3300042006 | Bacteria | 1019 |
| 252 | Ga0439451_008450 | 3300042009 | Bacteria | 2087 |
| 253 | Ga0439451_008701 | 3300042009 | Bacteria | 2056 |
| 254 | Ga0439452_000363 | 3300042010 | Bacteria | 27675 |
| 255 | Ga0439452_004175 | 3300042010 | Bacteria | 4897 |
| 256 | Ga0439452_010976 | 3300042010 | Bacteria | 2616 |
| 257 | Ga0439452_016863 | 3300042010 | Bacteria | 1976 |
| 258 | Ga0439452_054732 | 3300042010 | Bacteria | 905 |
| 259 | Ga0439456_000065 | 3300042013 | Bacteria | 37775 |
| 260 | Ga0439456_010172 | 3300042013 | Bacteria | 1943 |
| 261 | Ga0439456_010707 | 3300042013 | Bacteria | 1896 |
| 262 | Ga0439456_014475 | 3300042013 | Bacteria | 1645 |
| 263 | Ga0439456_031273 | 3300042013 | Bacteria | 1140 |
| 264 | Ga0439463_000583 | 3300042016 | Bacteria | 10213 |
| 265 | Ga0450911_002207 | 3300042115 | Bacteria | 3933 |
| 266 | Ga0450919_002101 | 3300042121 | Bacteria | 2587 |
| 267 | Ga0450922_000436 | 3300042124 | Bacteria | 4468 |
| 268 | Ga0450902_000111 | 3300042137 | Bacteria | 8401 |
| 269 | Ga0450903_005870 | 3300042138 | Bacteria | 2049 |
| 270 | Ga0450910_000249 | 3300042147 | Bacteria | 6166 |
| 271 | Ga0450910_023484 | 3300042147 | Bacteria | 943 |
| 272 | Ga0439446_0022272 | 3300042156 | Bacteria | 1795 |
| 273 | Ga0439446_0036404 | 3300042156 | Bacteria | 1438 |
| 274 | Ga0450908_108599 | 3300042184 | Bacteria | 511 |
| 275 | Ga0439460_0068732 | 3300042461 | Bacteria | 1093 |
| 276 | Ga0450918_086231 | 3300042531 | Bacteria | 603 |
| 277 | Ga0450893_0000768 | 3300042532 | Bacteria | 4686 |
| 278 | Ga0450893_0015117 | 3300042532 | Bacteria | 1299 |
| 279 | Ga0451577_0011709 | 3300042876 | Bacteria | 8280 |
| 280 | Ga0439440_0003338 | 3300042993 | Bacteria | 3090 |
| 281 | Ga0453683_0012263 | 3300044673 | Bacteria | 5621 |
| 282 | Ga0466963_0844041 | 3300044694 | Bacteria | 646 |
| 283 | Ga0453684_0031986 | 3300044712 | Bacteria | 7377 |
| 284 | Ga0451576_0037783 | 3300045051 | Bacteria | 5113 |
| 285 | Ga0451576_0217822 | 3300045051 | Bacteria | 1993 |
| 286 | Ga0495617_001780 | 3300046452 | Bacteria | 9191 |
| 287 | Ga0495617_005964 | 3300046452 | Bacteria | 4298 |
| 288 | Ga0495617_027610 | 3300046452 | Bacteria | 1909 |
| 289 | Ga0495627_000236 | 3300046453 | Bacteria | 58365 |
| 290 | Ga0495627_000913 | 3300046453 | Bacteria | 20472 |
| 291 | Ga0495627_004413 | 3300046453 | Bacteria | 5893 |
| 292 | Ga0495627_019803 | 3300046453 | Bacteria | 2251 |
| 293 | Ga0495627_024631 | 3300046453 | Bacteria | 1960 |
| 294 | Ga0495627_033993 | 3300046453 | Bacteria | 1595 |
| 295 | Ga0495592_0596636 | 3300046454 | Bacteria | 674 |
| 296 | Ga0495603_0127894 | 3300046455 | Bacteria | 1480 |
| 297 | Ga0495590_0004856 | 3300046457 | Bacteria | 5378 |
| 298 | Ga0495590_0006830 | 3300046457 | Bacteria | 4434 |
| 299 | Ga0495590_0019724 | 3300046457 | Bacteria | 2399 |
| 300 | Ga0495590_0328322 | 3300046457 | Bacteria | 579 |
| 301 | Ga0495590_0351324 | 3300046457 | Bacteria | 560 |
| 302 | Ga0495591_000262 | 3300046458 | Bacteria | 50259 |
| 303 | Ga0495591_000908 | 3300046458 | Bacteria | 20592 |
| 304 | Ga0495591_005704 | 3300046458 | Bacteria | 5686 |
| 305 | Ga0495591_062845 | 3300046458 | Bacteria | 982 |
| 306 | Ga0495591_077494 | 3300046458 | Bacteria | 852 |
| 307 | Ga0495591_149772 | 3300046458 | Bacteria | 560 |
| 308 | Ga0495629_0017879 | 3300046459 | Bacteria | 5081 |
| 309 | Ga0495629_0536684 | 3300046459 | Bacteria | 786 |
| 310 | Ga0495638_0017189 | 3300046460 | Bacteria | 4829 |
| 311 | Ga0495638_0019683 | 3300046460 | Bacteria | 4463 |
| 312 | Ga0495638_0033102 | 3300046460 | Bacteria | 3306 |
| 313 | Ga0495638_0059044 | 3300046460 | Bacteria | 2376 |
| 314 | Ga0495638_0364930 | 3300046460 | Bacteria | 758 |
| 315 | Ga0495653_0003057 | 3300046463 | Bacteria | 13431 |
| 316 | Ga0495653_0022711 | 3300046463 | Bacteria | 5075 |
| 317 | Ga0495653_0023453 | 3300046463 | Bacteria | 4983 |
| 318 | Ga0495653_0078617 | 3300046463 | Bacteria | 2445 |
| 319 | Ga0495650_0001753 | 3300046471 | Bacteria | 19743 |
| 320 | Ga0495650_0011649 | 3300046471 | Bacteria | 4795 |
| 321 | Ga0495650_0015510 | 3300046471 | Bacteria | 3904 |
| 322 | Ga0495650_0041618 | 3300046471 | Bacteria | 1963 |
| 323 | Ga0495582_0012439 | 3300046473 | Bacteria | 4689 |
| 324 | Ga0495605_0000305 | 3300046474 | Bacteria | 52699 |
| 325 | Ga0495605_0004768 | 3300046474 | Bacteria | 7927 |
| 326 | Ga0495605_0300191 | 3300046474 | Bacteria | 679 |
| 327 | Ga0495639_0004444 | 3300046475 | Bacteria | 6012 |
| 328 | Ga0495664_0063537 | 3300046477 | Bacteria | 2201 |
| 329 | Ga0495584_0001213 | 3300046491 | Bacteria | 15750 |
| 330 | Ga0495584_0056028 | 3300046491 | Bacteria | 1983 |
| 331 | Ga0495584_0179772 | 3300046491 | Bacteria | 1075 |
| 332 | Ga0495585_0002376 | 3300046492 | Bacteria | 13510 |
| 333 | Ga0495585_0004001 | 3300046492 | Bacteria | 9711 |
| 334 | Ga0495585_0007958 | 3300046492 | Bacteria | 6443 |
| 335 | Ga0495585_0114194 | 3300046492 | Bacteria | 1433 |
| 336 | Ga0495594_0313651 | 3300046499 | Bacteria | 893 |
| 337 | Ga0495607_0001512 | 3300046501 | Bacteria | 20500 |
| 338 | Ga0495607_0001663 | 3300046501 | Bacteria | 19235 |
| 339 | Ga0495607_0001685 | 3300046501 | Bacteria | 19046 |
| 340 | Ga0495607_0001747 | 3300046501 | Bacteria | 18602 |
| 341 | Ga0495607_0002473 | 3300046501 | Bacteria | 14994 |
| 342 | Ga0495607_0047403 | 3300046501 | Bacteria | 2518 |
| 343 | Ga0495607_0050932 | 3300046501 | Bacteria | 2407 |
| 344 | Ga0495607_0104096 | 3300046501 | Bacteria | 1515 |
| 345 | Ga0495607_0163611 | 3300046501 | Bacteria | 1128 |
| 346 | Ga0495607_0251164 | 3300046501 | Bacteria | 851 |
| 347 | Ga0495607_0507291 | 3300046501 | Bacteria | 534 |
| 348 | Ga0495583_0002263 | 3300046506 | Bacteria | 16900 |
| 349 | Ga0495583_0003780 | 3300046506 | Bacteria | 11247 |
| 350 | Ga0495583_0006029 | 3300046506 | Bacteria | 8032 |
| 351 | Ga0495583_0273942 | 3300046506 | Bacteria | 673 |
| 352 | Ga0495606_0000785 | 3300046507 | Bacteria | 48544 |
| 353 | Ga0495606_0003478 | 3300046507 | Bacteria | 16690 |
| 354 | Ga0495606_0023130 | 3300046507 | Bacteria | 4512 |
| 355 | Ga0495606_0069559 | 3300046507 | Bacteria | 2222 |
| 356 | Ga0495610_0010636 | 3300046512 | Bacteria | 5698 |
| 357 | Ga0495610_0038056 | 3300046512 | Bacteria | 2443 |
| 358 | Ga0495616_0001961 | 3300046513 | Bacteria | 13850 |
| 359 | Ga0495616_0163522 | 3300046513 | Bacteria | 999 |
| 360 | Ga0495616_0194365 | 3300046513 | Bacteria | 895 |
| 361 | Ga0495620_0000033 | 3300046515 | Bacteria | 118157 |
| 362 | Ga0495620_0014188 | 3300046515 | Bacteria | 4057 |
| 363 | Ga0495620_0033940 | 3300046515 | Bacteria | 2310 |
| 364 | Ga0495628_0502412 | 3300046516 | Bacteria | 875 |
| 365 | Ga0495630_0019938 | 3300046517 | Bacteria | 4936 |
| 366 | Ga0495630_0028337 | 3300046517 | Bacteria | 4162 |
| 367 | Ga0495631_0001408 | 3300046518 | Bacteria | 14633 |
| 368 | Ga0495631_0006806 | 3300046518 | Bacteria | 5867 |
| 369 | Ga0495631_0044439 | 3300046518 | Bacteria | 1957 |
| 370 | Ga0495632_0000399 | 3300046519 | Bacteria | 40815 |
| 371 | Ga0495632_0001643 | 3300046519 | Bacteria | 18317 |
| 372 | Ga0495632_0004604 | 3300046519 | Bacteria | 9341 |
| 373 | Ga0495632_0006335 | 3300046519 | Bacteria | 7634 |
| 374 | Ga0495632_0008067 | 3300046519 | Bacteria | 6525 |
| 375 | Ga0495632_0012185 | 3300046519 | Bacteria | 4969 |
| 376 | Ga0495632_0022973 | 3300046519 | Bacteria | 3336 |
| 377 | Ga0495632_0030851 | 3300046519 | Bacteria | 2777 |
| 378 | Ga0495632_0059406 | 3300046519 | Bacteria | 1860 |
| 379 | Ga0495632_0060365 | 3300046519 | Bacteria | 1842 |
| 380 | Ga0495632_0089548 | 3300046519 | Bacteria | 1460 |
| 381 | Ga0495632_0160037 | 3300046519 | Bacteria | 1037 |
| 382 | Ga0495637_0001314 | 3300046520 | Bacteria | 14925 |
| 383 | Ga0495637_0002210 | 3300046520 | Bacteria | 10867 |
| 384 | Ga0495637_0002604 | 3300046520 | Bacteria | 9906 |
| 385 | Ga0495637_0011937 | 3300046520 | Bacteria | 4163 |
| 386 | Ga0495637_0012382 | 3300046520 | Bacteria | 4080 |
| 387 | Ga0495637_0015609 | 3300046520 | Bacteria | 3563 |
| 388 | Ga0495637_0017272 | 3300046520 | Bacteria | 3366 |
| 389 | Ga0495637_0025612 | 3300046520 | Bacteria | 2656 |
| 390 | Ga0495637_0065262 | 3300046520 | Bacteria | 1482 |
| 391 | Ga0495637_0110850 | 3300046520 | Bacteria | 1063 |
| 392 | Ga0495643_0001356 | 3300046522 | Bacteria | 22936 |
| 393 | Ga0495643_0004576 | 3300046522 | Bacteria | 9629 |
| 394 | Ga0495643_0029284 | 3300046522 | Bacteria | 3082 |
| 395 | Ga0495644_0003429 | 3300046523 | Bacteria | 6275 |
| 396 | Ga0495648_0002328 | 3300046524 | Bacteria | 17684 |
| 397 | Ga0495648_0002836 | 3300046524 | Bacteria | 15600 |
| 398 | Ga0495648_0009421 | 3300046524 | Bacteria | 7574 |
| 399 | Ga0495648_0012155 | 3300046524 | Bacteria | 6440 |
| 400 | Ga0495648_0071018 | 3300046524 | Bacteria | 2020 |
| 401 | Ga0495648_0100587 | 3300046524 | Bacteria | 1596 |
| 402 | Ga0495648_0160601 | 3300046524 | Bacteria | 1162 |
| 403 | Ga0495666_0009296 | 3300046526 | Bacteria | 4914 |
| 404 | Ga0495666_0009803 | 3300046526 | Bacteria | 4786 |
| 405 | Ga0495666_0021846 | 3300046526 | Bacteria | 3167 |
| 406 | Ga0495666_0376683 | 3300046526 | Bacteria | 639 |
| 407 | Ga0495642_0000910 | 3300046528 | Bacteria | 13902 |
| 408 | Ga0495652_1114907 | 3300046529 | Bacteria | 512 |
| 409 | Ga0495654_0001804 | 3300046530 | Bacteria | 14270 |
| 410 | Ga0495654_0003274 | 3300046530 | Bacteria | 9985 |
| 411 | Ga0495654_0007411 | 3300046530 | Bacteria | 6130 |
| 412 | Ga0495654_0009251 | 3300046530 | Bacteria | 5402 |
| 413 | Ga0495654_0020033 | 3300046530 | Bacteria | 3492 |
| 414 | Ga0495654_0028422 | 3300046530 | Bacteria | 2859 |
| 415 | Ga0495654_0040865 | 3300046530 | Bacteria | 2308 |
| 416 | Ga0495654_0123134 | 3300046530 | Bacteria | 1171 |
| 417 | Ga0495654_0303987 | 3300046530 | Bacteria | 650 |
| 418 | Ga0495586_0149539 | 3300046535 | Bacteria | 1313 |
| 419 | Ga0495586_0469407 | 3300046535 | Bacteria | 726 |
| 420 | Ga0495587_0010198 | 3300046536 | Bacteria | 5991 |
| 421 | Ga0495587_0259213 | 3300046536 | Bacteria | 977 |
| 422 | Ga0495587_0358227 | 3300046536 | Bacteria | 812 |
| 423 | Ga0495609_0000226 | 3300046538 | Bacteria | 55095 |
| 424 | Ga0495609_0005057 | 3300046538 | Bacteria | 7036 |
| 425 | Ga0495609_0005960 | 3300046538 | Bacteria | 6299 |
| 426 | Ga0495609_0025842 | 3300046538 | Bacteria | 2689 |
| 427 | Ga0495609_0026423 | 3300046538 | Bacteria | 2658 |
| 428 | Ga0495609_0058308 | 3300046538 | Bacteria | 1707 |
| 429 | Ga0495609_0070746 | 3300046538 | Bacteria | 1533 |
| 430 | Ga0495621_0003005 | 3300046539 | Bacteria | 4600 |
| 431 | Ga0495597_0000235 | 3300046542 | Bacteria | 49912 |
| 432 | Ga0495597_0006339 | 3300046542 | Bacteria | 6129 |
| 433 | Ga0495597_0009917 | 3300046542 | Bacteria | 4681 |
| 434 | Ga0495597_0016368 | 3300046542 | Bacteria | 3500 |
| 435 | Ga0495645_0035434 | 3300046543 | Bacteria | 3638 |
| 436 | Ga0495645_0037736 | 3300046543 | Bacteria | 3523 |
| 437 | Ga0495645_0192699 | 3300046543 | Bacteria | 1388 |
| 438 | Ga0495645_0295460 | 3300046543 | Unclassified | 1060 |
| 439 | Ga0495645_0493087 | 3300046543 | Bacteria | 767 |
| 440 | Ga0495622_0005622 | 3300046557 | Bacteria | 5812 |
| 441 | Ga0495622_0093996 | 3300046557 | Bacteria | 1376 |
| 442 | Ga0495633_0040855 | 3300046558 | Bacteria | 2207 |
| 443 | Ga0495668_0015584 | 3300046616 | Bacteria | 4435 |
| 444 | Ga0495668_0192940 | 3300046616 | Bacteria | 1115 |
| 445 | Ga0495634_0017298 | 3300046642 | Bacteria | 5147 |
| 446 | Ga0495634_0026732 | 3300046642 | Bacteria | 4025 |
| 447 | Ga0495611_0115710 | 3300046648 | Bacteria | 1249 |
| 448 | Ga0495625_0012667 | 3300046660 | Bacteria | 6823 |
| 449 | Ga0495625_0340579 | 3300046660 | Bacteria | 950 |
| 450 | Ga0495635_0018083 | 3300046663 | Bacteria | 4922 |
| 451 | Ga0495635_0021873 | 3300046663 | Bacteria | 4457 |
| 452 | Ga0495635_0044488 | 3300046663 | Unclassified | 3063 |
| 453 | Ga0495661_0000320 | 3300046665 | Bacteria | 53065 |
| 454 | Ga0495661_0000340 | 3300046665 | Bacteria | 51118 |
| 455 | Ga0495661_0004957 | 3300046665 | Bacteria | 9520 |
| 456 | Ga0495661_0144767 | 3300046665 | Bacteria | 1289 |
| 457 | Ga0495661_0276123 | 3300046665 | Bacteria | 848 |
| 458 | Ga0495657_0069879 | 3300046675 | Bacteria | 2296 |
| 459 | Ga0495657_0104099 | 3300046675 | Bacteria | 1805 |
| 460 | Ga0495599_0013493 | 3300046678 | Bacteria | 5048 |
| 461 | Ga0495623_0005830 | 3300046679 | Bacteria | 8034 |
| 462 | Ga0495623_0022106 | 3300046679 | Bacteria | 4107 |
| 463 | Ga0495646_0077615 | 3300046680 | Bacteria | 1942 |
| 464 | Ga0495646_0114860 | 3300046680 | Bacteria | 1529 |
| 465 | Ga0495669_0053917 | 3300046684 | Bacteria | 1809 |
| 466 | Ga0495613_0012188 | 3300046689 | Bacteria | 6390 |
| 467 | Ga0495613_0251426 | 3300046689 | Bacteria | 1233 |
| 468 | Ga0495670_0008703 | 3300046691 | Bacteria | 4996 |
| 469 | Ga0495670_0227285 | 3300046691 | Bacteria | 992 |
| 470 | Ga0495670_0310492 | 3300046691 | Bacteria | 846 |
| 471 | Ga0495670_0322910 | 3300046691 | Bacteria | 829 |
| 472 | Ga0495670_0483248 | 3300046691 | Bacteria | 672 |
| 473 | Ga0495671_0001637 | 3300046692 | Bacteria | 14695 |
| 474 | Ga0495671_0012382 | 3300046692 | Bacteria | 4661 |
| 475 | Ga0495671_0016806 | 3300046692 | Bacteria | 3901 |
| 476 | Ga0495671_0027263 | 3300046692 | Bacteria | 2951 |
| 477 | Ga0495671_0084299 | 3300046692 | Bacteria | 1557 |
| 478 | Ga0495671_0117479 | 3300046692 | Bacteria | 1298 |
| 479 | Ga0495671_0515418 | 3300046692 | Bacteria | 570 |
| 480 | Ga0495649_0001345 | 3300046694 | Bacteria | 18678 |
| 481 | Ga0495649_0001639 | 3300046694 | Bacteria | 16650 |
| 482 | Ga0495649_0035144 | 3300046694 | Bacteria | 2756 |
| 483 | Ga0495649_0129357 | 3300046694 | Bacteria | 1332 |
| 484 | Ga0495649_0188277 | 3300046694 | Bacteria | 1075 |
| 485 | Ga0495589_0000890 | 3300046794 | Bacteria | 18550 |
| 486 | Ga0495589_0080322 | 3300046794 | Bacteria | 1587 |
| 487 | Ga0495600_0087300 | 3300046809 | Bacteria | 2035 |
| 488 | Ga0495600_0444657 | 3300046809 | Bacteria | 802 |
| 489 | Ga0495660_0004190 | 3300046810 | Bacteria | 8763 |
| 490 | Ga0495660_0010112 | 3300046810 | Bacteria | 5485 |
| 491 | Ga0495660_0012324 | 3300046810 | Bacteria | 4960 |
| 492 | Ga0495660_0059096 | 3300046810 | Bacteria | 2063 |
| 493 | Ga0495660_0127326 | 3300046810 | Bacteria | 1281 |
| 494 | Ga0495660_0138648 | 3300046810 | Bacteria | 1212 |
| 495 | Ga0495660_0380900 | 3300046810 | Bacteria | 621 |
| 496 | Ga0495581_0022649 | 3300047315 | Bacteria | 3639 |
| 497 | Ga0495604_0009657 | 3300047317 | Bacteria | 7627 |
| 498 | Ga0495604_0085571 | 3300047317 | Unclassified | 2352 |
| 499 | Ga0495636_0015323 | 3300047318 | Bacteria | 3055 |
| 500 | Ga0495636_0148566 | 3300047318 | Bacteria | 1050 |
| 501 | Ga0495674_0042227 | 3300047319 | Bacteria | 4069 |
| 502 | Ga0495672_0001307 | 3300047320 | Bacteria | 24818 |
| 503 | Ga0495672_0003882 | 3300047320 | Bacteria | 12563 |
| 504 | Ga0495672_0008309 | 3300047320 | Bacteria | 7686 |
| 505 | Ga0495672_0013691 | 3300047320 | Bacteria | 5582 |
| 506 | Ga0495672_0019008 | 3300047320 | Bacteria | 4544 |
| 507 | Ga0495672_0048088 | 3300047320 | Bacteria | 2531 |
| 508 | Ga0495672_0122800 | 3300047320 | Bacteria | 1378 |
| 509 | Ga0495672_0139526 | 3300047320 | Bacteria | 1267 |
| 510 | Ga0495676_0359831 | 3300047321 | Bacteria | 971 |
| 511 | Ga0495676_0398924 | 3300047321 | Bacteria | 913 |
| 512 | Ga0495680_0023663 | 3300047322 | Bacteria | 5104 |
| 513 | Ga0495680_0027415 | 3300047322 | Bacteria | 4681 |
| 514 | Ga0495680_0064963 | 3300047322 | Bacteria | 2796 |
| 515 | Ga0495680_0116414 | 3300047322 | Bacteria | 1976 |
| 516 | Ga0495680_0702293 | 3300047322 | Unclassified | 668 |
| 517 | Ga0495683_0000016 | 3300047323 | Bacteria | 191396 |
| 518 | Ga0495683_0005198 | 3300047323 | Bacteria | 7250 |
| 519 | Ga0495683_0006784 | 3300047323 | Bacteria | 6224 |
| 520 | Ga0495687_003652 | 3300047443 | Bacteria | 10959 |
| 521 | Ga0495675_0013899 | 3300047444 | Bacteria | 5090 |
| 522 | Ga0495675_0025502 | 3300047444 | Bacteria | 3769 |
| 523 | Ga0495675_0041542 | 3300047444 | Bacteria | 2931 |
| 524 | Ga0495675_0057262 | 3300047444 | Bacteria | 2471 |
| 525 | Ga0495675_0171216 | 3300047444 | Bacteria | 1333 |
| 526 | Ga0495685_002011 | 3300047447 | Bacteria | 6312 |
| 527 | Ga0495673_0000789 | 3300047469 | Bacteria | 29813 |
| 528 | Ga0495673_0002977 | 3300047469 | Bacteria | 11414 |
| 529 | Ga0495673_0008171 | 3300047469 | Bacteria | 5917 |
| 530 | Ga0495673_0009275 | 3300047469 | Bacteria | 5458 |
| 531 | Ga0495673_0009999 | 3300047469 | Bacteria | 5195 |
| 532 | Ga0495673_0249402 | 3300047469 | Bacteria | 648 |
| 533 | Ga0495681_0008902 | 3300047470 | Bacteria | 6235 |
| 534 | Ga0495681_0009457 | 3300047470 | Bacteria | 6001 |
| 535 | Ga0495681_0014126 | 3300047470 | Bacteria | 4597 |
| 536 | Ga0495681_0047354 | 3300047470 | Bacteria | 2045 |
| 537 | Ga0495681_0078697 | 3300047470 | Bacteria | 1476 |
| 538 | Ga0495681_0219869 | 3300047470 | Bacteria | 762 |
| 539 | Ga0495684_0025570 | 3300047471 | Bacteria | 4535 |
| 540 | Ga0495686_0011284 | 3300047472 | Bacteria | 6298 |
| 541 | Ga0495686_0489003 | 3300047472 | Bacteria | 649 |
| 542 | Ga0495593_0082409 | 3300047673 | Bacteria | 1662 |
| 543 | Ga0495593_0169587 | 3300047673 | Bacteria | 1100 |
| 544 | Ga0495602_0258216 | 3300048088 | Bacteria | 1294 |
| 545 | Ga0495602_0316823 | 3300048088 | Bacteria | 1136 |
| 546 | Ga0495626_0004436 | 3300048091 | Bacteria | 8614 |
| 547 | Ga0495626_0010993 | 3300048091 | Bacteria | 4802 |
| 548 | Ga0495626_0036093 | 3300048091 | Bacteria | 2356 |
| 549 | Ga0495626_0085196 | 3300048091 | Bacteria | 1397 |
| 550 | Ga0496102_0003362 | 3300048905 | Bacteria | 13560 |
| 551 | Ga0496103_0011982 | 3300048906 | Bacteria | 5149 |
| 552 | Ga0496110_0082470 | 3300048913 | Bacteria | 2868 |
| 553 | Ga0496111_0606560 | 3300048914 | Bacteria | 801 |
| 554 | Ga0496112_0189050 | 3300048915 | Bacteria | 2022 |
| 555 | Ga0496114_0842127 | 3300048917 | Bacteria | 797 |
| 556 | Ga0496116_0006223 | 3300048919 | Bacteria | 10895 |
| 557 | Ga0496116_0030580 | 3300048919 | Bacteria | 3865 |
| 558 | Ga0496116_0116898 | 3300048919 | Bacteria | 1553 |
| 559 | Ga0496117_0003735 | 3300048920 | Bacteria | 17441 |
| 560 | Ga0496117_0010816 | 3300048920 | Bacteria | 8237 |
| 561 | Ga0496117_0023680 | 3300048920 | Bacteria | 4882 |
| 562 | Ga0496117_0059992 | 3300048920 | Bacteria | 2625 |
| 563 | Ga0496117_0078071 | 3300048920 | Bacteria | 2188 |
| 564 | Ga0496117_0116907 | 3300048920 | Bacteria | 1647 |
| 565 | Ga0496118_0002905 | 3300048921 | Bacteria | 22275 |
| 566 | Ga0496118_0034166 | 3300048921 | Bacteria | 4155 |
| 567 | Ga0496118_0034853 | 3300048921 | Bacteria | 4098 |
| 568 | Ga0496119_0000071 | 3300048922 | Bacteria | 153652 |
| 569 | Ga0496119_0052534 | 3300048922 | Bacteria | 2495 |
| 570 | Ga0496120_0004847 | 3300048923 | Bacteria | 11002 |
| 571 | Ga0496121_0065402 | 3300048924 | Bacteria | 2959 |
| 572 | Ga0496121_0157986 | 3300048924 | Bacteria | 1661 |
| 573 | Ga0496121_0162368 | 3300048924 | Bacteria | 1632 |
| 574 | Ga0496121_0339995 | 3300048924 | Bacteria | 1003 |
| 575 | Ga0496121_0887112 | 3300048924 | Bacteria | 514 |
| 576 | Ga0496122_0003639 | 3300048925 | Bacteria | 20044 |
| 577 | Ga0496122_0204105 | 3300048925 | Bacteria | 1152 |
| 578 | Ga0496123_0002904 | 3300048926 | Bacteria | 20054 |
| 579 | Ga0496123_0219271 | 3300048926 | Bacteria | 961 |
| 580 | Ga0496123_0254352 | 3300048926 | Bacteria | 864 |
| 581 | Ga0496124_0000730 | 3300048927 | Bacteria | 53903 |
| 582 | Ga0496124_0014510 | 3300048927 | Bacteria | 7614 |
| 583 | Ga0496124_0052285 | 3300048927 | Bacteria | 3470 |
| 584 | Ga0496124_0087764 | 3300048927 | Bacteria | 2544 |
| 585 | Ga0496124_0168466 | 3300048927 | Bacteria | 1699 |
| 586 | Ga0496125_0001109 | 3300048928 | Bacteria | 41385 |
| 587 | Ga0496126_0167444 | 3300048929 | Bacteria | 1874 |
| 588 | Ga0496126_0255649 | 3300048929 | Bacteria | 1458 |
| 589 | Ga0496126_0255673 | 3300048929 | Bacteria | 1458 |
| 590 | Ga0495678_001974 | 3300049459 | Bacteria | 14782 |
| 591 | Ga0495678_002020 | 3300049459 | Bacteria | 14560 |
| 592 | Ga0495678_010151 | 3300049459 | Bacteria | 4591 |
| 593 | Ga0495678_021034 | 3300049459 | Bacteria | 2879 |
| 594 | Ga0495682_0000198 | 3300049460 | Bacteria | 48570 |
| 595 | Ga0495682_0004844 | 3300049460 | Bacteria | 5680 |
| 596 | Ga0495682_0023086 | 3300049460 | Bacteria | 2324 |
| 597 | Ga0501291_126640 | 3300049514 | Bacteria | 559 |
| 598 | Ga0501314_025131 | 3300049530 | Bacteria | 639 |
| 599 | Ga0501323_000644 | 3300049539 | Bacteria | 2688 |
| 600 | Ga0501031_0810835 | 3300049568 | Bacteria | 600 |
| 601 | Ga0501036_0107811 | 3300049572 | Bacteria | 2355 |
| 602 | Ga0501036_0247379 | 3300049572 | Bacteria | 1495 |
| 603 | Ga0501039_1480782 | 3300049575 | Bacteria | 522 |
| 604 | Ga0501040_0803102 | 3300049576 | Bacteria | 681 |
| 605 | Ga0501041_0748277 | 3300049577 | Bacteria | 626 |
| 606 | Ga0501042_0391007 | 3300049578 | Bacteria | 1007 |
| 607 | Ga0501042_0403516 | 3300049578 | Bacteria | 990 |
| 608 | Ga0501046_0280040 | 3300049580 | Bacteria | 1222 |
| 609 | Ga0501048_0610428 | 3300049582 | Bacteria | 783 |
| 610 | Ga0501048_1164066 | 3300049582 | Bacteria | 555 |
| 611 | Ga0501067_0014698 | 3300049583 | Bacteria | 4331 |
| 612 | Ga0501068_0148253 | 3300049584 | Bacteria | 1473 |
| 613 | Ga0501069_0143596 | 3300049585 | Bacteria | 1370 |
| 614 | Ga0501072_0033268 | 3300049588 | Bacteria | 4040 |
| 615 | Ga0501073_0308941 | 3300049589 | Bacteria | 1091 |
| 616 | Ga0501075_0033022 | 3300049591 | Bacteria | 3849 |
| 617 | Ga0501075_0691062 | 3300049591 | Bacteria | 777 |
| 618 | Ga0501076_0380884 | 3300049592 | Bacteria | 1160 |
| 619 | Ga0501227_018988 | 3300049665 | Bacteria | 1564 |
| 620 | Ga0501250_098197 | 3300049680 | Bacteria | 518 |
| 621 | Ga0501079_0291187 | 3300049741 | Unclassified | 1277 |
| 622 | Ga0501079_0899878 | 3300049741 | Bacteria | 697 |
| 623 | Ga0501080_0427819 | 3300049742 | Bacteria | 1189 |
| 624 | Ga0501080_0939664 | 3300049742 | Bacteria | 752 |
| 625 | Ga0501080_1125694 | 3300049742 | Bacteria | 677 |
| 626 | Ga0501081_0398870 | 3300049743 | Bacteria | 1018 |
| 627 | Ga0501081_0591366 | 3300049743 | Bacteria | 830 |
| 628 | Ga0501081_1491515 | 3300049743 | Bacteria | 514 |
| 629 | Ga0501269_005839 | 3300049766 | Bacteria | 1481 |
| 630 | Ga0501035_0858132 | 3300049822 | Bacteria | 722 |
| 631 | Ga0501035_0990611 | 3300049822 | Unclassified | 661 |
| 632 | Ga0501045_0130958 | 3300049824 | Bacteria | 1864 |
| 633 | Ga0501226_001532 | 3300049853 | Bacteria | 2948 |
| 634 | nmdc:mga03683_73603_c1 | 3300050489 | Bacteria | 1465 |
| 635 | nmdc:mga03683_98987_c1 | 3300050489 | Bacteria | 1280 |
| 636 | nmdc:mga00v17_279842_c1 | 3300050491 | Bacteria | 1083 |
| 637 | nmdc:mga0k408_498873_c1 | 3300050493 | Bacteria | 721 |
| 638 | nmdc:mga09592_1340675_c1 | 3300050508 | Bacteria | 587 |
| 639 | nmdc:mga0qj67_721125_c1 | 3300050509 | Bacteria | 792 |
| 640 | nmdc:mga08y16_1231_c1 | 3300050511 | Bacteria | 25326 |
| 641 | nmdc:mga08y16_139190_c1 | 3300050511 | Bacteria | 2523 |
| 642 | nmdc:mga08y16_226260_c1 | 3300050511 | Bacteria | 1936 |
| 643 | nmdc:mga08y16_597470_c1 | 3300050511 | Bacteria | 1113 |
| 644 | nmdc:mga0a205_67097_c1 | 3300050515 | Bacteria | 2699 |
| 645 | Ga0500555_010659 | 3300053103 | Bacteria | 2639 |
| 646 | Ga0500572_001757 | 3300053111 | Bacteria | 5590 |
| 647 | Ga0500564_104323 | 3300053138 | Bacteria | 1250 |
| 648 | Ga0500573_0044851 | 3300053140 | Bacteria | 2549 |
| 649 | Ga0500577_0118775 | 3300053142 | Bacteria | 1099 |
| 650 | Ga0500586_168579 | 3300053145 | Bacteria | 738 |
| 651 | Ga0501084_0061070 | 3300054114 | Bacteria | 3155 |
| 652 | Ga0501084_0394814 | 3300054114 | Bacteria | 1169 |
| 653 | Ga0501082_0795640 | 3300060353 | Bacteria | 827 |
| 654 | Ga0501082_1154840 | 3300060353 | Bacteria | 677 |
| 655 | Ga0530510_0057468 | 3300061734 | Bacteria | 2811 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_101278119 | Ga0070671_1012781192 | 96 |
| 2 | 3300005455 | Ga0070663_101889510 | Ga0070663_1018895101 | 96 |
| 3 | 3300005618 | Ga0068864_100606555 | Ga0068864_1006065552 | 96 |
| 4 | 3300049822 | Ga0501035_0990611 | Ga0501035_0990611_19_312 | 96 |
| 5 | 3300009094 | Ga0111539_10460265 | Ga0111539_104602653 | 103 |
| 6 | 3300050508 | nmdc:mga09592_1340675_c1 | nmdc:mga09592_1340675_c1_18_371 | 103 |
| 7 | 3300050511 | nmdc:mga08y16_139190_c1 | nmdc:mga08y16_139190_c1_498_851 | 103 |
| 8 | 3300005441 | Ga0070700_100065764 | Ga0070700_1000657643 | 106 |
| 9 | iso_pu_bacteria | 2511231006 | 2511267855 | 108 |
| 10 | iso_pu_bacteria | 2511231008 | 2511279723 | 108 |
| 11 | iso_pu_bacteria | 2511231011 | 2511296879 | 108 |
| 12 | iso_pu_bacteria | 2511231012 | 2511304583 | 108 |
| 13 | iso_pu_bacteria | 2511231014 | 2511313563 | 108 |
| 14 | iso_pu_bacteria | 2511231015 | 2511318341 | 108 |
| 15 | iso_pu_bacteria | 2511231017 | 2511331348 | 108 |
| 16 | iso_pu_bacteria | 2511231018 | 2511337418 | 108 |
| 17 | iso_pu_bacteria | 2511231019 | 2511341781 | 108 |
| 18 | iso_pu_bacteria | 2511231020 | 2511351444 | 108 |
| 19 | iso_pu_bacteria | 2511231021 | 2511357688 | 108 |
| 20 | iso_pu_bacteria | 2511231023 | 2511367040 | 108 |
| 21 | iso_pu_bacteria | 2511231031 | 2511415806 | 108 |
| 22 | iso_pu_bacteria | 2511231156 | 2511827329 | 108 |
| 23 | iso_pu_bacteria | 2512047018 | 2512329517 | 108 |
| 24 | iso_pu_bacteria | 2554235231 | 2555246731 | 108 |
| 25 | iso_pu_bacteria | 2582580891 | 2583795016 | 108 |
| 26 | iso_pu_bacteria | 2597489887 | 2597860578 | 108 |
| 27 | iso_pu_bacteria | 2597489888 | 2597866329 | 108 |
| 28 | iso_pu_bacteria | 2597489889 | 2597872174 | 108 |
| 29 | iso_pu_bacteria | 2599185155 | 2599330862 | 108 |
| 30 | iso_pu_bacteria | 2599185185 | 2599486185 | 108 |
| 31 | iso_pu_bacteria | 2599185188 | 2599502348 | 108 |
| 32 | iso_pu_bacteria | 2599185189 | 2599505461 | 108 |
| 33 | iso_pu_bacteria | 2599185212 | 2599616959 | 108 |
| 34 | iso_pu_bacteria | 2599185248 | 2599768484 | 108 |
| 35 | iso_pu_bacteria | 2599185257 | 2599804968 | 108 |
| 36 | iso_pu_bacteria | 2599185289 | 2599885904 | 108 |
| 37 | iso_pu_bacteria | 2599185291 | 2599897618 | 108 |
| 38 | iso_pu_bacteria | 2599185300 | 2599933954 | 108 |
| 39 | iso_pu_bacteria | 2599185302 | 2599945768 | 108 |
| 40 | iso_pu_bacteria | 2599185303 | 2599951122 | 108 |
| 41 | iso_pu_bacteria | 2599185304 | 2599956762 | 108 |
| 42 | iso_pu_bacteria | 2599185305 | 2599961475 | 108 |
| 43 | iso_pu_bacteria | 2599185306 | 2599965748 | 108 |
| 44 | iso_pu_bacteria | 2599185308 | 2599978578 | 108 |
| 45 | iso_pu_bacteria | 2599185309 | 2599984853 | 108 |
| 46 | iso_pu_bacteria | 2599185310 | 2599988062 | 108 |
| 47 | iso_pu_bacteria | 2599185311 | 2599993717 | 108 |
| 48 | iso_pu_bacteria | 2599185312 | 2599998852 | 108 |
| 49 | iso_pu_bacteria | 2599185313 | 2600008543 | 108 |
| 50 | iso_pu_bacteria | 2599185314 | 2600012645 | 108 |
| 51 | iso_pu_bacteria | 2599185315 | 2600018724 | 108 |
| 52 | iso_pu_bacteria | 2599185316 | 2600025129 | 108 |
| 53 | iso_pu_bacteria | 2599185317 | 2600030014 | 108 |
| 54 | iso_pu_bacteria | 2599185318 | 2600036599 | 108 |
| 55 | iso_pu_bacteria | 2599185319 | 2600041908 | 108 |
| 56 | iso_pu_bacteria | 2599185320 | 2600046390 | 108 |
| 57 | iso_pu_bacteria | 2599185321 | 2600053104 | 108 |
| 58 | iso_pu_bacteria | 2599185322 | 2600062812 | 108 |
| 59 | iso_pu_bacteria | 2599185323 | 2600066093 | 108 |
| 60 | iso_pu_bacteria | 2599185324 | 2600073671 | 108 |
| 61 | iso_pu_bacteria | 2599185325 | 2600079634 | 108 |
| 62 | iso_pu_bacteria | 2600254930 | 2600359701 | 108 |
| 63 | iso_pu_bacteria | 2600254931 | 2600366235 | 108 |
| 64 | iso_pu_bacteria | 2600255296 | 2601693737 | 108 |
| 65 | iso_pu_bacteria | 2619619299 | 2621297140 | 108 |
| 66 | iso_pu_bacteria | 2643221565 | 2643842337 | 108 |
| 67 | iso_pu_bacteria | 2643221589 | 2643955946 | 108 |
| 68 | iso_pu_bacteria | 2643221602 | 2644020740 | 108 |
| 69 | iso_pu_bacteria | 2643221650 | 2644283364 | 108 |
| 70 | iso_pu_bacteria | 2643221713 | 2644620675 | 108 |
| 71 | iso_pu_bacteria | 2651869719 | 2652545982 | 108 |
| 72 | iso_pu_bacteria | 2667528170 | 2671089229 | 108 |
| 73 | iso_pu_bacteria | 2667528176 | 2671128733 | 108 |
| 74 | iso_pu_bacteria | 2671180172 | 2671771974 | 108 |
| 75 | iso_pu_bacteria | 2675903420 | 2677901299 | 108 |
| 76 | iso_pu_bacteria | 2675903515 | 2678265841 | 108 |
| 77 | iso_pu_bacteria | 2721755607 | 2723251065 | 108 |
| 78 | iso_pu_bacteria | 2728369097 | 2729146142 | 108 |
| 79 | iso_pu_bacteria | 2738541265 | 2738671959 | 108 |
| 80 | iso_pu_bacteria | 2738541271 | 2738690349 | 108 |
| 81 | iso_pu_bacteria | 2738541282 | 2738750353 | 108 |
| 82 | iso_pu_bacteria | 2738541303 | 2738859393 | 108 |
| 83 | iso_pu_bacteria | 2738543004 | 2739198753 | 108 |
| 84 | iso_pu_bacteria | 2738543015 | 2739261480 | 108 |
| 85 | iso_pu_bacteria | 2738543016 | 2739266123 | 108 |
| 86 | iso_pu_bacteria | 2738543025 | 2739312818 | 108 |
| 87 | iso_pu_bacteria | 2740892503 | 2743740129 | 108 |
| 88 | iso_pu_bacteria | 2744054620 | 2745007073 | 108 |
| 89 | iso_pu_bacteria | 2773857673 | 2774135873 | 108 |
| 90 | iso_pu_bacteria | 2784132063 | 2784262127 | 108 |
| 91 | iso_pu_bacteria | 2791355520 | 2794598533 | 108 |
| 92 | iso_pu_bacteria | 2808606377 | 2808932282 | 108 |
| 93 | iso_pu_bacteria | 2808606381 | 2808954403 | 108 |
| 94 | iso_pu_bacteria | 2808606382 | 2808960831 | 108 |
| 95 | iso_pu_bacteria | 2808606385 | 2808975839 | 108 |
| 96 | iso_pu_bacteria | 2808606388 | 2808992948 | 108 |
| 97 | iso_pu_bacteria | 2816332298 | 2817493747 | 108 |
| 98 | iso_pu_bacteria | 2818991456 | 2819654825 | 108 |
| 99 | iso_pu_bacteria | 2825651385 | 2825655408 | 108 |
| 100 | iso_pu_bacteria | 2826581358 | 2826582164 | 108 |
| 101 | iso_pu_bacteria | 2842815866 | 2842821159 | 108 |
| 102 | iso_pu_bacteria | 2842826826 | 2842829307 | 108 |
| 103 | iso_pu_bacteria | 2842837860 | 2842842156 | 108 |
| 104 | iso_pu_bacteria | 2842849001 | 2842852490 | 108 |
| 105 | iso_pu_bacteria | 2842854478 | 2842855313 | 108 |
| 106 | iso_pu_bacteria | 2852612431 | 2852616028 | 108 |
| 107 | iso_pu_bacteria | 2852657418 | 2852662553 | 108 |
| 108 | iso_pu_bacteria | 2852667396 | 2852670996 | 108 |
| 109 | iso_pu_bacteria | 2860339153 | 2860341408 | 108 |
| 110 | iso_pu_bacteria | 2860867994 | 2860872726 | 108 |
| 111 | iso_pu_bacteria | 2880230671 | 2880235683 | 108 |
| 112 | iso_pu_bacteria | 2904518522 | 2904519257 | 108 |
| 113 | iso_pu_bacteria | 2904550169 | 2904555450 | 108 |
| 114 | iso_pu_bacteria | 2908446538 | 2908452265 | 108 |
| 115 | iso_pu_bacteria | 2912963787 | 2912968595 | 108 |
| 116 | iso_pu_bacteria | 2913036834 | 2913042251 | 108 |
| 117 | iso_pu_bacteria | 2919155634 | 2919155641 | 108 |
| 118 | iso_pu_bacteria | 2919456309 | 2919457247 | 108 |
| 119 | iso_pu_bacteria | 2923153595 | 2923159221 | 108 |
| 120 | iso_pu_bacteria | 2923586266 | 2923591921 | 108 |
| 121 | iso_pu_bacteria | 2929144301 | 2929149637 | 108 |
| 122 | iso_pu_bacteria | 2931369376 | 2931372957 | 108 |
| 123 | iso_pu_bacteria | 2939636861 | 2939642180 | 108 |
| 124 | iso_pu_bacteria | 2939651529 | 2939653935 | 108 |
| 125 | iso_pu_bacteria | 2945928738 | 2945931217 | 108 |
| 126 | iso_pu_bacteria | 2945961074 | 2945966487 | 108 |
| 127 | iso_pu_bacteria | 2946006987 | 2946007253 | 108 |
| 128 | iso_pu_bacteria | 2969304461 | 2969309869 | 108 |
| 129 | iso_pu_bacteria | 2984286254 | 2984286926 | 108 |
| 130 | iso_pu_bacteria | 3007395558 | 3007398869 | 108 |
| 131 | iso_pu_bacteria | 3007419365 | 3007425409 | 108 |
| 132 | iso_pu_bacteria | 3007619802 | 3007622256 | 108 |
| 133 | iso_pu_bacteria | 3007718800 | 3007720034 | 108 |
| 134 | iso_pu_bacteria | 651053060 | 651174558 | 108 |
| 135 | iso_pu_bacteria | 8015687852 | 8015693310 | 108 |
| 136 | iso_pu_bacteria | 8054285046 | 8054291435 | 108 |
| 137 | iso_pu_bacteria | 8054347763 | 8054349875 | 108 |
| 138 | iso_pu_bacteria | 8054503363 | 8054508615 | 108 |
| 139 | iso_pu_bacteria | 8054929484 | 8054934286 | 108 |
| 140 | iso_pu_bacteria | 8055770955 | 8055776560 | 108 |
| 141 | iso_pu_bacteria | 8055878733 | 8055879300 | 108 |
| 142 | iso_pu_bacteria | 8056125926 | 8056131302 | 108 |
| 143 | iso_pu_bacteria | 8056131705 | 8056137019 | 108 |
| 144 | iso_pu_bacteria | 8056143049 | 8056148460 | 108 |
| 145 | iso_pu_bacteria | 8056161164 | 8056163315 | 108 |
| 146 | iso_pu_bacteria | 8056172158 | 8056177717 | 108 |
| 147 | iso_pu_bacteria | 8056177738 | 8056181697 | 108 |
| 148 | 3300005327 | Ga0070658_11068322 | Ga0070658_110683222 | 109 |
| 149 | 3300012503 | Ga0157313_1002555 | Ga0157313_10025552 | 109 |
| 150 | 3300046458 | Ga0495591_062845 | Ga0495591_062845_200_529 | 109 |
| 151 | 3300014326 | Ga0157380_10128497 | Ga0157380_101284971 | 110 |
| 152 | 3300014968 | Ga0157379_10233215 | Ga0157379_102332152 | 110 |
| 153 | 3300041453 | Ga0451797_0571604 | Ga0451797_0571604_294_632 | 110 |
| 154 | 3300046529 | Ga0495652_1114907 | Ga0495652_1114907_58_405 | 110 |
| 155 | 3300046543 | Ga0495645_0035434 | Ga0495645_0035434_45_392 | 110 |
| 156 | 3300046678 | Ga0495599_0013493 | Ga0495599_0013493_1942_2289 | 110 |
| 157 | 3300053103 | Ga0500555_010659 | Ga0500555_010659_582_923 | 110 |
| 158 | 3300005331 | Ga0070670_100626199 | Ga0070670_1006261992 | 111 |
| 159 | 3300005333 | Ga0070677_10230730 | Ga0070677_102307301 | 111 |
| 160 | 3300005333 | Ga0070677_10666426 | Ga0070677_106664262 | 111 |
| 161 | 3300005336 | Ga0070680_100205125 | Ga0070680_1002051252 | 111 |
| 162 | 3300005345 | Ga0070692_10122771 | Ga0070692_101227711 | 111 |
| 163 | 3300005354 | Ga0070675_100506158 | Ga0070675_1005061581 | 111 |
| 164 | 3300005356 | Ga0070674_100117082 | Ga0070674_1001170823 | 111 |
| 165 | 3300005364 | Ga0070673_101747872 | Ga0070673_1017478721 | 111 |
| 166 | 3300005444 | Ga0070694_100092950 | Ga0070694_1000929503 | 111 |
| 167 | 3300005444 | Ga0070694_101519785 | Ga0070694_1015197852 | 111 |
| 168 | 3300005543 | Ga0070672_100456423 | Ga0070672_1004564232 | 111 |
| 169 | 3300005614 | Ga0068856_100571006 | Ga0068856_1005710063 | 111 |
| 170 | 3300005618 | Ga0068864_102122317 | Ga0068864_1021223171 | 111 |
| 171 | 3300005841 | Ga0068863_100587720 | Ga0068863_1005877202 | 111 |
| 172 | 3300005841 | Ga0068863_101435572 | Ga0068863_1014355721 | 111 |
| 173 | 3300005844 | Ga0068862_100569153 | Ga0068862_1005691532 | 111 |
| 174 | 3300006051 | Ga0075364_11222676 | Ga0075364_112226762 | 111 |
| 175 | 3300006058 | Ga0075432_10107019 | Ga0075432_101070192 | 111 |
| 176 | 3300006195 | Ga0075366_10496181 | Ga0075366_104961812 | 111 |
| 177 | 3300006844 | Ga0075428_100067243 | Ga0075428_1000672434 | 111 |
| 178 | 3300006844 | Ga0075428_101071261 | Ga0075428_1010712612 | 111 |
| 179 | 3300006846 | Ga0075430_100427646 | Ga0075430_1004276462 | 111 |
| 180 | 3300006880 | Ga0075429_101026141 | Ga0075429_1010261411 | 111 |
| 181 | 3300009094 | Ga0111539_10199037 | Ga0111539_101990371 | 111 |
| 182 | 3300009094 | Ga0111539_11137655 | Ga0111539_111376552 | 111 |
| 183 | 3300011119 | Ga0105246_10596506 | Ga0105246_105965062 | 111 |
| 184 | 3300013296 | Ga0157374_10904200 | Ga0157374_109042002 | 111 |
| 185 | 3300013308 | Ga0157375_10806812 | Ga0157375_108068122 | 111 |
| 186 | 3300013308 | Ga0157375_11424709 | Ga0157375_114247092 | 111 |
| 187 | 3300014325 | Ga0163163_10009963 | Ga0163163_100099633 | 111 |
| 188 | 3300014326 | Ga0157380_10370482 | Ga0157380_103704822 | 111 |
| 189 | 3300014326 | Ga0157380_10466189 | Ga0157380_104661892 | 111 |
| 190 | 3300014326 | Ga0157380_12866217 | Ga0157380_128662172 | 111 |
| 191 | 3300014969 | Ga0157376_10346479 | Ga0157376_103464793 | 111 |
| 192 | 3300025917 | Ga0207660_11505875 | Ga0207660_115058752 | 111 |
| 193 | 3300025941 | Ga0207711_10022622 | Ga0207711_100226222 | 111 |
| 194 | 3300026041 | Ga0207639_12187292 | Ga0207639_121872922 | 111 |
| 195 | 3300026075 | Ga0207708_10190301 | Ga0207708_101903011 | 111 |
| 196 | 3300026078 | Ga0207702_10488514 | Ga0207702_104885143 | 111 |
| 197 | 3300026088 | Ga0207641_11402164 | Ga0207641_114021642 | 111 |
| 198 | 3300026088 | Ga0207641_11912810 | Ga0207641_119128101 | 111 |
| 199 | 3300026095 | Ga0207676_10210411 | Ga0207676_102104113 | 111 |
| 200 | 3300026121 | Ga0207683_10171205 | Ga0207683_101712052 | 111 |
| 201 | 3300027907 | Ga0207428_10001453 | Ga0207428_1000145320 | 111 |
| 202 | 3300027907 | Ga0207428_10045203 | Ga0207428_100452034 | 111 |
| 203 | 3300027907 | Ga0207428_10714540 | Ga0207428_107145402 | 111 |
| 204 | 3300028380 | Ga0268265_10516484 | Ga0268265_105164842 | 111 |
| 205 | 3300031911 | Ga0307412_11679614 | Ga0307412_116796142 | 111 |
| 206 | 3300031995 | Ga0307409_101959451 | Ga0307409_1019594512 | 111 |
| 207 | 3300041459 | Ga0451800_1249912 | Ga0451800_1249912_384_725 | 111 |
| 208 | 3300041512 | Ga0451853_3562112 | Ga0451853_3562112_61_402 | 111 |
| 209 | 3300042156 | Ga0439446_0036404 | Ga0439446_0036404_1020_1361 | 111 |
| 210 | 3300044694 | Ga0466963_0844041 | Ga0466963_0844041_41_385 | 111 |
| 211 | 3300046459 | Ga0495629_0536684 | Ga0495629_0536684_184_528 | 111 |
| 212 | 3300046477 | Ga0495664_0063537 | Ga0495664_0063537_853_1191 | 111 |
| 213 | 3300046536 | Ga0495587_0259213 | Ga0495587_0259213_573_911 | 111 |
| 214 | 3300046539 | Ga0495621_0003005 | Ga0495621_0003005_4127_4474 | 111 |
| 215 | 3300046543 | Ga0495645_0037736 | Ga0495645_0037736_2408_2746 | 111 |
| 216 | 3300046543 | Ga0495645_0295460 | Ga0495645_0295460_11_349 | 111 |
| 217 | 3300046663 | Ga0495635_0044488 | Ga0495635_0044488_1490_1828 | 111 |
| 218 | 3300046675 | Ga0495657_0104099 | Ga0495657_0104099_318_656 | 111 |
| 219 | 3300046679 | Ga0495623_0005830 | Ga0495623_0005830_3190_3528 | 111 |
| 220 | 3300046684 | Ga0495669_0053917 | Ga0495669_0053917_1138_1476 | 111 |
| 221 | 3300046691 | Ga0495670_0310492 | Ga0495670_0310492_206_550 | 111 |
| 222 | 3300046691 | Ga0495670_0322910 | Ga0495670_0322910_399_746 | 111 |
| 223 | 3300046809 | Ga0495600_0444657 | Ga0495600_0444657_185_523 | 111 |
| 224 | 3300047317 | Ga0495604_0085571 | Ga0495604_0085571_1964_2302 | 111 |
| 225 | 3300047318 | Ga0495636_0148566 | Ga0495636_0148566_685_1023 | 111 |
| 226 | 3300047321 | Ga0495676_0398924 | Ga0495676_0398924_180_524 | 111 |
| 227 | 3300047322 | Ga0495680_0702293 | Ga0495680_0702293_51_389 | 111 |
| 228 | 3300047444 | Ga0495675_0013899 | Ga0495675_0013899_2772_3110 | 111 |
| 229 | 3300047444 | Ga0495675_0057262 | Ga0495675_0057262_917_1255 | 111 |
| 230 | 3300048088 | Ga0495602_0258216 | Ga0495602_0258216_639_977 | 111 |
| 231 | 3300049514 | Ga0501291_126640 | Ga0501291_126640_67_411 | 111 |
| 232 | 3300049572 | Ga0501036_0107811 | Ga0501036_0107811_446_787 | 111 |
| 233 | 3300049575 | Ga0501039_1480782 | Ga0501039_1480782_94_435 | 111 |
| 234 | 3300049577 | Ga0501041_0748277 | Ga0501041_0748277_52_393 | 111 |
| 235 | 3300049578 | Ga0501042_0391007 | Ga0501042_0391007_603_944 | 111 |
| 236 | 3300049578 | Ga0501042_0403516 | Ga0501042_0403516_567_908 | 111 |
| 237 | 3300049580 | Ga0501046_0280040 | Ga0501046_0280040_201_542 | 111 |
| 238 | 3300049582 | Ga0501048_0610428 | Ga0501048_0610428_92_433 | 111 |
| 239 | 3300049582 | Ga0501048_1164066 | Ga0501048_1164066_132_473 | 111 |
| 240 | 3300049588 | Ga0501072_0033268 | Ga0501072_0033268_1886_2227 | 111 |
| 241 | 3300049589 | Ga0501073_0308941 | Ga0501073_0308941_420_761 | 111 |
| 242 | 3300049591 | Ga0501075_0033022 | Ga0501075_0033022_903_1244 | 111 |
| 243 | 3300049591 | Ga0501075_0691062 | Ga0501075_0691062_164_505 | 111 |
| 244 | 3300049592 | Ga0501076_0380884 | Ga0501076_0380884_730_1071 | 111 |
| 245 | 3300049741 | Ga0501079_0291187 | Ga0501079_0291187_299_637 | 111 |
| 246 | 3300049742 | Ga0501080_0427819 | Ga0501080_0427819_98_439 | 111 |
| 247 | 3300049742 | Ga0501080_0939664 | Ga0501080_0939664_98_439 | 111 |
| 248 | 3300049742 | Ga0501080_1125694 | Ga0501080_1125694_49_387 | 111 |
| 249 | 3300049743 | Ga0501081_0398870 | Ga0501081_0398870_398_739 | 111 |
| 250 | 3300049743 | Ga0501081_0591366 | Ga0501081_0591366_264_602 | 111 |
| 251 | 3300049822 | Ga0501035_0858132 | Ga0501035_0858132_47_388 | 111 |
| 252 | 3300049824 | Ga0501045_0130958 | Ga0501045_0130958_182_523 | 111 |
| 253 | 3300050493 | nmdc:mga0k408_498873_c1 | nmdc:mga0k408_498873_c1_46_387 | 111 |
| 254 | 3300050509 | nmdc:mga0qj67_721125_c1 | nmdc:mga0qj67_721125_c1_162_503 | 111 |
| 255 | 3300050511 | nmdc:mga08y16_1231_c1 | nmdc:mga08y16_1231_c1_15045_15386 | 111 |
| 256 | 3300050511 | nmdc:mga08y16_226260_c1 | nmdc:mga08y16_226260_c1_937_1278 | 111 |
| 257 | 3300050511 | nmdc:mga08y16_597470_c1 | nmdc:mga08y16_597470_c1_115_456 | 111 |
| 258 | 3300054114 | Ga0501084_0061070 | Ga0501084_0061070_790_1131 | 111 |
| 259 | 3300054114 | Ga0501084_0394814 | Ga0501084_0394814_793_1134 | 111 |
| 260 | 3300060353 | Ga0501082_0795640 | Ga0501082_0795640_365_706 | 111 |
| 261 | 3300060353 | Ga0501082_1154840 | Ga0501082_1154840_208_549 | 111 |
| 262 | 3300061734 | Ga0530510_0057468 | Ga0530510_0057468_205_546 | 111 |
| 263 | 2162886011 | MRS1b_contig_2079529 | MRS1b_0524.00001140 | 112 |
| 264 | 3300003503 | JGI26141J51220_1004726 | JGI26141J51220_10047262 | 112 |
| 265 | 3300003781 | Ga0055536_1002226 | Ga0055536_10022265 | 112 |
| 266 | 3300003791 | Ga0055530_10000513 | Ga0055530_1000051323 | 112 |
| 267 | 3300003791 | Ga0055530_10002706 | Ga0055530_100027065 | 112 |
| 268 | 3300003791 | Ga0055530_10057419 | Ga0055530_100574191 | 112 |
| 269 | 3300003792 | Ga0055540_1000426 | Ga0055540_100042623 | 112 |
| 270 | 3300003792 | Ga0055540_1000516 | Ga0055540_100051617 | 112 |
| 271 | 3300005288 | Ga0065714_10003982 | Ga0065714_100039823 | 112 |
| 272 | 3300005288 | Ga0065714_10013467 | Ga0065714_100134672 | 112 |
| 273 | 3300005288 | Ga0065714_10018129 | Ga0065714_100181292 | 112 |
| 274 | 3300005288 | Ga0065714_10031746 | Ga0065714_100317461 | 112 |
| 275 | 3300005288 | Ga0065714_10088528 | Ga0065714_100885282 | 112 |
| 276 | 3300005288 | Ga0065714_10138835 | Ga0065714_101388351 | 112 |
| 277 | 3300005289 | Ga0065704_10016620 | Ga0065704_100166203 | 112 |
| 278 | 3300005289 | Ga0065704_10029536 | Ga0065704_100295363 | 112 |
| 279 | 3300005289 | Ga0065704_10070839 | Ga0065704_100708399 | 112 |
| 280 | 3300005289 | Ga0065704_10082761 | Ga0065704_100827612 | 112 |
| 281 | 3300005289 | Ga0065704_10107455 | Ga0065704_101074552 | 112 |
| 282 | 3300005290 | Ga0065712_10068271 | Ga0065712_100682716 | 112 |
| 283 | 3300005331 | Ga0070670_100055136 | Ga0070670_1000551361 | 112 |
| 284 | 3300005347 | Ga0070668_100505535 | Ga0070668_1005055352 | 112 |
| 285 | 3300005353 | Ga0070669_100521194 | Ga0070669_1005211942 | 112 |
| 286 | 3300005356 | Ga0070674_100429091 | Ga0070674_1004290912 | 112 |
| 287 | 3300005456 | Ga0070678_100863396 | Ga0070678_1008633962 | 112 |
| 288 | 3300005548 | Ga0070665_100969913 | Ga0070665_1009699132 | 112 |
| 289 | 3300005563 | Ga0068855_101599002 | Ga0068855_1015990021 | 112 |
| 290 | 3300005841 | Ga0068863_101092414 | Ga0068863_1010924142 | 112 |
| 291 | 3300006038 | Ga0075365_10325229 | Ga0075365_103252292 | 112 |
| 292 | 3300006051 | Ga0075364_10177853 | Ga0075364_101778533 | 112 |
| 293 | 3300006051 | Ga0075364_10247907 | Ga0075364_102479072 | 112 |
| 294 | 3300006058 | Ga0075432_10007357 | Ga0075432_100073571 | 112 |
| 295 | 3300006058 | Ga0075432_10036242 | Ga0075432_100362422 | 112 |
| 296 | 3300006058 | Ga0075432_10042415 | Ga0075432_100424152 | 112 |
| 297 | 3300006058 | Ga0075432_10069857 | Ga0075432_100698572 | 112 |
| 298 | 3300006058 | Ga0075432_10364468 | Ga0075432_103644682 | 112 |
| 299 | 3300006177 | Ga0075362_10162367 | Ga0075362_101623672 | 112 |
| 300 | 3300006177 | Ga0075362_10393227 | Ga0075362_103932272 | 112 |
| 301 | 3300006358 | Ga0068871_101979739 | Ga0068871_1019797391 | 112 |
| 302 | 3300006844 | Ga0075428_101099077 | Ga0075428_1010990772 | 112 |
| 303 | 3300006852 | Ga0075433_10172749 | Ga0075433_101727492 | 112 |
| 304 | 3300006881 | Ga0068865_100249172 | Ga0068865_1002491721 | 112 |
| 305 | 3300006914 | Ga0075436_100463883 | Ga0075436_1004638832 | 112 |
| 306 | 3300006946 | Ga0079104_1002096 | Ga0079104_10020963 | 112 |
| 307 | 3300009011 | Ga0105251_10000322 | Ga0105251_1000032238 | 112 |
| 308 | 3300009011 | Ga0105251_10001209 | Ga0105251_1000120915 | 112 |
| 309 | 3300009011 | Ga0105251_10004229 | Ga0105251_100042293 | 112 |
| 310 | 3300009011 | Ga0105251_10025863 | Ga0105251_100258635 | 112 |
| 311 | 3300009011 | Ga0105251_10150016 | Ga0105251_101500161 | 112 |
| 312 | 3300009011 | Ga0105251_10254405 | Ga0105251_102544052 | 112 |
| 313 | 3300009011 | Ga0105251_10264450 | Ga0105251_102644502 | 112 |
| 314 | 3300009036 | Ga0105244_10001414 | Ga0105244_1000141415 | 112 |
| 315 | 3300009036 | Ga0105244_10099039 | Ga0105244_100990392 | 112 |
| 316 | 3300009036 | Ga0105244_10132498 | Ga0105244_101324982 | 112 |
| 317 | 3300009036 | Ga0105244_10136140 | Ga0105244_101361402 | 112 |
| 318 | 3300009036 | Ga0105244_10239977 | Ga0105244_102399772 | 112 |
| 319 | 3300009036 | Ga0105244_10365250 | Ga0105244_103652501 | 112 |
| 320 | 3300009092 | Ga0105250_10000708 | Ga0105250_1000070810 | 112 |
| 321 | 3300009092 | Ga0105250_10013410 | Ga0105250_100134103 | 112 |
| 322 | 3300009092 | Ga0105250_10067548 | Ga0105250_100675482 | 112 |
| 323 | 3300009093 | Ga0105240_10374631 | Ga0105240_103746312 | 112 |
| 324 | 3300009094 | Ga0111539_10776502 | Ga0111539_107765022 | 112 |
| 325 | 3300009148 | Ga0105243_10016043 | Ga0105243_100160437 | 112 |
| 326 | 3300009148 | Ga0105243_10068135 | Ga0105243_100681354 | 112 |
| 327 | 3300009148 | Ga0105243_10069695 | Ga0105243_100696954 | 112 |
| 328 | 3300009148 | Ga0105243_10095786 | Ga0105243_100957861 | 112 |
| 329 | 3300009148 | Ga0105243_10190332 | Ga0105243_101903323 | 112 |
| 330 | 3300009148 | Ga0105243_10476606 | Ga0105243_104766062 | 112 |
| 331 | 3300009176 | Ga0105242_10445872 | Ga0105242_104458723 | 112 |
| 332 | 3300011119 | Ga0105246_10005186 | Ga0105246_100051865 | 112 |
| 333 | 3300012498 | Ga0157345_1000309 | Ga0157345_10003096 | 112 |
| 334 | 3300013100 | Ga0157373_10273837 | Ga0157373_102738372 | 112 |
| 335 | 3300013102 | Ga0157371_10000536 | Ga0157371_1000053637 | 112 |
| 336 | 3300013104 | Ga0157370_10196235 | Ga0157370_101962353 | 112 |
| 337 | 3300013104 | Ga0157370_11589889 | Ga0157370_115898892 | 112 |
| 338 | 3300013105 | Ga0157369_10394127 | Ga0157369_103941272 | 112 |
| 339 | 3300013306 | Ga0163162_10545464 | Ga0163162_105454642 | 112 |
| 340 | 3300013306 | Ga0163162_10761676 | Ga0163162_107616761 | 112 |
| 341 | 3300013307 | Ga0157372_10012166 | Ga0157372_100121666 | 112 |
| 342 | 3300013307 | Ga0157372_10162967 | Ga0157372_101629672 | 112 |
| 343 | 3300014326 | Ga0157380_10216934 | Ga0157380_102169342 | 112 |
| 344 | 3300014497 | Ga0182008_10009603 | Ga0182008_100096035 | 112 |
| 345 | 3300014497 | Ga0182008_10011766 | Ga0182008_100117665 | 112 |
| 346 | 3300014497 | Ga0182008_10037144 | Ga0182008_100371442 | 112 |
| 347 | 3300015261 | Ga0182006_1002602 | Ga0182006_10026025 | 112 |
| 348 | 3300015261 | Ga0182006_1018853 | Ga0182006_10188532 | 112 |
| 349 | 3300015261 | Ga0182006_1069548 | Ga0182006_10695482 | 112 |
| 350 | 3300015265 | Ga0182005_1017317 | Ga0182005_10173173 | 112 |
| 351 | 3300017792 | Ga0163161_10014054 | Ga0163161_100140544 | 112 |
| 352 | 3300017792 | Ga0163161_10017026 | Ga0163161_100170262 | 112 |
| 353 | 3300017792 | Ga0163161_10172271 | Ga0163161_101722712 | 112 |
| 354 | 3300017792 | Ga0163161_10986452 | Ga0163161_109864522 | 112 |
| 355 | 3300017792 | Ga0163161_11403819 | Ga0163161_114038192 | 112 |
| 356 | 3300025292 | Ga0209676_1000668 | Ga0209676_100066810 | 112 |
| 357 | 3300025292 | Ga0209676_1001477 | Ga0209676_100147714 | 112 |
| 358 | 3300025292 | Ga0209676_1008998 | Ga0209676_10089986 | 112 |
| 359 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024481 | 112 |
| 360 | 3300025298 | Ga0209050_1000128 | Ga0209050_100012810 | 112 |
| 361 | 3300025298 | Ga0209050_1005862 | Ga0209050_10058626 | 112 |
| 362 | 3300025303 | Ga0209051_1000023 | Ga0209051_1000023397 | 112 |
| 363 | 3300025303 | Ga0209051_1000791 | Ga0209051_100079110 | 112 |
| 364 | 3300025303 | Ga0209051_1015706 | Ga0209051_10157063 | 112 |
| 365 | 3300025304 | Ga0209257_1011030 | Ga0209257_10110305 | 112 |
| 366 | 3300025711 | Ga0207696_1000064 | Ga0207696_1000064203 | 112 |
| 367 | 3300025711 | Ga0207696_1000094 | Ga0207696_100009410 | 112 |
| 368 | 3300025711 | Ga0207696_1005907 | Ga0207696_10059076 | 112 |
| 369 | 3300025711 | Ga0207696_1006396 | Ga0207696_10063962 | 112 |
| 370 | 3300025728 | Ga0207655_1000598 | Ga0207655_100059835 | 112 |
| 371 | 3300025728 | Ga0207655_1001446 | Ga0207655_100144622 | 112 |
| 372 | 3300025728 | Ga0207655_1004682 | Ga0207655_10046823 | 112 |
| 373 | 3300025728 | Ga0207655_1004949 | Ga0207655_10049496 | 112 |
| 374 | 3300025728 | Ga0207655_1010242 | Ga0207655_10102422 | 112 |
| 375 | 3300025728 | Ga0207655_1016556 | Ga0207655_10165566 | 112 |
| 376 | 3300025728 | Ga0207655_1214563 | Ga0207655_12145632 | 112 |
| 377 | 3300025728 | Ga0207655_1239797 | Ga0207655_12397971 | 112 |
| 378 | 3300025735 | Ga0207713_1000010 | Ga0207713_100001010 | 112 |
| 379 | 3300025735 | Ga0207713_1001149 | Ga0207713_10011499 | 112 |
| 380 | 3300025735 | Ga0207713_1002491 | Ga0207713_10024917 | 112 |
| 381 | 3300025735 | Ga0207713_1005765 | Ga0207713_10057655 | 112 |
| 382 | 3300025735 | Ga0207713_1006592 | Ga0207713_10065923 | 112 |
| 383 | 3300025735 | Ga0207713_1009458 | Ga0207713_10094585 | 112 |
| 384 | 3300025735 | Ga0207713_1170096 | Ga0207713_11700961 | 112 |
| 385 | 3300025735 | Ga0207713_1193285 | Ga0207713_11932851 | 112 |
| 386 | 3300025913 | Ga0207695_11157143 | Ga0207695_111571432 | 112 |
| 387 | 3300025925 | Ga0207650_10000591 | Ga0207650_100005919 | 112 |
| 388 | 3300025935 | Ga0207709_10007973 | Ga0207709_100079738 | 112 |
| 389 | 3300025935 | Ga0207709_10135427 | Ga0207709_101354271 | 112 |
| 390 | 3300025935 | Ga0207709_10656677 | Ga0207709_106566772 | 112 |
| 391 | 3300025935 | Ga0207709_10973257 | Ga0207709_109732572 | 112 |
| 392 | 3300025972 | Ga0207668_10184618 | Ga0207668_101846183 | 112 |
| 393 | 3300026078 | Ga0207702_11500637 | Ga0207702_115006371 | 112 |
| 394 | 3300026088 | Ga0207641_11054096 | Ga0207641_110540962 | 112 |
| 395 | 3300026089 | Ga0207648_11494309 | Ga0207648_114943091 | 112 |
| 396 | 3300027111 | Ga0209281_1000016 | Ga0209281_100001610 | 112 |
| 397 | 3300027312 | Ga0209371_1043794 | Ga0209371_10437941 | 112 |
| 398 | 3300027378 | Ga0209981_1011386 | Ga0209981_10113862 | 112 |
| 399 | 3300027471 | Ga0209995_1015309 | Ga0209995_10153092 | 112 |
| 400 | 3300027665 | Ga0209983_1000782 | Ga0209983_10007825 | 112 |
| 401 | 3300027682 | Ga0209971_1000459 | Ga0209971_10004595 | 112 |
| 402 | 3300027876 | Ga0209974_10001088 | Ga0209974_100010888 | 112 |
| 403 | 3300027907 | Ga0207428_10350211 | Ga0207428_103502112 | 112 |
| 404 | 3300030500 | Ga0268256_1016622 | Ga0268256_10166222 | 112 |
| 405 | 3300030731 | Ga0316177_1039133 | Ga0316177_10391332 | 112 |
| 406 | 3300030733 | Ga0314311_1171705 | Ga0314311_11717052 | 112 |
| 407 | 3300030744 | Ga0316181_1230923 | Ga0316181_12309232 | 112 |
| 408 | 3300031238 | Ga0265332_10240885 | Ga0265332_102408851 | 112 |
| 409 | 3300031251 | Ga0265327_10000050 | Ga0265327_10000050153 | 112 |
| 410 | 3300031344 | Ga0265316_10105543 | Ga0265316_101055433 | 112 |
| 411 | 3300031548 | Ga0307408_100004188 | Ga0307408_1000041887 | 112 |
| 412 | 3300031548 | Ga0307408_100412081 | Ga0307408_1004120812 | 112 |
| 413 | 3300031548 | Ga0307408_101594883 | Ga0307408_1015948832 | 112 |
| 414 | 3300031616 | Ga0307508_10002430 | Ga0307508_100024309 | 112 |
| 415 | 3300031730 | Ga0307516_10230890 | Ga0307516_102308903 | 112 |
| 416 | 3300031730 | Ga0307516_10264213 | Ga0307516_102642131 | 112 |
| 417 | 3300031731 | Ga0307405_10012759 | Ga0307405_100127594 | 112 |
| 418 | 3300031731 | Ga0307405_10081139 | Ga0307405_100811392 | 112 |
| 419 | 3300031824 | Ga0307413_10108728 | Ga0307413_101087283 | 112 |
| 420 | 3300031824 | Ga0307413_10309152 | Ga0307413_103091522 | 112 |
| 421 | 3300031901 | Ga0307406_10018460 | Ga0307406_100184603 | 112 |
| 422 | 3300031911 | Ga0307412_10013027 | Ga0307412_100130273 | 112 |
| 423 | 3300031911 | Ga0307412_10027025 | Ga0307412_100270253 | 112 |
| 424 | 3300031911 | Ga0307412_11340905 | Ga0307412_113409051 | 112 |
| 425 | 3300032002 | Ga0307416_100238893 | Ga0307416_1002388933 | 112 |
| 426 | 3300032004 | Ga0307414_10051516 | Ga0307414_100515162 | 112 |
| 427 | 3300032004 | Ga0307414_11700222 | Ga0307414_117002221 | 112 |
| 428 | 3300032005 | Ga0307411_10046127 | Ga0307411_100461274 | 112 |
| 429 | 3300033180 | Ga0307510_10364876 | Ga0307510_103648762 | 112 |
| 430 | 3300035724 | Ga0373933_1144682 | Ga0373933_1144682_107_451 | 112 |
| 431 | 3300035725 | Ga0373947_0653781 | Ga0373947_0653781_71_415 | 112 |
| 432 | 3300037418 | Ga0395900_0049625 | Ga0395900_0049625_2229_2570 | 112 |
| 433 | 3300039453 | Ga0436362_0459754 | Ga0436362_0459754_48_389 | 112 |
| 434 | 3300041405 | Ga0439438_000617 | Ga0439438_000617_7459_7797 | 112 |
| 435 | 3300041405 | Ga0439438_001709 | Ga0439438_001709_7855_8193 | 112 |
| 436 | 3300041405 | Ga0439438_005876 | Ga0439438_005876_2551_2889 | 112 |
| 437 | 3300041405 | Ga0439438_015441 | Ga0439438_015441_1193_1531 | 112 |
| 438 | 3300041405 | Ga0439438_019173 | Ga0439438_019173_1278_1616 | 112 |
| 439 | 3300041407 | Ga0439447_004863 | Ga0439447_004863_2874_3212 | 112 |
| 440 | 3300041407 | Ga0439447_006699 | Ga0439447_006699_2551_2889 | 112 |
| 441 | 3300041407 | Ga0439447_019050 | Ga0439447_019050_811_1149 | 112 |
| 442 | 3300041411 | Ga0439466_0000656 | Ga0439466_0000656_9123_9461 | 112 |
| 443 | 3300041411 | Ga0439466_0013218 | Ga0439466_0013218_2610_2948 | 112 |
| 444 | 3300041411 | Ga0439466_0031810 | Ga0439466_0031810_301_639 | 112 |
| 445 | 3300041411 | Ga0439466_0068474 | Ga0439466_0068474_660_998 | 112 |
| 446 | 3300041460 | Ga0451802_0143070 | Ga0451802_0143070_226_564 | 112 |
| 447 | 3300041997 | Ga0439431_0000429 | Ga0439431_0000429_5064_5402 | 112 |
| 448 | 3300042004 | Ga0439445_0005090 | Ga0439445_0005090_1395_1733 | 112 |
| 449 | 3300042006 | Ga0439432_000568 | Ga0439432_000568_4061_4399 | 112 |
| 450 | 3300042006 | Ga0439432_001884 | Ga0439432_001884_6387_6725 | 112 |
| 451 | 3300042006 | Ga0439432_064942 | Ga0439432_064942_176_514 | 112 |
| 452 | 3300042006 | Ga0439432_076187 | Ga0439432_076187_36_374 | 112 |
| 453 | 3300042009 | Ga0439451_008450 | Ga0439451_008450_1130_1468 | 112 |
| 454 | 3300042009 | Ga0439451_008701 | Ga0439451_008701_1081_1419 | 112 |
| 455 | 3300042010 | Ga0439452_000363 | Ga0439452_000363_23781_24119 | 112 |
| 456 | 3300042010 | Ga0439452_004175 | Ga0439452_004175_2039_2377 | 112 |
| 457 | 3300042010 | Ga0439452_010976 | Ga0439452_010976_1416_1754 | 112 |
| 458 | 3300042010 | Ga0439452_016863 | Ga0439452_016863_861_1199 | 112 |
| 459 | 3300042010 | Ga0439452_054732 | Ga0439452_054732_469_846 | 112 |
| 460 | 3300042013 | Ga0439456_000065 | Ga0439456_000065_8908_9246 | 112 |
| 461 | 3300042013 | Ga0439456_010172 | Ga0439456_010172_1022_1360 | 112 |
| 462 | 3300042013 | Ga0439456_010707 | Ga0439456_010707_1109_1447 | 112 |
| 463 | 3300042013 | Ga0439456_014475 | Ga0439456_014475_1148_1486 | 112 |
| 464 | 3300042013 | Ga0439456_031273 | Ga0439456_031273_441_779 | 112 |
| 465 | 3300042016 | Ga0439463_000583 | Ga0439463_000583_3555_3893 | 112 |
| 466 | 3300042115 | Ga0450911_002207 | Ga0450911_002207_289_627 | 112 |
| 467 | 3300042121 | Ga0450919_002101 | Ga0450919_002101_2107_2445 | 112 |
| 468 | 3300042124 | Ga0450922_000436 | Ga0450922_000436_1298_1636 | 112 |
| 469 | 3300042137 | Ga0450902_000111 | Ga0450902_000111_1815_2153 | 112 |
| 470 | 3300042138 | Ga0450903_005870 | Ga0450903_005870_1166_1504 | 112 |
| 471 | 3300042147 | Ga0450910_000249 | Ga0450910_000249_4077_4415 | 112 |
| 472 | 3300042147 | Ga0450910_023484 | Ga0450910_023484_70_408 | 112 |
| 473 | 3300042156 | Ga0439446_0022272 | Ga0439446_0022272_973_1311 | 112 |
| 474 | 3300042184 | Ga0450908_108599 | Ga0450908_108599_45_383 | 112 |
| 475 | 3300042461 | Ga0439460_0068732 | Ga0439460_0068732_284_622 | 112 |
| 476 | 3300042531 | Ga0450918_086231 | Ga0450918_086231_100_438 | 112 |
| 477 | 3300042532 | Ga0450893_0000768 | Ga0450893_0000768_3243_3581 | 112 |
| 478 | 3300042532 | Ga0450893_0015117 | Ga0450893_0015117_857_1195 | 112 |
| 479 | 3300042876 | Ga0451577_0011709 | Ga0451577_0011709_1261_1605 | 112 |
| 480 | 3300042993 | Ga0439440_0003338 | Ga0439440_0003338_453_791 | 112 |
| 481 | 3300044673 | Ga0453683_0012263 | Ga0453683_0012263_4005_4349 | 112 |
| 482 | 3300044712 | Ga0453684_0031986 | Ga0453684_0031986_1290_1634 | 112 |
| 483 | 3300045051 | Ga0451576_0037783 | Ga0451576_0037783_3137_3487 | 112 |
| 484 | 3300045051 | Ga0451576_0217822 | Ga0451576_0217822_183_527 | 112 |
| 485 | 3300046452 | Ga0495617_001780 | Ga0495617_001780_4102_4440 | 112 |
| 486 | 3300046452 | Ga0495617_005964 | Ga0495617_005964_1091_1429 | 112 |
| 487 | 3300046452 | Ga0495617_027610 | Ga0495617_027610_1137_1475 | 112 |
| 488 | 3300046453 | Ga0495627_000236 | Ga0495627_000236_48799_49137 | 112 |
| 489 | 3300046453 | Ga0495627_000913 | Ga0495627_000913_8129_8467 | 112 |
| 490 | 3300046453 | Ga0495627_004413 | Ga0495627_004413_3531_3869 | 112 |
| 491 | 3300046453 | Ga0495627_019803 | Ga0495627_019803_689_1027 | 112 |
| 492 | 3300046453 | Ga0495627_024631 | Ga0495627_024631_607_945 | 112 |
| 493 | 3300046453 | Ga0495627_033993 | Ga0495627_033993_1170_1508 | 112 |
| 494 | 3300046454 | Ga0495592_0596636 | Ga0495592_0596636_108_488 | 112 |
| 495 | 3300046455 | Ga0495603_0127894 | Ga0495603_0127894_612_950 | 112 |
| 496 | 3300046457 | Ga0495590_0004856 | Ga0495590_0004856_3190_3528 | 112 |
| 497 | 3300046457 | Ga0495590_0006830 | Ga0495590_0006830_2903_3241 | 112 |
| 498 | 3300046457 | Ga0495590_0019724 | Ga0495590_0019724_2027_2365 | 112 |
| 499 | 3300046457 | Ga0495590_0328322 | Ga0495590_0328322_121_459 | 112 |
| 500 | 3300046457 | Ga0495590_0351324 | Ga0495590_0351324_194_532 | 112 |
| 501 | 3300046458 | Ga0495591_000262 | Ga0495591_000262_9304_9693 | 112 |
| 502 | 3300046458 | Ga0495591_000908 | Ga0495591_000908_5669_6007 | 112 |
| 503 | 3300046458 | Ga0495591_005704 | Ga0495591_005704_1172_1510 | 112 |
| 504 | 3300046458 | Ga0495591_077494 | Ga0495591_077494_206_544 | 112 |
| 505 | 3300046458 | Ga0495591_149772 | Ga0495591_149772_38_376 | 112 |
| 506 | 3300046459 | Ga0495629_0017879 | Ga0495629_0017879_4372_4752 | 112 |
| 507 | 3300046460 | Ga0495638_0017189 | Ga0495638_0017189_3267_3605 | 112 |
| 508 | 3300046460 | Ga0495638_0019683 | Ga0495638_0019683_3551_3889 | 112 |
| 509 | 3300046460 | Ga0495638_0033102 | Ga0495638_0033102_937_1275 | 112 |
| 510 | 3300046460 | Ga0495638_0059044 | Ga0495638_0059044_846_1184 | 112 |
| 511 | 3300046460 | Ga0495638_0364930 | Ga0495638_0364930_385_723 | 112 |
| 512 | 3300046463 | Ga0495653_0003057 | Ga0495653_0003057_660_998 | 112 |
| 513 | 3300046463 | Ga0495653_0022711 | Ga0495653_0022711_1085_1465 | 112 |
| 514 | 3300046463 | Ga0495653_0023453 | Ga0495653_0023453_1270_1608 | 112 |
| 515 | 3300046463 | Ga0495653_0078617 | Ga0495653_0078617_2075_2413 | 112 |
| 516 | 3300046471 | Ga0495650_0001753 | Ga0495650_0001753_8145_8483 | 112 |
| 517 | 3300046471 | Ga0495650_0011649 | Ga0495650_0011649_3708_4046 | 112 |
| 518 | 3300046471 | Ga0495650_0015510 | Ga0495650_0015510_3103_3441 | 112 |
| 519 | 3300046471 | Ga0495650_0041618 | Ga0495650_0041618_470_808 | 112 |
| 520 | 3300046473 | Ga0495582_0012439 | Ga0495582_0012439_3180_3560 | 112 |
| 521 | 3300046474 | Ga0495605_0000305 | Ga0495605_0000305_43992_44330 | 112 |
| 522 | 3300046474 | Ga0495605_0004768 | Ga0495605_0004768_2828_3166 | 112 |
| 523 | 3300046474 | Ga0495605_0300191 | Ga0495605_0300191_267_605 | 112 |
| 524 | 3300046475 | Ga0495639_0004444 | Ga0495639_0004444_1406_1786 | 112 |
| 525 | 3300046491 | Ga0495584_0001213 | Ga0495584_0001213_10637_10975 | 112 |
| 526 | 3300046491 | Ga0495584_0056028 | Ga0495584_0056028_809_1147 | 112 |
| 527 | 3300046491 | Ga0495584_0179772 | Ga0495584_0179772_11_349 | 112 |
| 528 | 3300046492 | Ga0495585_0002376 | Ga0495585_0002376_8398_8736 | 112 |
| 529 | 3300046492 | Ga0495585_0004001 | Ga0495585_0004001_1488_1826 | 112 |
| 530 | 3300046492 | Ga0495585_0007958 | Ga0495585_0007958_4784_5122 | 112 |
| 531 | 3300046492 | Ga0495585_0114194 | Ga0495585_0114194_718_1056 | 112 |
| 532 | 3300046499 | Ga0495594_0313651 | Ga0495594_0313651_32_412 | 112 |
| 533 | 3300046501 | Ga0495607_0001512 | Ga0495607_0001512_8209_8547 | 112 |
| 534 | 3300046501 | Ga0495607_0001663 | Ga0495607_0001663_12386_12724 | 112 |
| 535 | 3300046501 | Ga0495607_0001685 | Ga0495607_0001685_9553_9942 | 112 |
| 536 | 3300046501 | Ga0495607_0001747 | Ga0495607_0001747_4757_5095 | 112 |
| 537 | 3300046501 | Ga0495607_0002473 | Ga0495607_0002473_7791_8129 | 112 |
| 538 | 3300046501 | Ga0495607_0047403 | Ga0495607_0047403_962_1300 | 112 |
| 539 | 3300046501 | Ga0495607_0050932 | Ga0495607_0050932_1927_2265 | 112 |
| 540 | 3300046501 | Ga0495607_0104096 | Ga0495607_0104096_80_418 | 112 |
| 541 | 3300046501 | Ga0495607_0163611 | Ga0495607_0163611_272_610 | 112 |
| 542 | 3300046501 | Ga0495607_0251164 | Ga0495607_0251164_298_636 | 112 |
| 543 | 3300046501 | Ga0495607_0507291 | Ga0495607_0507291_123_461 | 112 |
| 544 | 3300046506 | Ga0495583_0002263 | Ga0495583_0002263_8263_8601 | 112 |
| 545 | 3300046506 | Ga0495583_0003780 | Ga0495583_0003780_2153_2512 | 112 |
| 546 | 3300046506 | Ga0495583_0006029 | Ga0495583_0006029_3802_4140 | 112 |
| 547 | 3300046506 | Ga0495583_0273942 | Ga0495583_0273942_22_360 | 112 |
| 548 | 3300046507 | Ga0495606_0000785 | Ga0495606_0000785_39961_40299 | 112 |
| 549 | 3300046507 | Ga0495606_0003478 | Ga0495606_0003478_12598_12936 | 112 |
| 550 | 3300046507 | Ga0495606_0023130 | Ga0495606_0023130_3080_3418 | 112 |
| 551 | 3300046507 | Ga0495606_0069559 | Ga0495606_0069559_720_1058 | 112 |
| 552 | 3300046512 | Ga0495610_0010636 | Ga0495610_0010636_3766_4104 | 112 |
| 553 | 3300046512 | Ga0495610_0038056 | Ga0495610_0038056_1172_1510 | 112 |
| 554 | 3300046513 | Ga0495616_0001961 | Ga0495616_0001961_4753_5091 | 112 |
| 555 | 3300046513 | Ga0495616_0163522 | Ga0495616_0163522_471_809 | 112 |
| 556 | 3300046513 | Ga0495616_0194365 | Ga0495616_0194365_97_435 | 112 |
| 557 | 3300046515 | Ga0495620_0000033 | Ga0495620_0000033_8312_8650 | 112 |
| 558 | 3300046515 | Ga0495620_0014188 | Ga0495620_0014188_2575_2913 | 112 |
| 559 | 3300046515 | Ga0495620_0033940 | Ga0495620_0033940_814_1152 | 112 |
| 560 | 3300046516 | Ga0495628_0502412 | Ga0495628_0502412_318_656 | 112 |
| 561 | 3300046517 | Ga0495630_0019938 | Ga0495630_0019938_1022_1360 | 112 |
| 562 | 3300046517 | Ga0495630_0028337 | Ga0495630_0028337_3515_3895 | 112 |
| 563 | 3300046518 | Ga0495631_0001408 | Ga0495631_0001408_11938_12276 | 112 |
| 564 | 3300046518 | Ga0495631_0006806 | Ga0495631_0006806_1155_1493 | 112 |
| 565 | 3300046518 | Ga0495631_0044439 | Ga0495631_0044439_1607_1945 | 112 |
| 566 | 3300046519 | Ga0495632_0000399 | Ga0495632_0000399_8316_8654 | 112 |
| 567 | 3300046519 | Ga0495632_0001643 | Ga0495632_0001643_13211_13549 | 112 |
| 568 | 3300046519 | Ga0495632_0004604 | Ga0495632_0004604_748_1086 | 112 |
| 569 | 3300046519 | Ga0495632_0006335 | Ga0495632_0006335_1985_2323 | 112 |
| 570 | 3300046519 | Ga0495632_0008067 | Ga0495632_0008067_853_1191 | 112 |
| 571 | 3300046519 | Ga0495632_0012185 | Ga0495632_0012185_3779_4117 | 112 |
| 572 | 3300046519 | Ga0495632_0022973 | Ga0495632_0022973_2689_3027 | 112 |
| 573 | 3300046519 | Ga0495632_0030851 | Ga0495632_0030851_1528_1866 | 112 |
| 574 | 3300046519 | Ga0495632_0059406 | Ga0495632_0059406_36_374 | 112 |
| 575 | 3300046519 | Ga0495632_0060365 | Ga0495632_0060365_376_714 | 112 |
| 576 | 3300046519 | Ga0495632_0089548 | Ga0495632_0089548_36_374 | 112 |
| 577 | 3300046519 | Ga0495632_0160037 | Ga0495632_0160037_213_551 | 112 |
| 578 | 3300046520 | Ga0495637_0001314 | Ga0495637_0001314_6696_7034 | 112 |
| 579 | 3300046520 | Ga0495637_0002210 | Ga0495637_0002210_2339_2677 | 112 |
| 580 | 3300046520 | Ga0495637_0002604 | Ga0495637_0002604_8547_8936 | 112 |
| 581 | 3300046520 | Ga0495637_0011937 | Ga0495637_0011937_2673_3011 | 112 |
| 582 | 3300046520 | Ga0495637_0012382 | Ga0495637_0012382_2426_2764 | 112 |
| 583 | 3300046520 | Ga0495637_0015609 | Ga0495637_0015609_1921_2259 | 112 |
| 584 | 3300046520 | Ga0495637_0017272 | Ga0495637_0017272_1444_1782 | 112 |
| 585 | 3300046520 | Ga0495637_0025612 | Ga0495637_0025612_2087_2425 | 112 |
| 586 | 3300046520 | Ga0495637_0065262 | Ga0495637_0065262_71_409 | 112 |
| 587 | 3300046520 | Ga0495637_0110850 | Ga0495637_0110850_28_366 | 112 |
| 588 | 3300046522 | Ga0495643_0001356 | Ga0495643_0001356_14151_14489 | 112 |
| 589 | 3300046522 | Ga0495643_0004576 | Ga0495643_0004576_4807_5145 | 112 |
| 590 | 3300046522 | Ga0495643_0029284 | Ga0495643_0029284_1906_2244 | 112 |
| 591 | 3300046523 | Ga0495644_0003429 | Ga0495644_0003429_4971_5309 | 112 |
| 592 | 3300046524 | Ga0495648_0002328 | Ga0495648_0002328_8160_8498 | 112 |
| 593 | 3300046524 | Ga0495648_0002836 | Ga0495648_0002836_6837_7175 | 112 |
| 594 | 3300046524 | Ga0495648_0009421 | Ga0495648_0009421_4750_5088 | 112 |
| 595 | 3300046524 | Ga0495648_0012155 | Ga0495648_0012155_1457_1795 | 112 |
| 596 | 3300046524 | Ga0495648_0071018 | Ga0495648_0071018_1249_1587 | 112 |
| 597 | 3300046524 | Ga0495648_0100587 | Ga0495648_0100587_1171_1509 | 112 |
| 598 | 3300046524 | Ga0495648_0160601 | Ga0495648_0160601_93_431 | 112 |
| 599 | 3300046526 | Ga0495666_0009296 | Ga0495666_0009296_1355_1735 | 112 |
| 600 | 3300046526 | Ga0495666_0009803 | Ga0495666_0009803_3471_3809 | 112 |
| 601 | 3300046526 | Ga0495666_0021846 | Ga0495666_0021846_2203_2541 | 112 |
| 602 | 3300046526 | Ga0495666_0376683 | Ga0495666_0376683_90_428 | 112 |
| 603 | 3300046528 | Ga0495642_0000910 | Ga0495642_0000910_4616_4954 | 112 |
| 604 | 3300046530 | Ga0495654_0001804 | Ga0495654_0001804_5920_6258 | 112 |
| 605 | 3300046530 | Ga0495654_0003274 | Ga0495654_0003274_182_520 | 112 |
| 606 | 3300046530 | Ga0495654_0007411 | Ga0495654_0007411_4710_5048 | 112 |
| 607 | 3300046530 | Ga0495654_0009251 | Ga0495654_0009251_3279_3617 | 112 |
| 608 | 3300046530 | Ga0495654_0020033 | Ga0495654_0020033_1109_1447 | 112 |
| 609 | 3300046530 | Ga0495654_0028422 | Ga0495654_0028422_1286_1624 | 112 |
| 610 | 3300046530 | Ga0495654_0040865 | Ga0495654_0040865_1006_1344 | 112 |
| 611 | 3300046530 | Ga0495654_0123134 | Ga0495654_0123134_280_618 | 112 |
| 612 | 3300046530 | Ga0495654_0303987 | Ga0495654_0303987_54_392 | 112 |
| 613 | 3300046535 | Ga0495586_0149539 | Ga0495586_0149539_393_773 | 112 |
| 614 | 3300046535 | Ga0495586_0469407 | Ga0495586_0469407_374_712 | 112 |
| 615 | 3300046536 | Ga0495587_0010198 | Ga0495587_0010198_2075_2413 | 112 |
| 616 | 3300046536 | Ga0495587_0358227 | Ga0495587_0358227_288_668 | 112 |
| 617 | 3300046538 | Ga0495609_0000226 | Ga0495609_0000226_46539_46877 | 112 |
| 618 | 3300046538 | Ga0495609_0005057 | Ga0495609_0005057_4765_5103 | 112 |
| 619 | 3300046538 | Ga0495609_0005960 | Ga0495609_0005960_4771_5109 | 112 |
| 620 | 3300046538 | Ga0495609_0025842 | Ga0495609_0025842_1561_1899 | 112 |
| 621 | 3300046538 | Ga0495609_0026423 | Ga0495609_0026423_462_800 | 112 |
| 622 | 3300046538 | Ga0495609_0058308 | Ga0495609_0058308_35_373 | 112 |
| 623 | 3300046538 | Ga0495609_0070746 | Ga0495609_0070746_434_772 | 112 |
| 624 | 3300046542 | Ga0495597_0000235 | Ga0495597_0000235_9186_9575 | 112 |
| 625 | 3300046542 | Ga0495597_0006339 | Ga0495597_0006339_3717_4055 | 112 |
| 626 | 3300046542 | Ga0495597_0009917 | Ga0495597_0009917_4205_4543 | 112 |
| 627 | 3300046542 | Ga0495597_0016368 | Ga0495597_0016368_2295_2633 | 112 |
| 628 | 3300046543 | Ga0495645_0192699 | Ga0495645_0192699_302_682 | 112 |
| 629 | 3300046543 | Ga0495645_0493087 | Ga0495645_0493087_18_356 | 112 |
| 630 | 3300046557 | Ga0495622_0005622 | Ga0495622_0005622_1157_1495 | 112 |
| 631 | 3300046557 | Ga0495622_0093996 | Ga0495622_0093996_406_744 | 112 |
| 632 | 3300046558 | Ga0495633_0040855 | Ga0495633_0040855_1132_1470 | 112 |
| 633 | 3300046616 | Ga0495668_0015584 | Ga0495668_0015584_2940_3278 | 112 |
| 634 | 3300046616 | Ga0495668_0192940 | Ga0495668_0192940_224_562 | 112 |
| 635 | 3300046642 | Ga0495634_0017298 | Ga0495634_0017298_1182_1520 | 112 |
| 636 | 3300046642 | Ga0495634_0026732 | Ga0495634_0026732_2934_3314 | 112 |
| 637 | 3300046648 | Ga0495611_0115710 | Ga0495611_0115710_314_652 | 112 |
| 638 | 3300046660 | Ga0495625_0012667 | Ga0495625_0012667_828_1166 | 112 |
| 639 | 3300046660 | Ga0495625_0340579 | Ga0495625_0340579_131_475 | 112 |
| 640 | 3300046663 | Ga0495635_0018083 | Ga0495635_0018083_1014_1352 | 112 |
| 641 | 3300046663 | Ga0495635_0021873 | Ga0495635_0021873_2737_3117 | 112 |
| 642 | 3300046665 | Ga0495661_0000320 | Ga0495661_0000320_8213_8551 | 112 |
| 643 | 3300046665 | Ga0495661_0000340 | Ga0495661_0000340_42921_43259 | 112 |
| 644 | 3300046665 | Ga0495661_0004957 | Ga0495661_0004957_2440_2778 | 112 |
| 645 | 3300046665 | Ga0495661_0144767 | Ga0495661_0144767_257_595 | 112 |
| 646 | 3300046665 | Ga0495661_0276123 | Ga0495661_0276123_71_409 | 112 |
| 647 | 3300046675 | Ga0495657_0069879 | Ga0495657_0069879_1310_1648 | 112 |
| 648 | 3300046679 | Ga0495623_0022106 | Ga0495623_0022106_155_493 | 112 |
| 649 | 3300046680 | Ga0495646_0077615 | Ga0495646_0077615_275_655 | 112 |
| 650 | 3300046680 | Ga0495646_0114860 | Ga0495646_0114860_33_371 | 112 |
| 651 | 3300046689 | Ga0495613_0012188 | Ga0495613_0012188_1217_1597 | 112 |
| 652 | 3300046689 | Ga0495613_0251426 | Ga0495613_0251426_377_715 | 112 |
| 653 | 3300046691 | Ga0495670_0008703 | Ga0495670_0008703_4613_4951 | 112 |
| 654 | 3300046691 | Ga0495670_0227285 | Ga0495670_0227285_156_494 | 112 |
| 655 | 3300046691 | Ga0495670_0483248 | Ga0495670_0483248_244_582 | 112 |
| 656 | 3300046692 | Ga0495671_0001637 | Ga0495671_0001637_9421_9759 | 112 |
| 657 | 3300046692 | Ga0495671_0012382 | Ga0495671_0012382_2525_2863 | 112 |
| 658 | 3300046692 | Ga0495671_0016806 | Ga0495671_0016806_1136_1474 | 112 |
| 659 | 3300046692 | Ga0495671_0027263 | Ga0495671_0027263_334_672 | 112 |
| 660 | 3300046692 | Ga0495671_0084299 | Ga0495671_0084299_110_448 | 112 |
| 661 | 3300046692 | Ga0495671_0117479 | Ga0495671_0117479_173_511 | 112 |
| 662 | 3300046692 | Ga0495671_0515418 | Ga0495671_0515418_77_415 | 112 |
| 663 | 3300046694 | Ga0495649_0001345 | Ga0495649_0001345_13572_13910 | 112 |
| 664 | 3300046694 | Ga0495649_0001639 | Ga0495649_0001639_8400_8738 | 112 |
| 665 | 3300046694 | Ga0495649_0035144 | Ga0495649_0035144_2368_2706 | 112 |
| 666 | 3300046694 | Ga0495649_0129357 | Ga0495649_0129357_255_593 | 112 |
| 667 | 3300046694 | Ga0495649_0188277 | Ga0495649_0188277_464_802 | 112 |
| 668 | 3300046794 | Ga0495589_0000890 | Ga0495589_0000890_13421_13759 | 112 |
| 669 | 3300046794 | Ga0495589_0080322 | Ga0495589_0080322_93_431 | 112 |
| 670 | 3300046809 | Ga0495600_0087300 | Ga0495600_0087300_538_876 | 112 |
| 671 | 3300046810 | Ga0495660_0004190 | Ga0495660_0004190_6546_6935 | 112 |
| 672 | 3300046810 | Ga0495660_0010112 | Ga0495660_0010112_486_824 | 112 |
| 673 | 3300046810 | Ga0495660_0012324 | Ga0495660_0012324_1152_1490 | 112 |
| 674 | 3300046810 | Ga0495660_0059096 | Ga0495660_0059096_882_1220 | 112 |
| 675 | 3300046810 | Ga0495660_0127326 | Ga0495660_0127326_869_1207 | 112 |
| 676 | 3300046810 | Ga0495660_0138648 | Ga0495660_0138648_154_492 | 112 |
| 677 | 3300046810 | Ga0495660_0380900 | Ga0495660_0380900_213_551 | 112 |
| 678 | 3300047315 | Ga0495581_0022649 | Ga0495581_0022649_266_646 | 112 |
| 679 | 3300047317 | Ga0495604_0009657 | Ga0495604_0009657_1340_1678 | 112 |
| 680 | 3300047318 | Ga0495636_0015323 | Ga0495636_0015323_793_1131 | 112 |
| 681 | 3300047319 | Ga0495674_0042227 | Ga0495674_0042227_145_483 | 112 |
| 682 | 3300047320 | Ga0495672_0001307 | Ga0495672_0001307_4209_4547 | 112 |
| 683 | 3300047320 | Ga0495672_0003882 | Ga0495672_0003882_7464_7802 | 112 |
| 684 | 3300047320 | Ga0495672_0008309 | Ga0495672_0008309_3794_4249 | 112 |
| 685 | 3300047320 | Ga0495672_0013691 | Ga0495672_0013691_895_1233 | 112 |
| 686 | 3300047320 | Ga0495672_0019008 | Ga0495672_0019008_1696_2085 | 112 |
| 687 | 3300047320 | Ga0495672_0048088 | Ga0495672_0048088_1254_1592 | 112 |
| 688 | 3300047320 | Ga0495672_0122800 | Ga0495672_0122800_66_404 | 112 |
| 689 | 3300047320 | Ga0495672_0139526 | Ga0495672_0139526_915_1253 | 112 |
| 690 | 3300047321 | Ga0495676_0359831 | Ga0495676_0359831_563_901 | 112 |
| 691 | 3300047322 | Ga0495680_0023663 | Ga0495680_0023663_3544_3882 | 112 |
| 692 | 3300047322 | Ga0495680_0027415 | Ga0495680_0027415_856_1236 | 112 |
| 693 | 3300047322 | Ga0495680_0064963 | Ga0495680_0064963_2047_2385 | 112 |
| 694 | 3300047322 | Ga0495680_0116414 | Ga0495680_0116414_1251_1589 | 112 |
| 695 | 3300047323 | Ga0495683_0000016 | Ga0495683_0000016_8257_8595 | 112 |
| 696 | 3300047323 | Ga0495683_0005198 | Ga0495683_0005198_3470_3808 | 112 |
| 697 | 3300047323 | Ga0495683_0006784 | Ga0495683_0006784_4804_5142 | 112 |
| 698 | 3300047443 | Ga0495687_003652 | Ga0495687_003652_5874_6212 | 112 |
| 699 | 3300047444 | Ga0495675_0025502 | Ga0495675_0025502_1027_1365 | 112 |
| 700 | 3300047444 | Ga0495675_0041542 | Ga0495675_0041542_908_1246 | 112 |
| 701 | 3300047444 | Ga0495675_0171216 | Ga0495675_0171216_496_876 | 112 |
| 702 | 3300047447 | Ga0495685_002011 | Ga0495685_002011_4659_4997 | 112 |
| 703 | 3300047469 | Ga0495673_0000789 | Ga0495673_0000789_20162_20500 | 112 |
| 704 | 3300047469 | Ga0495673_0002977 | Ga0495673_0002977_3684_4022 | 112 |
| 705 | 3300047469 | Ga0495673_0008171 | Ga0495673_0008171_1184_1522 | 112 |
| 706 | 3300047469 | Ga0495673_0009275 | Ga0495673_0009275_3136_3474 | 112 |
| 707 | 3300047469 | Ga0495673_0009999 | Ga0495673_0009999_1817_2155 | 112 |
| 708 | 3300047469 | Ga0495673_0249402 | Ga0495673_0249402_135_473 | 112 |
| 709 | 3300047470 | Ga0495681_0008902 | Ga0495681_0008902_1158_1496 | 112 |
| 710 | 3300047470 | Ga0495681_0009457 | Ga0495681_0009457_882_1262 | 112 |
| 711 | 3300047470 | Ga0495681_0014126 | Ga0495681_0014126_3100_3438 | 112 |
| 712 | 3300047470 | Ga0495681_0047354 | Ga0495681_0047354_1265_1603 | 112 |
| 713 | 3300047470 | Ga0495681_0078697 | Ga0495681_0078697_1125_1463 | 112 |
| 714 | 3300047470 | Ga0495681_0219869 | Ga0495681_0219869_411_749 | 112 |
| 715 | 3300047471 | Ga0495684_0025570 | Ga0495684_0025570_2999_3337 | 112 |
| 716 | 3300047472 | Ga0495686_0011284 | Ga0495686_0011284_1192_1530 | 112 |
| 717 | 3300047472 | Ga0495686_0489003 | Ga0495686_0489003_77_466 | 112 |
| 718 | 3300047673 | Ga0495593_0082409 | Ga0495593_0082409_1216_1554 | 112 |
| 719 | 3300047673 | Ga0495593_0169587 | Ga0495593_0169587_550_888 | 112 |
| 720 | 3300048088 | Ga0495602_0316823 | Ga0495602_0316823_676_1014 | 112 |
| 721 | 3300048091 | Ga0495626_0004436 | Ga0495626_0004436_4749_5087 | 112 |
| 722 | 3300048091 | Ga0495626_0010993 | Ga0495626_0010993_1149_1487 | 112 |
| 723 | 3300048091 | Ga0495626_0036093 | Ga0495626_0036093_1932_2270 | 112 |
| 724 | 3300048091 | Ga0495626_0085196 | Ga0495626_0085196_915_1253 | 112 |
| 725 | 3300048905 | Ga0496102_0003362 | Ga0496102_0003362_9559_9897 | 112 |
| 726 | 3300048906 | Ga0496103_0011982 | Ga0496103_0011982_1226_1564 | 112 |
| 727 | 3300048913 | Ga0496110_0082470 | Ga0496110_0082470_1014_1352 | 112 |
| 728 | 3300048914 | Ga0496111_0606560 | Ga0496111_0606560_162_500 | 112 |
| 729 | 3300048915 | Ga0496112_0189050 | Ga0496112_0189050_433_771 | 112 |
| 730 | 3300048917 | Ga0496114_0842127 | Ga0496114_0842127_426_764 | 112 |
| 731 | 3300048919 | Ga0496116_0006223 | Ga0496116_0006223_1186_1524 | 112 |
| 732 | 3300048919 | Ga0496116_0030580 | Ga0496116_0030580_2463_2801 | 112 |
| 733 | 3300048919 | Ga0496116_0116898 | Ga0496116_0116898_452_790 | 112 |
| 734 | 3300048920 | Ga0496117_0003735 | Ga0496117_0003735_1970_2308 | 112 |
| 735 | 3300048920 | Ga0496117_0010816 | Ga0496117_0010816_1938_2276 | 112 |
| 736 | 3300048920 | Ga0496117_0023680 | Ga0496117_0023680_3557_3895 | 112 |
| 737 | 3300048920 | Ga0496117_0059992 | Ga0496117_0059992_1221_1559 | 112 |
| 738 | 3300048920 | Ga0496117_0078071 | Ga0496117_0078071_1836_2174 | 112 |
| 739 | 3300048920 | Ga0496117_0116907 | Ga0496117_0116907_274_612 | 112 |
| 740 | 3300048921 | Ga0496118_0002905 | Ga0496118_0002905_13160_13498 | 112 |
| 741 | 3300048921 | Ga0496118_0034166 | Ga0496118_0034166_3466_3804 | 112 |
| 742 | 3300048921 | Ga0496118_0034853 | Ga0496118_0034853_155_493 | 112 |
| 743 | 3300048922 | Ga0496119_0000071 | Ga0496119_0000071_7605_7943 | 112 |
| 744 | 3300048922 | Ga0496119_0052534 | Ga0496119_0052534_1813_2151 | 112 |
| 745 | 3300048923 | Ga0496120_0004847 | Ga0496120_0004847_7240_7578 | 112 |
| 746 | 3300048924 | Ga0496121_0065402 | Ga0496121_0065402_1524_1862 | 112 |
| 747 | 3300048924 | Ga0496121_0157986 | Ga0496121_0157986_611_949 | 112 |
| 748 | 3300048924 | Ga0496121_0162368 | Ga0496121_0162368_386_724 | 112 |
| 749 | 3300048924 | Ga0496121_0339995 | Ga0496121_0339995_412_750 | 112 |
| 750 | 3300048924 | Ga0496121_0887112 | Ga0496121_0887112_109_447 | 112 |
| 751 | 3300048925 | Ga0496122_0003639 | Ga0496122_0003639_11457_11795 | 112 |
| 752 | 3300048925 | Ga0496122_0204105 | Ga0496122_0204105_170_508 | 112 |
| 753 | 3300048926 | Ga0496123_0002904 | Ga0496123_0002904_11467_11805 | 112 |
| 754 | 3300048926 | Ga0496123_0219271 | Ga0496123_0219271_336_674 | 112 |
| 755 | 3300048926 | Ga0496123_0254352 | Ga0496123_0254352_355_693 | 112 |
| 756 | 3300048927 | Ga0496124_0000730 | Ga0496124_0000730_45323_45661 | 112 |
| 757 | 3300048927 | Ga0496124_0014510 | Ga0496124_0014510_2793_3131 | 112 |
| 758 | 3300048927 | Ga0496124_0052285 | Ga0496124_0052285_658_996 | 112 |
| 759 | 3300048927 | Ga0496124_0087764 | Ga0496124_0087764_1978_2316 | 112 |
| 760 | 3300048927 | Ga0496124_0168466 | Ga0496124_0168466_1021_1359 | 112 |
| 761 | 3300048928 | Ga0496125_0001109 | Ga0496125_0001109_8393_8731 | 112 |
| 762 | 3300048929 | Ga0496126_0167444 | Ga0496126_0167444_379_717 | 112 |
| 763 | 3300048929 | Ga0496126_0255649 | Ga0496126_0255649_865_1203 | 112 |
| 764 | 3300048929 | Ga0496126_0255673 | Ga0496126_0255673_614_952 | 112 |
| 765 | 3300049459 | Ga0495678_001974 | Ga0495678_001974_8246_8584 | 112 |
| 766 | 3300049459 | Ga0495678_002020 | Ga0495678_002020_9444_9782 | 112 |
| 767 | 3300049459 | Ga0495678_010151 | Ga0495678_010151_1174_1512 | 112 |
| 768 | 3300049459 | Ga0495678_021034 | Ga0495678_021034_1804_2142 | 112 |
| 769 | 3300049460 | Ga0495682_0000198 | Ga0495682_0000198_40102_40440 | 112 |
| 770 | 3300049460 | Ga0495682_0004844 | Ga0495682_0004844_1185_1523 | 112 |
| 771 | 3300049460 | Ga0495682_0023086 | Ga0495682_0023086_1570_1908 | 112 |
| 772 | 3300049530 | Ga0501314_025131 | Ga0501314_025131_202_540 | 112 |
| 773 | 3300049539 | Ga0501323_000644 | Ga0501323_000644_2071_2409 | 112 |
| 774 | 3300049568 | Ga0501031_0810835 | Ga0501031_0810835_93_437 | 112 |
| 775 | 3300049572 | Ga0501036_0247379 | Ga0501036_0247379_783_1133 | 112 |
| 776 | 3300049576 | Ga0501040_0803102 | Ga0501040_0803102_122_472 | 112 |
| 777 | 3300049583 | Ga0501067_0014698 | Ga0501067_0014698_1846_2190 | 112 |
| 778 | 3300049584 | Ga0501068_0148253 | Ga0501068_0148253_246_590 | 112 |
| 779 | 3300049585 | Ga0501069_0143596 | Ga0501069_0143596_228_572 | 112 |
| 780 | 3300049665 | Ga0501227_018988 | Ga0501227_018988_758_1096 | 112 |
| 781 | 3300049680 | Ga0501250_098197 | Ga0501250_098197_152_490 | 112 |
| 782 | 3300049741 | Ga0501079_0899878 | Ga0501079_0899878_327_671 | 112 |
| 783 | 3300049743 | Ga0501081_1491515 | Ga0501081_1491515_81_425 | 112 |
| 784 | 3300049766 | Ga0501269_005839 | Ga0501269_005839_473_811 | 112 |
| 785 | 3300049853 | Ga0501226_001532 | Ga0501226_001532_1075_1413 | 112 |
| 786 | 3300050489 | nmdc:mga03683_73603_c1 | nmdc:mga03683_73603_c1_579_917 | 112 |
| 787 | 3300050489 | nmdc:mga03683_98987_c1 | nmdc:mga03683_98987_c1_15_353 | 112 |
| 788 | 3300050491 | nmdc:mga00v17_279842_c1 | nmdc:mga00v17_279842_c1_32_370 | 112 |
| 789 | 3300050515 | nmdc:mga0a205_67097_c1 | nmdc:mga0a205_67097_c1_1870_2214 | 112 |
| 790 | 3300053111 | Ga0500572_001757 | Ga0500572_001757_4106_4444 | 112 |
| 791 | 3300053138 | Ga0500564_104323 | Ga0500564_104323_283_624 | 112 |
| 792 | 3300053140 | Ga0500573_0044851 | Ga0500573_0044851_1417_1755 | 112 |
| 793 | 3300053142 | Ga0500577_0118775 | Ga0500577_0118775_457_795 | 112 |
| 794 | 3300053145 | Ga0500586_168579 | Ga0500586_168579_68_412 | 112 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uvm-assembly1.cif.gz_A | hit family hydrolase from clostridium thermocellum cth-393 | 0.9735 | 2 | 108 |
| 3o1c-assembly1.cif.gz_A-2 | high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine | 0.9699 | 1 | 112 |
| 3qgz-assembly1.cif.gz_A | re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine | 0.9696 | 1 | 112 |
| 6j65-assembly1.cif.gz_B | crystal structure of human hint1 mutant complexing with ap4a ii | 0.9696 | 1 | 112 |
| 3o1x-assembly1.cif.gz_A-2 | high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c84a mutant from rabbit complexed with adenosine | 0.969 | 1 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8STA5_22_150_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9699 | 2 | 112 | 3.30.428.10 |
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9684 | 2 | 108 | 3.30.428.10 |
| 1kpcB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9633 | 2 | 112 | 3.30.428.10 |
| af_I1MGX8_45_178_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9594 | 1 | 112 | 3.30.428.10 |
| 3n1sB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9584 | 1 | 108 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q08JU7-F1-model_v4 | Protein kinase c inhibitor | 0.9939 | 13 | 103 |
GO:0016301
|
| AF-A0A5F4VTR7-F1-model_v4 | HIT domain-containing protein | 0.988 | 1 | 108 |
GO:0000166
GO:0003824 |
| AF-A0A5S9PID5-F1-model_v4 | Purine nucleoside phosphoramidase (EC 3.9.1.-) | 0.9869 | 1 | 109 |
GO:0016787
|
| AF-A0A7W0JED7-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9865 | 2 | 108 |
GO:0003824
|
| AF-A0A2K6V7R2-F1-model_v4 | HIT domain-containing protein | 0.9863 | 5 | 101 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar