F481086
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 794 | 476 | 663 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10068963|Ga0070709_100689632 |
| Length | 287 |
| Sequence | MFRSRSIKAFPSGAEGGSRPENAPHRKSRARFRWHRNGRGSGHRIVLTGAMLAIVSVASGCSSIDRLSQIGEQPKLNAIENPTAQPGYKPVQMPMPKPETVSYNANSLWRNGSRAFFKDQRAARIGDILTVTVNITDKANIANETQRSRTSKEDSGITDFIGAKTLGAQAQKVLPGRILTADSTASTDGKGSVNRQEALQTNVAAVVTQILPNGNLVVEGKQEIRVNFEIRELVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQLTDVQQPRYGQQVMDVLLPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 13 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 14 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2791355199 | |||
| 17 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 18 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 19 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 20 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 21 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 22 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 23 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 24 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 25 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 26 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 27 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 28 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 29 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 30 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 31 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 32 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 33 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 34 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 35 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 36 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 37 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 38 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 39 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 40 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 41 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 42 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 43 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 44 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 45 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 46 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 47 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 48 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 49 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 50 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 51 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 52 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 53 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 54 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 55 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 56 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 57 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 58 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 59 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 60 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 61 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 62 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 63 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 64 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 65 | 2904699407 | |||
| 66 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 67 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 68 | 2906610324 | |||
| 69 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 70 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 71 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 72 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 73 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 74 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 75 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 76 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 77 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 78 | 2922425934 | |||
| 79 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 80 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 81 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 82 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 83 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 84 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 85 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 86 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 87 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 88 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 89 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 90 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 91 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 92 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 93 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 94 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 95 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 96 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 97 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 98 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 99 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 100 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 101 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 102 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 103 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 104 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 105 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 106 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 107 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 108 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 109 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 110 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 111 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 112 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 133 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 137 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 139 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 140 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 145 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 146 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 147 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 151 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 152 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 153 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 155 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 159 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 160 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 161 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 162 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 164 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 165 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 166 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 167 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 168 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 178 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 181 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 182 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 192 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 193 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 194 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 195 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 196 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 197 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 254 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 267 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 292 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 376 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 377 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 421 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 422 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 423 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 426 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 428 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 432 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 433 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 436 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 437 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 439 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 440 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 444 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 446 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 448 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 450 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 451 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 452 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 453 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 454 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 455 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 456 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 457 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 458 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 459 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 460 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 461 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 462 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 463 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 464 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 465 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 466 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 467 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 468 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 469 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 470 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 471 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 472 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 473 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 474 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 475 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 476 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.92 |
| Metatranscriptomes | 0 |
| Isolates | 16.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.56 |
| Nodule | 12.97 |
| Rhizoplane | 5.67 |
| Rhizosphere | 62.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002642 | 3300001979 | Bacteria | 8071 |
| 2 | JGI24739J22299_10015078 | 3300001989 | Bacteria | 2810 |
| 3 | JGI24737J22298_10011358 | 3300001990 | Bacteria | 2920 |
| 4 | JGI24735J21928_10082505 | 3300002067 | Bacteria | 921 |
| 5 | JGI25165J46597_1006803 | 3300003214 | Bacteria | 1982 |
| 6 | JGI25153J46596_10000257 | 3300003215 | Bacteria | 42775 |
| 7 | JGI25153J46596_10008206 | 3300003215 | Bacteria | 5024 |
| 8 | JGI25153J46596_10015237 | 3300003215 | Bacteria | 3146 |
| 9 | JGI25160J50197_1003851 | 3300003354 | Bacteria | 6590 |
| 10 | JGI25404J52841_10042226 | 3300003659 | Bacteria | 965 |
| 11 | Ga0070690_100133192 | 3300005330 | Bacteria | 1680 |
| 12 | Ga0070670_100000009 | 3300005331 | Bacteria | 291074 |
| 13 | Ga0070666_10151637 | 3300005335 | Bacteria | 1617 |
| 14 | Ga0070680_100012789 | 3300005336 | Bacteria | 6528 |
| 15 | Ga0070680_100103391 | 3300005336 | Bacteria | 2367 |
| 16 | Ga0070680_100178213 | 3300005336 | Bacteria | 1790 |
| 17 | Ga0070668_100003906 | 3300005347 | Bacteria | 11008 |
| 18 | Ga0070668_100005548 | 3300005347 | Bacteria | 9364 |
| 19 | Ga0070668_100010666 | 3300005347 | Bacteria | 6831 |
| 20 | Ga0070668_100066414 | 3300005347 | Bacteria | 2799 |
| 21 | Ga0070668_100214584 | 3300005347 | Bacteria | 1584 |
| 22 | Ga0070675_100609162 | 3300005354 | Bacteria | 991 |
| 23 | Ga0070674_100045828 | 3300005356 | Bacteria | 2988 |
| 24 | Ga0070659_100022240 | 3300005366 | Bacteria | 4838 |
| 25 | Ga0070659_100172624 | 3300005366 | Bacteria | 1772 |
| 26 | Ga0070667_100002908 | 3300005367 | Bacteria | 14718 |
| 27 | Ga0070709_10053772 | 3300005434 | Bacteria | 2536 |
| 28 | Ga0070709_10068963 | 3300005434 | Bacteria | 2276 |
| 29 | Ga0070714_100004662 | 3300005435 | Bacteria | 10355 |
| 30 | Ga0070714_100611800 | 3300005435 | Bacteria | 1047 |
| 31 | Ga0070713_100955749 | 3300005436 | Bacteria | 825 |
| 32 | Ga0070710_10003916 | 3300005437 | Bacteria | 7052 |
| 33 | Ga0070701_10151839 | 3300005438 | Bacteria | 1334 |
| 34 | Ga0070701_10221896 | 3300005438 | Bacteria | 1127 |
| 35 | Ga0070711_100028398 | 3300005439 | Bacteria | 3681 |
| 36 | Ga0070711_100031977 | 3300005439 | Bacteria | 3496 |
| 37 | Ga0070711_100132226 | 3300005439 | Bacteria | 1860 |
| 38 | Ga0070711_100159102 | 3300005439 | Bacteria | 1711 |
| 39 | Ga0070678_100286235 | 3300005456 | Bacteria | 1395 |
| 40 | Ga0070681_10120730 | 3300005458 | Bacteria | 2556 |
| 41 | Ga0070706_100209873 | 3300005467 | Bacteria | 1819 |
| 42 | Ga0070679_100040901 | 3300005530 | Bacteria | 4613 |
| 43 | Ga0070679_100148200 | 3300005530 | Bacteria | 2324 |
| 44 | Ga0070697_100127802 | 3300005536 | Bacteria | 2129 |
| 45 | Ga0068853_100061451 | 3300005539 | Bacteria | 3249 |
| 46 | Ga0068853_100089056 | 3300005539 | Bacteria | 2710 |
| 47 | Ga0068853_100100944 | 3300005539 | Bacteria | 2552 |
| 48 | Ga0068853_100132265 | 3300005539 | Bacteria | 2234 |
| 49 | Ga0068853_100380677 | 3300005539 | Bacteria | 1318 |
| 50 | Ga0070686_100431401 | 3300005544 | Bacteria | 1009 |
| 51 | Ga0070695_100323180 | 3300005545 | Bacteria | 1148 |
| 52 | Ga0070665_100000338 | 3300005548 | Bacteria | 71282 |
| 53 | Ga0070665_100009207 | 3300005548 | Bacteria | 10002 |
| 54 | Ga0070665_100123975 | 3300005548 | Bacteria | 2586 |
| 55 | Ga0070665_100388147 | 3300005548 | Bacteria | 1404 |
| 56 | Ga0068855_100024002 | 3300005563 | Bacteria | 7301 |
| 57 | Ga0068855_100024662 | 3300005563 | Bacteria | 7194 |
| 58 | Ga0068855_100025884 | 3300005563 | Bacteria | 7017 |
| 59 | Ga0068855_100479923 | 3300005563 | Bacteria | 1353 |
| 60 | Ga0068855_101029593 | 3300005563 | Bacteria | 864 |
| 61 | Ga0070664_100365028 | 3300005564 | Bacteria | 1315 |
| 62 | Ga0068857_100026380 | 3300005577 | Bacteria | 5121 |
| 63 | Ga0068857_100027238 | 3300005577 | Bacteria | 5040 |
| 64 | Ga0068854_100008796 | 3300005578 | Bacteria | 6498 |
| 65 | Ga0068854_100018770 | 3300005578 | Bacteria | 4648 |
| 66 | Ga0068854_100018967 | 3300005578 | Bacteria | 4626 |
| 67 | Ga0068854_100079449 | 3300005578 | Bacteria | 2418 |
| 68 | Ga0068856_100000140 | 3300005614 | Bacteria | 73194 |
| 69 | Ga0068856_100013132 | 3300005614 | Bacteria | 8024 |
| 70 | Ga0068852_100014382 | 3300005616 | Bacteria | 6091 |
| 71 | Ga0068852_100019510 | 3300005616 | Bacteria | 5368 |
| 72 | Ga0068859_100293798 | 3300005617 | Bacteria | 1718 |
| 73 | Ga0068864_100000151 | 3300005618 | Bacteria | 65372 |
| 74 | Ga0068861_100187723 | 3300005719 | Bacteria | 1725 |
| 75 | Ga0068851_10014629 | 3300005834 | Bacteria | 3726 |
| 76 | Ga0068851_10053146 | 3300005834 | Bacteria | 2062 |
| 77 | Ga0068863_100000399 | 3300005841 | Bacteria | 44173 |
| 78 | Ga0068863_100032206 | 3300005841 | Bacteria | 4997 |
| 79 | Ga0068863_100080741 | 3300005841 | Bacteria | 3081 |
| 80 | Ga0068858_100068456 | 3300005842 | Bacteria | 3290 |
| 81 | Ga0068860_100000161 | 3300005843 | Bacteria | 110123 |
| 82 | Ga0068860_100000184 | 3300005843 | Bacteria | 100730 |
| 83 | Ga0068860_100540573 | 3300005843 | Bacteria | 1166 |
| 84 | Ga0068862_100017886 | 3300005844 | Bacteria | 5902 |
| 85 | Ga0068862_100105508 | 3300005844 | Bacteria | 2469 |
| 86 | Ga0081455_10040908 | 3300005937 | Bacteria | 4084 |
| 87 | Ga0081455_10071958 | 3300005937 | Bacteria | 2865 |
| 88 | Ga0081540_1004203 | 3300005983 | Bacteria | 11068 |
| 89 | Ga0081540_1008157 | 3300005983 | Bacteria | 7345 |
| 90 | Ga0081540_1028032 | 3300005983 | Bacteria | 3174 |
| 91 | Ga0081540_1030158 | 3300005983 | Bacteria | 3009 |
| 92 | Ga0081540_1044573 | 3300005983 | Bacteria | 2263 |
| 93 | Ga0081539_10000319 | 3300005985 | Bacteria | 106944 |
| 94 | Ga0070717_10039333 | 3300006028 | Bacteria | 3848 |
| 95 | Ga0075365_10023940 | 3300006038 | Bacteria | 3846 |
| 96 | Ga0075365_10087926 | 3300006038 | Bacteria | 2113 |
| 97 | Ga0075365_10162700 | 3300006038 | Bacteria | 1555 |
| 98 | Ga0075365_10224761 | 3300006038 | Bacteria | 1317 |
| 99 | Ga0070715_10002040 | 3300006163 | Bacteria | 6091 |
| 100 | Ga0070716_100022589 | 3300006173 | Bacteria | 3326 |
| 101 | Ga0070712_100013473 | 3300006175 | Bacteria | 5226 |
| 102 | Ga0070712_100221322 | 3300006175 | Bacteria | 1499 |
| 103 | Ga0075367_10065406 | 3300006178 | Bacteria | 2177 |
| 104 | Ga0075369_10008711 | 3300006186 | Bacteria | 3916 |
| 105 | Ga0075428_100090838 | 3300006844 | Bacteria | 3331 |
| 106 | Ga0075428_100135095 | 3300006844 | Bacteria | 2682 |
| 107 | Ga0068865_100291674 | 3300006881 | Bacteria | 1302 |
| 108 | Ga0097620_100293793 | 3300006931 | Bacteria | 1718 |
| 109 | Ga0099825_1029497 | 3300006941 | Bacteria | 2539 |
| 110 | Ga0099824_1002092 | 3300006942 | Bacteria | 28972 |
| 111 | Ga0099824_1007912 | 3300006942 | Bacteria | 13834 |
| 112 | Ga0099822_1000668 | 3300006943 | Bacteria | 34457 |
| 113 | Ga0099794_10019670 | 3300007265 | Bacteria | 3047 |
| 114 | Ga0099795_10032764 | 3300007788 | Bacteria | 1800 |
| 115 | Ga0105240_10000875 | 3300009093 | Bacteria | 54199 |
| 116 | Ga0105240_10004915 | 3300009093 | Bacteria | 20101 |
| 117 | Ga0105240_10009118 | 3300009093 | Bacteria | 14086 |
| 118 | Ga0105240_10027340 | 3300009093 | Bacteria | 7469 |
| 119 | Ga0105240_10094344 | 3300009093 | Bacteria | 3650 |
| 120 | Ga0105247_10188332 | 3300009101 | Bacteria | 1380 |
| 121 | Ga0114129_10084007 | 3300009147 | Bacteria | 4421 |
| 122 | Ga0114129_10351618 | 3300009147 | Bacteria | 1952 |
| 123 | Ga0105243_10123903 | 3300009148 | Bacteria | 2183 |
| 124 | Ga0105241_10018928 | 3300009174 | Bacteria | 5075 |
| 125 | Ga0105248_10047128 | 3300009177 | Bacteria | 4833 |
| 126 | Ga0105248_10281011 | 3300009177 | Bacteria | 1874 |
| 127 | Ga0105248_10470648 | 3300009177 | Bacteria | 1416 |
| 128 | Ga0105237_10141592 | 3300009545 | Bacteria | 2399 |
| 129 | Ga0105237_10147841 | 3300009545 | Bacteria | 2345 |
| 130 | Ga0105237_10169001 | 3300009545 | Bacteria | 2186 |
| 131 | Ga0105238_10003151 | 3300009551 | Bacteria | 16458 |
| 132 | Ga0105238_10049938 | 3300009551 | Bacteria | 4211 |
| 133 | Ga0105238_10127124 | 3300009551 | Bacteria | 2527 |
| 134 | Ga0105238_10399624 | 3300009551 | Bacteria | 1367 |
| 135 | Ga0105238_10440859 | 3300009551 | Bacteria | 1299 |
| 136 | Ga0105238_10777832 | 3300009551 | Bacteria | 972 |
| 137 | Ga0105249_10002575 | 3300009553 | Bacteria | 15692 |
| 138 | Ga0099796_10001299 | 3300010159 | Bacteria | 4941 |
| 139 | Ga0099796_10132305 | 3300010159 | Bacteria | 968 |
| 140 | Ga0105239_10023167 | 3300010375 | Bacteria | 6844 |
| 141 | Ga0105239_10041893 | 3300010375 | Bacteria | 5017 |
| 142 | Ga0105239_10057368 | 3300010375 | Bacteria | 4271 |
| 143 | Ga0105239_10143426 | 3300010375 | Bacteria | 2662 |
| 144 | Ga0105246_10290427 | 3300011119 | Bacteria | 1315 |
| 145 | Ga0157328_1001127 | 3300012478 | Bacteria | 1102 |
| 146 | Ga0157343_1004752 | 3300012488 | Bacteria | 855 |
| 147 | Ga0157371_10037559 | 3300013102 | Bacteria | 3465 |
| 148 | Ga0157370_10028441 | 3300013104 | Bacteria | 5498 |
| 149 | Ga0157370_10174882 | 3300013104 | Bacteria | 1996 |
| 150 | Ga0157370_10525718 | 3300013104 | Bacteria | 1085 |
| 151 | Ga0157374_10566303 | 3300013296 | Bacteria | 1145 |
| 152 | Ga0157378_10012316 | 3300013297 | Bacteria | 7489 |
| 153 | Ga0163162_10135326 | 3300013306 | Bacteria | 2575 |
| 154 | Ga0157372_10325632 | 3300013307 | Bacteria | 1789 |
| 155 | Ga0157372_11153476 | 3300013307 | Bacteria | 896 |
| 156 | Ga0157375_10673512 | 3300013308 | Bacteria | 1189 |
| 157 | Ga0163163_10235289 | 3300014325 | Bacteria | 1881 |
| 158 | Ga0157379_10036023 | 3300014968 | Bacteria | 4412 |
| 159 | Ga0157379_10037102 | 3300014968 | Bacteria | 4346 |
| 160 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 161 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 162 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 163 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 164 | Ga0213876_10009102 | 3300021384 | Bacteria | 5346 |
| 165 | Ga0228598_1026063 | 3300024227 | Bacteria | 1151 |
| 166 | Ga0209677_100238 | 3300025253 | Bacteria | 38405 |
| 167 | Ga0209233_1005863 | 3300025261 | Bacteria | 4031 |
| 168 | Ga0209233_1022091 | 3300025261 | Bacteria | 1634 |
| 169 | Ga0209455_1006321 | 3300025272 | Bacteria | 3515 |
| 170 | Ga0209673_1051616 | 3300025273 | Bacteria | 1084 |
| 171 | Ga0209758_1001525 | 3300025297 | Bacteria | 26806 |
| 172 | Ga0209758_1004742 | 3300025297 | Bacteria | 11058 |
| 173 | Ga0209758_1006166 | 3300025297 | Bacteria | 8778 |
| 174 | Ga0209758_1041649 | 3300025297 | Bacteria | 1714 |
| 175 | Ga0207426_1000847 | 3300025302 | Bacteria | 32206 |
| 176 | Ga0209257_1024258 | 3300025304 | Bacteria | 2104 |
| 177 | Ga0207656_10014093 | 3300025321 | Bacteria | 3072 |
| 178 | Ga0207692_10005248 | 3300025898 | Bacteria | 5178 |
| 179 | Ga0207710_10122472 | 3300025900 | Bacteria | 1243 |
| 180 | Ga0207688_10080342 | 3300025901 | Bacteria | 1861 |
| 181 | Ga0207680_10009251 | 3300025903 | Bacteria | 4877 |
| 182 | Ga0207685_10024778 | 3300025905 | Bacteria | 2062 |
| 183 | Ga0207699_10039340 | 3300025906 | Bacteria | 2717 |
| 184 | Ga0207654_10000123 | 3300025911 | Bacteria | 50130 |
| 185 | Ga0207707_10012352 | 3300025912 | Bacteria | 7422 |
| 186 | Ga0207707_10158396 | 3300025912 | Bacteria | 1980 |
| 187 | Ga0207695_10004074 | 3300025913 | Bacteria | 20097 |
| 188 | Ga0207695_10009321 | 3300025913 | Bacteria | 12149 |
| 189 | Ga0207695_10009841 | 3300025913 | Bacteria | 11749 |
| 190 | Ga0207695_10038444 | 3300025913 | Bacteria | 5152 |
| 191 | Ga0207695_10217083 | 3300025913 | Bacteria | 1821 |
| 192 | Ga0207671_10077109 | 3300025914 | Bacteria | 2495 |
| 193 | Ga0207671_10142555 | 3300025914 | Bacteria | 1847 |
| 194 | Ga0207671_10192177 | 3300025914 | Bacteria | 1592 |
| 195 | Ga0207693_10008696 | 3300025915 | Bacteria | 8303 |
| 196 | Ga0207693_10044656 | 3300025915 | Bacteria | 3482 |
| 197 | Ga0207693_10368988 | 3300025915 | Bacteria | 1123 |
| 198 | Ga0207663_10000967 | 3300025916 | Bacteria | 13125 |
| 199 | Ga0207663_10433807 | 3300025916 | Bacteria | 1011 |
| 200 | Ga0207660_10169233 | 3300025917 | Bacteria | 1690 |
| 201 | Ga0207657_10000891 | 3300025919 | Bacteria | 31605 |
| 202 | Ga0207657_10288106 | 3300025919 | Bacteria | 1303 |
| 203 | Ga0207694_10000810 | 3300025924 | Bacteria | 27944 |
| 204 | Ga0207694_10062596 | 3300025924 | Bacteria | 2897 |
| 205 | Ga0207694_10608237 | 3300025924 | Bacteria | 919 |
| 206 | Ga0207650_10000014 | 3300025925 | Bacteria | 398063 |
| 207 | Ga0207690_10249830 | 3300025932 | Bacteria | 1370 |
| 208 | Ga0207706_10144673 | 3300025933 | Bacteria | 2091 |
| 209 | Ga0207669_10076362 | 3300025937 | Bacteria | 2126 |
| 210 | Ga0207704_10086964 | 3300025938 | Bacteria | 2040 |
| 211 | Ga0207704_10271557 | 3300025938 | Bacteria | 1284 |
| 212 | Ga0207665_10007992 | 3300025939 | Bacteria | 6980 |
| 213 | Ga0207665_10075275 | 3300025939 | Bacteria | 2312 |
| 214 | Ga0207711_10010577 | 3300025941 | Bacteria | 7670 |
| 215 | Ga0207711_10055999 | 3300025941 | Bacteria | 3387 |
| 216 | Ga0207711_10196691 | 3300025941 | Bacteria | 1839 |
| 217 | Ga0207667_10017201 | 3300025949 | Bacteria | 8148 |
| 218 | Ga0207667_10050594 | 3300025949 | Bacteria | 4383 |
| 219 | Ga0207667_10084657 | 3300025949 | Bacteria | 3283 |
| 220 | Ga0207667_10696509 | 3300025949 | Bacteria | 1019 |
| 221 | Ga0207651_10118622 | 3300025960 | Bacteria | 2002 |
| 222 | Ga0207712_10000782 | 3300025961 | Bacteria | 23725 |
| 223 | Ga0207712_10039078 | 3300025961 | Bacteria | 3249 |
| 224 | Ga0207712_10043753 | 3300025961 | Bacteria | 3091 |
| 225 | Ga0207668_10000025 | 3300025972 | Bacteria | 131733 |
| 226 | Ga0207668_10022139 | 3300025972 | Bacteria | 4063 |
| 227 | Ga0207668_10036246 | 3300025972 | Bacteria | 3290 |
| 228 | Ga0207668_10150963 | 3300025972 | Bacteria | 1798 |
| 229 | Ga0207640_10011447 | 3300025981 | Bacteria | 5026 |
| 230 | Ga0207640_10035802 | 3300025981 | Bacteria | 3110 |
| 231 | Ga0207640_10081840 | 3300025981 | Bacteria | 2209 |
| 232 | Ga0207640_10107087 | 3300025981 | Bacteria | 1973 |
| 233 | Ga0207640_10225956 | 3300025981 | Bacteria | 1436 |
| 234 | Ga0207658_10007795 | 3300025986 | Bacteria | 7291 |
| 235 | Ga0207658_10007800 | 3300025986 | Bacteria | 7289 |
| 236 | Ga0207703_10005534 | 3300026035 | Bacteria | 10143 |
| 237 | Ga0207639_10049520 | 3300026041 | Bacteria | 3186 |
| 238 | Ga0207639_10087947 | 3300026041 | Bacteria | 2478 |
| 239 | Ga0207678_10023438 | 3300026067 | Bacteria | 5399 |
| 240 | Ga0207678_10024105 | 3300026067 | Bacteria | 5316 |
| 241 | Ga0207678_10192961 | 3300026067 | Bacteria | 1741 |
| 242 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 243 | Ga0207702_10000261 | 3300026078 | Bacteria | 61023 |
| 244 | Ga0207702_10059332 | 3300026078 | Bacteria | 3259 |
| 245 | Ga0207702_10180548 | 3300026078 | Bacteria | 1943 |
| 246 | Ga0207702_10553327 | 3300026078 | Bacteria | 1126 |
| 247 | Ga0207641_10001549 | 3300026088 | Bacteria | 22513 |
| 248 | Ga0207641_10028788 | 3300026088 | Bacteria | 4593 |
| 249 | Ga0207641_10260998 | 3300026088 | Bacteria | 1622 |
| 250 | Ga0207641_10679899 | 3300026088 | Bacteria | 1012 |
| 251 | Ga0207676_10000594 | 3300026095 | Bacteria | 29743 |
| 252 | Ga0207676_10448073 | 3300026095 | Bacteria | 1216 |
| 253 | Ga0207674_10008432 | 3300026116 | Bacteria | 11906 |
| 254 | Ga0207674_10016966 | 3300026116 | Bacteria | 7950 |
| 255 | Ga0207674_10946740 | 3300026116 | Bacteria | 830 |
| 256 | Ga0207675_100095062 | 3300026118 | Bacteria | 2803 |
| 257 | Ga0207683_10113780 | 3300026121 | Bacteria | 2424 |
| 258 | Ga0207698_10024150 | 3300026142 | Bacteria | 4261 |
| 259 | Ga0207698_10054630 | 3300026142 | Bacteria | 3074 |
| 260 | Ga0207698_10394450 | 3300026142 | Bacteria | 1321 |
| 261 | Ga0207698_10816915 | 3300026142 | Bacteria | 935 |
| 262 | Ga0209389_1000127 | 3300027296 | Bacteria | 67209 |
| 263 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 264 | Ga0209589_1000243 | 3300027357 | Bacteria | 67209 |
| 265 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 266 | Ga0209489_103202 | 3300027361 | Bacteria | 32241 |
| 267 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 268 | Ga0209179_1002826 | 3300027512 | Bacteria | 2412 |
| 269 | Ga0268266_10000533 | 3300028379 | Bacteria | 53233 |
| 270 | Ga0268266_10009547 | 3300028379 | Bacteria | 8538 |
| 271 | Ga0268265_10005273 | 3300028380 | Bacteria | 8847 |
| 272 | Ga0268265_10028249 | 3300028380 | Bacteria | 4015 |
| 273 | Ga0268264_10000096 | 3300028381 | Bacteria | 230188 |
| 274 | Ga0268264_10000124 | 3300028381 | Bacteria | 187493 |
| 275 | Ga0268264_10000170 | 3300028381 | Bacteria | 144898 |
| 276 | Ga0265334_10016764 | 3300028573 | Bacteria | 3030 |
| 277 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 278 | Ga0307511_10193374 | 3300030521 | Bacteria | 1071 |
| 279 | Ga0265330_10014486 | 3300031235 | Bacteria | 3660 |
| 280 | Ga0265340_10005635 | 3300031247 | Bacteria | 6934 |
| 281 | Ga0265339_10197133 | 3300031249 | Bacteria | 995 |
| 282 | Ga0307513_10041126 | 3300031456 | Bacteria | 5106 |
| 283 | Ga0307509_10062472 | 3300031507 | Bacteria | 3927 |
| 284 | Ga0307509_10348882 | 3300031507 | Bacteria | 1204 |
| 285 | Ga0307508_10000168 | 3300031616 | Bacteria | 79496 |
| 286 | Ga0307508_10084175 | 3300031616 | Bacteria | 2763 |
| 287 | Ga0265314_10054438 | 3300031711 | Bacteria | 2769 |
| 288 | Ga0265342_10052350 | 3300031712 | Bacteria | 2434 |
| 289 | Ga0307516_10137292 | 3300031730 | Bacteria | 2218 |
| 290 | Ga0307516_10328772 | 3300031730 | Bacteria | 1198 |
| 291 | Ga0307413_10046415 | 3300031824 | Bacteria | 2583 |
| 292 | Ga0307416_100685982 | 3300032002 | Bacteria | 1112 |
| 293 | Ga0307415_100061113 | 3300032126 | Bacteria | 2607 |
| 294 | Ga0307510_10015971 | 3300033180 | Bacteria | 8872 |
| 295 | Ga0307510_10044615 | 3300033180 | Bacteria | 4799 |
| 296 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 297 | Ga0373928_0059864 | 3300035084 | Bacteria | 919 |
| 298 | Ga0373934_0007659 | 3300035086 | Bacteria | 4011 |
| 299 | Ga0373923_0168093 | 3300035111 | Bacteria | 1003 |
| 300 | Ga0373936_0027445 | 3300035113 | Bacteria | 2233 |
| 301 | Ga0373945_0024492 | 3300035116 | Bacteria | 2092 |
| 302 | Ga0373954_0045048 | 3300035118 | Bacteria | 2060 |
| 303 | Ga0373954_0109224 | 3300035118 | Bacteria | 1337 |
| 304 | Ga0373954_0205639 | 3300035118 | Bacteria | 967 |
| 305 | Ga0373956_0017735 | 3300035119 | Bacteria | 3006 |
| 306 | Ga0373955_0004802 | 3300035172 | Bacteria | 6018 |
| 307 | Ga0373955_0369661 | 3300035172 | Bacteria | 870 |
| 308 | Ga0373924_0052995 | 3300035410 | Bacteria | 1685 |
| 309 | Ga0373924_0088147 | 3300035410 | Bacteria | 1325 |
| 310 | Ga0373931_0100625 | 3300035691 | Bacteria | 1625 |
| 311 | Ga0373931_0213070 | 3300035691 | Bacteria | 1159 |
| 312 | Ga0373931_0304228 | 3300035691 | Bacteria | 986 |
| 313 | Ga0373935_0037854 | 3300035692 | Bacteria | 3019 |
| 314 | Ga0373935_0390982 | 3300035692 | Bacteria | 997 |
| 315 | Ga0373927_0005668 | 3300035695 | Bacteria | 8579 |
| 316 | Ga0373927_0042463 | 3300035695 | Bacteria | 2946 |
| 317 | Ga0373927_0071939 | 3300035695 | Bacteria | 2238 |
| 318 | Ga0373927_0163114 | 3300035695 | Bacteria | 1460 |
| 319 | Ga0373933_0000124 | 3300035724 | Bacteria | 49441 |
| 320 | Ga0373933_0020774 | 3300035724 | Bacteria | 3723 |
| 321 | Ga0373933_0054242 | 3300035724 | Bacteria | 2402 |
| 322 | Ga0373947_0004083 | 3300035725 | Bacteria | 8597 |
| 323 | Ga0373947_0195608 | 3300035725 | Bacteria | 1321 |
| 324 | Ga0373937_0026270 | 3300036401 | Bacteria | 5262 |
| 325 | Ga0373937_0088458 | 3300036401 | Bacteria | 2867 |
| 326 | Ga0373937_0200973 | 3300036401 | Bacteria | 1873 |
| 327 | Ga0373937_0205770 | 3300036401 | Bacteria | 1851 |
| 328 | Ga0373925_0006216 | 3300037068 | Bacteria | 8812 |
| 329 | Ga0373925_0050641 | 3300037068 | Bacteria | 3098 |
| 330 | Ga0373925_0203809 | 3300037068 | Bacteria | 1574 |
| 331 | Ga0373925_0243367 | 3300037068 | Bacteria | 1441 |
| 332 | Ga0395905_0098736 | 3300037471 | Bacteria | 2742 |
| 333 | Ga0395901_0142943 | 3300038443 | Bacteria | 2515 |
| 334 | Ga0436365_0547035 | 3300039437 | Bacteria | 4529 |
| 335 | Ga0436365_1593583 | 3300039437 | Bacteria | 1303 |
| 336 | Ga0436363_1041317 | 3300039450 | Bacteria | 1085 |
| 337 | Ga0436362_0214249 | 3300039453 | Bacteria | 2899 |
| 338 | Ga0451853_2263250 | 3300041512 | Bacteria | 1532 |
| 339 | Ga0439458_0057679 | 3300042157 | Bacteria | 966 |
| 340 | Ga0466969_0043915 | 3300044656 | Bacteria | 2226 |
| 341 | Ga0466972_0003847 | 3300044658 | Bacteria | 7471 |
| 342 | Ga0466965_0037393 | 3300044683 | Bacteria | 2383 |
| 343 | Ga0466966_0001672 | 3300044684 | Bacteria | 14305 |
| 344 | Ga0466961_0001529 | 3300044693 | Bacteria | 14321 |
| 345 | Ga0466963_0033109 | 3300044694 | Bacteria | 3352 |
| 346 | Ga0466970_0084344 | 3300044765 | Bacteria | 1720 |
| 347 | Ga0466967_0266325 | 3300045976 | Bacteria | 1640 |
| 348 | Ga0495592_0022949 | 3300046454 | Bacteria | 4748 |
| 349 | Ga0495592_0039060 | 3300046454 | Bacteria | 3568 |
| 350 | Ga0495592_0347063 | 3300046454 | Bacteria | 952 |
| 351 | Ga0495603_0005079 | 3300046455 | Bacteria | 7861 |
| 352 | Ga0495603_0059096 | 3300046455 | Bacteria | 2267 |
| 353 | Ga0495603_0155670 | 3300046455 | Bacteria | 1326 |
| 354 | Ga0495603_0242664 | 3300046455 | Bacteria | 1038 |
| 355 | Ga0495590_0030733 | 3300046457 | Bacteria | 1882 |
| 356 | Ga0495629_0000672 | 3300046459 | Bacteria | 27723 |
| 357 | Ga0495629_0013089 | 3300046459 | Bacteria | 5994 |
| 358 | Ga0495629_0388293 | 3300046459 | Bacteria | 949 |
| 359 | Ga0495629_0466086 | 3300046459 | Bacteria | 854 |
| 360 | Ga0495641_0076584 | 3300046461 | Bacteria | 1499 |
| 361 | Ga0495651_0022682 | 3300046462 | Bacteria | 4879 |
| 362 | Ga0495651_0165722 | 3300046462 | Bacteria | 1578 |
| 363 | Ga0495653_0122576 | 3300046463 | Bacteria | 1850 |
| 364 | Ga0495653_0277783 | 3300046463 | Bacteria | 1100 |
| 365 | Ga0495653_0427881 | 3300046463 | Bacteria | 836 |
| 366 | Ga0495580_0012605 | 3300046472 | Bacteria | 6480 |
| 367 | Ga0495582_0000336 | 3300046473 | Bacteria | 25701 |
| 368 | Ga0495639_0000154 | 3300046475 | Bacteria | 35394 |
| 369 | Ga0495662_0003756 | 3300046476 | Bacteria | 7658 |
| 370 | Ga0495664_0013710 | 3300046477 | Bacteria | 4597 |
| 371 | Ga0495664_0020483 | 3300046477 | Bacteria | 3815 |
| 372 | Ga0495664_0128800 | 3300046477 | Bacteria | 1532 |
| 373 | Ga0495594_0002042 | 3300046499 | Bacteria | 10519 |
| 374 | Ga0495596_0039486 | 3300046500 | Bacteria | 1864 |
| 375 | Ga0495607_0046041 | 3300046501 | Bacteria | 2564 |
| 376 | Ga0495608_0021126 | 3300046511 | Bacteria | 4470 |
| 377 | Ga0495608_0136597 | 3300046511 | Bacteria | 1566 |
| 378 | Ga0495610_0122624 | 3300046512 | Bacteria | 1137 |
| 379 | Ga0495628_0014412 | 3300046516 | Bacteria | 6628 |
| 380 | Ga0495628_0026090 | 3300046516 | Bacteria | 4770 |
| 381 | Ga0495628_0474660 | 3300046516 | Bacteria | 906 |
| 382 | Ga0495630_0008732 | 3300046517 | Bacteria | 7280 |
| 383 | Ga0495632_0022696 | 3300046519 | Bacteria | 3359 |
| 384 | Ga0495666_0247701 | 3300046526 | Bacteria | 812 |
| 385 | Ga0495642_0055798 | 3300046528 | Bacteria | 1631 |
| 386 | Ga0495652_0048678 | 3300046529 | Bacteria | 3630 |
| 387 | Ga0495652_0251335 | 3300046529 | Bacteria | 1310 |
| 388 | Ga0495652_0253010 | 3300046529 | Bacteria | 1304 |
| 389 | Ga0495652_0549055 | 3300046529 | Bacteria | 795 |
| 390 | Ga0495654_0128698 | 3300046530 | Bacteria | 1139 |
| 391 | Ga0495665_0012053 | 3300046531 | Bacteria | 4679 |
| 392 | Ga0495640_0008600 | 3300046533 | Bacteria | 8002 |
| 393 | Ga0495587_0185504 | 3300046536 | Bacteria | 1178 |
| 394 | Ga0495587_0275395 | 3300046536 | Bacteria | 943 |
| 395 | Ga0495645_0017715 | 3300046543 | Bacteria | 5106 |
| 396 | Ga0495667_0050594 | 3300046559 | Bacteria | 2742 |
| 397 | Ga0495667_0197940 | 3300046559 | Bacteria | 1286 |
| 398 | Ga0495667_0221498 | 3300046559 | Bacteria | 1207 |
| 399 | Ga0495656_0009707 | 3300046615 | Bacteria | 3471 |
| 400 | Ga0495656_0026136 | 3300046615 | Bacteria | 2321 |
| 401 | Ga0495656_0112738 | 3300046615 | Bacteria | 1274 |
| 402 | Ga0495668_0091007 | 3300046616 | Bacteria | 1671 |
| 403 | Ga0495634_0005666 | 3300046642 | Bacteria | 9562 |
| 404 | Ga0495634_0052483 | 3300046642 | Bacteria | 2733 |
| 405 | Ga0495634_0084954 | 3300046642 | Bacteria | 2063 |
| 406 | Ga0495634_0136396 | 3300046642 | Bacteria | 1561 |
| 407 | Ga0495625_0286394 | 3300046660 | Bacteria | 1058 |
| 408 | Ga0495635_0010397 | 3300046663 | Bacteria | 6509 |
| 409 | Ga0495635_0049581 | 3300046663 | Bacteria | 2893 |
| 410 | Ga0495635_0184748 | 3300046663 | Bacteria | 1416 |
| 411 | Ga0495588_0165570 | 3300046674 | Bacteria | 1169 |
| 412 | Ga0495657_0091513 | 3300046675 | Bacteria | 1950 |
| 413 | Ga0495599_0029454 | 3300046678 | Bacteria | 3442 |
| 414 | Ga0495599_0063344 | 3300046678 | Bacteria | 2310 |
| 415 | Ga0495599_0277214 | 3300046678 | Bacteria | 1016 |
| 416 | Ga0495623_0072074 | 3300046679 | Bacteria | 2149 |
| 417 | Ga0495646_0023543 | 3300046680 | Bacteria | 3876 |
| 418 | Ga0495646_0043244 | 3300046680 | Bacteria | 2760 |
| 419 | Ga0495647_0009564 | 3300046681 | Bacteria | 3286 |
| 420 | Ga0495658_0005565 | 3300046683 | Bacteria | 6190 |
| 421 | Ga0495669_0020855 | 3300046684 | Bacteria | 2838 |
| 422 | Ga0495613_0014087 | 3300046689 | Bacteria | 5932 |
| 423 | Ga0495613_0284320 | 3300046689 | Bacteria | 1148 |
| 424 | Ga0495624_0002880 | 3300046690 | Bacteria | 12873 |
| 425 | Ga0495649_0048664 | 3300046694 | Bacteria | 2304 |
| 426 | Ga0495589_0141712 | 3300046794 | Bacteria | 1151 |
| 427 | Ga0495600_0015717 | 3300046809 | Bacteria | 4791 |
| 428 | Ga0495600_0063345 | 3300046809 | Bacteria | 2416 |
| 429 | Ga0495600_0166725 | 3300046809 | Bacteria | 1422 |
| 430 | Ga0495600_0315712 | 3300046809 | Bacteria | 983 |
| 431 | Ga0495581_0004403 | 3300047315 | Bacteria | 8141 |
| 432 | Ga0495604_0162220 | 3300047317 | Bacteria | 1578 |
| 433 | Ga0495604_0171265 | 3300047317 | Bacteria | 1526 |
| 434 | Ga0495636_0038480 | 3300047318 | Bacteria | 1979 |
| 435 | Ga0495674_0005189 | 3300047319 | Bacteria | 12509 |
| 436 | Ga0495674_0027448 | 3300047319 | Bacteria | 5203 |
| 437 | Ga0495674_0087688 | 3300047319 | Bacteria | 2663 |
| 438 | Ga0495672_0000485 | 3300047320 | Bacteria | 46894 |
| 439 | Ga0495672_0112258 | 3300047320 | Bacteria | 1461 |
| 440 | Ga0495676_0058263 | 3300047321 | Bacteria | 3040 |
| 441 | Ga0495680_0031150 | 3300047322 | Bacteria | 4345 |
| 442 | Ga0495680_0110640 | 3300047322 | Bacteria | 2035 |
| 443 | Ga0495680_0263401 | 3300047322 | Bacteria | 1219 |
| 444 | Ga0495683_0167661 | 3300047323 | Bacteria | 1011 |
| 445 | Ga0495683_0238642 | 3300047323 | Bacteria | 803 |
| 446 | Ga0495675_0081208 | 3300047444 | Bacteria | 2041 |
| 447 | Ga0495675_0105808 | 3300047444 | Bacteria | 1758 |
| 448 | Ga0495681_0065774 | 3300047470 | Bacteria | 1656 |
| 449 | Ga0495684_0043074 | 3300047471 | Bacteria | 3455 |
| 450 | Ga0495686_0114846 | 3300047472 | Bacteria | 1611 |
| 451 | Ga0495593_0003415 | 3300047673 | Bacteria | 9513 |
| 452 | Ga0495593_0112090 | 3300047673 | Bacteria | 1392 |
| 453 | Ga0495602_0410031 | 3300048088 | Bacteria | 964 |
| 454 | Ga0495602_0556830 | 3300048088 | Bacteria | 794 |
| 455 | Ga0496100_0098849 | 3300048903 | Bacteria | 2007 |
| 456 | Ga0496101_0054755 | 3300048904 | Bacteria | 2880 |
| 457 | Ga0496102_0017493 | 3300048905 | Bacteria | 6279 |
| 458 | Ga0496102_0145128 | 3300048905 | Bacteria | 2227 |
| 459 | Ga0496102_0305550 | 3300048905 | Bacteria | 1499 |
| 460 | Ga0496102_0396711 | 3300048905 | Bacteria | 1297 |
| 461 | Ga0496102_0461380 | 3300048905 | Bacteria | 1191 |
| 462 | Ga0496102_0716333 | 3300048905 | Bacteria | 924 |
| 463 | Ga0496103_0095603 | 3300048906 | Bacteria | 1877 |
| 464 | Ga0496104_0204040 | 3300048907 | Bacteria | 1889 |
| 465 | Ga0496105_0116419 | 3300048908 | Bacteria | 2205 |
| 466 | Ga0496106_0009237 | 3300048909 | Bacteria | 7285 |
| 467 | Ga0496106_0339048 | 3300048909 | Bacteria | 1207 |
| 468 | Ga0496106_0340125 | 3300048909 | Bacteria | 1205 |
| 469 | Ga0496107_0013255 | 3300048910 | Bacteria | 5761 |
| 470 | Ga0496107_0427031 | 3300048910 | Bacteria | 985 |
| 471 | Ga0496107_0445027 | 3300048910 | Bacteria | 963 |
| 472 | Ga0496108_0000380 | 3300048911 | Bacteria | 36881 |
| 473 | Ga0496108_0063689 | 3300048911 | Bacteria | 3105 |
| 474 | Ga0496108_0118670 | 3300048911 | Bacteria | 2268 |
| 475 | Ga0496108_0325379 | 3300048911 | Bacteria | 1340 |
| 476 | Ga0496109_0000887 | 3300048912 | Bacteria | 25028 |
| 477 | Ga0496109_0168020 | 3300048912 | Bacteria | 2057 |
| 478 | Ga0496109_0181960 | 3300048912 | Bacteria | 1974 |
| 479 | Ga0496109_0288742 | 3300048912 | Bacteria | 1546 |
| 480 | Ga0496110_0026404 | 3300048913 | Bacteria | 4970 |
| 481 | Ga0496110_0037493 | 3300048913 | Bacteria | 4214 |
| 482 | Ga0496110_0089901 | 3300048913 | Bacteria | 2745 |
| 483 | Ga0496110_0134651 | 3300048913 | Bacteria | 2232 |
| 484 | Ga0496110_0548721 | 3300048913 | Bacteria | 1050 |
| 485 | Ga0496110_0865764 | 3300048913 | Bacteria | 809 |
| 486 | Ga0496111_0121022 | 3300048914 | Bacteria | 1933 |
| 487 | Ga0496111_0138437 | 3300048914 | Bacteria | 1803 |
| 488 | Ga0496111_0635687 | 3300048914 | Bacteria | 779 |
| 489 | Ga0496112_0019379 | 3300048915 | Bacteria | 6422 |
| 490 | Ga0496112_0028537 | 3300048915 | Bacteria | 5387 |
| 491 | Ga0496112_0039717 | 3300048915 | Bacteria | 4600 |
| 492 | Ga0496112_0137280 | 3300048915 | Bacteria | 2415 |
| 493 | Ga0496112_0597584 | 3300048915 | Bacteria | 1035 |
| 494 | Ga0496113_0228831 | 3300048916 | Bacteria | 1482 |
| 495 | Ga0496115_0124230 | 3300048918 | Bacteria | 2125 |
| 496 | Ga0496115_0274707 | 3300048918 | Bacteria | 1384 |
| 497 | Ga0496115_0356559 | 3300048918 | Bacteria | 1192 |
| 498 | Ga0496115_0622326 | 3300048918 | Bacteria | 856 |
| 499 | Ga0496116_0210268 | 3300048919 | Bacteria | 1009 |
| 500 | Ga0496117_0006861 | 3300048920 | Bacteria | 11313 |
| 501 | Ga0496117_0121802 | 3300048920 | Bacteria | 1601 |
| 502 | Ga0496118_0018608 | 3300048921 | Bacteria | 6253 |
| 503 | Ga0496121_0000300 | 3300048924 | Bacteria | 102506 |
| 504 | Ga0496121_0001712 | 3300048924 | Bacteria | 35901 |
| 505 | Ga0496121_0017013 | 3300048924 | Bacteria | 7462 |
| 506 | Ga0496121_0018815 | 3300048924 | Bacteria | 6938 |
| 507 | Ga0496121_0177054 | 3300048924 | Bacteria | 1543 |
| 508 | Ga0496121_0325944 | 3300048924 | Bacteria | 1032 |
| 509 | Ga0496124_0007174 | 3300048927 | Bacteria | 11912 |
| 510 | Ga0496124_0141336 | 3300048927 | Bacteria | 1899 |
| 511 | Ga0496124_0208231 | 3300048927 | Bacteria | 1482 |
| 512 | Ga0496124_0247129 | 3300048927 | Bacteria | 1322 |
| 513 | Ga0496124_0357714 | 3300048927 | Bacteria | 1030 |
| 514 | Ga0496125_0062738 | 3300048928 | Bacteria | 2969 |
| 515 | Ga0496126_0007237 | 3300048929 | Bacteria | 12206 |
| 516 | Ga0496126_0007334 | 3300048929 | Bacteria | 12111 |
| 517 | Ga0496126_0016251 | 3300048929 | Bacteria | 7450 |
| 518 | Ga0496126_0031256 | 3300048929 | Bacteria | 5033 |
| 519 | Ga0496126_0075680 | 3300048929 | Bacteria | 2987 |
| 520 | Ga0496126_0083011 | 3300048929 | Bacteria | 2829 |
| 521 | Ga0496126_0137806 | 3300048929 | Bacteria | 2103 |
| 522 | Ga0496126_0335678 | 3300048929 | Bacteria | 1239 |
| 523 | Ga0496126_0400131 | 3300048929 | Bacteria | 1114 |
| 524 | Ga0501031_0010682 | 3300049568 | Bacteria | 5981 |
| 525 | Ga0501031_0280212 | 3300049568 | Bacteria | 1081 |
| 526 | Ga0501032_0000038 | 3300049569 | Bacteria | 115810 |
| 527 | Ga0501032_0034799 | 3300049569 | Bacteria | 3445 |
| 528 | Ga0501032_0182504 | 3300049569 | Bacteria | 1373 |
| 529 | Ga0501033_0000222 | 3300049570 | Bacteria | 54685 |
| 530 | Ga0501033_0002083 | 3300049570 | Bacteria | 17325 |
| 531 | Ga0501033_0265580 | 3300049570 | Bacteria | 1214 |
| 532 | Ga0501033_0305921 | 3300049570 | Bacteria | 1118 |
| 533 | Ga0501034_0000228 | 3300049571 | Bacteria | 106111 |
| 534 | Ga0501034_0213416 | 3300049571 | Bacteria | 1884 |
| 535 | Ga0501034_0247532 | 3300049571 | Bacteria | 1727 |
| 536 | Ga0501034_0568128 | 3300049571 | Bacteria | 1042 |
| 537 | Ga0501034_0598238 | 3300049571 | Bacteria | 1008 |
| 538 | Ga0501036_0001157 | 3300049572 | Bacteria | 20051 |
| 539 | Ga0501036_0022021 | 3300049572 | Bacteria | 5359 |
| 540 | Ga0501036_0054330 | 3300049572 | Bacteria | 3392 |
| 541 | Ga0501036_0175239 | 3300049572 | Bacteria | 1806 |
| 542 | Ga0501036_0492239 | 3300049572 | Bacteria | 1020 |
| 543 | Ga0501037_0000291 | 3300049573 | Bacteria | 42514 |
| 544 | Ga0501037_0076565 | 3300049573 | Bacteria | 2428 |
| 545 | Ga0501037_0233620 | 3300049573 | Bacteria | 1290 |
| 546 | Ga0501038_0000079 | 3300049574 | Bacteria | 81639 |
| 547 | Ga0501038_0000782 | 3300049574 | Bacteria | 28176 |
| 548 | Ga0501038_0018111 | 3300049574 | Bacteria | 6362 |
| 549 | Ga0501038_0025917 | 3300049574 | Bacteria | 5222 |
| 550 | Ga0501038_0337204 | 3300049574 | Bacteria | 1176 |
| 551 | Ga0501039_0005342 | 3300049575 | Bacteria | 9714 |
| 552 | Ga0501039_0024316 | 3300049575 | Bacteria | 4651 |
| 553 | Ga0501039_0076170 | 3300049575 | Bacteria | 2608 |
| 554 | Ga0501039_0100222 | 3300049575 | Bacteria | 2260 |
| 555 | Ga0501039_0177994 | 3300049575 | Bacteria | 1672 |
| 556 | Ga0501040_0396527 | 3300049576 | Bacteria | 991 |
| 557 | Ga0501041_0293731 | 3300049577 | Bacteria | 1024 |
| 558 | Ga0501042_0026138 | 3300049578 | Bacteria | 4103 |
| 559 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 560 | Ga0501043_0009067 | 3300049579 | Bacteria | 7828 |
| 561 | Ga0501043_0037854 | 3300049579 | Bacteria | 3794 |
| 562 | Ga0501043_0057027 | 3300049579 | Bacteria | 3067 |
| 563 | Ga0501046_0000632 | 3300049580 | Bacteria | 34569 |
| 564 | Ga0501046_0017892 | 3300049580 | Bacteria | 5908 |
| 565 | Ga0501046_0114383 | 3300049580 | Bacteria | 2058 |
| 566 | Ga0501047_0000041 | 3300049581 | Bacteria | 184355 |
| 567 | Ga0501047_0150958 | 3300049581 | Bacteria | 2199 |
| 568 | Ga0501047_0382266 | 3300049581 | Bacteria | 1242 |
| 569 | Ga0501048_0002271 | 3300049582 | Bacteria | 14667 |
| 570 | Ga0501048_0197178 | 3300049582 | Bacteria | 1427 |
| 571 | Ga0501067_0000411 | 3300049583 | Bacteria | 23399 |
| 572 | Ga0501068_0003389 | 3300049584 | Bacteria | 8567 |
| 573 | Ga0501068_0162355 | 3300049584 | Bacteria | 1408 |
| 574 | Ga0501068_0418964 | 3300049584 | Bacteria | 865 |
| 575 | Ga0501069_0017775 | 3300049585 | Bacteria | 3833 |
| 576 | Ga0501070_0012019 | 3300049586 | Bacteria | 7307 |
| 577 | Ga0501070_0049641 | 3300049586 | Bacteria | 3484 |
| 578 | Ga0501070_0097042 | 3300049586 | Bacteria | 2438 |
| 579 | Ga0501070_0302529 | 3300049586 | Bacteria | 1303 |
| 580 | Ga0501071_0003588 | 3300049587 | Bacteria | 9719 |
| 581 | Ga0501072_0019878 | 3300049588 | Bacteria | 5197 |
| 582 | Ga0501072_0023902 | 3300049588 | Bacteria | 4749 |
| 583 | Ga0501072_0365533 | 3300049588 | Bacteria | 1145 |
| 584 | Ga0501073_0000056 | 3300049589 | Bacteria | 70854 |
| 585 | Ga0501073_0156778 | 3300049589 | Bacteria | 1577 |
| 586 | Ga0501074_0007359 | 3300049590 | Bacteria | 7960 |
| 587 | Ga0501074_0077642 | 3300049590 | Bacteria | 2383 |
| 588 | Ga0501076_0148277 | 3300049592 | Bacteria | 1908 |
| 589 | Ga0501079_0001331 | 3300049741 | Bacteria | 17381 |
| 590 | Ga0501079_0220792 | 3300049741 | Bacteria | 1481 |
| 591 | Ga0501080_0000138 | 3300049742 | Bacteria | 50982 |
| 592 | Ga0501080_0037141 | 3300049742 | Bacteria | 4547 |
| 593 | Ga0501080_0091226 | 3300049742 | Bacteria | 2830 |
| 594 | Ga0501083_0002147 | 3300049744 | Bacteria | 13527 |
| 595 | Ga0501035_0000090 | 3300049822 | Bacteria | 112445 |
| 596 | Ga0501035_0022751 | 3300049822 | Bacteria | 5756 |
| 597 | Ga0501035_0108401 | 3300049822 | Bacteria | 2435 |
| 598 | Ga0501035_0236731 | 3300049822 | Bacteria | 1554 |
| 599 | Ga0501035_0332398 | 3300049822 | Bacteria | 1275 |
| 600 | Ga0501035_0352217 | 3300049822 | Bacteria | 1232 |
| 601 | Ga0501044_0000054 | 3300049823 | Bacteria | 141399 |
| 602 | Ga0501044_0060341 | 3300049823 | Bacteria | 3884 |
| 603 | Ga0501044_0062701 | 3300049823 | Bacteria | 3799 |
| 604 | Ga0501044_0063239 | 3300049823 | Bacteria | 3781 |
| 605 | Ga0501044_0066970 | 3300049823 | Bacteria | 3660 |
| 606 | Ga0501044_0086405 | 3300049823 | Bacteria | 3168 |
| 607 | Ga0501045_0088054 | 3300049824 | Bacteria | 2293 |
| 608 | nmdc:mga0yw44_32637_c1 | 3300050492 | Bacteria | 3036 |
| 609 | nmdc:mga0yw44_34378_c1 | 3300050492 | Bacteria | 2970 |
| 610 | nmdc:mga0yw44_78757_c1 | 3300050492 | Bacteria | 2061 |
| 611 | nmdc:mga0qj67_357193_c1 | 3300050509 | Bacteria | 1181 |
| 612 | nmdc:mga06r32_194702_c1 | 3300050510 | Bacteria | 2014 |
| 613 | nmdc:mga0sz30_91464_c1 | 3300050516 | Bacteria | 1324 |
| 614 | Ga0495601_0011980 | 3300053077 | Bacteria | 5195 |
| 615 | Ga0495612_0173189 | 3300053078 | Bacteria | 946 |
| 616 | Ga0500635_0000120 | 3300053080 | Bacteria | 46183 |
| 617 | Ga0500635_0008610 | 3300053080 | Bacteria | 2803 |
| 618 | Ga0495619_0035769 | 3300053085 | Bacteria | 3231 |
| 619 | Ga0495619_0127020 | 3300053085 | Bacteria | 1751 |
| 620 | Ga0500643_019089 | 3300053087 | Bacteria | 2263 |
| 621 | Ga0500651_0011575 | 3300053093 | Bacteria | 5323 |
| 622 | Ga0500566_0004641 | 3300053094 | Bacteria | 8172 |
| 623 | Ga0500641_0182371 | 3300053096 | Bacteria | 901 |
| 624 | Ga0500654_077101 | 3300053099 | Bacteria | 1581 |
| 625 | Ga0500554_000726 | 3300053102 | Bacteria | 6657 |
| 626 | Ga0500555_011379 | 3300053103 | Bacteria | 2556 |
| 627 | Ga0500562_000043 | 3300053108 | Bacteria | 65591 |
| 628 | Ga0500562_060363 | 3300053108 | Bacteria | 1019 |
| 629 | Ga0500572_001185 | 3300053111 | Bacteria | 7456 |
| 630 | Ga0500582_001062 | 3300053114 | Bacteria | 3759 |
| 631 | Ga0500594_0049473 | 3300053118 | Bacteria | 1179 |
| 632 | Ga0500595_001479 | 3300053119 | Bacteria | 12486 |
| 633 | Ga0500595_001984 | 3300053119 | Bacteria | 10498 |
| 634 | Ga0500595_002130 | 3300053119 | Bacteria | 10082 |
| 635 | Ga0500595_006059 | 3300053119 | Bacteria | 5186 |
| 636 | Ga0500617_173706 | 3300053124 | Bacteria | 824 |
| 637 | Ga0500559_0000581 | 3300053136 | Bacteria | 25087 |
| 638 | Ga0500559_0007362 | 3300053136 | Bacteria | 4881 |
| 639 | Ga0500559_0250577 | 3300053136 | Bacteria | 834 |
| 640 | Ga0500561_0049246 | 3300053137 | Bacteria | 1143 |
| 641 | Ga0500573_0023333 | 3300053140 | Bacteria | 3552 |
| 642 | Ga0500589_088330 | 3300053147 | Bacteria | 1370 |
| 643 | Ga0500603_001051 | 3300053150 | Bacteria | 6492 |
| 644 | Ga0500603_018903 | 3300053150 | Bacteria | 1666 |
| 645 | Ga0500622_0003131 | 3300053156 | Bacteria | 11359 |
| 646 | Ga0500633_0118786 | 3300053160 | Bacteria | 983 |
| 647 | Ga0500638_002099 | 3300053162 | Bacteria | 6759 |
| 648 | Ga0500638_186615 | 3300053162 | Bacteria | 890 |
| 649 | Ga0500639_026058 | 3300053163 | Bacteria | 3089 |
| 650 | Ga0500636_0016803 | 3300053177 | Bacteria | 4314 |
| 651 | Ga0500636_0023252 | 3300053177 | Bacteria | 3664 |
| 652 | Ga0500637_0000107 | 3300053178 | Bacteria | 29902 |
| 653 | Ga0500637_0000325 | 3300053178 | Bacteria | 17915 |
| 654 | Ga0500637_0001936 | 3300053178 | Bacteria | 9005 |
| 655 | Ga0500637_0054556 | 3300053178 | Bacteria | 2281 |
| 656 | Ga0500645_004847 | 3300053730 | Bacteria | 5072 |
| 657 | Ga0500596_001376 | 3300053735 | Bacteria | 4908 |
| 658 | Ga0500596_010189 | 3300053735 | Bacteria | 1456 |
| 659 | Ga0501084_0009659 | 3300054114 | Bacteria | 7981 |
| 660 | Ga0501084_0025430 | 3300054114 | Bacteria | 4940 |
| 661 | Ga0500661_002117 | 3300055283 | Bacteria | 3750 |
| 662 | Ga0501082_0063390 | 3300060353 | Bacteria | 3182 |
| 663 | Ga0501082_0127365 | 3300060353 | Bacteria | 2209 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047323 | Ga0495683_0238642 | Ga0495683_0238642_31_636 | 196 |
| 2 | 3300009177 | Ga0105248_10281011 | Ga0105248_102810112 | 200 |
| 3 | 3300049571 | Ga0501034_0213416 | Ga0501034_0213416_382_1248 | 210 |
| 4 | 3300049572 | Ga0501036_0492239 | Ga0501036_0492239_108_974 | 210 |
| 5 | 3300049574 | Ga0501038_0025917 | Ga0501038_0025917_357_1223 | 210 |
| 6 | 3300049575 | Ga0501039_0076170 | Ga0501039_0076170_1314_2180 | 210 |
| 7 | 3300049579 | Ga0501043_0057027 | Ga0501043_0057027_270_1136 | 210 |
| 8 | 3300049580 | Ga0501046_0017892 | Ga0501046_0017892_2079_2945 | 210 |
| 9 | 3300049581 | Ga0501047_0150958 | Ga0501047_0150958_697_1563 | 210 |
| 10 | 3300049582 | Ga0501048_0197178 | Ga0501048_0197178_296_1162 | 210 |
| 11 | 3300049584 | Ga0501068_0162355 | Ga0501068_0162355_160_1026 | 210 |
| 12 | 3300049586 | Ga0501070_0049641 | Ga0501070_0049641_2270_3136 | 210 |
| 13 | 3300049588 | Ga0501072_0365533 | Ga0501072_0365533_201_1067 | 210 |
| 14 | 3300049589 | Ga0501073_0156778 | Ga0501073_0156778_75_941 | 210 |
| 15 | 3300049590 | Ga0501074_0077642 | Ga0501074_0077642_1358_2224 | 210 |
| 16 | 3300049592 | Ga0501076_0148277 | Ga0501076_0148277_126_992 | 210 |
| 17 | 3300049822 | Ga0501035_0022751 | Ga0501035_0022751_4440_5306 | 210 |
| 18 | 3300049823 | Ga0501044_0063239 | Ga0501044_0063239_75_941 | 210 |
| 19 | 3300060353 | Ga0501082_0063390 | Ga0501082_0063390_1703_2569 | 210 |
| 20 | 3300005548 | Ga0070665_100123975 | Ga0070665_1001239752 | 215 |
| 21 | 3300039437 | Ga0436365_1593583 | Ga0436365_1593583_516_1271 | 218 |
| 22 | 3300005331 | Ga0070670_100000009 | Ga0070670_100000009165 | 219 |
| 23 | 3300005335 | Ga0070666_10151637 | Ga0070666_101516372 | 219 |
| 24 | 3300005347 | Ga0070668_100003906 | Ga0070668_1000039064 | 219 |
| 25 | 3300005367 | Ga0070667_100002908 | Ga0070667_1000029086 | 219 |
| 26 | 3300005548 | Ga0070665_100009207 | Ga0070665_1000092073 | 219 |
| 27 | 3300005618 | Ga0068864_100000151 | Ga0068864_10000015160 | 219 |
| 28 | 3300005841 | Ga0068863_100000399 | Ga0068863_10000039925 | 219 |
| 29 | 3300005842 | Ga0068858_100068456 | Ga0068858_1000684562 | 219 |
| 30 | 3300005843 | Ga0068860_100000184 | Ga0068860_10000018437 | 219 |
| 31 | 3300005844 | Ga0068862_100017886 | Ga0068862_1000178863 | 219 |
| 32 | 3300009101 | Ga0105247_10188332 | Ga0105247_101883322 | 219 |
| 33 | 3300009177 | Ga0105248_10047128 | Ga0105248_100471282 | 219 |
| 34 | 3300009553 | Ga0105249_10002575 | Ga0105249_100025752 | 219 |
| 35 | 3300013306 | Ga0163162_10135326 | Ga0163162_101353263 | 219 |
| 36 | 3300014325 | Ga0163163_10235289 | Ga0163163_102352892 | 219 |
| 37 | 3300014968 | Ga0157379_10036023 | Ga0157379_100360232 | 219 |
| 38 | 3300025900 | Ga0207710_10122472 | Ga0207710_101224721 | 219 |
| 39 | 3300025903 | Ga0207680_10009251 | Ga0207680_100092516 | 219 |
| 40 | 3300025925 | Ga0207650_10000014 | Ga0207650_10000014317 | 219 |
| 41 | 3300025941 | Ga0207711_10010577 | Ga0207711_100105774 | 219 |
| 42 | 3300025961 | Ga0207712_10000782 | Ga0207712_100007822 | 219 |
| 43 | 3300025972 | Ga0207668_10022139 | Ga0207668_100221392 | 219 |
| 44 | 3300025986 | Ga0207658_10007795 | Ga0207658_100077953 | 219 |
| 45 | 3300026035 | Ga0207703_10005534 | Ga0207703_1000553410 | 219 |
| 46 | 3300026088 | Ga0207641_10001549 | Ga0207641_100015492 | 219 |
| 47 | 3300026095 | Ga0207676_10000594 | Ga0207676_100005949 | 219 |
| 48 | 3300028379 | Ga0268266_10009547 | Ga0268266_100095479 | 219 |
| 49 | 3300028380 | Ga0268265_10005273 | Ga0268265_100052739 | 219 |
| 50 | 3300028381 | Ga0268264_10000124 | Ga0268264_10000124164 | 219 |
| 51 | 3300028381 | Ga0268264_10000170 | Ga0268264_10000170141 | 219 |
| 52 | 3300048905 | Ga0496102_0716333 | Ga0496102_0716333_37_777 | 219 |
| 53 | 3300048906 | Ga0496103_0095603 | Ga0496103_0095603_176_916 | 219 |
| 54 | 3300048909 | Ga0496106_0340125 | Ga0496106_0340125_410_1150 | 219 |
| 55 | 3300005347 | Ga0070668_100005548 | Ga0070668_1000055485 | 223 |
| 56 | 3300005548 | Ga0070665_100000338 | Ga0070665_1000003383 | 223 |
| 57 | 3300005617 | Ga0068859_100293798 | Ga0068859_1002937981 | 223 |
| 58 | 3300005844 | Ga0068862_100105508 | Ga0068862_1001055082 | 223 |
| 59 | 3300006931 | Ga0097620_100293793 | Ga0097620_1002937931 | 223 |
| 60 | 3300025941 | Ga0207711_10196691 | Ga0207711_101966911 | 223 |
| 61 | 3300025961 | Ga0207712_10039078 | Ga0207712_100390783 | 223 |
| 62 | 3300025972 | Ga0207668_10000025 | Ga0207668_10000025131 | 223 |
| 63 | 3300025986 | Ga0207658_10007800 | Ga0207658_100078009 | 223 |
| 64 | 3300026088 | Ga0207641_10260998 | Ga0207641_102609982 | 223 |
| 65 | 3300028379 | Ga0268266_10000533 | Ga0268266_100005334 | 223 |
| 66 | 3300028380 | Ga0268265_10028249 | Ga0268265_100282494 | 223 |
| 67 | 3300053156 | Ga0500622_0003131 | Ga0500622_0003131_6139_6870 | 223 |
| 68 | 3300053087 | Ga0500643_019089 | Ga0500643_019089_516_1256 | 224 |
| 69 | 3300046794 | Ga0495589_0141712 | Ga0495589_0141712_15_719 | 227 |
| 70 | 3300049822 | Ga0501035_0352217 | Ga0501035_0352217_224_931 | 227 |
| 71 | 3300005841 | Ga0068863_100032206 | Ga0068863_1000322062 | 228 |
| 72 | 3300013307 | Ga0157372_11153476 | Ga0157372_111534761 | 228 |
| 73 | 3300026088 | Ga0207641_10028788 | Ga0207641_100287885 | 228 |
| 74 | 3300006844 | Ga0075428_100135095 | Ga0075428_1001350952 | 229 |
| 75 | 3300009545 | Ga0105237_10169001 | Ga0105237_101690013 | 229 |
| 76 | 3300025914 | Ga0207671_10142555 | Ga0207671_101425552 | 229 |
| 77 | 3300025924 | Ga0207694_10608237 | Ga0207694_106082371 | 229 |
| 78 | 3300050509 | nmdc:mga0qj67_357193_c1 | nmdc:mga0qj67_357193_c1_37_786 | 229 |
| 79 | 3300050510 | nmdc:mga06r32_194702_c1 | nmdc:mga06r32_194702_c1_730_1479 | 229 |
| 80 | 3300046459 | Ga0495629_0013089 | Ga0495629_0013089_133_879 | 230 |
| 81 | 3300049570 | Ga0501033_0265580 | Ga0501033_0265580_353_1084 | 230 |
| 82 | 3300049574 | Ga0501038_0337204 | Ga0501038_0337204_243_974 | 230 |
| 83 | 3300049822 | Ga0501035_0332398 | Ga0501035_0332398_339_1070 | 230 |
| 84 | 3300049823 | Ga0501044_0066970 | Ga0501044_0066970_2506_3237 | 230 |
| 85 | 3300053080 | Ga0500635_0000120 | Ga0500635_0000120_9727_10461 | 230 |
| 86 | 3300053108 | Ga0500562_000043 | Ga0500562_000043_47594_48346 | 230 |
| 87 | 3300053162 | Ga0500638_186615 | Ga0500638_186615_48_782 | 230 |
| 88 | 3300053177 | Ga0500636_0016803 | Ga0500636_0016803_1644_2378 | 230 |
| 89 | 3300053178 | Ga0500637_0054556 | Ga0500637_0054556_1412_2146 | 230 |
| 90 | 3300005347 | Ga0070668_100010666 | Ga0070668_1000106663 | 231 |
| 91 | 3300046529 | Ga0495652_0549055 | Ga0495652_0549055_60_764 | 234 |
| 92 | 3300035086 | Ga0373934_0007659 | Ga0373934_0007659_439_1146 | 235 |
| 93 | 3300035410 | Ga0373924_0052995 | Ga0373924_0052995_67_774 | 235 |
| 94 | 3300036401 | Ga0373937_0088458 | Ga0373937_0088458_2120_2827 | 235 |
| 95 | 3300036401 | Ga0373937_0200973 | Ga0373937_0200973_1126_1833 | 235 |
| 96 | 3300046454 | Ga0495592_0347063 | Ga0495592_0347063_13_720 | 235 |
| 97 | 3300046462 | Ga0495651_0165722 | Ga0495651_0165722_41_748 | 235 |
| 98 | 3300046463 | Ga0495653_0427881 | Ga0495653_0427881_89_796 | 235 |
| 99 | 3300046511 | Ga0495608_0136597 | Ga0495608_0136597_177_884 | 235 |
| 100 | 3300046516 | Ga0495628_0026090 | Ga0495628_0026090_2503_3210 | 235 |
| 101 | 3300046529 | Ga0495652_0048678 | Ga0495652_0048678_1242_1949 | 235 |
| 102 | 3300046529 | Ga0495652_0253010 | Ga0495652_0253010_414_1121 | 235 |
| 103 | 3300046536 | Ga0495587_0275395 | Ga0495587_0275395_35_742 | 235 |
| 104 | 3300046559 | Ga0495667_0050594 | Ga0495667_0050594_1943_2650 | 235 |
| 105 | 3300046559 | Ga0495667_0197940 | Ga0495667_0197940_562_1269 | 235 |
| 106 | 3300046642 | Ga0495634_0052483 | Ga0495634_0052483_214_921 | 235 |
| 107 | 3300046663 | Ga0495635_0184748 | Ga0495635_0184748_669_1376 | 235 |
| 108 | 3300046678 | Ga0495599_0063344 | Ga0495599_0063344_1423_2130 | 235 |
| 109 | 3300046809 | Ga0495600_0166725 | Ga0495600_0166725_675_1382 | 235 |
| 110 | 3300046809 | Ga0495600_0315712 | Ga0495600_0315712_236_943 | 235 |
| 111 | 3300047317 | Ga0495604_0171265 | Ga0495604_0171265_41_748 | 235 |
| 112 | 3300047319 | Ga0495674_0087688 | Ga0495674_0087688_1015_1722 | 235 |
| 113 | 3300047322 | Ga0495680_0110640 | Ga0495680_0110640_41_748 | 235 |
| 114 | 3300047444 | Ga0495675_0081208 | Ga0495675_0081208_1294_2001 | 235 |
| 115 | 3300047673 | Ga0495593_0112090 | Ga0495593_0112090_53_760 | 235 |
| 116 | 3300048913 | Ga0496110_0134651 | Ga0496110_0134651_1058_1765 | 235 |
| 117 | 3300048918 | Ga0496115_0274707 | Ga0496115_0274707_251_958 | 235 |
| 118 | 3300048929 | Ga0496126_0400131 | Ga0496126_0400131_16_723 | 235 |
| 119 | 3300053085 | Ga0495619_0035769 | Ga0495619_0035769_1891_2598 | 235 |
| 120 | iso_pu_bacteria | 2840878972 | 2840880215 | 235 |
| 121 | 3300048929 | Ga0496126_0016251 | Ga0496126_0016251_23_733 | 236 |
| 122 | 3300053118 | Ga0500594_0049473 | Ga0500594_0049473_454_1164 | 236 |
| 123 | 3300053124 | Ga0500617_173706 | Ga0500617_173706_11_721 | 236 |
| 124 | 3300025906 | Ga0207699_10039340 | Ga0207699_100393403 | 237 |
| 125 | 3300046455 | Ga0495603_0242664 | Ga0495603_0242664_284_997 | 237 |
| 126 | 3300046526 | Ga0495666_0247701 | Ga0495666_0247701_42_755 | 237 |
| 127 | 3300048088 | Ga0495602_0556830 | Ga0495602_0556830_36_749 | 237 |
| 128 | 3300048905 | Ga0496102_0396711 | Ga0496102_0396711_25_738 | 237 |
| 129 | 3300048929 | Ga0496126_0031256 | Ga0496126_0031256_27_743 | 238 |
| 130 | 3300049588 | Ga0501072_0019878 | Ga0501072_0019878_3265_3996 | 238 |
| 131 | 3300049742 | Ga0501080_0037141 | Ga0501080_0037141_2363_3094 | 238 |
| 132 | 3300049744 | Ga0501083_0002147 | Ga0501083_0002147_9947_10678 | 238 |
| 133 | 3300054114 | Ga0501084_0009659 | Ga0501084_0009659_2256_2987 | 238 |
| 134 | 3300010159 | Ga0099796_10132305 | Ga0099796_101323051 | 240 |
| 135 | 3300005563 | Ga0068855_100479923 | Ga0068855_1004799231 | 241 |
| 136 | 3300035691 | Ga0373931_0213070 | Ga0373931_0213070_210_935 | 241 |
| 137 | 3300035692 | Ga0373935_0390982 | Ga0373935_0390982_84_809 | 241 |
| 138 | 3300035695 | Ga0373927_0042463 | Ga0373927_0042463_1217_1942 | 241 |
| 139 | 3300046455 | Ga0495603_0059096 | Ga0495603_0059096_478_1227 | 241 |
| 140 | 3300046457 | Ga0495590_0030733 | Ga0495590_0030733_617_1366 | 241 |
| 141 | 3300046528 | Ga0495642_0055798 | Ga0495642_0055798_868_1617 | 241 |
| 142 | 3300046694 | Ga0495649_0048664 | Ga0495649_0048664_1033_1782 | 241 |
| 143 | 3300047320 | Ga0495672_0000485 | Ga0495672_0000485_23607_24356 | 241 |
| 144 | 3300048905 | Ga0496102_0017493 | Ga0496102_0017493_4917_5642 | 241 |
| 145 | 3300048911 | Ga0496108_0118670 | Ga0496108_0118670_1204_1929 | 241 |
| 146 | 3300048914 | Ga0496111_0635687 | Ga0496111_0635687_30_755 | 241 |
| 147 | 3300048916 | Ga0496113_0228831 | Ga0496113_0228831_25_750 | 241 |
| 148 | 3300048918 | Ga0496115_0124230 | Ga0496115_0124230_101_826 | 241 |
| 149 | 3300053178 | Ga0500637_0001936 | Ga0500637_0001936_2749_3498 | 241 |
| 150 | 3300005539 | Ga0068853_100061451 | Ga0068853_1000614512 | 242 |
| 151 | 3300005563 | Ga0068855_100024002 | Ga0068855_1000240023 | 244 |
| 152 | 3300009093 | Ga0105240_10000875 | Ga0105240_1000087536 | 244 |
| 153 | 3300009093 | Ga0105240_10004915 | Ga0105240_100049158 | 244 |
| 154 | 3300025913 | Ga0207695_10004074 | Ga0207695_100040748 | 244 |
| 155 | 3300025913 | Ga0207695_10009841 | Ga0207695_100098416 | 244 |
| 156 | 3300025949 | Ga0207667_10017201 | Ga0207667_100172018 | 244 |
| 157 | 3300035695 | Ga0373927_0163114 | Ga0373927_0163114_289_1104 | 246 |
| 158 | 3300035725 | Ga0373947_0195608 | Ga0373947_0195608_389_1204 | 246 |
| 159 | 3300037068 | Ga0373925_0203809 | Ga0373925_0203809_407_1222 | 246 |
| 160 | iso_pu_bacteria | 2513237096 | 2513660524 | 246 |
| 161 | iso_pu_bacteria | 2513237101 | 2513695436 | 246 |
| 162 | iso_pu_bacteria | 2513237137 | 2513858095 | 246 |
| 163 | iso_pu_bacteria | 2513237145 | 2513922316 | 246 |
| 164 | iso_pu_bacteria | 2524023228 | 2524536178 | 246 |
| 165 | iso_pu_bacteria | 2667528175 | 2671122997 | 246 |
| 166 | iso_pu_bacteria | 2728368998 | 2728754656 | 246 |
| 167 | iso_pu_bacteria | 2791355197 | 2793072741 | 246 |
| 168 | iso_pu_bacteria | 2791355199 | 2793079338 | 246 |
| 169 | iso_pu_bacteria | 2874604998 | 2874612191 | 246 |
| 170 | iso_pu_bacteria | 2876808645 | 2876817723 | 246 |
| 171 | iso_pu_bacteria | 2879110137 | 2879111851 | 246 |
| 172 | iso_pu_bacteria | 2885374607 | 2885375015 | 246 |
| 173 | iso_pu_bacteria | 2889033259 | 2889041969 | 246 |
| 174 | iso_pu_bacteria | 2903748898 | 2903756936 | 246 |
| 175 | iso_pu_bacteria | 2904690495 | 2904697480 | 246 |
| 176 | iso_pu_bacteria | 2904699407 | 2904705206 | 246 |
| 177 | iso_pu_bacteria | 2906610324 | 2906610906 | 246 |
| 178 | iso_pu_bacteria | 2906635258 | 2906635732 | 246 |
| 179 | iso_pu_bacteria | 2906660503 | 2906661706 | 246 |
| 180 | iso_pu_bacteria | 2908739725 | 2908744423 | 246 |
| 181 | iso_pu_bacteria | 2908756301 | 2908762064 | 246 |
| 182 | iso_pu_bacteria | 2922361189 | 2922366159 | 246 |
| 183 | iso_pu_bacteria | 2922386360 | 2922386762 | 246 |
| 184 | iso_pu_bacteria | 2922425934 | 2922428417 | 246 |
| 185 | iso_pu_bacteria | 2935630451 | 2935634410 | 246 |
| 186 | iso_pu_bacteria | 2941507105 | 2941508896 | 246 |
| 187 | iso_pu_bacteria | 2941515067 | 2941516725 | 246 |
| 188 | iso_pu_bacteria | 2941523033 | 2941525181 | 246 |
| 189 | iso_pu_bacteria | 3005474847 | 3005478536 | 246 |
| 190 | iso_pu_bacteria | 8006933436 | 8006942828 | 246 |
| 191 | iso_pu_bacteria | 8006964411 | 8006964959 | 246 |
| 192 | iso_pu_bacteria | 8006973647 | 8006982547 | 246 |
| 193 | iso_pu_bacteria | 8006984368 | 8006991644 | 246 |
| 194 | iso_pu_bacteria | 8006994254 | 8006994320 | 246 |
| 195 | iso_pu_bacteria | 8019555841 | 8019558583 | 246 |
| 196 | iso_pu_bacteria | 8056681323 | 8056685264 | 246 |
| 197 | iso_pu_bacteria | 8056689827 | 8056691742 | 246 |
| 198 | 3300003659 | JGI25404J52841_10042226 | JGI25404J52841_100422261 | 247 |
| 199 | 3300005548 | Ga0070665_100388147 | Ga0070665_1003881472 | 247 |
| 200 | 3300005937 | Ga0081455_10040908 | Ga0081455_100409084 | 247 |
| 201 | 3300005983 | Ga0081540_1004203 | Ga0081540_10042037 | 247 |
| 202 | 3300005983 | Ga0081540_1008157 | Ga0081540_10081576 | 247 |
| 203 | 3300005983 | Ga0081540_1028032 | Ga0081540_10280323 | 247 |
| 204 | 3300005983 | Ga0081540_1030158 | Ga0081540_10301582 | 247 |
| 205 | 3300012478 | Ga0157328_1001127 | Ga0157328_10011271 | 247 |
| 206 | 3300035691 | Ga0373931_0100625 | Ga0373931_0100625_34_795 | 247 |
| 207 | 3300048911 | Ga0496108_0325379 | Ga0496108_0325379_549_1310 | 247 |
| 208 | 3300048915 | Ga0496112_0137280 | Ga0496112_0137280_802_1563 | 247 |
| 209 | 3300005985 | Ga0081539_10000319 | Ga0081539_10000319114 | 248 |
| 210 | 3300024227 | Ga0228598_1026063 | Ga0228598_10260631 | 248 |
| 211 | 3300025261 | Ga0209233_1005863 | Ga0209233_10058636 | 248 |
| 212 | 3300025272 | Ga0209455_1006321 | Ga0209455_10063212 | 248 |
| 213 | 3300053099 | Ga0500654_077101 | Ga0500654_077101_765_1511 | 248 |
| 214 | 3300053147 | Ga0500589_088330 | Ga0500589_088330_559_1305 | 248 |
| 215 | 3300003214 | JGI25165J46597_1006803 | JGI25165J46597_10068032 | 249 |
| 216 | 3300003215 | JGI25153J46596_10008206 | JGI25153J46596_100082062 | 249 |
| 217 | 3300003215 | JGI25153J46596_10015237 | JGI25153J46596_100152373 | 249 |
| 218 | 3300003354 | JGI25160J50197_1003851 | JGI25160J50197_10038515 | 249 |
| 219 | 3300005336 | Ga0070680_100178213 | Ga0070680_1001782132 | 249 |
| 220 | 3300005366 | Ga0070659_100022240 | Ga0070659_1000222407 | 249 |
| 221 | 3300005530 | Ga0070679_100148200 | Ga0070679_1001482003 | 249 |
| 222 | 3300005563 | Ga0068855_101029593 | Ga0068855_1010295931 | 249 |
| 223 | 3300005578 | Ga0068854_100079449 | Ga0068854_1000794492 | 249 |
| 224 | 3300005616 | Ga0068852_100014382 | Ga0068852_1000143823 | 249 |
| 225 | 3300005983 | Ga0081540_1044573 | Ga0081540_10445733 | 249 |
| 226 | 3300006038 | Ga0075365_10162700 | Ga0075365_101627002 | 249 |
| 227 | 3300006942 | Ga0099824_1007912 | Ga0099824_10079124 | 249 |
| 228 | 3300009551 | Ga0105238_10127124 | Ga0105238_101271242 | 249 |
| 229 | 3300009551 | Ga0105238_10777832 | Ga0105238_107778321 | 249 |
| 230 | 3300013104 | Ga0157370_10525718 | Ga0157370_105257181 | 249 |
| 231 | 3300013307 | Ga0157372_10325632 | Ga0157372_103256322 | 249 |
| 232 | 3300025273 | Ga0209673_1051616 | Ga0209673_10516161 | 249 |
| 233 | 3300025302 | Ga0207426_1000847 | Ga0207426_100084719 | 249 |
| 234 | 3300025304 | Ga0209257_1024258 | Ga0209257_10242581 | 249 |
| 235 | 3300025917 | Ga0207660_10169233 | Ga0207660_101692332 | 249 |
| 236 | 3300025919 | Ga0207657_10000891 | Ga0207657_1000089110 | 249 |
| 237 | 3300025919 | Ga0207657_10288106 | Ga0207657_102881062 | 249 |
| 238 | 3300025949 | Ga0207667_10696509 | Ga0207667_106965092 | 249 |
| 239 | 3300025981 | Ga0207640_10081840 | Ga0207640_100818402 | 249 |
| 240 | 3300026067 | Ga0207678_10024105 | Ga0207678_100241054 | 249 |
| 241 | 3300026078 | Ga0207702_10180548 | Ga0207702_101805482 | 249 |
| 242 | 3300026142 | Ga0207698_10054630 | Ga0207698_100546302 | 249 |
| 243 | 3300027296 | Ga0209389_1000127 | Ga0209389_100012767 | 249 |
| 244 | 3300027357 | Ga0209589_1000243 | Ga0209589_100024367 | 249 |
| 245 | 3300027361 | Ga0209489_103202 | Ga0209489_10320223 | 249 |
| 246 | 3300037471 | Ga0395905_0098736 | Ga0395905_0098736_995_1756 | 249 |
| 247 | 3300038443 | Ga0395901_0142943 | Ga0395901_0142943_116_877 | 249 |
| 248 | 3300044658 | Ga0466972_0003847 | Ga0466972_0003847_4894_5655 | 249 |
| 249 | 3300044683 | Ga0466965_0037393 | Ga0466965_0037393_548_1309 | 249 |
| 250 | 3300044684 | Ga0466966_0001672 | Ga0466966_0001672_6658_7419 | 249 |
| 251 | 3300044693 | Ga0466961_0001529 | Ga0466961_0001529_10857_11618 | 249 |
| 252 | 3300044694 | Ga0466963_0033109 | Ga0466963_0033109_1316_2077 | 249 |
| 253 | 3300044765 | Ga0466970_0084344 | Ga0466970_0084344_21_782 | 249 |
| 254 | 3300045976 | Ga0466967_0266325 | Ga0466967_0266325_73_834 | 249 |
| 255 | 3300048927 | Ga0496124_0208231 | Ga0496124_0208231_84_845 | 249 |
| 256 | 3300050492 | nmdc:mga0yw44_78757_c1 | nmdc:mga0yw44_78757_c1_1011_1772 | 249 |
| 257 | iso_pu_bacteria | 2513237092 | 2513627578 | 249 |
| 258 | iso_pu_bacteria | 2513237161 | 2514017140 | 249 |
| 259 | iso_pu_bacteria | 2517093001 | 2517105243 | 249 |
| 260 | iso_pu_bacteria | 2824671348 | 2824678263 | 249 |
| 261 | iso_pu_bacteria | 2824687955 | 2824694735 | 249 |
| 262 | iso_pu_bacteria | 2824704595 | 2824708306 | 249 |
| 263 | iso_pu_bacteria | 2824753945 | 2824761037 | 249 |
| 264 | iso_pu_bacteria | 2824763712 | 2824771750 | 249 |
| 265 | iso_pu_bacteria | 2824773399 | 2824780760 | 249 |
| 266 | iso_pu_bacteria | 2838122688 | 2838125650 | 249 |
| 267 | iso_pu_bacteria | 2841941048 | 2841941688 | 249 |
| 268 | iso_pu_bacteria | 2841949485 | 2841951117 | 249 |
| 269 | iso_pu_bacteria | 2841966195 | 2841974245 | 249 |
| 270 | iso_pu_bacteria | 2841974524 | 2841975917 | 249 |
| 271 | iso_pu_bacteria | 2841983080 | 2841989230 | 249 |
| 272 | iso_pu_bacteria | 2844315083 | 2844317572 | 249 |
| 273 | iso_pu_bacteria | 2874612657 | 2874618056 | 249 |
| 274 | iso_pu_bacteria | 2874620515 | 2874627949 | 249 |
| 275 | iso_pu_bacteria | 2881665667 | 2881670771 | 249 |
| 276 | iso_pu_bacteria | 2885366525 | 2885368754 | 249 |
| 277 | iso_pu_bacteria | 2903727486 | 2903735256 | 249 |
| 278 | iso_pu_bacteria | 2904666416 | 2904666683 | 249 |
| 279 | iso_pu_bacteria | 2904711408 | 2904718640 | 249 |
| 280 | iso_pu_bacteria | 2906602504 | 2906608830 | 249 |
| 281 | iso_pu_bacteria | 3005483717 | 3005487775 | 249 |
| 282 | iso_pu_bacteria | 3005594810 | 3005597308 | 249 |
| 283 | iso_pu_bacteria | 3005718088 | 3005720690 | 249 |
| 284 | iso_pu_bacteria | 8056967851 | 8056969376 | 249 |
| 285 | 3300003215 | JGI25153J46596_10000257 | JGI25153J46596_1000025737 | 250 |
| 286 | 3300005347 | Ga0070668_100066414 | Ga0070668_1000664143 | 250 |
| 287 | 3300005347 | Ga0070668_100214584 | Ga0070668_1002145842 | 250 |
| 288 | 3300005356 | Ga0070674_100045828 | Ga0070674_1000458284 | 250 |
| 289 | 3300005366 | Ga0070659_100172624 | Ga0070659_1001726242 | 250 |
| 290 | 3300005438 | Ga0070701_10151839 | Ga0070701_101518392 | 250 |
| 291 | 3300005438 | Ga0070701_10221896 | Ga0070701_102218962 | 250 |
| 292 | 3300005439 | Ga0070711_100031977 | Ga0070711_1000319774 | 250 |
| 293 | 3300005456 | Ga0070678_100286235 | Ga0070678_1002862352 | 250 |
| 294 | 3300005536 | Ga0070697_100127802 | Ga0070697_1001278022 | 250 |
| 295 | 3300005539 | Ga0068853_100132265 | Ga0068853_1001322652 | 250 |
| 296 | 3300005545 | Ga0070695_100323180 | Ga0070695_1003231801 | 250 |
| 297 | 3300005564 | Ga0070664_100365028 | Ga0070664_1003650282 | 250 |
| 298 | 3300005719 | Ga0068861_100187723 | Ga0068861_1001877232 | 250 |
| 299 | 3300005843 | Ga0068860_100540573 | Ga0068860_1005405732 | 250 |
| 300 | 3300005937 | Ga0081455_10071958 | Ga0081455_100719586 | 250 |
| 301 | 3300006038 | Ga0075365_10087926 | Ga0075365_100879262 | 250 |
| 302 | 3300006038 | Ga0075365_10224761 | Ga0075365_102247612 | 250 |
| 303 | 3300006178 | Ga0075367_10065406 | Ga0075367_100654063 | 250 |
| 304 | 3300006186 | Ga0075369_10008711 | Ga0075369_100087117 | 250 |
| 305 | 3300006844 | Ga0075428_100090838 | Ga0075428_1000908386 | 250 |
| 306 | 3300006881 | Ga0068865_100291674 | Ga0068865_1002916742 | 250 |
| 307 | 3300006941 | Ga0099825_1029497 | Ga0099825_10294972 | 250 |
| 308 | 3300006942 | Ga0099824_1002092 | Ga0099824_100209214 | 250 |
| 309 | 3300006943 | Ga0099822_1000668 | Ga0099822_10006688 | 250 |
| 310 | 3300009147 | Ga0114129_10084007 | Ga0114129_100840075 | 250 |
| 311 | 3300009147 | Ga0114129_10351618 | Ga0114129_103516182 | 250 |
| 312 | 3300009148 | Ga0105243_10123903 | Ga0105243_101239033 | 250 |
| 313 | 3300009177 | Ga0105248_10470648 | Ga0105248_104706482 | 250 |
| 314 | 3300009551 | Ga0105238_10399624 | Ga0105238_103996241 | 250 |
| 315 | 3300012488 | Ga0157343_1004752 | Ga0157343_10047521 | 250 |
| 316 | 3300013104 | Ga0157370_10174882 | Ga0157370_101748821 | 250 |
| 317 | 3300014968 | Ga0157379_10037102 | Ga0157379_100371021 | 250 |
| 318 | 3300021320 | Ga0214544_1000020 | Ga0214544_10000205 | 250 |
| 319 | 3300021321 | Ga0214542_1000024 | Ga0214542_100002417 | 250 |
| 320 | 3300021324 | Ga0214545_1000011 | Ga0214545_100001117 | 250 |
| 321 | 3300021327 | Ga0214543_1000033 | Ga0214543_1000033188 | 250 |
| 322 | 3300025253 | Ga0209677_100238 | Ga0209677_1002387 | 250 |
| 323 | 3300025261 | Ga0209233_1022091 | Ga0209233_10220911 | 250 |
| 324 | 3300025297 | Ga0209758_1001525 | Ga0209758_10015255 | 250 |
| 325 | 3300025297 | Ga0209758_1004742 | Ga0209758_100474212 | 250 |
| 326 | 3300025297 | Ga0209758_1041649 | Ga0209758_10416492 | 250 |
| 327 | 3300025915 | Ga0207693_10044656 | Ga0207693_100446562 | 250 |
| 328 | 3300025932 | Ga0207690_10249830 | Ga0207690_102498301 | 250 |
| 329 | 3300025937 | Ga0207669_10076362 | Ga0207669_100763622 | 250 |
| 330 | 3300025938 | Ga0207704_10086964 | Ga0207704_100869641 | 250 |
| 331 | 3300025938 | Ga0207704_10271557 | Ga0207704_102715572 | 250 |
| 332 | 3300025939 | Ga0207665_10075275 | Ga0207665_100752751 | 250 |
| 333 | 3300025941 | Ga0207711_10055999 | Ga0207711_100559994 | 250 |
| 334 | 3300025961 | Ga0207712_10043753 | Ga0207712_100437534 | 250 |
| 335 | 3300025972 | Ga0207668_10036246 | Ga0207668_100362464 | 250 |
| 336 | 3300025972 | Ga0207668_10150963 | Ga0207668_101509632 | 250 |
| 337 | 3300026041 | Ga0207639_10087947 | Ga0207639_100879472 | 250 |
| 338 | 3300026118 | Ga0207675_100095062 | Ga0207675_1000950623 | 250 |
| 339 | 3300026121 | Ga0207683_10113780 | Ga0207683_101137803 | 250 |
| 340 | 3300026142 | Ga0207698_10816915 | Ga0207698_108169151 | 250 |
| 341 | 3300027357 | Ga0209589_1000018 | Ga0209589_1000018182 | 250 |
| 342 | 3300027361 | Ga0209489_100026 | Ga0209489_100026182 | 250 |
| 343 | 3300027363 | Ga0209700_100035 | Ga0209700_100035182 | 250 |
| 344 | 3300030521 | Ga0307511_10193374 | Ga0307511_101933742 | 250 |
| 345 | 3300031456 | Ga0307513_10041126 | Ga0307513_100411263 | 250 |
| 346 | 3300031507 | Ga0307509_10062472 | Ga0307509_100624721 | 250 |
| 347 | 3300031730 | Ga0307516_10328772 | Ga0307516_103287722 | 250 |
| 348 | 3300031824 | Ga0307413_10046415 | Ga0307413_100464153 | 250 |
| 349 | 3300032002 | Ga0307416_100685982 | Ga0307416_1006859821 | 250 |
| 350 | 3300032126 | Ga0307415_100061113 | Ga0307415_1000611133 | 250 |
| 351 | 3300033180 | Ga0307510_10044615 | Ga0307510_100446155 | 250 |
| 352 | 3300033442 | Ga0315911_1000011 | Ga0315911_1000011206 | 250 |
| 353 | 3300035084 | Ga0373928_0059864 | Ga0373928_0059864_24_776 | 250 |
| 354 | 3300035691 | Ga0373931_0304228 | Ga0373931_0304228_62_814 | 250 |
| 355 | 3300035695 | Ga0373927_0071939 | Ga0373927_0071939_1150_1902 | 250 |
| 356 | 3300042157 | Ga0439458_0057679 | Ga0439458_0057679_100_852 | 250 |
| 357 | 3300046455 | Ga0495603_0155670 | Ga0495603_0155670_14_766 | 250 |
| 358 | 3300046500 | Ga0495596_0039486 | Ga0495596_0039486_560_1312 | 250 |
| 359 | 3300046501 | Ga0495607_0046041 | Ga0495607_0046041_366_1118 | 250 |
| 360 | 3300046512 | Ga0495610_0122624 | Ga0495610_0122624_58_810 | 250 |
| 361 | 3300046519 | Ga0495632_0022696 | Ga0495632_0022696_63_815 | 250 |
| 362 | 3300046530 | Ga0495654_0128698 | Ga0495654_0128698_322_1074 | 250 |
| 363 | 3300046615 | Ga0495656_0009707 | Ga0495656_0009707_801_1553 | 250 |
| 364 | 3300046615 | Ga0495656_0026136 | Ga0495656_0026136_593_1345 | 250 |
| 365 | 3300046615 | Ga0495656_0112738 | Ga0495656_0112738_30_782 | 250 |
| 366 | 3300046616 | Ga0495668_0091007 | Ga0495668_0091007_848_1600 | 250 |
| 367 | 3300046660 | Ga0495625_0286394 | Ga0495625_0286394_230_982 | 250 |
| 368 | 3300046684 | Ga0495669_0020855 | Ga0495669_0020855_22_774 | 250 |
| 369 | 3300047318 | Ga0495636_0038480 | Ga0495636_0038480_338_1090 | 250 |
| 370 | 3300047320 | Ga0495672_0112258 | Ga0495672_0112258_540_1298 | 250 |
| 371 | 3300047323 | Ga0495683_0167661 | Ga0495683_0167661_64_816 | 250 |
| 372 | 3300047470 | Ga0495681_0065774 | Ga0495681_0065774_387_1139 | 250 |
| 373 | 3300048904 | Ga0496101_0054755 | Ga0496101_0054755_394_1146 | 250 |
| 374 | 3300048905 | Ga0496102_0145128 | Ga0496102_0145128_455_1207 | 250 |
| 375 | 3300048905 | Ga0496102_0461380 | Ga0496102_0461380_208_960 | 250 |
| 376 | 3300048908 | Ga0496105_0116419 | Ga0496105_0116419_1426_2178 | 250 |
| 377 | 3300048910 | Ga0496107_0427031 | Ga0496107_0427031_211_963 | 250 |
| 378 | 3300048912 | Ga0496109_0181960 | Ga0496109_0181960_1074_1826 | 250 |
| 379 | 3300048913 | Ga0496110_0548721 | Ga0496110_0548721_145_903 | 250 |
| 380 | 3300048914 | Ga0496111_0121022 | Ga0496111_0121022_660_1418 | 250 |
| 381 | 3300048915 | Ga0496112_0597584 | Ga0496112_0597584_234_998 | 250 |
| 382 | 3300048918 | Ga0496115_0622326 | Ga0496115_0622326_82_834 | 250 |
| 383 | 3300048924 | Ga0496121_0000300 | Ga0496121_0000300_63443_64201 | 250 |
| 384 | 3300048924 | Ga0496121_0018815 | Ga0496121_0018815_4808_5560 | 250 |
| 385 | 3300048924 | Ga0496121_0177054 | Ga0496121_0177054_220_996 | 250 |
| 386 | 3300048924 | Ga0496121_0325944 | Ga0496121_0325944_208_960 | 250 |
| 387 | 3300048927 | Ga0496124_0357714 | Ga0496124_0357714_14_766 | 250 |
| 388 | 3300048928 | Ga0496125_0062738 | Ga0496125_0062738_1004_1756 | 250 |
| 389 | 3300048929 | Ga0496126_0007334 | Ga0496126_0007334_3932_4684 | 250 |
| 390 | 3300048929 | Ga0496126_0075680 | Ga0496126_0075680_1261_2013 | 250 |
| 391 | 3300050492 | nmdc:mga0yw44_32637_c1 | nmdc:mga0yw44_32637_c1_1085_1837 | 250 |
| 392 | 3300053103 | Ga0500555_011379 | Ga0500555_011379_1401_2153 | 250 |
| 393 | 3300053108 | Ga0500562_060363 | Ga0500562_060363_67_819 | 250 |
| 394 | 3300053114 | Ga0500582_001062 | Ga0500582_001062_1330_2082 | 250 |
| 395 | 3300053119 | Ga0500595_001984 | Ga0500595_001984_7521_8279 | 250 |
| 396 | 3300053119 | Ga0500595_002130 | Ga0500595_002130_7338_8090 | 250 |
| 397 | 3300053137 | Ga0500561_0049246 | Ga0500561_0049246_372_1124 | 250 |
| 398 | 3300053160 | Ga0500633_0118786 | Ga0500633_0118786_67_819 | 250 |
| 399 | 3300053730 | Ga0500645_004847 | Ga0500645_004847_779_1531 | 250 |
| 400 | iso_pu_bacteria | 2513237095 | 2513648829 | 250 |
| 401 | iso_pu_bacteria | 2513237104 | 2513721842 | 250 |
| 402 | iso_pu_bacteria | 2617270741 | 2617379113 | 250 |
| 403 | iso_pu_bacteria | 2816332527 | 2818241767 | 250 |
| 404 | iso_pu_bacteria | 2824617872 | 2824625131 | 250 |
| 405 | iso_pu_bacteria | 2824626560 | 2824634304 | 250 |
| 406 | iso_pu_bacteria | 2824635225 | 2824641641 | 250 |
| 407 | iso_pu_bacteria | 2824644064 | 2824649797 | 250 |
| 408 | iso_pu_bacteria | 2824679649 | 2824684113 | 250 |
| 409 | iso_pu_bacteria | 2824714736 | 2824719301 | 250 |
| 410 | iso_pu_bacteria | 2824723954 | 2824729146 | 250 |
| 411 | iso_pu_bacteria | 2824732956 | 2824737094 | 250 |
| 412 | iso_pu_bacteria | 2824746037 | 2824752246 | 250 |
| 413 | iso_pu_bacteria | 2857509624 | 2857509792 | 250 |
| 414 | iso_pu_bacteria | 2876761206 | 2876762808 | 250 |
| 415 | iso_pu_bacteria | 2881364244 | 2881367589 | 250 |
| 416 | iso_pu_bacteria | 2888378607 | 2888382275 | 250 |
| 417 | iso_pu_bacteria | 2906626472 | 2906634625 | 250 |
| 418 | iso_pu_bacteria | 2908775508 | 2908778548 | 250 |
| 419 | iso_pu_bacteria | 2922393267 | 2922394813 | 250 |
| 420 | iso_pu_bacteria | 2935769743 | 2935771334 | 250 |
| 421 | iso_pu_bacteria | 2935777560 | 2935779021 | 250 |
| 422 | iso_pu_bacteria | 2935785616 | 2935788228 | 250 |
| 423 | iso_pu_bacteria | 2935793552 | 2935797007 | 250 |
| 424 | iso_pu_bacteria | 3005587118 | 3005589283 | 250 |
| 425 | iso_pu_bacteria | 8016522445 | 8016523057 | 250 |
| 426 | iso_pu_bacteria | 8016530956 | 8016536523 | 250 |
| 427 | iso_pu_bacteria | 8016539877 | 8016540802 | 250 |
| 428 | iso_pu_bacteria | 8016548790 | 8016552442 | 250 |
| 429 | iso_pu_bacteria | 8016557553 | 8016560825 | 250 |
| 430 | iso_pu_bacteria | 8016566248 | 8016574885 | 250 |
| 431 | iso_pu_bacteria | 8016575299 | 8016578954 | 250 |
| 432 | iso_pu_bacteria | 8016595262 | 8016598697 | 250 |
| 433 | iso_pu_bacteria | 8016603502 | 8016612388 | 250 |
| 434 | iso_pu_bacteria | 8016613128 | 8016621416 | 250 |
| 435 | iso_pu_bacteria | 8016622563 | 8016628535 | 250 |
| 436 | iso_pu_bacteria | 8019530166 | 8019536236 | 250 |
| 437 | iso_pu_bacteria | 8019538911 | 8019543226 | 250 |
| 438 | 3300001979 | JGI24740J21852_10002642 | JGI24740J21852_100026429 | 251 |
| 439 | 3300001989 | JGI24739J22299_10015078 | JGI24739J22299_100150785 | 251 |
| 440 | 3300001990 | JGI24737J22298_10011358 | JGI24737J22298_100113585 | 251 |
| 441 | 3300002067 | JGI24735J21928_10082505 | JGI24735J21928_100825052 | 251 |
| 442 | 3300005330 | Ga0070690_100133192 | Ga0070690_1001331922 | 251 |
| 443 | 3300005336 | Ga0070680_100012789 | Ga0070680_1000127892 | 251 |
| 444 | 3300005336 | Ga0070680_100103391 | Ga0070680_1001033914 | 251 |
| 445 | 3300005354 | Ga0070675_100609162 | Ga0070675_1006091621 | 251 |
| 446 | 3300005434 | Ga0070709_10053772 | Ga0070709_100537723 | 251 |
| 447 | 3300005434 | Ga0070709_10068963 | Ga0070709_100689632 | 251 |
| 448 | 3300005435 | Ga0070714_100004662 | Ga0070714_1000046629 | 251 |
| 449 | 3300005435 | Ga0070714_100611800 | Ga0070714_1006118002 | 251 |
| 450 | 3300005436 | Ga0070713_100955749 | Ga0070713_1009557491 | 251 |
| 451 | 3300005437 | Ga0070710_10003916 | Ga0070710_100039164 | 251 |
| 452 | 3300005439 | Ga0070711_100028398 | Ga0070711_1000283984 | 251 |
| 453 | 3300005439 | Ga0070711_100132226 | Ga0070711_1001322262 | 251 |
| 454 | 3300005439 | Ga0070711_100159102 | Ga0070711_1001591022 | 251 |
| 455 | 3300005458 | Ga0070681_10120730 | Ga0070681_101207303 | 251 |
| 456 | 3300005467 | Ga0070706_100209873 | Ga0070706_1002098731 | 251 |
| 457 | 3300005530 | Ga0070679_100040901 | Ga0070679_1000409011 | 251 |
| 458 | 3300005539 | Ga0068853_100089056 | Ga0068853_1000890562 | 251 |
| 459 | 3300005539 | Ga0068853_100100944 | Ga0068853_1001009442 | 251 |
| 460 | 3300005539 | Ga0068853_100380677 | Ga0068853_1003806772 | 251 |
| 461 | 3300005544 | Ga0070686_100431401 | Ga0070686_1004314011 | 251 |
| 462 | 3300005563 | Ga0068855_100024662 | Ga0068855_1000246629 | 251 |
| 463 | 3300005563 | Ga0068855_100025884 | Ga0068855_10002588411 | 251 |
| 464 | 3300005577 | Ga0068857_100026380 | Ga0068857_1000263803 | 251 |
| 465 | 3300005577 | Ga0068857_100027238 | Ga0068857_1000272382 | 251 |
| 466 | 3300005578 | Ga0068854_100008796 | Ga0068854_1000087965 | 251 |
| 467 | 3300005578 | Ga0068854_100018770 | Ga0068854_1000187703 | 251 |
| 468 | 3300005578 | Ga0068854_100018967 | Ga0068854_1000189673 | 251 |
| 469 | 3300005614 | Ga0068856_100000140 | Ga0068856_10000014073 | 251 |
| 470 | 3300005614 | Ga0068856_100013132 | Ga0068856_1000131323 | 251 |
| 471 | 3300005616 | Ga0068852_100019510 | Ga0068852_1000195102 | 251 |
| 472 | 3300005834 | Ga0068851_10014629 | Ga0068851_100146292 | 251 |
| 473 | 3300005834 | Ga0068851_10053146 | Ga0068851_100531462 | 251 |
| 474 | 3300005841 | Ga0068863_100080741 | Ga0068863_1000807414 | 251 |
| 475 | 3300005843 | Ga0068860_100000161 | Ga0068860_10000016122 | 251 |
| 476 | 3300006028 | Ga0070717_10039333 | Ga0070717_100393334 | 251 |
| 477 | 3300006038 | Ga0075365_10023940 | Ga0075365_100239402 | 251 |
| 478 | 3300006163 | Ga0070715_10002040 | Ga0070715_100020408 | 251 |
| 479 | 3300006173 | Ga0070716_100022589 | Ga0070716_1000225894 | 251 |
| 480 | 3300006175 | Ga0070712_100013473 | Ga0070712_1000134734 | 251 |
| 481 | 3300006175 | Ga0070712_100221322 | Ga0070712_1002213222 | 251 |
| 482 | 3300007265 | Ga0099794_10019670 | Ga0099794_100196703 | 251 |
| 483 | 3300007788 | Ga0099795_10032764 | Ga0099795_100327642 | 251 |
| 484 | 3300009093 | Ga0105240_10009118 | Ga0105240_1000911811 | 251 |
| 485 | 3300009093 | Ga0105240_10027340 | Ga0105240_1002734010 | 251 |
| 486 | 3300009093 | Ga0105240_10094344 | Ga0105240_100943442 | 251 |
| 487 | 3300009174 | Ga0105241_10018928 | Ga0105241_100189282 | 251 |
| 488 | 3300009545 | Ga0105237_10141592 | Ga0105237_101415923 | 251 |
| 489 | 3300009545 | Ga0105237_10147841 | Ga0105237_101478412 | 251 |
| 490 | 3300009551 | Ga0105238_10003151 | Ga0105238_1000315117 | 251 |
| 491 | 3300009551 | Ga0105238_10049938 | Ga0105238_100499384 | 251 |
| 492 | 3300009551 | Ga0105238_10440859 | Ga0105238_104408592 | 251 |
| 493 | 3300010159 | Ga0099796_10001299 | Ga0099796_100012994 | 251 |
| 494 | 3300010375 | Ga0105239_10023167 | Ga0105239_100231672 | 251 |
| 495 | 3300010375 | Ga0105239_10041893 | Ga0105239_100418934 | 251 |
| 496 | 3300010375 | Ga0105239_10057368 | Ga0105239_100573682 | 251 |
| 497 | 3300010375 | Ga0105239_10143426 | Ga0105239_101434262 | 251 |
| 498 | 3300011119 | Ga0105246_10290427 | Ga0105246_102904272 | 251 |
| 499 | 3300013102 | Ga0157371_10037559 | Ga0157371_100375592 | 251 |
| 500 | 3300013104 | Ga0157370_10028441 | Ga0157370_100284412 | 251 |
| 501 | 3300013296 | Ga0157374_10566303 | Ga0157374_105663032 | 251 |
| 502 | 3300013297 | Ga0157378_10012316 | Ga0157378_1001231610 | 251 |
| 503 | 3300013308 | Ga0157375_10673512 | Ga0157375_106735121 | 251 |
| 504 | 3300021384 | Ga0213876_10009102 | Ga0213876_100091023 | 251 |
| 505 | 3300025297 | Ga0209758_1006166 | Ga0209758_10061663 | 251 |
| 506 | 3300025321 | Ga0207656_10014093 | Ga0207656_100140934 | 251 |
| 507 | 3300025898 | Ga0207692_10005248 | Ga0207692_100052484 | 251 |
| 508 | 3300025901 | Ga0207688_10080342 | Ga0207688_100803422 | 251 |
| 509 | 3300025905 | Ga0207685_10024778 | Ga0207685_100247783 | 251 |
| 510 | 3300025911 | Ga0207654_10000123 | Ga0207654_100001232 | 251 |
| 511 | 3300025912 | Ga0207707_10012352 | Ga0207707_100123525 | 251 |
| 512 | 3300025912 | Ga0207707_10158396 | Ga0207707_101583962 | 251 |
| 513 | 3300025913 | Ga0207695_10009321 | Ga0207695_100093216 | 251 |
| 514 | 3300025913 | Ga0207695_10038444 | Ga0207695_100384442 | 251 |
| 515 | 3300025913 | Ga0207695_10217083 | Ga0207695_102170832 | 251 |
| 516 | 3300025914 | Ga0207671_10077109 | Ga0207671_100771092 | 251 |
| 517 | 3300025914 | Ga0207671_10192177 | Ga0207671_101921771 | 251 |
| 518 | 3300025915 | Ga0207693_10008696 | Ga0207693_100086969 | 251 |
| 519 | 3300025915 | Ga0207693_10368988 | Ga0207693_103689881 | 251 |
| 520 | 3300025916 | Ga0207663_10000967 | Ga0207663_100009674 | 251 |
| 521 | 3300025916 | Ga0207663_10433807 | Ga0207663_104338071 | 251 |
| 522 | 3300025924 | Ga0207694_10000810 | Ga0207694_100008102 | 251 |
| 523 | 3300025924 | Ga0207694_10062596 | Ga0207694_100625962 | 251 |
| 524 | 3300025933 | Ga0207706_10144673 | Ga0207706_101446731 | 251 |
| 525 | 3300025939 | Ga0207665_10007992 | Ga0207665_100079928 | 251 |
| 526 | 3300025949 | Ga0207667_10050594 | Ga0207667_100505943 | 251 |
| 527 | 3300025949 | Ga0207667_10084657 | Ga0207667_100846574 | 251 |
| 528 | 3300025960 | Ga0207651_10118622 | Ga0207651_101186224 | 251 |
| 529 | 3300025981 | Ga0207640_10011447 | Ga0207640_100114473 | 251 |
| 530 | 3300025981 | Ga0207640_10035802 | Ga0207640_100358024 | 251 |
| 531 | 3300025981 | Ga0207640_10107087 | Ga0207640_101070872 | 251 |
| 532 | 3300025981 | Ga0207640_10225956 | Ga0207640_102259562 | 251 |
| 533 | 3300026041 | Ga0207639_10049520 | Ga0207639_100495202 | 251 |
| 534 | 3300026067 | Ga0207678_10023438 | Ga0207678_100234383 | 251 |
| 535 | 3300026067 | Ga0207678_10192961 | Ga0207678_101929611 | 251 |
| 536 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005441 | 251 |
| 537 | 3300026078 | Ga0207702_10000261 | Ga0207702_1000026129 | 251 |
| 538 | 3300026078 | Ga0207702_10059332 | Ga0207702_100593321 | 251 |
| 539 | 3300026078 | Ga0207702_10553327 | Ga0207702_105533271 | 251 |
| 540 | 3300026088 | Ga0207641_10679899 | Ga0207641_106798991 | 251 |
| 541 | 3300026095 | Ga0207676_10448073 | Ga0207676_104480732 | 251 |
| 542 | 3300026116 | Ga0207674_10008432 | Ga0207674_100084323 | 251 |
| 543 | 3300026116 | Ga0207674_10016966 | Ga0207674_1001696610 | 251 |
| 544 | 3300026116 | Ga0207674_10946740 | Ga0207674_109467401 | 251 |
| 545 | 3300026142 | Ga0207698_10024150 | Ga0207698_100241502 | 251 |
| 546 | 3300026142 | Ga0207698_10394450 | Ga0207698_103944502 | 251 |
| 547 | 3300027512 | Ga0209179_1002826 | Ga0209179_10028262 | 251 |
| 548 | 3300028381 | Ga0268264_10000096 | Ga0268264_10000096126 | 251 |
| 549 | 3300028573 | Ga0265334_10016764 | Ga0265334_100167643 | 251 |
| 550 | 3300028786 | Ga0307517_10000049 | Ga0307517_10000049161 | 251 |
| 551 | 3300031235 | Ga0265330_10014486 | Ga0265330_100144865 | 251 |
| 552 | 3300031247 | Ga0265340_10005635 | Ga0265340_100056356 | 251 |
| 553 | 3300031249 | Ga0265339_10197133 | Ga0265339_101971331 | 251 |
| 554 | 3300031507 | Ga0307509_10348882 | Ga0307509_103488821 | 251 |
| 555 | 3300031616 | Ga0307508_10000168 | Ga0307508_1000016862 | 251 |
| 556 | 3300031616 | Ga0307508_10084175 | Ga0307508_100841753 | 251 |
| 557 | 3300031711 | Ga0265314_10054438 | Ga0265314_100544383 | 251 |
| 558 | 3300031712 | Ga0265342_10052350 | Ga0265342_100523503 | 251 |
| 559 | 3300031730 | Ga0307516_10137292 | Ga0307516_101372922 | 251 |
| 560 | 3300033180 | Ga0307510_10015971 | Ga0307510_100159713 | 251 |
| 561 | 3300035111 | Ga0373923_0168093 | Ga0373923_0168093_180_935 | 251 |
| 562 | 3300035113 | Ga0373936_0027445 | Ga0373936_0027445_640_1398 | 251 |
| 563 | 3300035116 | Ga0373945_0024492 | Ga0373945_0024492_848_1606 | 251 |
| 564 | 3300035118 | Ga0373954_0045048 | Ga0373954_0045048_1272_2027 | 251 |
| 565 | 3300035118 | Ga0373954_0109224 | Ga0373954_0109224_566_1324 | 251 |
| 566 | 3300035118 | Ga0373954_0205639 | Ga0373954_0205639_187_942 | 251 |
| 567 | 3300035119 | Ga0373956_0017735 | Ga0373956_0017735_125_880 | 251 |
| 568 | 3300035172 | Ga0373955_0004802 | Ga0373955_0004802_118_873 | 251 |
| 569 | 3300035172 | Ga0373955_0369661 | Ga0373955_0369661_79_834 | 251 |
| 570 | 3300035410 | Ga0373924_0088147 | Ga0373924_0088147_193_948 | 251 |
| 571 | 3300035692 | Ga0373935_0037854 | Ga0373935_0037854_735_1493 | 251 |
| 572 | 3300035695 | Ga0373927_0005668 | Ga0373927_0005668_4017_4775 | 251 |
| 573 | 3300035724 | Ga0373933_0000124 | Ga0373933_0000124_10832_11596 | 251 |
| 574 | 3300035724 | Ga0373933_0020774 | Ga0373933_0020774_818_1573 | 251 |
| 575 | 3300035724 | Ga0373933_0054242 | Ga0373933_0054242_1582_2337 | 251 |
| 576 | 3300035725 | Ga0373947_0004083 | Ga0373947_0004083_3830_4588 | 251 |
| 577 | 3300036401 | Ga0373937_0026270 | Ga0373937_0026270_4391_5146 | 251 |
| 578 | 3300036401 | Ga0373937_0205770 | Ga0373937_0205770_523_1281 | 251 |
| 579 | 3300037068 | Ga0373925_0006216 | Ga0373925_0006216_6024_6782 | 251 |
| 580 | 3300037068 | Ga0373925_0050641 | Ga0373925_0050641_1020_1778 | 251 |
| 581 | 3300037068 | Ga0373925_0243367 | Ga0373925_0243367_276_1031 | 251 |
| 582 | 3300039437 | Ga0436365_0547035 | Ga0436365_0547035_1863_2627 | 251 |
| 583 | 3300039450 | Ga0436363_1041317 | Ga0436363_1041317_264_1043 | 251 |
| 584 | 3300039453 | Ga0436362_0214249 | Ga0436362_0214249_1735_2499 | 251 |
| 585 | 3300041512 | Ga0451853_2263250 | Ga0451853_2263250_610_1377 | 251 |
| 586 | 3300044656 | Ga0466969_0043915 | Ga0466969_0043915_262_1017 | 251 |
| 587 | 3300046454 | Ga0495592_0022949 | Ga0495592_0022949_520_1275 | 251 |
| 588 | 3300046454 | Ga0495592_0039060 | Ga0495592_0039060_250_1008 | 251 |
| 589 | 3300046455 | Ga0495603_0005079 | Ga0495603_0005079_5352_6110 | 251 |
| 590 | 3300046459 | Ga0495629_0000672 | Ga0495629_0000672_21632_22390 | 251 |
| 591 | 3300046459 | Ga0495629_0388293 | Ga0495629_0388293_124_879 | 251 |
| 592 | 3300046459 | Ga0495629_0466086 | Ga0495629_0466086_41_799 | 251 |
| 593 | 3300046461 | Ga0495641_0076584 | Ga0495641_0076584_601_1359 | 251 |
| 594 | 3300046462 | Ga0495651_0022682 | Ga0495651_0022682_2673_3428 | 251 |
| 595 | 3300046463 | Ga0495653_0122576 | Ga0495653_0122576_638_1396 | 251 |
| 596 | 3300046463 | Ga0495653_0277783 | Ga0495653_0277783_334_1089 | 251 |
| 597 | 3300046472 | Ga0495580_0012605 | Ga0495580_0012605_5098_5856 | 251 |
| 598 | 3300046473 | Ga0495582_0000336 | Ga0495582_0000336_6117_6875 | 251 |
| 599 | 3300046475 | Ga0495639_0000154 | Ga0495639_0000154_16481_17239 | 251 |
| 600 | 3300046476 | Ga0495662_0003756 | Ga0495662_0003756_6738_7496 | 251 |
| 601 | 3300046477 | Ga0495664_0013710 | Ga0495664_0013710_3705_4463 | 251 |
| 602 | 3300046477 | Ga0495664_0020483 | Ga0495664_0020483_1186_1941 | 251 |
| 603 | 3300046477 | Ga0495664_0128800 | Ga0495664_0128800_672_1427 | 251 |
| 604 | 3300046499 | Ga0495594_0002042 | Ga0495594_0002042_4929_5687 | 251 |
| 605 | 3300046511 | Ga0495608_0021126 | Ga0495608_0021126_2892_3647 | 251 |
| 606 | 3300046516 | Ga0495628_0014412 | Ga0495628_0014412_825_1580 | 251 |
| 607 | 3300046516 | Ga0495628_0474660 | Ga0495628_0474660_66_824 | 251 |
| 608 | 3300046517 | Ga0495630_0008732 | Ga0495630_0008732_3670_4428 | 251 |
| 609 | 3300046529 | Ga0495652_0251335 | Ga0495652_0251335_478_1233 | 251 |
| 610 | 3300046531 | Ga0495665_0012053 | Ga0495665_0012053_3063_3821 | 251 |
| 611 | 3300046533 | Ga0495640_0008600 | Ga0495640_0008600_3933_4691 | 251 |
| 612 | 3300046536 | Ga0495587_0185504 | Ga0495587_0185504_196_951 | 251 |
| 613 | 3300046543 | Ga0495645_0017715 | Ga0495645_0017715_2107_2862 | 251 |
| 614 | 3300046559 | Ga0495667_0221498 | Ga0495667_0221498_282_1040 | 251 |
| 615 | 3300046642 | Ga0495634_0005666 | Ga0495634_0005666_3876_4634 | 251 |
| 616 | 3300046642 | Ga0495634_0084954 | Ga0495634_0084954_509_1264 | 251 |
| 617 | 3300046642 | Ga0495634_0136396 | Ga0495634_0136396_724_1485 | 251 |
| 618 | 3300046663 | Ga0495635_0010397 | Ga0495635_0010397_2702_3460 | 251 |
| 619 | 3300046663 | Ga0495635_0049581 | Ga0495635_0049581_1243_1998 | 251 |
| 620 | 3300046674 | Ga0495588_0165570 | Ga0495588_0165570_59_817 | 251 |
| 621 | 3300046675 | Ga0495657_0091513 | Ga0495657_0091513_157_912 | 251 |
| 622 | 3300046678 | Ga0495599_0029454 | Ga0495599_0029454_2107_2862 | 251 |
| 623 | 3300046678 | Ga0495599_0277214 | Ga0495599_0277214_95_850 | 251 |
| 624 | 3300046679 | Ga0495623_0072074 | Ga0495623_0072074_390_1145 | 251 |
| 625 | 3300046680 | Ga0495646_0023543 | Ga0495646_0023543_1131_1886 | 251 |
| 626 | 3300046680 | Ga0495646_0043244 | Ga0495646_0043244_83_841 | 251 |
| 627 | 3300046681 | Ga0495647_0009564 | Ga0495647_0009564_1767_2525 | 251 |
| 628 | 3300046683 | Ga0495658_0005565 | Ga0495658_0005565_4704_5462 | 251 |
| 629 | 3300046689 | Ga0495613_0014087 | Ga0495613_0014087_3886_4644 | 251 |
| 630 | 3300046689 | Ga0495613_0284320 | Ga0495613_0284320_356_1111 | 251 |
| 631 | 3300046690 | Ga0495624_0002880 | Ga0495624_0002880_6766_7524 | 251 |
| 632 | 3300046809 | Ga0495600_0015717 | Ga0495600_0015717_443_1198 | 251 |
| 633 | 3300046809 | Ga0495600_0063345 | Ga0495600_0063345_1630_2385 | 251 |
| 634 | 3300047315 | Ga0495581_0004403 | Ga0495581_0004403_6758_7516 | 251 |
| 635 | 3300047317 | Ga0495604_0162220 | Ga0495604_0162220_338_1093 | 251 |
| 636 | 3300047319 | Ga0495674_0005189 | Ga0495674_0005189_3731_4489 | 251 |
| 637 | 3300047319 | Ga0495674_0027448 | Ga0495674_0027448_3652_4407 | 251 |
| 638 | 3300047321 | Ga0495676_0058263 | Ga0495676_0058263_1358_2116 | 251 |
| 639 | 3300047322 | Ga0495680_0031150 | Ga0495680_0031150_423_1178 | 251 |
| 640 | 3300047322 | Ga0495680_0263401 | Ga0495680_0263401_423_1178 | 251 |
| 641 | 3300047444 | Ga0495675_0105808 | Ga0495675_0105808_489_1244 | 251 |
| 642 | 3300047471 | Ga0495684_0043074 | Ga0495684_0043074_2472_3227 | 251 |
| 643 | 3300047472 | Ga0495686_0114846 | Ga0495686_0114846_734_1498 | 251 |
| 644 | 3300047673 | Ga0495593_0003415 | Ga0495593_0003415_6738_7496 | 251 |
| 645 | 3300048088 | Ga0495602_0410031 | Ga0495602_0410031_17_772 | 251 |
| 646 | 3300048903 | Ga0496100_0098849 | Ga0496100_0098849_294_1049 | 251 |
| 647 | 3300048905 | Ga0496102_0305550 | Ga0496102_0305550_325_1080 | 251 |
| 648 | 3300048907 | Ga0496104_0204040 | Ga0496104_0204040_121_876 | 251 |
| 649 | 3300048909 | Ga0496106_0009237 | Ga0496106_0009237_2752_3507 | 251 |
| 650 | 3300048909 | Ga0496106_0339048 | Ga0496106_0339048_421_1176 | 251 |
| 651 | 3300048910 | Ga0496107_0013255 | Ga0496107_0013255_1292_2047 | 251 |
| 652 | 3300048910 | Ga0496107_0445027 | Ga0496107_0445027_174_929 | 251 |
| 653 | 3300048911 | Ga0496108_0000380 | Ga0496108_0000380_26120_26875 | 251 |
| 654 | 3300048911 | Ga0496108_0063689 | Ga0496108_0063689_155_910 | 251 |
| 655 | 3300048912 | Ga0496109_0000887 | Ga0496109_0000887_15155_15910 | 251 |
| 656 | 3300048912 | Ga0496109_0168020 | Ga0496109_0168020_1178_1933 | 251 |
| 657 | 3300048912 | Ga0496109_0288742 | Ga0496109_0288742_429_1184 | 251 |
| 658 | 3300048913 | Ga0496110_0026404 | Ga0496110_0026404_2059_2814 | 251 |
| 659 | 3300048913 | Ga0496110_0037493 | Ga0496110_0037493_2956_3711 | 251 |
| 660 | 3300048913 | Ga0496110_0089901 | Ga0496110_0089901_176_931 | 251 |
| 661 | 3300048913 | Ga0496110_0865764 | Ga0496110_0865764_41_796 | 251 |
| 662 | 3300048914 | Ga0496111_0138437 | Ga0496111_0138437_597_1352 | 251 |
| 663 | 3300048915 | Ga0496112_0019379 | Ga0496112_0019379_1617_2372 | 251 |
| 664 | 3300048915 | Ga0496112_0028537 | Ga0496112_0028537_4488_5243 | 251 |
| 665 | 3300048915 | Ga0496112_0039717 | Ga0496112_0039717_1688_2443 | 251 |
| 666 | 3300048918 | Ga0496115_0356559 | Ga0496115_0356559_263_1018 | 251 |
| 667 | 3300048919 | Ga0496116_0210268 | Ga0496116_0210268_167_922 | 251 |
| 668 | 3300048920 | Ga0496117_0006861 | Ga0496117_0006861_1745_2500 | 251 |
| 669 | 3300048920 | Ga0496117_0121802 | Ga0496117_0121802_663_1427 | 251 |
| 670 | 3300048921 | Ga0496118_0018608 | Ga0496118_0018608_5401_6156 | 251 |
| 671 | 3300048924 | Ga0496121_0001712 | Ga0496121_0001712_26645_27409 | 251 |
| 672 | 3300048924 | Ga0496121_0017013 | Ga0496121_0017013_218_973 | 251 |
| 673 | 3300048927 | Ga0496124_0007174 | Ga0496124_0007174_10356_11111 | 251 |
| 674 | 3300048927 | Ga0496124_0141336 | Ga0496124_0141336_1100_1855 | 251 |
| 675 | 3300048927 | Ga0496124_0247129 | Ga0496124_0247129_100_879 | 251 |
| 676 | 3300048929 | Ga0496126_0007237 | Ga0496126_0007237_10362_11147 | 251 |
| 677 | 3300048929 | Ga0496126_0083011 | Ga0496126_0083011_1544_2302 | 251 |
| 678 | 3300048929 | Ga0496126_0137806 | Ga0496126_0137806_1263_2042 | 251 |
| 679 | 3300048929 | Ga0496126_0335678 | Ga0496126_0335678_349_1104 | 251 |
| 680 | 3300049568 | Ga0501031_0010682 | Ga0501031_0010682_1289_2047 | 251 |
| 681 | 3300049568 | Ga0501031_0280212 | Ga0501031_0280212_286_1044 | 251 |
| 682 | 3300049569 | Ga0501032_0000038 | Ga0501032_0000038_75874_76632 | 251 |
| 683 | 3300049569 | Ga0501032_0034799 | Ga0501032_0034799_2383_3141 | 251 |
| 684 | 3300049569 | Ga0501032_0182504 | Ga0501032_0182504_261_1019 | 251 |
| 685 | 3300049570 | Ga0501033_0000222 | Ga0501033_0000222_40298_41056 | 251 |
| 686 | 3300049570 | Ga0501033_0002083 | Ga0501033_0002083_1637_2395 | 251 |
| 687 | 3300049570 | Ga0501033_0305921 | Ga0501033_0305921_297_1055 | 251 |
| 688 | 3300049571 | Ga0501034_0000228 | Ga0501034_0000228_86881_87639 | 251 |
| 689 | 3300049571 | Ga0501034_0247532 | Ga0501034_0247532_144_902 | 251 |
| 690 | 3300049571 | Ga0501034_0568128 | Ga0501034_0568128_232_996 | 251 |
| 691 | 3300049571 | Ga0501034_0598238 | Ga0501034_0598238_50_808 | 251 |
| 692 | 3300049572 | Ga0501036_0001157 | Ga0501036_0001157_2993_3751 | 251 |
| 693 | 3300049572 | Ga0501036_0022021 | Ga0501036_0022021_1951_2709 | 251 |
| 694 | 3300049572 | Ga0501036_0054330 | Ga0501036_0054330_1564_2322 | 251 |
| 695 | 3300049572 | Ga0501036_0175239 | Ga0501036_0175239_848_1606 | 251 |
| 696 | 3300049573 | Ga0501037_0000291 | Ga0501037_0000291_23424_24182 | 251 |
| 697 | 3300049573 | Ga0501037_0076565 | Ga0501037_0076565_517_1275 | 251 |
| 698 | 3300049573 | Ga0501037_0233620 | Ga0501037_0233620_126_884 | 251 |
| 699 | 3300049574 | Ga0501038_0000079 | Ga0501038_0000079_18490_19248 | 251 |
| 700 | 3300049574 | Ga0501038_0000782 | Ga0501038_0000782_1644_2402 | 251 |
| 701 | 3300049574 | Ga0501038_0018111 | Ga0501038_0018111_4978_5736 | 251 |
| 702 | 3300049575 | Ga0501039_0005342 | Ga0501039_0005342_4986_5744 | 251 |
| 703 | 3300049575 | Ga0501039_0024316 | Ga0501039_0024316_1154_1912 | 251 |
| 704 | 3300049575 | Ga0501039_0100222 | Ga0501039_0100222_254_1012 | 251 |
| 705 | 3300049575 | Ga0501039_0177994 | Ga0501039_0177994_377_1135 | 251 |
| 706 | 3300049576 | Ga0501040_0396527 | Ga0501040_0396527_141_899 | 251 |
| 707 | 3300049577 | Ga0501041_0293731 | Ga0501041_0293731_71_829 | 251 |
| 708 | 3300049578 | Ga0501042_0026138 | Ga0501042_0026138_3274_4032 | 251 |
| 709 | 3300049579 | Ga0501043_0000021 | Ga0501043_0000021_74308_75066 | 251 |
| 710 | 3300049579 | Ga0501043_0009067 | Ga0501043_0009067_2739_3497 | 251 |
| 711 | 3300049579 | Ga0501043_0037854 | Ga0501043_0037854_1171_1929 | 251 |
| 712 | 3300049580 | Ga0501046_0000632 | Ga0501046_0000632_17509_18267 | 251 |
| 713 | 3300049580 | Ga0501046_0114383 | Ga0501046_0114383_360_1118 | 251 |
| 714 | 3300049581 | Ga0501047_0000041 | Ga0501047_0000041_78406_79164 | 251 |
| 715 | 3300049581 | Ga0501047_0382266 | Ga0501047_0382266_301_1059 | 251 |
| 716 | 3300049582 | Ga0501048_0002271 | Ga0501048_0002271_9773_10531 | 251 |
| 717 | 3300049583 | Ga0501067_0000411 | Ga0501067_0000411_4180_4938 | 251 |
| 718 | 3300049584 | Ga0501068_0003389 | Ga0501068_0003389_6468_7226 | 251 |
| 719 | 3300049584 | Ga0501068_0418964 | Ga0501068_0418964_68_826 | 251 |
| 720 | 3300049585 | Ga0501069_0017775 | Ga0501069_0017775_1228_1986 | 251 |
| 721 | 3300049586 | Ga0501070_0012019 | Ga0501070_0012019_1966_2724 | 251 |
| 722 | 3300049586 | Ga0501070_0097042 | Ga0501070_0097042_902_1660 | 251 |
| 723 | 3300049586 | Ga0501070_0302529 | Ga0501070_0302529_185_949 | 251 |
| 724 | 3300049587 | Ga0501071_0003588 | Ga0501071_0003588_1495_2253 | 251 |
| 725 | 3300049588 | Ga0501072_0023902 | Ga0501072_0023902_19_777 | 251 |
| 726 | 3300049589 | Ga0501073_0000056 | Ga0501073_0000056_26577_27335 | 251 |
| 727 | 3300049590 | Ga0501074_0007359 | Ga0501074_0007359_4640_5398 | 251 |
| 728 | 3300049741 | Ga0501079_0001331 | Ga0501079_0001331_328_1086 | 251 |
| 729 | 3300049741 | Ga0501079_0220792 | Ga0501079_0220792_250_1008 | 251 |
| 730 | 3300049742 | Ga0501080_0000138 | Ga0501080_0000138_50026_50784 | 251 |
| 731 | 3300049742 | Ga0501080_0091226 | Ga0501080_0091226_1255_2013 | 251 |
| 732 | 3300049822 | Ga0501035_0000090 | Ga0501035_0000090_26577_27335 | 251 |
| 733 | 3300049822 | Ga0501035_0108401 | Ga0501035_0108401_135_893 | 251 |
| 734 | 3300049822 | Ga0501035_0236731 | Ga0501035_0236731_742_1500 | 251 |
| 735 | 3300049823 | Ga0501044_0000054 | Ga0501044_0000054_62236_62994 | 251 |
| 736 | 3300049823 | Ga0501044_0060341 | Ga0501044_0060341_1773_2531 | 251 |
| 737 | 3300049823 | Ga0501044_0062701 | Ga0501044_0062701_362_1120 | 251 |
| 738 | 3300049823 | Ga0501044_0086405 | Ga0501044_0086405_1044_1802 | 251 |
| 739 | 3300049824 | Ga0501045_0088054 | Ga0501045_0088054_1477_2235 | 251 |
| 740 | 3300050492 | nmdc:mga0yw44_34378_c1 | nmdc:mga0yw44_34378_c1_1989_2744 | 251 |
| 741 | 3300050516 | nmdc:mga0sz30_91464_c1 | nmdc:mga0sz30_91464_c1_114_881 | 251 |
| 742 | 3300053077 | Ga0495601_0011980 | Ga0495601_0011980_2842_3597 | 251 |
| 743 | 3300053078 | Ga0495612_0173189 | Ga0495612_0173189_25_780 | 251 |
| 744 | 3300053080 | Ga0500635_0008610 | Ga0500635_0008610_195_968 | 251 |
| 745 | 3300053085 | Ga0495619_0127020 | Ga0495619_0127020_585_1343 | 251 |
| 746 | 3300053093 | Ga0500651_0011575 | Ga0500651_0011575_62_826 | 251 |
| 747 | 3300053094 | Ga0500566_0004641 | Ga0500566_0004641_5165_5920 | 251 |
| 748 | 3300053096 | Ga0500641_0182371 | Ga0500641_0182371_37_801 | 251 |
| 749 | 3300053102 | Ga0500554_000726 | Ga0500554_000726_2911_3684 | 251 |
| 750 | 3300053111 | Ga0500572_001185 | Ga0500572_001185_37_816 | 251 |
| 751 | 3300053119 | Ga0500595_001479 | Ga0500595_001479_2705_3469 | 251 |
| 752 | 3300053119 | Ga0500595_006059 | Ga0500595_006059_766_1521 | 251 |
| 753 | 3300053136 | Ga0500559_0000581 | Ga0500559_0000581_11035_11814 | 251 |
| 754 | 3300053136 | Ga0500559_0007362 | Ga0500559_0007362_277_1032 | 251 |
| 755 | 3300053136 | Ga0500559_0250577 | Ga0500559_0250577_54_809 | 251 |
| 756 | 3300053140 | Ga0500573_0023333 | Ga0500573_0023333_419_1174 | 251 |
| 757 | 3300053150 | Ga0500603_001051 | Ga0500603_001051_1886_2659 | 251 |
| 758 | 3300053150 | Ga0500603_018903 | Ga0500603_018903_142_897 | 251 |
| 759 | 3300053162 | Ga0500638_002099 | Ga0500638_002099_1878_2633 | 251 |
| 760 | 3300053163 | Ga0500639_026058 | Ga0500639_026058_2294_3073 | 251 |
| 761 | 3300053177 | Ga0500636_0023252 | Ga0500636_0023252_2601_3359 | 251 |
| 762 | 3300053178 | Ga0500637_0000107 | Ga0500637_0000107_22423_23178 | 251 |
| 763 | 3300053178 | Ga0500637_0000325 | Ga0500637_0000325_2994_3767 | 251 |
| 764 | 3300053735 | Ga0500596_001376 | Ga0500596_001376_92_871 | 251 |
| 765 | 3300053735 | Ga0500596_010189 | Ga0500596_010189_615_1370 | 251 |
| 766 | 3300054114 | Ga0501084_0025430 | Ga0501084_0025430_1848_2606 | 251 |
| 767 | 3300055283 | Ga0500661_002117 | Ga0500661_002117_2760_3515 | 251 |
| 768 | 3300060353 | Ga0501082_0127365 | Ga0501082_0127365_955_1713 | 251 |
| 769 | iso_pu_bacteria | 2515154112 | 2515629969 | 251 |
| 770 | iso_pu_bacteria | 2874590934 | 2874593389 | 251 |
| 771 | iso_pu_bacteria | 2874645413 | 2874652836 | 251 |
| 772 | iso_pu_bacteria | 2876771140 | 2876773429 | 251 |
| 773 | iso_pu_bacteria | 2876818435 | 2876821382 | 251 |
| 774 | iso_pu_bacteria | 2879074833 | 2879077345 | 251 |
| 775 | iso_pu_bacteria | 2879127579 | 2879127778 | 251 |
| 776 | iso_pu_bacteria | 2879142872 | 2879143009 | 251 |
| 777 | iso_pu_bacteria | 2935608549 | 2935610904 | 251 |
| 778 | iso_pu_bacteria | 2935819856 | 2935820388 | 251 |
| 779 | iso_pu_bacteria | 2935847175 | 2935849602 | 251 |
| 780 | iso_pu_bacteria | 2935908558 | 2935911625 | 251 |
| 781 | iso_pu_bacteria | 2935916978 | 2935919279 | 251 |
| 782 | iso_pu_bacteria | 2935926038 | 2935928654 | 251 |
| 783 | iso_pu_bacteria | 2935934488 | 2935938299 | 251 |
| 784 | iso_pu_bacteria | 2935942939 | 2935945809 | 251 |
| 785 | iso_pu_bacteria | 2935951376 | 2935954584 | 251 |
| 786 | iso_pu_bacteria | 2935959822 | 2935963187 | 251 |
| 787 | iso_pu_bacteria | 2935967501 | 2935970471 | 251 |
| 788 | iso_pu_bacteria | 2935975950 | 2935979287 | 251 |
| 789 | iso_pu_bacteria | 8019619141 | 8019626343 | 251 |
| 790 | iso_pu_bacteria | 8019629233 | 8019636151 | 251 |
| 791 | iso_pu_bacteria | 8019659431 | 8019663918 | 251 |
| 792 | iso_pu_bacteria | 8019668869 | 8019673547 | 251 |
| 793 | iso_pu_bacteria | 8019678201 | 8019682585 | 251 |
| 794 | iso_pu_bacteria | 8019687851 | 8019688266 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar