F481086

General Info

Members Datasets Scaffolds Average Seq Length
794 476 663 249

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10068963|Ga0070709_100689632
Length 287
Sequence MFRSRSIKAFPSGAEGGSRPENAPHRKSRARFRWHRNGRGSGHRIVLTGAMLAIVSVASGCSSIDRLSQIGEQPKLNAIENPTAQPGYKPVQMPMPKPETVSYNANSLWRNGSRAFFKDQRAARIGDILTVTVNITDKANIANETQRSRTSKEDSGITDFIGAKTLGAQAQKVLPGRILTADSTASTDGKGSVNRQEALQTNVAAVVTQILPNGNLVVEGKQEIRVNFEIRELVVAGIVRPEDIQSDNTIDSSKIAQARIAYGGRGQLTDVQQPRYGQQVMDVLLPF

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
13 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2791355199
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
19 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
20 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
21 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
22 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
23 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
24 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
25 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
26 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
27 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
28 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
29 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
30 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
31 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
32 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
33 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
34 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
35 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
36 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
42 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
43 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
44 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
45 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
46 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
47 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
48 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
49 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
50 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
51 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
52 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
53 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
54 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
55 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
56 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
57 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
58 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
59 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
60 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
61 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
62 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
63 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
64 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
65 2904699407
66 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
67 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
68 2906610324
69 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
70 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
71 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
72 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
73 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
74 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
75 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
76 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
77 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
78 2922425934
79 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
80 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
81 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
82 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
83 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
84 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
85 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
86 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
87 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
88 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
89 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
90 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
91 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
92 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
93 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
94 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
95 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
96 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
97 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
98 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
99 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
100 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
101 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
102 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
103 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
104 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
105 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
106 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
107 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
111 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
113 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
114 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
115 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
125 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
126 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
127 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
128 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
129 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
132 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
133 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
134 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
137 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
138 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
139 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
140 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
145 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
146 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
147 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
151 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
152 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
153 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
154 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
155 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
156 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
157 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
161 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
162 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
164 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
165 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
166 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
167 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
168 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
177 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
178 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
179 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
180 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
181 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
182 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
185 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
188 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
189 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
192 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
193 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
194 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
195 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
196 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
197 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
244 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
245 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
246 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
247 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
254 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
319 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
320 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
424 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
425 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
426 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
427 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
430 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
431 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
432 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
433 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
434 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
437 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
438 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
439 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
440 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
441 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
444 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
445 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
446 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
447 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
450 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
451 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
452 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
453 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
454 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
455 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
456 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
457 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
458 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
459 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
460 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
461 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
462 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
463 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
464 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
465 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
466 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
467 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
468 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
469 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
470 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
471 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
472 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
473 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
474 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
475 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
476 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.92
Metatranscriptomes 0
Isolates 16.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 12.97
Rhizoplane 5.67
Rhizosphere 62.47
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002642 3300001979 Bacteria 8071
2 JGI24739J22299_10015078 3300001989 Bacteria 2810
3 JGI24737J22298_10011358 3300001990 Bacteria 2920
4 JGI24735J21928_10082505 3300002067 Bacteria 921
5 JGI25165J46597_1006803 3300003214 Bacteria 1982
6 JGI25153J46596_10000257 3300003215 Bacteria 42775
7 JGI25153J46596_10008206 3300003215 Bacteria 5024
8 JGI25153J46596_10015237 3300003215 Bacteria 3146
9 JGI25160J50197_1003851 3300003354 Bacteria 6590
10 JGI25404J52841_10042226 3300003659 Bacteria 965
11 Ga0070690_100133192 3300005330 Bacteria 1680
12 Ga0070670_100000009 3300005331 Bacteria 291074
13 Ga0070666_10151637 3300005335 Bacteria 1617
14 Ga0070680_100012789 3300005336 Bacteria 6528
15 Ga0070680_100103391 3300005336 Bacteria 2367
16 Ga0070680_100178213 3300005336 Bacteria 1790
17 Ga0070668_100003906 3300005347 Bacteria 11008
18 Ga0070668_100005548 3300005347 Bacteria 9364
19 Ga0070668_100010666 3300005347 Bacteria 6831
20 Ga0070668_100066414 3300005347 Bacteria 2799
21 Ga0070668_100214584 3300005347 Bacteria 1584
22 Ga0070675_100609162 3300005354 Bacteria 991
23 Ga0070674_100045828 3300005356 Bacteria 2988
24 Ga0070659_100022240 3300005366 Bacteria 4838
25 Ga0070659_100172624 3300005366 Bacteria 1772
26 Ga0070667_100002908 3300005367 Bacteria 14718
27 Ga0070709_10053772 3300005434 Bacteria 2536
28 Ga0070709_10068963 3300005434 Bacteria 2276
29 Ga0070714_100004662 3300005435 Bacteria 10355
30 Ga0070714_100611800 3300005435 Bacteria 1047
31 Ga0070713_100955749 3300005436 Bacteria 825
32 Ga0070710_10003916 3300005437 Bacteria 7052
33 Ga0070701_10151839 3300005438 Bacteria 1334
34 Ga0070701_10221896 3300005438 Bacteria 1127
35 Ga0070711_100028398 3300005439 Bacteria 3681
36 Ga0070711_100031977 3300005439 Bacteria 3496
37 Ga0070711_100132226 3300005439 Bacteria 1860
38 Ga0070711_100159102 3300005439 Bacteria 1711
39 Ga0070678_100286235 3300005456 Bacteria 1395
40 Ga0070681_10120730 3300005458 Bacteria 2556
41 Ga0070706_100209873 3300005467 Bacteria 1819
42 Ga0070679_100040901 3300005530 Bacteria 4613
43 Ga0070679_100148200 3300005530 Bacteria 2324
44 Ga0070697_100127802 3300005536 Bacteria 2129
45 Ga0068853_100061451 3300005539 Bacteria 3249
46 Ga0068853_100089056 3300005539 Bacteria 2710
47 Ga0068853_100100944 3300005539 Bacteria 2552
48 Ga0068853_100132265 3300005539 Bacteria 2234
49 Ga0068853_100380677 3300005539 Bacteria 1318
50 Ga0070686_100431401 3300005544 Bacteria 1009
51 Ga0070695_100323180 3300005545 Bacteria 1148
52 Ga0070665_100000338 3300005548 Bacteria 71282
53 Ga0070665_100009207 3300005548 Bacteria 10002
54 Ga0070665_100123975 3300005548 Bacteria 2586
55 Ga0070665_100388147 3300005548 Bacteria 1404
56 Ga0068855_100024002 3300005563 Bacteria 7301
57 Ga0068855_100024662 3300005563 Bacteria 7194
58 Ga0068855_100025884 3300005563 Bacteria 7017
59 Ga0068855_100479923 3300005563 Bacteria 1353
60 Ga0068855_101029593 3300005563 Bacteria 864
61 Ga0070664_100365028 3300005564 Bacteria 1315
62 Ga0068857_100026380 3300005577 Bacteria 5121
63 Ga0068857_100027238 3300005577 Bacteria 5040
64 Ga0068854_100008796 3300005578 Bacteria 6498
65 Ga0068854_100018770 3300005578 Bacteria 4648
66 Ga0068854_100018967 3300005578 Bacteria 4626
67 Ga0068854_100079449 3300005578 Bacteria 2418
68 Ga0068856_100000140 3300005614 Bacteria 73194
69 Ga0068856_100013132 3300005614 Bacteria 8024
70 Ga0068852_100014382 3300005616 Bacteria 6091
71 Ga0068852_100019510 3300005616 Bacteria 5368
72 Ga0068859_100293798 3300005617 Bacteria 1718
73 Ga0068864_100000151 3300005618 Bacteria 65372
74 Ga0068861_100187723 3300005719 Bacteria 1725
75 Ga0068851_10014629 3300005834 Bacteria 3726
76 Ga0068851_10053146 3300005834 Bacteria 2062
77 Ga0068863_100000399 3300005841 Bacteria 44173
78 Ga0068863_100032206 3300005841 Bacteria 4997
79 Ga0068863_100080741 3300005841 Bacteria 3081
80 Ga0068858_100068456 3300005842 Bacteria 3290
81 Ga0068860_100000161 3300005843 Bacteria 110123
82 Ga0068860_100000184 3300005843 Bacteria 100730
83 Ga0068860_100540573 3300005843 Bacteria 1166
84 Ga0068862_100017886 3300005844 Bacteria 5902
85 Ga0068862_100105508 3300005844 Bacteria 2469
86 Ga0081455_10040908 3300005937 Bacteria 4084
87 Ga0081455_10071958 3300005937 Bacteria 2865
88 Ga0081540_1004203 3300005983 Bacteria 11068
89 Ga0081540_1008157 3300005983 Bacteria 7345
90 Ga0081540_1028032 3300005983 Bacteria 3174
91 Ga0081540_1030158 3300005983 Bacteria 3009
92 Ga0081540_1044573 3300005983 Bacteria 2263
93 Ga0081539_10000319 3300005985 Bacteria 106944
94 Ga0070717_10039333 3300006028 Bacteria 3848
95 Ga0075365_10023940 3300006038 Bacteria 3846
96 Ga0075365_10087926 3300006038 Bacteria 2113
97 Ga0075365_10162700 3300006038 Bacteria 1555
98 Ga0075365_10224761 3300006038 Bacteria 1317
99 Ga0070715_10002040 3300006163 Bacteria 6091
100 Ga0070716_100022589 3300006173 Bacteria 3326
101 Ga0070712_100013473 3300006175 Bacteria 5226
102 Ga0070712_100221322 3300006175 Bacteria 1499
103 Ga0075367_10065406 3300006178 Bacteria 2177
104 Ga0075369_10008711 3300006186 Bacteria 3916
105 Ga0075428_100090838 3300006844 Bacteria 3331
106 Ga0075428_100135095 3300006844 Bacteria 2682
107 Ga0068865_100291674 3300006881 Bacteria 1302
108 Ga0097620_100293793 3300006931 Bacteria 1718
109 Ga0099825_1029497 3300006941 Bacteria 2539
110 Ga0099824_1002092 3300006942 Bacteria 28972
111 Ga0099824_1007912 3300006942 Bacteria 13834
112 Ga0099822_1000668 3300006943 Bacteria 34457
113 Ga0099794_10019670 3300007265 Bacteria 3047
114 Ga0099795_10032764 3300007788 Bacteria 1800
115 Ga0105240_10000875 3300009093 Bacteria 54199
116 Ga0105240_10004915 3300009093 Bacteria 20101
117 Ga0105240_10009118 3300009093 Bacteria 14086
118 Ga0105240_10027340 3300009093 Bacteria 7469
119 Ga0105240_10094344 3300009093 Bacteria 3650
120 Ga0105247_10188332 3300009101 Bacteria 1380
121 Ga0114129_10084007 3300009147 Bacteria 4421
122 Ga0114129_10351618 3300009147 Bacteria 1952
123 Ga0105243_10123903 3300009148 Bacteria 2183
124 Ga0105241_10018928 3300009174 Bacteria 5075
125 Ga0105248_10047128 3300009177 Bacteria 4833
126 Ga0105248_10281011 3300009177 Bacteria 1874
127 Ga0105248_10470648 3300009177 Bacteria 1416
128 Ga0105237_10141592 3300009545 Bacteria 2399
129 Ga0105237_10147841 3300009545 Bacteria 2345
130 Ga0105237_10169001 3300009545 Bacteria 2186
131 Ga0105238_10003151 3300009551 Bacteria 16458
132 Ga0105238_10049938 3300009551 Bacteria 4211
133 Ga0105238_10127124 3300009551 Bacteria 2527
134 Ga0105238_10399624 3300009551 Bacteria 1367
135 Ga0105238_10440859 3300009551 Bacteria 1299
136 Ga0105238_10777832 3300009551 Bacteria 972
137 Ga0105249_10002575 3300009553 Bacteria 15692
138 Ga0099796_10001299 3300010159 Bacteria 4941
139 Ga0099796_10132305 3300010159 Bacteria 968
140 Ga0105239_10023167 3300010375 Bacteria 6844
141 Ga0105239_10041893 3300010375 Bacteria 5017
142 Ga0105239_10057368 3300010375 Bacteria 4271
143 Ga0105239_10143426 3300010375 Bacteria 2662
144 Ga0105246_10290427 3300011119 Bacteria 1315
145 Ga0157328_1001127 3300012478 Bacteria 1102
146 Ga0157343_1004752 3300012488 Bacteria 855
147 Ga0157371_10037559 3300013102 Bacteria 3465
148 Ga0157370_10028441 3300013104 Bacteria 5498
149 Ga0157370_10174882 3300013104 Bacteria 1996
150 Ga0157370_10525718 3300013104 Bacteria 1085
151 Ga0157374_10566303 3300013296 Bacteria 1145
152 Ga0157378_10012316 3300013297 Bacteria 7489
153 Ga0163162_10135326 3300013306 Bacteria 2575
154 Ga0157372_10325632 3300013307 Bacteria 1789
155 Ga0157372_11153476 3300013307 Bacteria 896
156 Ga0157375_10673512 3300013308 Bacteria 1189
157 Ga0163163_10235289 3300014325 Bacteria 1881
158 Ga0157379_10036023 3300014968 Bacteria 4412
159 Ga0157379_10037102 3300014968 Bacteria 4346
160 Ga0214544_1000020 3300021320 Bacteria 178560
161 Ga0214542_1000024 3300021321 Bacteria 191218
162 Ga0214545_1000011 3300021324 Bacteria 190550
163 Ga0214543_1000033 3300021327 Bacteria 190419
164 Ga0213876_10009102 3300021384 Bacteria 5346
165 Ga0228598_1026063 3300024227 Bacteria 1151
166 Ga0209677_100238 3300025253 Bacteria 38405
167 Ga0209233_1005863 3300025261 Bacteria 4031
168 Ga0209233_1022091 3300025261 Bacteria 1634
169 Ga0209455_1006321 3300025272 Bacteria 3515
170 Ga0209673_1051616 3300025273 Bacteria 1084
171 Ga0209758_1001525 3300025297 Bacteria 26806
172 Ga0209758_1004742 3300025297 Bacteria 11058
173 Ga0209758_1006166 3300025297 Bacteria 8778
174 Ga0209758_1041649 3300025297 Bacteria 1714
175 Ga0207426_1000847 3300025302 Bacteria 32206
176 Ga0209257_1024258 3300025304 Bacteria 2104
177 Ga0207656_10014093 3300025321 Bacteria 3072
178 Ga0207692_10005248 3300025898 Bacteria 5178
179 Ga0207710_10122472 3300025900 Bacteria 1243
180 Ga0207688_10080342 3300025901 Bacteria 1861
181 Ga0207680_10009251 3300025903 Bacteria 4877
182 Ga0207685_10024778 3300025905 Bacteria 2062
183 Ga0207699_10039340 3300025906 Bacteria 2717
184 Ga0207654_10000123 3300025911 Bacteria 50130
185 Ga0207707_10012352 3300025912 Bacteria 7422
186 Ga0207707_10158396 3300025912 Bacteria 1980
187 Ga0207695_10004074 3300025913 Bacteria 20097
188 Ga0207695_10009321 3300025913 Bacteria 12149
189 Ga0207695_10009841 3300025913 Bacteria 11749
190 Ga0207695_10038444 3300025913 Bacteria 5152
191 Ga0207695_10217083 3300025913 Bacteria 1821
192 Ga0207671_10077109 3300025914 Bacteria 2495
193 Ga0207671_10142555 3300025914 Bacteria 1847
194 Ga0207671_10192177 3300025914 Bacteria 1592
195 Ga0207693_10008696 3300025915 Bacteria 8303
196 Ga0207693_10044656 3300025915 Bacteria 3482
197 Ga0207693_10368988 3300025915 Bacteria 1123
198 Ga0207663_10000967 3300025916 Bacteria 13125
199 Ga0207663_10433807 3300025916 Bacteria 1011
200 Ga0207660_10169233 3300025917 Bacteria 1690
201 Ga0207657_10000891 3300025919 Bacteria 31605
202 Ga0207657_10288106 3300025919 Bacteria 1303
203 Ga0207694_10000810 3300025924 Bacteria 27944
204 Ga0207694_10062596 3300025924 Bacteria 2897
205 Ga0207694_10608237 3300025924 Bacteria 919
206 Ga0207650_10000014 3300025925 Bacteria 398063
207 Ga0207690_10249830 3300025932 Bacteria 1370
208 Ga0207706_10144673 3300025933 Bacteria 2091
209 Ga0207669_10076362 3300025937 Bacteria 2126
210 Ga0207704_10086964 3300025938 Bacteria 2040
211 Ga0207704_10271557 3300025938 Bacteria 1284
212 Ga0207665_10007992 3300025939 Bacteria 6980
213 Ga0207665_10075275 3300025939 Bacteria 2312
214 Ga0207711_10010577 3300025941 Bacteria 7670
215 Ga0207711_10055999 3300025941 Bacteria 3387
216 Ga0207711_10196691 3300025941 Bacteria 1839
217 Ga0207667_10017201 3300025949 Bacteria 8148
218 Ga0207667_10050594 3300025949 Bacteria 4383
219 Ga0207667_10084657 3300025949 Bacteria 3283
220 Ga0207667_10696509 3300025949 Bacteria 1019
221 Ga0207651_10118622 3300025960 Bacteria 2002
222 Ga0207712_10000782 3300025961 Bacteria 23725
223 Ga0207712_10039078 3300025961 Bacteria 3249
224 Ga0207712_10043753 3300025961 Bacteria 3091
225 Ga0207668_10000025 3300025972 Bacteria 131733
226 Ga0207668_10022139 3300025972 Bacteria 4063
227 Ga0207668_10036246 3300025972 Bacteria 3290
228 Ga0207668_10150963 3300025972 Bacteria 1798
229 Ga0207640_10011447 3300025981 Bacteria 5026
230 Ga0207640_10035802 3300025981 Bacteria 3110
231 Ga0207640_10081840 3300025981 Bacteria 2209
232 Ga0207640_10107087 3300025981 Bacteria 1973
233 Ga0207640_10225956 3300025981 Bacteria 1436
234 Ga0207658_10007795 3300025986 Bacteria 7291
235 Ga0207658_10007800 3300025986 Bacteria 7289
236 Ga0207703_10005534 3300026035 Bacteria 10143
237 Ga0207639_10049520 3300026041 Bacteria 3186
238 Ga0207639_10087947 3300026041 Bacteria 2478
239 Ga0207678_10023438 3300026067 Bacteria 5399
240 Ga0207678_10024105 3300026067 Bacteria 5316
241 Ga0207678_10192961 3300026067 Bacteria 1741
242 Ga0207702_10000005 3300026078 Bacteria 420296
243 Ga0207702_10000261 3300026078 Bacteria 61023
244 Ga0207702_10059332 3300026078 Bacteria 3259
245 Ga0207702_10180548 3300026078 Bacteria 1943
246 Ga0207702_10553327 3300026078 Bacteria 1126
247 Ga0207641_10001549 3300026088 Bacteria 22513
248 Ga0207641_10028788 3300026088 Bacteria 4593
249 Ga0207641_10260998 3300026088 Bacteria 1622
250 Ga0207641_10679899 3300026088 Bacteria 1012
251 Ga0207676_10000594 3300026095 Bacteria 29743
252 Ga0207676_10448073 3300026095 Bacteria 1216
253 Ga0207674_10008432 3300026116 Bacteria 11906
254 Ga0207674_10016966 3300026116 Bacteria 7950
255 Ga0207674_10946740 3300026116 Bacteria 830
256 Ga0207675_100095062 3300026118 Bacteria 2803
257 Ga0207683_10113780 3300026121 Bacteria 2424
258 Ga0207698_10024150 3300026142 Bacteria 4261
259 Ga0207698_10054630 3300026142 Bacteria 3074
260 Ga0207698_10394450 3300026142 Bacteria 1321
261 Ga0207698_10816915 3300026142 Bacteria 935
262 Ga0209389_1000127 3300027296 Bacteria 67209
263 Ga0209589_1000018 3300027357 Bacteria 192614
264 Ga0209589_1000243 3300027357 Bacteria 67209
265 Ga0209489_100026 3300027361 Bacteria 192614
266 Ga0209489_103202 3300027361 Bacteria 32241
267 Ga0209700_100035 3300027363 Bacteria 192614
268 Ga0209179_1002826 3300027512 Bacteria 2412
269 Ga0268266_10000533 3300028379 Bacteria 53233
270 Ga0268266_10009547 3300028379 Bacteria 8538
271 Ga0268265_10005273 3300028380 Bacteria 8847
272 Ga0268265_10028249 3300028380 Bacteria 4015
273 Ga0268264_10000096 3300028381 Bacteria 230188
274 Ga0268264_10000124 3300028381 Bacteria 187493
275 Ga0268264_10000170 3300028381 Bacteria 144898
276 Ga0265334_10016764 3300028573 Bacteria 3030
277 Ga0307517_10000049 3300028786 Bacteria 160368
278 Ga0307511_10193374 3300030521 Bacteria 1071
279 Ga0265330_10014486 3300031235 Bacteria 3660
280 Ga0265340_10005635 3300031247 Bacteria 6934
281 Ga0265339_10197133 3300031249 Bacteria 995
282 Ga0307513_10041126 3300031456 Bacteria 5106
283 Ga0307509_10062472 3300031507 Bacteria 3927
284 Ga0307509_10348882 3300031507 Bacteria 1204
285 Ga0307508_10000168 3300031616 Bacteria 79496
286 Ga0307508_10084175 3300031616 Bacteria 2763
287 Ga0265314_10054438 3300031711 Bacteria 2769
288 Ga0265342_10052350 3300031712 Bacteria 2434
289 Ga0307516_10137292 3300031730 Bacteria 2218
290 Ga0307516_10328772 3300031730 Bacteria 1198
291 Ga0307413_10046415 3300031824 Bacteria 2583
292 Ga0307416_100685982 3300032002 Bacteria 1112
293 Ga0307415_100061113 3300032126 Bacteria 2607
294 Ga0307510_10015971 3300033180 Bacteria 8872
295 Ga0307510_10044615 3300033180 Bacteria 4799
296 Ga0315911_1000011 3300033442 Bacteria 264678
297 Ga0373928_0059864 3300035084 Bacteria 919
298 Ga0373934_0007659 3300035086 Bacteria 4011
299 Ga0373923_0168093 3300035111 Bacteria 1003
300 Ga0373936_0027445 3300035113 Bacteria 2233
301 Ga0373945_0024492 3300035116 Bacteria 2092
302 Ga0373954_0045048 3300035118 Bacteria 2060
303 Ga0373954_0109224 3300035118 Bacteria 1337
304 Ga0373954_0205639 3300035118 Bacteria 967
305 Ga0373956_0017735 3300035119 Bacteria 3006
306 Ga0373955_0004802 3300035172 Bacteria 6018
307 Ga0373955_0369661 3300035172 Bacteria 870
308 Ga0373924_0052995 3300035410 Bacteria 1685
309 Ga0373924_0088147 3300035410 Bacteria 1325
310 Ga0373931_0100625 3300035691 Bacteria 1625
311 Ga0373931_0213070 3300035691 Bacteria 1159
312 Ga0373931_0304228 3300035691 Bacteria 986
313 Ga0373935_0037854 3300035692 Bacteria 3019
314 Ga0373935_0390982 3300035692 Bacteria 997
315 Ga0373927_0005668 3300035695 Bacteria 8579
316 Ga0373927_0042463 3300035695 Bacteria 2946
317 Ga0373927_0071939 3300035695 Bacteria 2238
318 Ga0373927_0163114 3300035695 Bacteria 1460
319 Ga0373933_0000124 3300035724 Bacteria 49441
320 Ga0373933_0020774 3300035724 Bacteria 3723
321 Ga0373933_0054242 3300035724 Bacteria 2402
322 Ga0373947_0004083 3300035725 Bacteria 8597
323 Ga0373947_0195608 3300035725 Bacteria 1321
324 Ga0373937_0026270 3300036401 Bacteria 5262
325 Ga0373937_0088458 3300036401 Bacteria 2867
326 Ga0373937_0200973 3300036401 Bacteria 1873
327 Ga0373937_0205770 3300036401 Bacteria 1851
328 Ga0373925_0006216 3300037068 Bacteria 8812
329 Ga0373925_0050641 3300037068 Bacteria 3098
330 Ga0373925_0203809 3300037068 Bacteria 1574
331 Ga0373925_0243367 3300037068 Bacteria 1441
332 Ga0395905_0098736 3300037471 Bacteria 2742
333 Ga0395901_0142943 3300038443 Bacteria 2515
334 Ga0436365_0547035 3300039437 Bacteria 4529
335 Ga0436365_1593583 3300039437 Bacteria 1303
336 Ga0436363_1041317 3300039450 Bacteria 1085
337 Ga0436362_0214249 3300039453 Bacteria 2899
338 Ga0451853_2263250 3300041512 Bacteria 1532
339 Ga0439458_0057679 3300042157 Bacteria 966
340 Ga0466969_0043915 3300044656 Bacteria 2226
341 Ga0466972_0003847 3300044658 Bacteria 7471
342 Ga0466965_0037393 3300044683 Bacteria 2383
343 Ga0466966_0001672 3300044684 Bacteria 14305
344 Ga0466961_0001529 3300044693 Bacteria 14321
345 Ga0466963_0033109 3300044694 Bacteria 3352
346 Ga0466970_0084344 3300044765 Bacteria 1720
347 Ga0466967_0266325 3300045976 Bacteria 1640
348 Ga0495592_0022949 3300046454 Bacteria 4748
349 Ga0495592_0039060 3300046454 Bacteria 3568
350 Ga0495592_0347063 3300046454 Bacteria 952
351 Ga0495603_0005079 3300046455 Bacteria 7861
352 Ga0495603_0059096 3300046455 Bacteria 2267
353 Ga0495603_0155670 3300046455 Bacteria 1326
354 Ga0495603_0242664 3300046455 Bacteria 1038
355 Ga0495590_0030733 3300046457 Bacteria 1882
356 Ga0495629_0000672 3300046459 Bacteria 27723
357 Ga0495629_0013089 3300046459 Bacteria 5994
358 Ga0495629_0388293 3300046459 Bacteria 949
359 Ga0495629_0466086 3300046459 Bacteria 854
360 Ga0495641_0076584 3300046461 Bacteria 1499
361 Ga0495651_0022682 3300046462 Bacteria 4879
362 Ga0495651_0165722 3300046462 Bacteria 1578
363 Ga0495653_0122576 3300046463 Bacteria 1850
364 Ga0495653_0277783 3300046463 Bacteria 1100
365 Ga0495653_0427881 3300046463 Bacteria 836
366 Ga0495580_0012605 3300046472 Bacteria 6480
367 Ga0495582_0000336 3300046473 Bacteria 25701
368 Ga0495639_0000154 3300046475 Bacteria 35394
369 Ga0495662_0003756 3300046476 Bacteria 7658
370 Ga0495664_0013710 3300046477 Bacteria 4597
371 Ga0495664_0020483 3300046477 Bacteria 3815
372 Ga0495664_0128800 3300046477 Bacteria 1532
373 Ga0495594_0002042 3300046499 Bacteria 10519
374 Ga0495596_0039486 3300046500 Bacteria 1864
375 Ga0495607_0046041 3300046501 Bacteria 2564
376 Ga0495608_0021126 3300046511 Bacteria 4470
377 Ga0495608_0136597 3300046511 Bacteria 1566
378 Ga0495610_0122624 3300046512 Bacteria 1137
379 Ga0495628_0014412 3300046516 Bacteria 6628
380 Ga0495628_0026090 3300046516 Bacteria 4770
381 Ga0495628_0474660 3300046516 Bacteria 906
382 Ga0495630_0008732 3300046517 Bacteria 7280
383 Ga0495632_0022696 3300046519 Bacteria 3359
384 Ga0495666_0247701 3300046526 Bacteria 812
385 Ga0495642_0055798 3300046528 Bacteria 1631
386 Ga0495652_0048678 3300046529 Bacteria 3630
387 Ga0495652_0251335 3300046529 Bacteria 1310
388 Ga0495652_0253010 3300046529 Bacteria 1304
389 Ga0495652_0549055 3300046529 Bacteria 795
390 Ga0495654_0128698 3300046530 Bacteria 1139
391 Ga0495665_0012053 3300046531 Bacteria 4679
392 Ga0495640_0008600 3300046533 Bacteria 8002
393 Ga0495587_0185504 3300046536 Bacteria 1178
394 Ga0495587_0275395 3300046536 Bacteria 943
395 Ga0495645_0017715 3300046543 Bacteria 5106
396 Ga0495667_0050594 3300046559 Bacteria 2742
397 Ga0495667_0197940 3300046559 Bacteria 1286
398 Ga0495667_0221498 3300046559 Bacteria 1207
399 Ga0495656_0009707 3300046615 Bacteria 3471
400 Ga0495656_0026136 3300046615 Bacteria 2321
401 Ga0495656_0112738 3300046615 Bacteria 1274
402 Ga0495668_0091007 3300046616 Bacteria 1671
403 Ga0495634_0005666 3300046642 Bacteria 9562
404 Ga0495634_0052483 3300046642 Bacteria 2733
405 Ga0495634_0084954 3300046642 Bacteria 2063
406 Ga0495634_0136396 3300046642 Bacteria 1561
407 Ga0495625_0286394 3300046660 Bacteria 1058
408 Ga0495635_0010397 3300046663 Bacteria 6509
409 Ga0495635_0049581 3300046663 Bacteria 2893
410 Ga0495635_0184748 3300046663 Bacteria 1416
411 Ga0495588_0165570 3300046674 Bacteria 1169
412 Ga0495657_0091513 3300046675 Bacteria 1950
413 Ga0495599_0029454 3300046678 Bacteria 3442
414 Ga0495599_0063344 3300046678 Bacteria 2310
415 Ga0495599_0277214 3300046678 Bacteria 1016
416 Ga0495623_0072074 3300046679 Bacteria 2149
417 Ga0495646_0023543 3300046680 Bacteria 3876
418 Ga0495646_0043244 3300046680 Bacteria 2760
419 Ga0495647_0009564 3300046681 Bacteria 3286
420 Ga0495658_0005565 3300046683 Bacteria 6190
421 Ga0495669_0020855 3300046684 Bacteria 2838
422 Ga0495613_0014087 3300046689 Bacteria 5932
423 Ga0495613_0284320 3300046689 Bacteria 1148
424 Ga0495624_0002880 3300046690 Bacteria 12873
425 Ga0495649_0048664 3300046694 Bacteria 2304
426 Ga0495589_0141712 3300046794 Bacteria 1151
427 Ga0495600_0015717 3300046809 Bacteria 4791
428 Ga0495600_0063345 3300046809 Bacteria 2416
429 Ga0495600_0166725 3300046809 Bacteria 1422
430 Ga0495600_0315712 3300046809 Bacteria 983
431 Ga0495581_0004403 3300047315 Bacteria 8141
432 Ga0495604_0162220 3300047317 Bacteria 1578
433 Ga0495604_0171265 3300047317 Bacteria 1526
434 Ga0495636_0038480 3300047318 Bacteria 1979
435 Ga0495674_0005189 3300047319 Bacteria 12509
436 Ga0495674_0027448 3300047319 Bacteria 5203
437 Ga0495674_0087688 3300047319 Bacteria 2663
438 Ga0495672_0000485 3300047320 Bacteria 46894
439 Ga0495672_0112258 3300047320 Bacteria 1461
440 Ga0495676_0058263 3300047321 Bacteria 3040
441 Ga0495680_0031150 3300047322 Bacteria 4345
442 Ga0495680_0110640 3300047322 Bacteria 2035
443 Ga0495680_0263401 3300047322 Bacteria 1219
444 Ga0495683_0167661 3300047323 Bacteria 1011
445 Ga0495683_0238642 3300047323 Bacteria 803
446 Ga0495675_0081208 3300047444 Bacteria 2041
447 Ga0495675_0105808 3300047444 Bacteria 1758
448 Ga0495681_0065774 3300047470 Bacteria 1656
449 Ga0495684_0043074 3300047471 Bacteria 3455
450 Ga0495686_0114846 3300047472 Bacteria 1611
451 Ga0495593_0003415 3300047673 Bacteria 9513
452 Ga0495593_0112090 3300047673 Bacteria 1392
453 Ga0495602_0410031 3300048088 Bacteria 964
454 Ga0495602_0556830 3300048088 Bacteria 794
455 Ga0496100_0098849 3300048903 Bacteria 2007
456 Ga0496101_0054755 3300048904 Bacteria 2880
457 Ga0496102_0017493 3300048905 Bacteria 6279
458 Ga0496102_0145128 3300048905 Bacteria 2227
459 Ga0496102_0305550 3300048905 Bacteria 1499
460 Ga0496102_0396711 3300048905 Bacteria 1297
461 Ga0496102_0461380 3300048905 Bacteria 1191
462 Ga0496102_0716333 3300048905 Bacteria 924
463 Ga0496103_0095603 3300048906 Bacteria 1877
464 Ga0496104_0204040 3300048907 Bacteria 1889
465 Ga0496105_0116419 3300048908 Bacteria 2205
466 Ga0496106_0009237 3300048909 Bacteria 7285
467 Ga0496106_0339048 3300048909 Bacteria 1207
468 Ga0496106_0340125 3300048909 Bacteria 1205
469 Ga0496107_0013255 3300048910 Bacteria 5761
470 Ga0496107_0427031 3300048910 Bacteria 985
471 Ga0496107_0445027 3300048910 Bacteria 963
472 Ga0496108_0000380 3300048911 Bacteria 36881
473 Ga0496108_0063689 3300048911 Bacteria 3105
474 Ga0496108_0118670 3300048911 Bacteria 2268
475 Ga0496108_0325379 3300048911 Bacteria 1340
476 Ga0496109_0000887 3300048912 Bacteria 25028
477 Ga0496109_0168020 3300048912 Bacteria 2057
478 Ga0496109_0181960 3300048912 Bacteria 1974
479 Ga0496109_0288742 3300048912 Bacteria 1546
480 Ga0496110_0026404 3300048913 Bacteria 4970
481 Ga0496110_0037493 3300048913 Bacteria 4214
482 Ga0496110_0089901 3300048913 Bacteria 2745
483 Ga0496110_0134651 3300048913 Bacteria 2232
484 Ga0496110_0548721 3300048913 Bacteria 1050
485 Ga0496110_0865764 3300048913 Bacteria 809
486 Ga0496111_0121022 3300048914 Bacteria 1933
487 Ga0496111_0138437 3300048914 Bacteria 1803
488 Ga0496111_0635687 3300048914 Bacteria 779
489 Ga0496112_0019379 3300048915 Bacteria 6422
490 Ga0496112_0028537 3300048915 Bacteria 5387
491 Ga0496112_0039717 3300048915 Bacteria 4600
492 Ga0496112_0137280 3300048915 Bacteria 2415
493 Ga0496112_0597584 3300048915 Bacteria 1035
494 Ga0496113_0228831 3300048916 Bacteria 1482
495 Ga0496115_0124230 3300048918 Bacteria 2125
496 Ga0496115_0274707 3300048918 Bacteria 1384
497 Ga0496115_0356559 3300048918 Bacteria 1192
498 Ga0496115_0622326 3300048918 Bacteria 856
499 Ga0496116_0210268 3300048919 Bacteria 1009
500 Ga0496117_0006861 3300048920 Bacteria 11313
501 Ga0496117_0121802 3300048920 Bacteria 1601
502 Ga0496118_0018608 3300048921 Bacteria 6253
503 Ga0496121_0000300 3300048924 Bacteria 102506
504 Ga0496121_0001712 3300048924 Bacteria 35901
505 Ga0496121_0017013 3300048924 Bacteria 7462
506 Ga0496121_0018815 3300048924 Bacteria 6938
507 Ga0496121_0177054 3300048924 Bacteria 1543
508 Ga0496121_0325944 3300048924 Bacteria 1032
509 Ga0496124_0007174 3300048927 Bacteria 11912
510 Ga0496124_0141336 3300048927 Bacteria 1899
511 Ga0496124_0208231 3300048927 Bacteria 1482
512 Ga0496124_0247129 3300048927 Bacteria 1322
513 Ga0496124_0357714 3300048927 Bacteria 1030
514 Ga0496125_0062738 3300048928 Bacteria 2969
515 Ga0496126_0007237 3300048929 Bacteria 12206
516 Ga0496126_0007334 3300048929 Bacteria 12111
517 Ga0496126_0016251 3300048929 Bacteria 7450
518 Ga0496126_0031256 3300048929 Bacteria 5033
519 Ga0496126_0075680 3300048929 Bacteria 2987
520 Ga0496126_0083011 3300048929 Bacteria 2829
521 Ga0496126_0137806 3300048929 Bacteria 2103
522 Ga0496126_0335678 3300048929 Bacteria 1239
523 Ga0496126_0400131 3300048929 Bacteria 1114
524 Ga0501031_0010682 3300049568 Bacteria 5981
525 Ga0501031_0280212 3300049568 Bacteria 1081
526 Ga0501032_0000038 3300049569 Bacteria 115810
527 Ga0501032_0034799 3300049569 Bacteria 3445
528 Ga0501032_0182504 3300049569 Bacteria 1373
529 Ga0501033_0000222 3300049570 Bacteria 54685
530 Ga0501033_0002083 3300049570 Bacteria 17325
531 Ga0501033_0265580 3300049570 Bacteria 1214
532 Ga0501033_0305921 3300049570 Bacteria 1118
533 Ga0501034_0000228 3300049571 Bacteria 106111
534 Ga0501034_0213416 3300049571 Bacteria 1884
535 Ga0501034_0247532 3300049571 Bacteria 1727
536 Ga0501034_0568128 3300049571 Bacteria 1042
537 Ga0501034_0598238 3300049571 Bacteria 1008
538 Ga0501036_0001157 3300049572 Bacteria 20051
539 Ga0501036_0022021 3300049572 Bacteria 5359
540 Ga0501036_0054330 3300049572 Bacteria 3392
541 Ga0501036_0175239 3300049572 Bacteria 1806
542 Ga0501036_0492239 3300049572 Bacteria 1020
543 Ga0501037_0000291 3300049573 Bacteria 42514
544 Ga0501037_0076565 3300049573 Bacteria 2428
545 Ga0501037_0233620 3300049573 Bacteria 1290
546 Ga0501038_0000079 3300049574 Bacteria 81639
547 Ga0501038_0000782 3300049574 Bacteria 28176
548 Ga0501038_0018111 3300049574 Bacteria 6362
549 Ga0501038_0025917 3300049574 Bacteria 5222
550 Ga0501038_0337204 3300049574 Bacteria 1176
551 Ga0501039_0005342 3300049575 Bacteria 9714
552 Ga0501039_0024316 3300049575 Bacteria 4651
553 Ga0501039_0076170 3300049575 Bacteria 2608
554 Ga0501039_0100222 3300049575 Bacteria 2260
555 Ga0501039_0177994 3300049575 Bacteria 1672
556 Ga0501040_0396527 3300049576 Bacteria 991
557 Ga0501041_0293731 3300049577 Bacteria 1024
558 Ga0501042_0026138 3300049578 Bacteria 4103
559 Ga0501043_0000021 3300049579 Bacteria 155025
560 Ga0501043_0009067 3300049579 Bacteria 7828
561 Ga0501043_0037854 3300049579 Bacteria 3794
562 Ga0501043_0057027 3300049579 Bacteria 3067
563 Ga0501046_0000632 3300049580 Bacteria 34569
564 Ga0501046_0017892 3300049580 Bacteria 5908
565 Ga0501046_0114383 3300049580 Bacteria 2058
566 Ga0501047_0000041 3300049581 Bacteria 184355
567 Ga0501047_0150958 3300049581 Bacteria 2199
568 Ga0501047_0382266 3300049581 Bacteria 1242
569 Ga0501048_0002271 3300049582 Bacteria 14667
570 Ga0501048_0197178 3300049582 Bacteria 1427
571 Ga0501067_0000411 3300049583 Bacteria 23399
572 Ga0501068_0003389 3300049584 Bacteria 8567
573 Ga0501068_0162355 3300049584 Bacteria 1408
574 Ga0501068_0418964 3300049584 Bacteria 865
575 Ga0501069_0017775 3300049585 Bacteria 3833
576 Ga0501070_0012019 3300049586 Bacteria 7307
577 Ga0501070_0049641 3300049586 Bacteria 3484
578 Ga0501070_0097042 3300049586 Bacteria 2438
579 Ga0501070_0302529 3300049586 Bacteria 1303
580 Ga0501071_0003588 3300049587 Bacteria 9719
581 Ga0501072_0019878 3300049588 Bacteria 5197
582 Ga0501072_0023902 3300049588 Bacteria 4749
583 Ga0501072_0365533 3300049588 Bacteria 1145
584 Ga0501073_0000056 3300049589 Bacteria 70854
585 Ga0501073_0156778 3300049589 Bacteria 1577
586 Ga0501074_0007359 3300049590 Bacteria 7960
587 Ga0501074_0077642 3300049590 Bacteria 2383
588 Ga0501076_0148277 3300049592 Bacteria 1908
589 Ga0501079_0001331 3300049741 Bacteria 17381
590 Ga0501079_0220792 3300049741 Bacteria 1481
591 Ga0501080_0000138 3300049742 Bacteria 50982
592 Ga0501080_0037141 3300049742 Bacteria 4547
593 Ga0501080_0091226 3300049742 Bacteria 2830
594 Ga0501083_0002147 3300049744 Bacteria 13527
595 Ga0501035_0000090 3300049822 Bacteria 112445
596 Ga0501035_0022751 3300049822 Bacteria 5756
597 Ga0501035_0108401 3300049822 Bacteria 2435
598 Ga0501035_0236731 3300049822 Bacteria 1554
599 Ga0501035_0332398 3300049822 Bacteria 1275
600 Ga0501035_0352217 3300049822 Bacteria 1232
601 Ga0501044_0000054 3300049823 Bacteria 141399
602 Ga0501044_0060341 3300049823 Bacteria 3884
603 Ga0501044_0062701 3300049823 Bacteria 3799
604 Ga0501044_0063239 3300049823 Bacteria 3781
605 Ga0501044_0066970 3300049823 Bacteria 3660
606 Ga0501044_0086405 3300049823 Bacteria 3168
607 Ga0501045_0088054 3300049824 Bacteria 2293
608 nmdc:mga0yw44_32637_c1 3300050492 Bacteria 3036
609 nmdc:mga0yw44_34378_c1 3300050492 Bacteria 2970
610 nmdc:mga0yw44_78757_c1 3300050492 Bacteria 2061
611 nmdc:mga0qj67_357193_c1 3300050509 Bacteria 1181
612 nmdc:mga06r32_194702_c1 3300050510 Bacteria 2014
613 nmdc:mga0sz30_91464_c1 3300050516 Bacteria 1324
614 Ga0495601_0011980 3300053077 Bacteria 5195
615 Ga0495612_0173189 3300053078 Bacteria 946
616 Ga0500635_0000120 3300053080 Bacteria 46183
617 Ga0500635_0008610 3300053080 Bacteria 2803
618 Ga0495619_0035769 3300053085 Bacteria 3231
619 Ga0495619_0127020 3300053085 Bacteria 1751
620 Ga0500643_019089 3300053087 Bacteria 2263
621 Ga0500651_0011575 3300053093 Bacteria 5323
622 Ga0500566_0004641 3300053094 Bacteria 8172
623 Ga0500641_0182371 3300053096 Bacteria 901
624 Ga0500654_077101 3300053099 Bacteria 1581
625 Ga0500554_000726 3300053102 Bacteria 6657
626 Ga0500555_011379 3300053103 Bacteria 2556
627 Ga0500562_000043 3300053108 Bacteria 65591
628 Ga0500562_060363 3300053108 Bacteria 1019
629 Ga0500572_001185 3300053111 Bacteria 7456
630 Ga0500582_001062 3300053114 Bacteria 3759
631 Ga0500594_0049473 3300053118 Bacteria 1179
632 Ga0500595_001479 3300053119 Bacteria 12486
633 Ga0500595_001984 3300053119 Bacteria 10498
634 Ga0500595_002130 3300053119 Bacteria 10082
635 Ga0500595_006059 3300053119 Bacteria 5186
636 Ga0500617_173706 3300053124 Bacteria 824
637 Ga0500559_0000581 3300053136 Bacteria 25087
638 Ga0500559_0007362 3300053136 Bacteria 4881
639 Ga0500559_0250577 3300053136 Bacteria 834
640 Ga0500561_0049246 3300053137 Bacteria 1143
641 Ga0500573_0023333 3300053140 Bacteria 3552
642 Ga0500589_088330 3300053147 Bacteria 1370
643 Ga0500603_001051 3300053150 Bacteria 6492
644 Ga0500603_018903 3300053150 Bacteria 1666
645 Ga0500622_0003131 3300053156 Bacteria 11359
646 Ga0500633_0118786 3300053160 Bacteria 983
647 Ga0500638_002099 3300053162 Bacteria 6759
648 Ga0500638_186615 3300053162 Bacteria 890
649 Ga0500639_026058 3300053163 Bacteria 3089
650 Ga0500636_0016803 3300053177 Bacteria 4314
651 Ga0500636_0023252 3300053177 Bacteria 3664
652 Ga0500637_0000107 3300053178 Bacteria 29902
653 Ga0500637_0000325 3300053178 Bacteria 17915
654 Ga0500637_0001936 3300053178 Bacteria 9005
655 Ga0500637_0054556 3300053178 Bacteria 2281
656 Ga0500645_004847 3300053730 Bacteria 5072
657 Ga0500596_001376 3300053735 Bacteria 4908
658 Ga0500596_010189 3300053735 Bacteria 1456
659 Ga0501084_0009659 3300054114 Bacteria 7981
660 Ga0501084_0025430 3300054114 Bacteria 4940
661 Ga0500661_002117 3300055283 Bacteria 3750
662 Ga0501082_0063390 3300060353 Bacteria 3182
663 Ga0501082_0127365 3300060353 Bacteria 2209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047323 Ga0495683_0238642 Ga0495683_0238642_31_636 196
2 3300009177 Ga0105248_10281011 Ga0105248_102810112 200
3 3300049571 Ga0501034_0213416 Ga0501034_0213416_382_1248 210
4 3300049572 Ga0501036_0492239 Ga0501036_0492239_108_974 210
5 3300049574 Ga0501038_0025917 Ga0501038_0025917_357_1223 210
6 3300049575 Ga0501039_0076170 Ga0501039_0076170_1314_2180 210
7 3300049579 Ga0501043_0057027 Ga0501043_0057027_270_1136 210
8 3300049580 Ga0501046_0017892 Ga0501046_0017892_2079_2945 210
9 3300049581 Ga0501047_0150958 Ga0501047_0150958_697_1563 210
10 3300049582 Ga0501048_0197178 Ga0501048_0197178_296_1162 210
11 3300049584 Ga0501068_0162355 Ga0501068_0162355_160_1026 210
12 3300049586 Ga0501070_0049641 Ga0501070_0049641_2270_3136 210
13 3300049588 Ga0501072_0365533 Ga0501072_0365533_201_1067 210
14 3300049589 Ga0501073_0156778 Ga0501073_0156778_75_941 210
15 3300049590 Ga0501074_0077642 Ga0501074_0077642_1358_2224 210
16 3300049592 Ga0501076_0148277 Ga0501076_0148277_126_992 210
17 3300049822 Ga0501035_0022751 Ga0501035_0022751_4440_5306 210
18 3300049823 Ga0501044_0063239 Ga0501044_0063239_75_941 210
19 3300060353 Ga0501082_0063390 Ga0501082_0063390_1703_2569 210
20 3300005548 Ga0070665_100123975 Ga0070665_1001239752 215
21 3300039437 Ga0436365_1593583 Ga0436365_1593583_516_1271 218
22 3300005331 Ga0070670_100000009 Ga0070670_100000009165 219
23 3300005335 Ga0070666_10151637 Ga0070666_101516372 219
24 3300005347 Ga0070668_100003906 Ga0070668_1000039064 219
25 3300005367 Ga0070667_100002908 Ga0070667_1000029086 219
26 3300005548 Ga0070665_100009207 Ga0070665_1000092073 219
27 3300005618 Ga0068864_100000151 Ga0068864_10000015160 219
28 3300005841 Ga0068863_100000399 Ga0068863_10000039925 219
29 3300005842 Ga0068858_100068456 Ga0068858_1000684562 219
30 3300005843 Ga0068860_100000184 Ga0068860_10000018437 219
31 3300005844 Ga0068862_100017886 Ga0068862_1000178863 219
32 3300009101 Ga0105247_10188332 Ga0105247_101883322 219
33 3300009177 Ga0105248_10047128 Ga0105248_100471282 219
34 3300009553 Ga0105249_10002575 Ga0105249_100025752 219
35 3300013306 Ga0163162_10135326 Ga0163162_101353263 219
36 3300014325 Ga0163163_10235289 Ga0163163_102352892 219
37 3300014968 Ga0157379_10036023 Ga0157379_100360232 219
38 3300025900 Ga0207710_10122472 Ga0207710_101224721 219
39 3300025903 Ga0207680_10009251 Ga0207680_100092516 219
40 3300025925 Ga0207650_10000014 Ga0207650_10000014317 219
41 3300025941 Ga0207711_10010577 Ga0207711_100105774 219
42 3300025961 Ga0207712_10000782 Ga0207712_100007822 219
43 3300025972 Ga0207668_10022139 Ga0207668_100221392 219
44 3300025986 Ga0207658_10007795 Ga0207658_100077953 219
45 3300026035 Ga0207703_10005534 Ga0207703_1000553410 219
46 3300026088 Ga0207641_10001549 Ga0207641_100015492 219
47 3300026095 Ga0207676_10000594 Ga0207676_100005949 219
48 3300028379 Ga0268266_10009547 Ga0268266_100095479 219
49 3300028380 Ga0268265_10005273 Ga0268265_100052739 219
50 3300028381 Ga0268264_10000124 Ga0268264_10000124164 219
51 3300028381 Ga0268264_10000170 Ga0268264_10000170141 219
52 3300048905 Ga0496102_0716333 Ga0496102_0716333_37_777 219
53 3300048906 Ga0496103_0095603 Ga0496103_0095603_176_916 219
54 3300048909 Ga0496106_0340125 Ga0496106_0340125_410_1150 219
55 3300005347 Ga0070668_100005548 Ga0070668_1000055485 223
56 3300005548 Ga0070665_100000338 Ga0070665_1000003383 223
57 3300005617 Ga0068859_100293798 Ga0068859_1002937981 223
58 3300005844 Ga0068862_100105508 Ga0068862_1001055082 223
59 3300006931 Ga0097620_100293793 Ga0097620_1002937931 223
60 3300025941 Ga0207711_10196691 Ga0207711_101966911 223
61 3300025961 Ga0207712_10039078 Ga0207712_100390783 223
62 3300025972 Ga0207668_10000025 Ga0207668_10000025131 223
63 3300025986 Ga0207658_10007800 Ga0207658_100078009 223
64 3300026088 Ga0207641_10260998 Ga0207641_102609982 223
65 3300028379 Ga0268266_10000533 Ga0268266_100005334 223
66 3300028380 Ga0268265_10028249 Ga0268265_100282494 223
67 3300053156 Ga0500622_0003131 Ga0500622_0003131_6139_6870 223
68 3300053087 Ga0500643_019089 Ga0500643_019089_516_1256 224
69 3300046794 Ga0495589_0141712 Ga0495589_0141712_15_719 227
70 3300049822 Ga0501035_0352217 Ga0501035_0352217_224_931 227
71 3300005841 Ga0068863_100032206 Ga0068863_1000322062 228
72 3300013307 Ga0157372_11153476 Ga0157372_111534761 228
73 3300026088 Ga0207641_10028788 Ga0207641_100287885 228
74 3300006844 Ga0075428_100135095 Ga0075428_1001350952 229
75 3300009545 Ga0105237_10169001 Ga0105237_101690013 229
76 3300025914 Ga0207671_10142555 Ga0207671_101425552 229
77 3300025924 Ga0207694_10608237 Ga0207694_106082371 229
78 3300050509 nmdc:mga0qj67_357193_c1 nmdc:mga0qj67_357193_c1_37_786 229
79 3300050510 nmdc:mga06r32_194702_c1 nmdc:mga06r32_194702_c1_730_1479 229
80 3300046459 Ga0495629_0013089 Ga0495629_0013089_133_879 230
81 3300049570 Ga0501033_0265580 Ga0501033_0265580_353_1084 230
82 3300049574 Ga0501038_0337204 Ga0501038_0337204_243_974 230
83 3300049822 Ga0501035_0332398 Ga0501035_0332398_339_1070 230
84 3300049823 Ga0501044_0066970 Ga0501044_0066970_2506_3237 230
85 3300053080 Ga0500635_0000120 Ga0500635_0000120_9727_10461 230
86 3300053108 Ga0500562_000043 Ga0500562_000043_47594_48346 230
87 3300053162 Ga0500638_186615 Ga0500638_186615_48_782 230
88 3300053177 Ga0500636_0016803 Ga0500636_0016803_1644_2378 230
89 3300053178 Ga0500637_0054556 Ga0500637_0054556_1412_2146 230
90 3300005347 Ga0070668_100010666 Ga0070668_1000106663 231
91 3300046529 Ga0495652_0549055 Ga0495652_0549055_60_764 234
92 3300035086 Ga0373934_0007659 Ga0373934_0007659_439_1146 235
93 3300035410 Ga0373924_0052995 Ga0373924_0052995_67_774 235
94 3300036401 Ga0373937_0088458 Ga0373937_0088458_2120_2827 235
95 3300036401 Ga0373937_0200973 Ga0373937_0200973_1126_1833 235
96 3300046454 Ga0495592_0347063 Ga0495592_0347063_13_720 235
97 3300046462 Ga0495651_0165722 Ga0495651_0165722_41_748 235
98 3300046463 Ga0495653_0427881 Ga0495653_0427881_89_796 235
99 3300046511 Ga0495608_0136597 Ga0495608_0136597_177_884 235
100 3300046516 Ga0495628_0026090 Ga0495628_0026090_2503_3210 235
101 3300046529 Ga0495652_0048678 Ga0495652_0048678_1242_1949 235
102 3300046529 Ga0495652_0253010 Ga0495652_0253010_414_1121 235
103 3300046536 Ga0495587_0275395 Ga0495587_0275395_35_742 235
104 3300046559 Ga0495667_0050594 Ga0495667_0050594_1943_2650 235
105 3300046559 Ga0495667_0197940 Ga0495667_0197940_562_1269 235
106 3300046642 Ga0495634_0052483 Ga0495634_0052483_214_921 235
107 3300046663 Ga0495635_0184748 Ga0495635_0184748_669_1376 235
108 3300046678 Ga0495599_0063344 Ga0495599_0063344_1423_2130 235
109 3300046809 Ga0495600_0166725 Ga0495600_0166725_675_1382 235
110 3300046809 Ga0495600_0315712 Ga0495600_0315712_236_943 235
111 3300047317 Ga0495604_0171265 Ga0495604_0171265_41_748 235
112 3300047319 Ga0495674_0087688 Ga0495674_0087688_1015_1722 235
113 3300047322 Ga0495680_0110640 Ga0495680_0110640_41_748 235
114 3300047444 Ga0495675_0081208 Ga0495675_0081208_1294_2001 235
115 3300047673 Ga0495593_0112090 Ga0495593_0112090_53_760 235
116 3300048913 Ga0496110_0134651 Ga0496110_0134651_1058_1765 235
117 3300048918 Ga0496115_0274707 Ga0496115_0274707_251_958 235
118 3300048929 Ga0496126_0400131 Ga0496126_0400131_16_723 235
119 3300053085 Ga0495619_0035769 Ga0495619_0035769_1891_2598 235
120 iso_pu_bacteria 2840878972 2840880215 235
121 3300048929 Ga0496126_0016251 Ga0496126_0016251_23_733 236
122 3300053118 Ga0500594_0049473 Ga0500594_0049473_454_1164 236
123 3300053124 Ga0500617_173706 Ga0500617_173706_11_721 236
124 3300025906 Ga0207699_10039340 Ga0207699_100393403 237
125 3300046455 Ga0495603_0242664 Ga0495603_0242664_284_997 237
126 3300046526 Ga0495666_0247701 Ga0495666_0247701_42_755 237
127 3300048088 Ga0495602_0556830 Ga0495602_0556830_36_749 237
128 3300048905 Ga0496102_0396711 Ga0496102_0396711_25_738 237
129 3300048929 Ga0496126_0031256 Ga0496126_0031256_27_743 238
130 3300049588 Ga0501072_0019878 Ga0501072_0019878_3265_3996 238
131 3300049742 Ga0501080_0037141 Ga0501080_0037141_2363_3094 238
132 3300049744 Ga0501083_0002147 Ga0501083_0002147_9947_10678 238
133 3300054114 Ga0501084_0009659 Ga0501084_0009659_2256_2987 238
134 3300010159 Ga0099796_10132305 Ga0099796_101323051 240
135 3300005563 Ga0068855_100479923 Ga0068855_1004799231 241
136 3300035691 Ga0373931_0213070 Ga0373931_0213070_210_935 241
137 3300035692 Ga0373935_0390982 Ga0373935_0390982_84_809 241
138 3300035695 Ga0373927_0042463 Ga0373927_0042463_1217_1942 241
139 3300046455 Ga0495603_0059096 Ga0495603_0059096_478_1227 241
140 3300046457 Ga0495590_0030733 Ga0495590_0030733_617_1366 241
141 3300046528 Ga0495642_0055798 Ga0495642_0055798_868_1617 241
142 3300046694 Ga0495649_0048664 Ga0495649_0048664_1033_1782 241
143 3300047320 Ga0495672_0000485 Ga0495672_0000485_23607_24356 241
144 3300048905 Ga0496102_0017493 Ga0496102_0017493_4917_5642 241
145 3300048911 Ga0496108_0118670 Ga0496108_0118670_1204_1929 241
146 3300048914 Ga0496111_0635687 Ga0496111_0635687_30_755 241
147 3300048916 Ga0496113_0228831 Ga0496113_0228831_25_750 241
148 3300048918 Ga0496115_0124230 Ga0496115_0124230_101_826 241
149 3300053178 Ga0500637_0001936 Ga0500637_0001936_2749_3498 241
150 3300005539 Ga0068853_100061451 Ga0068853_1000614512 242
151 3300005563 Ga0068855_100024002 Ga0068855_1000240023 244
152 3300009093 Ga0105240_10000875 Ga0105240_1000087536 244
153 3300009093 Ga0105240_10004915 Ga0105240_100049158 244
154 3300025913 Ga0207695_10004074 Ga0207695_100040748 244
155 3300025913 Ga0207695_10009841 Ga0207695_100098416 244
156 3300025949 Ga0207667_10017201 Ga0207667_100172018 244
157 3300035695 Ga0373927_0163114 Ga0373927_0163114_289_1104 246
158 3300035725 Ga0373947_0195608 Ga0373947_0195608_389_1204 246
159 3300037068 Ga0373925_0203809 Ga0373925_0203809_407_1222 246
160 iso_pu_bacteria 2513237096 2513660524 246
161 iso_pu_bacteria 2513237101 2513695436 246
162 iso_pu_bacteria 2513237137 2513858095 246
163 iso_pu_bacteria 2513237145 2513922316 246
164 iso_pu_bacteria 2524023228 2524536178 246
165 iso_pu_bacteria 2667528175 2671122997 246
166 iso_pu_bacteria 2728368998 2728754656 246
167 iso_pu_bacteria 2791355197 2793072741 246
168 iso_pu_bacteria 2791355199 2793079338 246
169 iso_pu_bacteria 2874604998 2874612191 246
170 iso_pu_bacteria 2876808645 2876817723 246
171 iso_pu_bacteria 2879110137 2879111851 246
172 iso_pu_bacteria 2885374607 2885375015 246
173 iso_pu_bacteria 2889033259 2889041969 246
174 iso_pu_bacteria 2903748898 2903756936 246
175 iso_pu_bacteria 2904690495 2904697480 246
176 iso_pu_bacteria 2904699407 2904705206 246
177 iso_pu_bacteria 2906610324 2906610906 246
178 iso_pu_bacteria 2906635258 2906635732 246
179 iso_pu_bacteria 2906660503 2906661706 246
180 iso_pu_bacteria 2908739725 2908744423 246
181 iso_pu_bacteria 2908756301 2908762064 246
182 iso_pu_bacteria 2922361189 2922366159 246
183 iso_pu_bacteria 2922386360 2922386762 246
184 iso_pu_bacteria 2922425934 2922428417 246
185 iso_pu_bacteria 2935630451 2935634410 246
186 iso_pu_bacteria 2941507105 2941508896 246
187 iso_pu_bacteria 2941515067 2941516725 246
188 iso_pu_bacteria 2941523033 2941525181 246
189 iso_pu_bacteria 3005474847 3005478536 246
190 iso_pu_bacteria 8006933436 8006942828 246
191 iso_pu_bacteria 8006964411 8006964959 246
192 iso_pu_bacteria 8006973647 8006982547 246
193 iso_pu_bacteria 8006984368 8006991644 246
194 iso_pu_bacteria 8006994254 8006994320 246
195 iso_pu_bacteria 8019555841 8019558583 246
196 iso_pu_bacteria 8056681323 8056685264 246
197 iso_pu_bacteria 8056689827 8056691742 246
198 3300003659 JGI25404J52841_10042226 JGI25404J52841_100422261 247
199 3300005548 Ga0070665_100388147 Ga0070665_1003881472 247
200 3300005937 Ga0081455_10040908 Ga0081455_100409084 247
201 3300005983 Ga0081540_1004203 Ga0081540_10042037 247
202 3300005983 Ga0081540_1008157 Ga0081540_10081576 247
203 3300005983 Ga0081540_1028032 Ga0081540_10280323 247
204 3300005983 Ga0081540_1030158 Ga0081540_10301582 247
205 3300012478 Ga0157328_1001127 Ga0157328_10011271 247
206 3300035691 Ga0373931_0100625 Ga0373931_0100625_34_795 247
207 3300048911 Ga0496108_0325379 Ga0496108_0325379_549_1310 247
208 3300048915 Ga0496112_0137280 Ga0496112_0137280_802_1563 247
209 3300005985 Ga0081539_10000319 Ga0081539_10000319114 248
210 3300024227 Ga0228598_1026063 Ga0228598_10260631 248
211 3300025261 Ga0209233_1005863 Ga0209233_10058636 248
212 3300025272 Ga0209455_1006321 Ga0209455_10063212 248
213 3300053099 Ga0500654_077101 Ga0500654_077101_765_1511 248
214 3300053147 Ga0500589_088330 Ga0500589_088330_559_1305 248
215 3300003214 JGI25165J46597_1006803 JGI25165J46597_10068032 249
216 3300003215 JGI25153J46596_10008206 JGI25153J46596_100082062 249
217 3300003215 JGI25153J46596_10015237 JGI25153J46596_100152373 249
218 3300003354 JGI25160J50197_1003851 JGI25160J50197_10038515 249
219 3300005336 Ga0070680_100178213 Ga0070680_1001782132 249
220 3300005366 Ga0070659_100022240 Ga0070659_1000222407 249
221 3300005530 Ga0070679_100148200 Ga0070679_1001482003 249
222 3300005563 Ga0068855_101029593 Ga0068855_1010295931 249
223 3300005578 Ga0068854_100079449 Ga0068854_1000794492 249
224 3300005616 Ga0068852_100014382 Ga0068852_1000143823 249
225 3300005983 Ga0081540_1044573 Ga0081540_10445733 249
226 3300006038 Ga0075365_10162700 Ga0075365_101627002 249
227 3300006942 Ga0099824_1007912 Ga0099824_10079124 249
228 3300009551 Ga0105238_10127124 Ga0105238_101271242 249
229 3300009551 Ga0105238_10777832 Ga0105238_107778321 249
230 3300013104 Ga0157370_10525718 Ga0157370_105257181 249
231 3300013307 Ga0157372_10325632 Ga0157372_103256322 249
232 3300025273 Ga0209673_1051616 Ga0209673_10516161 249
233 3300025302 Ga0207426_1000847 Ga0207426_100084719 249
234 3300025304 Ga0209257_1024258 Ga0209257_10242581 249
235 3300025917 Ga0207660_10169233 Ga0207660_101692332 249
236 3300025919 Ga0207657_10000891 Ga0207657_1000089110 249
237 3300025919 Ga0207657_10288106 Ga0207657_102881062 249
238 3300025949 Ga0207667_10696509 Ga0207667_106965092 249
239 3300025981 Ga0207640_10081840 Ga0207640_100818402 249
240 3300026067 Ga0207678_10024105 Ga0207678_100241054 249
241 3300026078 Ga0207702_10180548 Ga0207702_101805482 249
242 3300026142 Ga0207698_10054630 Ga0207698_100546302 249
243 3300027296 Ga0209389_1000127 Ga0209389_100012767 249
244 3300027357 Ga0209589_1000243 Ga0209589_100024367 249
245 3300027361 Ga0209489_103202 Ga0209489_10320223 249
246 3300037471 Ga0395905_0098736 Ga0395905_0098736_995_1756 249
247 3300038443 Ga0395901_0142943 Ga0395901_0142943_116_877 249
248 3300044658 Ga0466972_0003847 Ga0466972_0003847_4894_5655 249
249 3300044683 Ga0466965_0037393 Ga0466965_0037393_548_1309 249
250 3300044684 Ga0466966_0001672 Ga0466966_0001672_6658_7419 249
251 3300044693 Ga0466961_0001529 Ga0466961_0001529_10857_11618 249
252 3300044694 Ga0466963_0033109 Ga0466963_0033109_1316_2077 249
253 3300044765 Ga0466970_0084344 Ga0466970_0084344_21_782 249
254 3300045976 Ga0466967_0266325 Ga0466967_0266325_73_834 249
255 3300048927 Ga0496124_0208231 Ga0496124_0208231_84_845 249
256 3300050492 nmdc:mga0yw44_78757_c1 nmdc:mga0yw44_78757_c1_1011_1772 249
257 iso_pu_bacteria 2513237092 2513627578 249
258 iso_pu_bacteria 2513237161 2514017140 249
259 iso_pu_bacteria 2517093001 2517105243 249
260 iso_pu_bacteria 2824671348 2824678263 249
261 iso_pu_bacteria 2824687955 2824694735 249
262 iso_pu_bacteria 2824704595 2824708306 249
263 iso_pu_bacteria 2824753945 2824761037 249
264 iso_pu_bacteria 2824763712 2824771750 249
265 iso_pu_bacteria 2824773399 2824780760 249
266 iso_pu_bacteria 2838122688 2838125650 249
267 iso_pu_bacteria 2841941048 2841941688 249
268 iso_pu_bacteria 2841949485 2841951117 249
269 iso_pu_bacteria 2841966195 2841974245 249
270 iso_pu_bacteria 2841974524 2841975917 249
271 iso_pu_bacteria 2841983080 2841989230 249
272 iso_pu_bacteria 2844315083 2844317572 249
273 iso_pu_bacteria 2874612657 2874618056 249
274 iso_pu_bacteria 2874620515 2874627949 249
275 iso_pu_bacteria 2881665667 2881670771 249
276 iso_pu_bacteria 2885366525 2885368754 249
277 iso_pu_bacteria 2903727486 2903735256 249
278 iso_pu_bacteria 2904666416 2904666683 249
279 iso_pu_bacteria 2904711408 2904718640 249
280 iso_pu_bacteria 2906602504 2906608830 249
281 iso_pu_bacteria 3005483717 3005487775 249
282 iso_pu_bacteria 3005594810 3005597308 249
283 iso_pu_bacteria 3005718088 3005720690 249
284 iso_pu_bacteria 8056967851 8056969376 249
285 3300003215 JGI25153J46596_10000257 JGI25153J46596_1000025737 250
286 3300005347 Ga0070668_100066414 Ga0070668_1000664143 250
287 3300005347 Ga0070668_100214584 Ga0070668_1002145842 250
288 3300005356 Ga0070674_100045828 Ga0070674_1000458284 250
289 3300005366 Ga0070659_100172624 Ga0070659_1001726242 250
290 3300005438 Ga0070701_10151839 Ga0070701_101518392 250
291 3300005438 Ga0070701_10221896 Ga0070701_102218962 250
292 3300005439 Ga0070711_100031977 Ga0070711_1000319774 250
293 3300005456 Ga0070678_100286235 Ga0070678_1002862352 250
294 3300005536 Ga0070697_100127802 Ga0070697_1001278022 250
295 3300005539 Ga0068853_100132265 Ga0068853_1001322652 250
296 3300005545 Ga0070695_100323180 Ga0070695_1003231801 250
297 3300005564 Ga0070664_100365028 Ga0070664_1003650282 250
298 3300005719 Ga0068861_100187723 Ga0068861_1001877232 250
299 3300005843 Ga0068860_100540573 Ga0068860_1005405732 250
300 3300005937 Ga0081455_10071958 Ga0081455_100719586 250
301 3300006038 Ga0075365_10087926 Ga0075365_100879262 250
302 3300006038 Ga0075365_10224761 Ga0075365_102247612 250
303 3300006178 Ga0075367_10065406 Ga0075367_100654063 250
304 3300006186 Ga0075369_10008711 Ga0075369_100087117 250
305 3300006844 Ga0075428_100090838 Ga0075428_1000908386 250
306 3300006881 Ga0068865_100291674 Ga0068865_1002916742 250
307 3300006941 Ga0099825_1029497 Ga0099825_10294972 250
308 3300006942 Ga0099824_1002092 Ga0099824_100209214 250
309 3300006943 Ga0099822_1000668 Ga0099822_10006688 250
310 3300009147 Ga0114129_10084007 Ga0114129_100840075 250
311 3300009147 Ga0114129_10351618 Ga0114129_103516182 250
312 3300009148 Ga0105243_10123903 Ga0105243_101239033 250
313 3300009177 Ga0105248_10470648 Ga0105248_104706482 250
314 3300009551 Ga0105238_10399624 Ga0105238_103996241 250
315 3300012488 Ga0157343_1004752 Ga0157343_10047521 250
316 3300013104 Ga0157370_10174882 Ga0157370_101748821 250
317 3300014968 Ga0157379_10037102 Ga0157379_100371021 250
318 3300021320 Ga0214544_1000020 Ga0214544_10000205 250
319 3300021321 Ga0214542_1000024 Ga0214542_100002417 250
320 3300021324 Ga0214545_1000011 Ga0214545_100001117 250
321 3300021327 Ga0214543_1000033 Ga0214543_1000033188 250
322 3300025253 Ga0209677_100238 Ga0209677_1002387 250
323 3300025261 Ga0209233_1022091 Ga0209233_10220911 250
324 3300025297 Ga0209758_1001525 Ga0209758_10015255 250
325 3300025297 Ga0209758_1004742 Ga0209758_100474212 250
326 3300025297 Ga0209758_1041649 Ga0209758_10416492 250
327 3300025915 Ga0207693_10044656 Ga0207693_100446562 250
328 3300025932 Ga0207690_10249830 Ga0207690_102498301 250
329 3300025937 Ga0207669_10076362 Ga0207669_100763622 250
330 3300025938 Ga0207704_10086964 Ga0207704_100869641 250
331 3300025938 Ga0207704_10271557 Ga0207704_102715572 250
332 3300025939 Ga0207665_10075275 Ga0207665_100752751 250
333 3300025941 Ga0207711_10055999 Ga0207711_100559994 250
334 3300025961 Ga0207712_10043753 Ga0207712_100437534 250
335 3300025972 Ga0207668_10036246 Ga0207668_100362464 250
336 3300025972 Ga0207668_10150963 Ga0207668_101509632 250
337 3300026041 Ga0207639_10087947 Ga0207639_100879472 250
338 3300026118 Ga0207675_100095062 Ga0207675_1000950623 250
339 3300026121 Ga0207683_10113780 Ga0207683_101137803 250
340 3300026142 Ga0207698_10816915 Ga0207698_108169151 250
341 3300027357 Ga0209589_1000018 Ga0209589_1000018182 250
342 3300027361 Ga0209489_100026 Ga0209489_100026182 250
343 3300027363 Ga0209700_100035 Ga0209700_100035182 250
344 3300030521 Ga0307511_10193374 Ga0307511_101933742 250
345 3300031456 Ga0307513_10041126 Ga0307513_100411263 250
346 3300031507 Ga0307509_10062472 Ga0307509_100624721 250
347 3300031730 Ga0307516_10328772 Ga0307516_103287722 250
348 3300031824 Ga0307413_10046415 Ga0307413_100464153 250
349 3300032002 Ga0307416_100685982 Ga0307416_1006859821 250
350 3300032126 Ga0307415_100061113 Ga0307415_1000611133 250
351 3300033180 Ga0307510_10044615 Ga0307510_100446155 250
352 3300033442 Ga0315911_1000011 Ga0315911_1000011206 250
353 3300035084 Ga0373928_0059864 Ga0373928_0059864_24_776 250
354 3300035691 Ga0373931_0304228 Ga0373931_0304228_62_814 250
355 3300035695 Ga0373927_0071939 Ga0373927_0071939_1150_1902 250
356 3300042157 Ga0439458_0057679 Ga0439458_0057679_100_852 250
357 3300046455 Ga0495603_0155670 Ga0495603_0155670_14_766 250
358 3300046500 Ga0495596_0039486 Ga0495596_0039486_560_1312 250
359 3300046501 Ga0495607_0046041 Ga0495607_0046041_366_1118 250
360 3300046512 Ga0495610_0122624 Ga0495610_0122624_58_810 250
361 3300046519 Ga0495632_0022696 Ga0495632_0022696_63_815 250
362 3300046530 Ga0495654_0128698 Ga0495654_0128698_322_1074 250
363 3300046615 Ga0495656_0009707 Ga0495656_0009707_801_1553 250
364 3300046615 Ga0495656_0026136 Ga0495656_0026136_593_1345 250
365 3300046615 Ga0495656_0112738 Ga0495656_0112738_30_782 250
366 3300046616 Ga0495668_0091007 Ga0495668_0091007_848_1600 250
367 3300046660 Ga0495625_0286394 Ga0495625_0286394_230_982 250
368 3300046684 Ga0495669_0020855 Ga0495669_0020855_22_774 250
369 3300047318 Ga0495636_0038480 Ga0495636_0038480_338_1090 250
370 3300047320 Ga0495672_0112258 Ga0495672_0112258_540_1298 250
371 3300047323 Ga0495683_0167661 Ga0495683_0167661_64_816 250
372 3300047470 Ga0495681_0065774 Ga0495681_0065774_387_1139 250
373 3300048904 Ga0496101_0054755 Ga0496101_0054755_394_1146 250
374 3300048905 Ga0496102_0145128 Ga0496102_0145128_455_1207 250
375 3300048905 Ga0496102_0461380 Ga0496102_0461380_208_960 250
376 3300048908 Ga0496105_0116419 Ga0496105_0116419_1426_2178 250
377 3300048910 Ga0496107_0427031 Ga0496107_0427031_211_963 250
378 3300048912 Ga0496109_0181960 Ga0496109_0181960_1074_1826 250
379 3300048913 Ga0496110_0548721 Ga0496110_0548721_145_903 250
380 3300048914 Ga0496111_0121022 Ga0496111_0121022_660_1418 250
381 3300048915 Ga0496112_0597584 Ga0496112_0597584_234_998 250
382 3300048918 Ga0496115_0622326 Ga0496115_0622326_82_834 250
383 3300048924 Ga0496121_0000300 Ga0496121_0000300_63443_64201 250
384 3300048924 Ga0496121_0018815 Ga0496121_0018815_4808_5560 250
385 3300048924 Ga0496121_0177054 Ga0496121_0177054_220_996 250
386 3300048924 Ga0496121_0325944 Ga0496121_0325944_208_960 250
387 3300048927 Ga0496124_0357714 Ga0496124_0357714_14_766 250
388 3300048928 Ga0496125_0062738 Ga0496125_0062738_1004_1756 250
389 3300048929 Ga0496126_0007334 Ga0496126_0007334_3932_4684 250
390 3300048929 Ga0496126_0075680 Ga0496126_0075680_1261_2013 250
391 3300050492 nmdc:mga0yw44_32637_c1 nmdc:mga0yw44_32637_c1_1085_1837 250
392 3300053103 Ga0500555_011379 Ga0500555_011379_1401_2153 250
393 3300053108 Ga0500562_060363 Ga0500562_060363_67_819 250
394 3300053114 Ga0500582_001062 Ga0500582_001062_1330_2082 250
395 3300053119 Ga0500595_001984 Ga0500595_001984_7521_8279 250
396 3300053119 Ga0500595_002130 Ga0500595_002130_7338_8090 250
397 3300053137 Ga0500561_0049246 Ga0500561_0049246_372_1124 250
398 3300053160 Ga0500633_0118786 Ga0500633_0118786_67_819 250
399 3300053730 Ga0500645_004847 Ga0500645_004847_779_1531 250
400 iso_pu_bacteria 2513237095 2513648829 250
401 iso_pu_bacteria 2513237104 2513721842 250
402 iso_pu_bacteria 2617270741 2617379113 250
403 iso_pu_bacteria 2816332527 2818241767 250
404 iso_pu_bacteria 2824617872 2824625131 250
405 iso_pu_bacteria 2824626560 2824634304 250
406 iso_pu_bacteria 2824635225 2824641641 250
407 iso_pu_bacteria 2824644064 2824649797 250
408 iso_pu_bacteria 2824679649 2824684113 250
409 iso_pu_bacteria 2824714736 2824719301 250
410 iso_pu_bacteria 2824723954 2824729146 250
411 iso_pu_bacteria 2824732956 2824737094 250
412 iso_pu_bacteria 2824746037 2824752246 250
413 iso_pu_bacteria 2857509624 2857509792 250
414 iso_pu_bacteria 2876761206 2876762808 250
415 iso_pu_bacteria 2881364244 2881367589 250
416 iso_pu_bacteria 2888378607 2888382275 250
417 iso_pu_bacteria 2906626472 2906634625 250
418 iso_pu_bacteria 2908775508 2908778548 250
419 iso_pu_bacteria 2922393267 2922394813 250
420 iso_pu_bacteria 2935769743 2935771334 250
421 iso_pu_bacteria 2935777560 2935779021 250
422 iso_pu_bacteria 2935785616 2935788228 250
423 iso_pu_bacteria 2935793552 2935797007 250
424 iso_pu_bacteria 3005587118 3005589283 250
425 iso_pu_bacteria 8016522445 8016523057 250
426 iso_pu_bacteria 8016530956 8016536523 250
427 iso_pu_bacteria 8016539877 8016540802 250
428 iso_pu_bacteria 8016548790 8016552442 250
429 iso_pu_bacteria 8016557553 8016560825 250
430 iso_pu_bacteria 8016566248 8016574885 250
431 iso_pu_bacteria 8016575299 8016578954 250
432 iso_pu_bacteria 8016595262 8016598697 250
433 iso_pu_bacteria 8016603502 8016612388 250
434 iso_pu_bacteria 8016613128 8016621416 250
435 iso_pu_bacteria 8016622563 8016628535 250
436 iso_pu_bacteria 8019530166 8019536236 250
437 iso_pu_bacteria 8019538911 8019543226 250
438 3300001979 JGI24740J21852_10002642 JGI24740J21852_100026429 251
439 3300001989 JGI24739J22299_10015078 JGI24739J22299_100150785 251
440 3300001990 JGI24737J22298_10011358 JGI24737J22298_100113585 251
441 3300002067 JGI24735J21928_10082505 JGI24735J21928_100825052 251
442 3300005330 Ga0070690_100133192 Ga0070690_1001331922 251
443 3300005336 Ga0070680_100012789 Ga0070680_1000127892 251
444 3300005336 Ga0070680_100103391 Ga0070680_1001033914 251
445 3300005354 Ga0070675_100609162 Ga0070675_1006091621 251
446 3300005434 Ga0070709_10053772 Ga0070709_100537723 251
447 3300005434 Ga0070709_10068963 Ga0070709_100689632 251
448 3300005435 Ga0070714_100004662 Ga0070714_1000046629 251
449 3300005435 Ga0070714_100611800 Ga0070714_1006118002 251
450 3300005436 Ga0070713_100955749 Ga0070713_1009557491 251
451 3300005437 Ga0070710_10003916 Ga0070710_100039164 251
452 3300005439 Ga0070711_100028398 Ga0070711_1000283984 251
453 3300005439 Ga0070711_100132226 Ga0070711_1001322262 251
454 3300005439 Ga0070711_100159102 Ga0070711_1001591022 251
455 3300005458 Ga0070681_10120730 Ga0070681_101207303 251
456 3300005467 Ga0070706_100209873 Ga0070706_1002098731 251
457 3300005530 Ga0070679_100040901 Ga0070679_1000409011 251
458 3300005539 Ga0068853_100089056 Ga0068853_1000890562 251
459 3300005539 Ga0068853_100100944 Ga0068853_1001009442 251
460 3300005539 Ga0068853_100380677 Ga0068853_1003806772 251
461 3300005544 Ga0070686_100431401 Ga0070686_1004314011 251
462 3300005563 Ga0068855_100024662 Ga0068855_1000246629 251
463 3300005563 Ga0068855_100025884 Ga0068855_10002588411 251
464 3300005577 Ga0068857_100026380 Ga0068857_1000263803 251
465 3300005577 Ga0068857_100027238 Ga0068857_1000272382 251
466 3300005578 Ga0068854_100008796 Ga0068854_1000087965 251
467 3300005578 Ga0068854_100018770 Ga0068854_1000187703 251
468 3300005578 Ga0068854_100018967 Ga0068854_1000189673 251
469 3300005614 Ga0068856_100000140 Ga0068856_10000014073 251
470 3300005614 Ga0068856_100013132 Ga0068856_1000131323 251
471 3300005616 Ga0068852_100019510 Ga0068852_1000195102 251
472 3300005834 Ga0068851_10014629 Ga0068851_100146292 251
473 3300005834 Ga0068851_10053146 Ga0068851_100531462 251
474 3300005841 Ga0068863_100080741 Ga0068863_1000807414 251
475 3300005843 Ga0068860_100000161 Ga0068860_10000016122 251
476 3300006028 Ga0070717_10039333 Ga0070717_100393334 251
477 3300006038 Ga0075365_10023940 Ga0075365_100239402 251
478 3300006163 Ga0070715_10002040 Ga0070715_100020408 251
479 3300006173 Ga0070716_100022589 Ga0070716_1000225894 251
480 3300006175 Ga0070712_100013473 Ga0070712_1000134734 251
481 3300006175 Ga0070712_100221322 Ga0070712_1002213222 251
482 3300007265 Ga0099794_10019670 Ga0099794_100196703 251
483 3300007788 Ga0099795_10032764 Ga0099795_100327642 251
484 3300009093 Ga0105240_10009118 Ga0105240_1000911811 251
485 3300009093 Ga0105240_10027340 Ga0105240_1002734010 251
486 3300009093 Ga0105240_10094344 Ga0105240_100943442 251
487 3300009174 Ga0105241_10018928 Ga0105241_100189282 251
488 3300009545 Ga0105237_10141592 Ga0105237_101415923 251
489 3300009545 Ga0105237_10147841 Ga0105237_101478412 251
490 3300009551 Ga0105238_10003151 Ga0105238_1000315117 251
491 3300009551 Ga0105238_10049938 Ga0105238_100499384 251
492 3300009551 Ga0105238_10440859 Ga0105238_104408592 251
493 3300010159 Ga0099796_10001299 Ga0099796_100012994 251
494 3300010375 Ga0105239_10023167 Ga0105239_100231672 251
495 3300010375 Ga0105239_10041893 Ga0105239_100418934 251
496 3300010375 Ga0105239_10057368 Ga0105239_100573682 251
497 3300010375 Ga0105239_10143426 Ga0105239_101434262 251
498 3300011119 Ga0105246_10290427 Ga0105246_102904272 251
499 3300013102 Ga0157371_10037559 Ga0157371_100375592 251
500 3300013104 Ga0157370_10028441 Ga0157370_100284412 251
501 3300013296 Ga0157374_10566303 Ga0157374_105663032 251
502 3300013297 Ga0157378_10012316 Ga0157378_1001231610 251
503 3300013308 Ga0157375_10673512 Ga0157375_106735121 251
504 3300021384 Ga0213876_10009102 Ga0213876_100091023 251
505 3300025297 Ga0209758_1006166 Ga0209758_10061663 251
506 3300025321 Ga0207656_10014093 Ga0207656_100140934 251
507 3300025898 Ga0207692_10005248 Ga0207692_100052484 251
508 3300025901 Ga0207688_10080342 Ga0207688_100803422 251
509 3300025905 Ga0207685_10024778 Ga0207685_100247783 251
510 3300025911 Ga0207654_10000123 Ga0207654_100001232 251
511 3300025912 Ga0207707_10012352 Ga0207707_100123525 251
512 3300025912 Ga0207707_10158396 Ga0207707_101583962 251
513 3300025913 Ga0207695_10009321 Ga0207695_100093216 251
514 3300025913 Ga0207695_10038444 Ga0207695_100384442 251
515 3300025913 Ga0207695_10217083 Ga0207695_102170832 251
516 3300025914 Ga0207671_10077109 Ga0207671_100771092 251
517 3300025914 Ga0207671_10192177 Ga0207671_101921771 251
518 3300025915 Ga0207693_10008696 Ga0207693_100086969 251
519 3300025915 Ga0207693_10368988 Ga0207693_103689881 251
520 3300025916 Ga0207663_10000967 Ga0207663_100009674 251
521 3300025916 Ga0207663_10433807 Ga0207663_104338071 251
522 3300025924 Ga0207694_10000810 Ga0207694_100008102 251
523 3300025924 Ga0207694_10062596 Ga0207694_100625962 251
524 3300025933 Ga0207706_10144673 Ga0207706_101446731 251
525 3300025939 Ga0207665_10007992 Ga0207665_100079928 251
526 3300025949 Ga0207667_10050594 Ga0207667_100505943 251
527 3300025949 Ga0207667_10084657 Ga0207667_100846574 251
528 3300025960 Ga0207651_10118622 Ga0207651_101186224 251
529 3300025981 Ga0207640_10011447 Ga0207640_100114473 251
530 3300025981 Ga0207640_10035802 Ga0207640_100358024 251
531 3300025981 Ga0207640_10107087 Ga0207640_101070872 251
532 3300025981 Ga0207640_10225956 Ga0207640_102259562 251
533 3300026041 Ga0207639_10049520 Ga0207639_100495202 251
534 3300026067 Ga0207678_10023438 Ga0207678_100234383 251
535 3300026067 Ga0207678_10192961 Ga0207678_101929611 251
536 3300026078 Ga0207702_10000005 Ga0207702_10000005441 251
537 3300026078 Ga0207702_10000261 Ga0207702_1000026129 251
538 3300026078 Ga0207702_10059332 Ga0207702_100593321 251
539 3300026078 Ga0207702_10553327 Ga0207702_105533271 251
540 3300026088 Ga0207641_10679899 Ga0207641_106798991 251
541 3300026095 Ga0207676_10448073 Ga0207676_104480732 251
542 3300026116 Ga0207674_10008432 Ga0207674_100084323 251
543 3300026116 Ga0207674_10016966 Ga0207674_1001696610 251
544 3300026116 Ga0207674_10946740 Ga0207674_109467401 251
545 3300026142 Ga0207698_10024150 Ga0207698_100241502 251
546 3300026142 Ga0207698_10394450 Ga0207698_103944502 251
547 3300027512 Ga0209179_1002826 Ga0209179_10028262 251
548 3300028381 Ga0268264_10000096 Ga0268264_10000096126 251
549 3300028573 Ga0265334_10016764 Ga0265334_100167643 251
550 3300028786 Ga0307517_10000049 Ga0307517_10000049161 251
551 3300031235 Ga0265330_10014486 Ga0265330_100144865 251
552 3300031247 Ga0265340_10005635 Ga0265340_100056356 251
553 3300031249 Ga0265339_10197133 Ga0265339_101971331 251
554 3300031507 Ga0307509_10348882 Ga0307509_103488821 251
555 3300031616 Ga0307508_10000168 Ga0307508_1000016862 251
556 3300031616 Ga0307508_10084175 Ga0307508_100841753 251
557 3300031711 Ga0265314_10054438 Ga0265314_100544383 251
558 3300031712 Ga0265342_10052350 Ga0265342_100523503 251
559 3300031730 Ga0307516_10137292 Ga0307516_101372922 251
560 3300033180 Ga0307510_10015971 Ga0307510_100159713 251
561 3300035111 Ga0373923_0168093 Ga0373923_0168093_180_935 251
562 3300035113 Ga0373936_0027445 Ga0373936_0027445_640_1398 251
563 3300035116 Ga0373945_0024492 Ga0373945_0024492_848_1606 251
564 3300035118 Ga0373954_0045048 Ga0373954_0045048_1272_2027 251
565 3300035118 Ga0373954_0109224 Ga0373954_0109224_566_1324 251
566 3300035118 Ga0373954_0205639 Ga0373954_0205639_187_942 251
567 3300035119 Ga0373956_0017735 Ga0373956_0017735_125_880 251
568 3300035172 Ga0373955_0004802 Ga0373955_0004802_118_873 251
569 3300035172 Ga0373955_0369661 Ga0373955_0369661_79_834 251
570 3300035410 Ga0373924_0088147 Ga0373924_0088147_193_948 251
571 3300035692 Ga0373935_0037854 Ga0373935_0037854_735_1493 251
572 3300035695 Ga0373927_0005668 Ga0373927_0005668_4017_4775 251
573 3300035724 Ga0373933_0000124 Ga0373933_0000124_10832_11596 251
574 3300035724 Ga0373933_0020774 Ga0373933_0020774_818_1573 251
575 3300035724 Ga0373933_0054242 Ga0373933_0054242_1582_2337 251
576 3300035725 Ga0373947_0004083 Ga0373947_0004083_3830_4588 251
577 3300036401 Ga0373937_0026270 Ga0373937_0026270_4391_5146 251
578 3300036401 Ga0373937_0205770 Ga0373937_0205770_523_1281 251
579 3300037068 Ga0373925_0006216 Ga0373925_0006216_6024_6782 251
580 3300037068 Ga0373925_0050641 Ga0373925_0050641_1020_1778 251
581 3300037068 Ga0373925_0243367 Ga0373925_0243367_276_1031 251
582 3300039437 Ga0436365_0547035 Ga0436365_0547035_1863_2627 251
583 3300039450 Ga0436363_1041317 Ga0436363_1041317_264_1043 251
584 3300039453 Ga0436362_0214249 Ga0436362_0214249_1735_2499 251
585 3300041512 Ga0451853_2263250 Ga0451853_2263250_610_1377 251
586 3300044656 Ga0466969_0043915 Ga0466969_0043915_262_1017 251
587 3300046454 Ga0495592_0022949 Ga0495592_0022949_520_1275 251
588 3300046454 Ga0495592_0039060 Ga0495592_0039060_250_1008 251
589 3300046455 Ga0495603_0005079 Ga0495603_0005079_5352_6110 251
590 3300046459 Ga0495629_0000672 Ga0495629_0000672_21632_22390 251
591 3300046459 Ga0495629_0388293 Ga0495629_0388293_124_879 251
592 3300046459 Ga0495629_0466086 Ga0495629_0466086_41_799 251
593 3300046461 Ga0495641_0076584 Ga0495641_0076584_601_1359 251
594 3300046462 Ga0495651_0022682 Ga0495651_0022682_2673_3428 251
595 3300046463 Ga0495653_0122576 Ga0495653_0122576_638_1396 251
596 3300046463 Ga0495653_0277783 Ga0495653_0277783_334_1089 251
597 3300046472 Ga0495580_0012605 Ga0495580_0012605_5098_5856 251
598 3300046473 Ga0495582_0000336 Ga0495582_0000336_6117_6875 251
599 3300046475 Ga0495639_0000154 Ga0495639_0000154_16481_17239 251
600 3300046476 Ga0495662_0003756 Ga0495662_0003756_6738_7496 251
601 3300046477 Ga0495664_0013710 Ga0495664_0013710_3705_4463 251
602 3300046477 Ga0495664_0020483 Ga0495664_0020483_1186_1941 251
603 3300046477 Ga0495664_0128800 Ga0495664_0128800_672_1427 251
604 3300046499 Ga0495594_0002042 Ga0495594_0002042_4929_5687 251
605 3300046511 Ga0495608_0021126 Ga0495608_0021126_2892_3647 251
606 3300046516 Ga0495628_0014412 Ga0495628_0014412_825_1580 251
607 3300046516 Ga0495628_0474660 Ga0495628_0474660_66_824 251
608 3300046517 Ga0495630_0008732 Ga0495630_0008732_3670_4428 251
609 3300046529 Ga0495652_0251335 Ga0495652_0251335_478_1233 251
610 3300046531 Ga0495665_0012053 Ga0495665_0012053_3063_3821 251
611 3300046533 Ga0495640_0008600 Ga0495640_0008600_3933_4691 251
612 3300046536 Ga0495587_0185504 Ga0495587_0185504_196_951 251
613 3300046543 Ga0495645_0017715 Ga0495645_0017715_2107_2862 251
614 3300046559 Ga0495667_0221498 Ga0495667_0221498_282_1040 251
615 3300046642 Ga0495634_0005666 Ga0495634_0005666_3876_4634 251
616 3300046642 Ga0495634_0084954 Ga0495634_0084954_509_1264 251
617 3300046642 Ga0495634_0136396 Ga0495634_0136396_724_1485 251
618 3300046663 Ga0495635_0010397 Ga0495635_0010397_2702_3460 251
619 3300046663 Ga0495635_0049581 Ga0495635_0049581_1243_1998 251
620 3300046674 Ga0495588_0165570 Ga0495588_0165570_59_817 251
621 3300046675 Ga0495657_0091513 Ga0495657_0091513_157_912 251
622 3300046678 Ga0495599_0029454 Ga0495599_0029454_2107_2862 251
623 3300046678 Ga0495599_0277214 Ga0495599_0277214_95_850 251
624 3300046679 Ga0495623_0072074 Ga0495623_0072074_390_1145 251
625 3300046680 Ga0495646_0023543 Ga0495646_0023543_1131_1886 251
626 3300046680 Ga0495646_0043244 Ga0495646_0043244_83_841 251
627 3300046681 Ga0495647_0009564 Ga0495647_0009564_1767_2525 251
628 3300046683 Ga0495658_0005565 Ga0495658_0005565_4704_5462 251
629 3300046689 Ga0495613_0014087 Ga0495613_0014087_3886_4644 251
630 3300046689 Ga0495613_0284320 Ga0495613_0284320_356_1111 251
631 3300046690 Ga0495624_0002880 Ga0495624_0002880_6766_7524 251
632 3300046809 Ga0495600_0015717 Ga0495600_0015717_443_1198 251
633 3300046809 Ga0495600_0063345 Ga0495600_0063345_1630_2385 251
634 3300047315 Ga0495581_0004403 Ga0495581_0004403_6758_7516 251
635 3300047317 Ga0495604_0162220 Ga0495604_0162220_338_1093 251
636 3300047319 Ga0495674_0005189 Ga0495674_0005189_3731_4489 251
637 3300047319 Ga0495674_0027448 Ga0495674_0027448_3652_4407 251
638 3300047321 Ga0495676_0058263 Ga0495676_0058263_1358_2116 251
639 3300047322 Ga0495680_0031150 Ga0495680_0031150_423_1178 251
640 3300047322 Ga0495680_0263401 Ga0495680_0263401_423_1178 251
641 3300047444 Ga0495675_0105808 Ga0495675_0105808_489_1244 251
642 3300047471 Ga0495684_0043074 Ga0495684_0043074_2472_3227 251
643 3300047472 Ga0495686_0114846 Ga0495686_0114846_734_1498 251
644 3300047673 Ga0495593_0003415 Ga0495593_0003415_6738_7496 251
645 3300048088 Ga0495602_0410031 Ga0495602_0410031_17_772 251
646 3300048903 Ga0496100_0098849 Ga0496100_0098849_294_1049 251
647 3300048905 Ga0496102_0305550 Ga0496102_0305550_325_1080 251
648 3300048907 Ga0496104_0204040 Ga0496104_0204040_121_876 251
649 3300048909 Ga0496106_0009237 Ga0496106_0009237_2752_3507 251
650 3300048909 Ga0496106_0339048 Ga0496106_0339048_421_1176 251
651 3300048910 Ga0496107_0013255 Ga0496107_0013255_1292_2047 251
652 3300048910 Ga0496107_0445027 Ga0496107_0445027_174_929 251
653 3300048911 Ga0496108_0000380 Ga0496108_0000380_26120_26875 251
654 3300048911 Ga0496108_0063689 Ga0496108_0063689_155_910 251
655 3300048912 Ga0496109_0000887 Ga0496109_0000887_15155_15910 251
656 3300048912 Ga0496109_0168020 Ga0496109_0168020_1178_1933 251
657 3300048912 Ga0496109_0288742 Ga0496109_0288742_429_1184 251
658 3300048913 Ga0496110_0026404 Ga0496110_0026404_2059_2814 251
659 3300048913 Ga0496110_0037493 Ga0496110_0037493_2956_3711 251
660 3300048913 Ga0496110_0089901 Ga0496110_0089901_176_931 251
661 3300048913 Ga0496110_0865764 Ga0496110_0865764_41_796 251
662 3300048914 Ga0496111_0138437 Ga0496111_0138437_597_1352 251
663 3300048915 Ga0496112_0019379 Ga0496112_0019379_1617_2372 251
664 3300048915 Ga0496112_0028537 Ga0496112_0028537_4488_5243 251
665 3300048915 Ga0496112_0039717 Ga0496112_0039717_1688_2443 251
666 3300048918 Ga0496115_0356559 Ga0496115_0356559_263_1018 251
667 3300048919 Ga0496116_0210268 Ga0496116_0210268_167_922 251
668 3300048920 Ga0496117_0006861 Ga0496117_0006861_1745_2500 251
669 3300048920 Ga0496117_0121802 Ga0496117_0121802_663_1427 251
670 3300048921 Ga0496118_0018608 Ga0496118_0018608_5401_6156 251
671 3300048924 Ga0496121_0001712 Ga0496121_0001712_26645_27409 251
672 3300048924 Ga0496121_0017013 Ga0496121_0017013_218_973 251
673 3300048927 Ga0496124_0007174 Ga0496124_0007174_10356_11111 251
674 3300048927 Ga0496124_0141336 Ga0496124_0141336_1100_1855 251
675 3300048927 Ga0496124_0247129 Ga0496124_0247129_100_879 251
676 3300048929 Ga0496126_0007237 Ga0496126_0007237_10362_11147 251
677 3300048929 Ga0496126_0083011 Ga0496126_0083011_1544_2302 251
678 3300048929 Ga0496126_0137806 Ga0496126_0137806_1263_2042 251
679 3300048929 Ga0496126_0335678 Ga0496126_0335678_349_1104 251
680 3300049568 Ga0501031_0010682 Ga0501031_0010682_1289_2047 251
681 3300049568 Ga0501031_0280212 Ga0501031_0280212_286_1044 251
682 3300049569 Ga0501032_0000038 Ga0501032_0000038_75874_76632 251
683 3300049569 Ga0501032_0034799 Ga0501032_0034799_2383_3141 251
684 3300049569 Ga0501032_0182504 Ga0501032_0182504_261_1019 251
685 3300049570 Ga0501033_0000222 Ga0501033_0000222_40298_41056 251
686 3300049570 Ga0501033_0002083 Ga0501033_0002083_1637_2395 251
687 3300049570 Ga0501033_0305921 Ga0501033_0305921_297_1055 251
688 3300049571 Ga0501034_0000228 Ga0501034_0000228_86881_87639 251
689 3300049571 Ga0501034_0247532 Ga0501034_0247532_144_902 251
690 3300049571 Ga0501034_0568128 Ga0501034_0568128_232_996 251
691 3300049571 Ga0501034_0598238 Ga0501034_0598238_50_808 251
692 3300049572 Ga0501036_0001157 Ga0501036_0001157_2993_3751 251
693 3300049572 Ga0501036_0022021 Ga0501036_0022021_1951_2709 251
694 3300049572 Ga0501036_0054330 Ga0501036_0054330_1564_2322 251
695 3300049572 Ga0501036_0175239 Ga0501036_0175239_848_1606 251
696 3300049573 Ga0501037_0000291 Ga0501037_0000291_23424_24182 251
697 3300049573 Ga0501037_0076565 Ga0501037_0076565_517_1275 251
698 3300049573 Ga0501037_0233620 Ga0501037_0233620_126_884 251
699 3300049574 Ga0501038_0000079 Ga0501038_0000079_18490_19248 251
700 3300049574 Ga0501038_0000782 Ga0501038_0000782_1644_2402 251
701 3300049574 Ga0501038_0018111 Ga0501038_0018111_4978_5736 251
702 3300049575 Ga0501039_0005342 Ga0501039_0005342_4986_5744 251
703 3300049575 Ga0501039_0024316 Ga0501039_0024316_1154_1912 251
704 3300049575 Ga0501039_0100222 Ga0501039_0100222_254_1012 251
705 3300049575 Ga0501039_0177994 Ga0501039_0177994_377_1135 251
706 3300049576 Ga0501040_0396527 Ga0501040_0396527_141_899 251
707 3300049577 Ga0501041_0293731 Ga0501041_0293731_71_829 251
708 3300049578 Ga0501042_0026138 Ga0501042_0026138_3274_4032 251
709 3300049579 Ga0501043_0000021 Ga0501043_0000021_74308_75066 251
710 3300049579 Ga0501043_0009067 Ga0501043_0009067_2739_3497 251
711 3300049579 Ga0501043_0037854 Ga0501043_0037854_1171_1929 251
712 3300049580 Ga0501046_0000632 Ga0501046_0000632_17509_18267 251
713 3300049580 Ga0501046_0114383 Ga0501046_0114383_360_1118 251
714 3300049581 Ga0501047_0000041 Ga0501047_0000041_78406_79164 251
715 3300049581 Ga0501047_0382266 Ga0501047_0382266_301_1059 251
716 3300049582 Ga0501048_0002271 Ga0501048_0002271_9773_10531 251
717 3300049583 Ga0501067_0000411 Ga0501067_0000411_4180_4938 251
718 3300049584 Ga0501068_0003389 Ga0501068_0003389_6468_7226 251
719 3300049584 Ga0501068_0418964 Ga0501068_0418964_68_826 251
720 3300049585 Ga0501069_0017775 Ga0501069_0017775_1228_1986 251
721 3300049586 Ga0501070_0012019 Ga0501070_0012019_1966_2724 251
722 3300049586 Ga0501070_0097042 Ga0501070_0097042_902_1660 251
723 3300049586 Ga0501070_0302529 Ga0501070_0302529_185_949 251
724 3300049587 Ga0501071_0003588 Ga0501071_0003588_1495_2253 251
725 3300049588 Ga0501072_0023902 Ga0501072_0023902_19_777 251
726 3300049589 Ga0501073_0000056 Ga0501073_0000056_26577_27335 251
727 3300049590 Ga0501074_0007359 Ga0501074_0007359_4640_5398 251
728 3300049741 Ga0501079_0001331 Ga0501079_0001331_328_1086 251
729 3300049741 Ga0501079_0220792 Ga0501079_0220792_250_1008 251
730 3300049742 Ga0501080_0000138 Ga0501080_0000138_50026_50784 251
731 3300049742 Ga0501080_0091226 Ga0501080_0091226_1255_2013 251
732 3300049822 Ga0501035_0000090 Ga0501035_0000090_26577_27335 251
733 3300049822 Ga0501035_0108401 Ga0501035_0108401_135_893 251
734 3300049822 Ga0501035_0236731 Ga0501035_0236731_742_1500 251
735 3300049823 Ga0501044_0000054 Ga0501044_0000054_62236_62994 251
736 3300049823 Ga0501044_0060341 Ga0501044_0060341_1773_2531 251
737 3300049823 Ga0501044_0062701 Ga0501044_0062701_362_1120 251
738 3300049823 Ga0501044_0086405 Ga0501044_0086405_1044_1802 251
739 3300049824 Ga0501045_0088054 Ga0501045_0088054_1477_2235 251
740 3300050492 nmdc:mga0yw44_34378_c1 nmdc:mga0yw44_34378_c1_1989_2744 251
741 3300050516 nmdc:mga0sz30_91464_c1 nmdc:mga0sz30_91464_c1_114_881 251
742 3300053077 Ga0495601_0011980 Ga0495601_0011980_2842_3597 251
743 3300053078 Ga0495612_0173189 Ga0495612_0173189_25_780 251
744 3300053080 Ga0500635_0008610 Ga0500635_0008610_195_968 251
745 3300053085 Ga0495619_0127020 Ga0495619_0127020_585_1343 251
746 3300053093 Ga0500651_0011575 Ga0500651_0011575_62_826 251
747 3300053094 Ga0500566_0004641 Ga0500566_0004641_5165_5920 251
748 3300053096 Ga0500641_0182371 Ga0500641_0182371_37_801 251
749 3300053102 Ga0500554_000726 Ga0500554_000726_2911_3684 251
750 3300053111 Ga0500572_001185 Ga0500572_001185_37_816 251
751 3300053119 Ga0500595_001479 Ga0500595_001479_2705_3469 251
752 3300053119 Ga0500595_006059 Ga0500595_006059_766_1521 251
753 3300053136 Ga0500559_0000581 Ga0500559_0000581_11035_11814 251
754 3300053136 Ga0500559_0007362 Ga0500559_0007362_277_1032 251
755 3300053136 Ga0500559_0250577 Ga0500559_0250577_54_809 251
756 3300053140 Ga0500573_0023333 Ga0500573_0023333_419_1174 251
757 3300053150 Ga0500603_001051 Ga0500603_001051_1886_2659 251
758 3300053150 Ga0500603_018903 Ga0500603_018903_142_897 251
759 3300053162 Ga0500638_002099 Ga0500638_002099_1878_2633 251
760 3300053163 Ga0500639_026058 Ga0500639_026058_2294_3073 251
761 3300053177 Ga0500636_0023252 Ga0500636_0023252_2601_3359 251
762 3300053178 Ga0500637_0000107 Ga0500637_0000107_22423_23178 251
763 3300053178 Ga0500637_0000325 Ga0500637_0000325_2994_3767 251
764 3300053735 Ga0500596_001376 Ga0500596_001376_92_871 251
765 3300053735 Ga0500596_010189 Ga0500596_010189_615_1370 251
766 3300054114 Ga0501084_0025430 Ga0501084_0025430_1848_2606 251
767 3300055283 Ga0500661_002117 Ga0500661_002117_2760_3515 251
768 3300060353 Ga0501082_0127365 Ga0501082_0127365_955_1713 251
769 iso_pu_bacteria 2515154112 2515629969 251
770 iso_pu_bacteria 2874590934 2874593389 251
771 iso_pu_bacteria 2874645413 2874652836 251
772 iso_pu_bacteria 2876771140 2876773429 251
773 iso_pu_bacteria 2876818435 2876821382 251
774 iso_pu_bacteria 2879074833 2879077345 251
775 iso_pu_bacteria 2879127579 2879127778 251
776 iso_pu_bacteria 2879142872 2879143009 251
777 iso_pu_bacteria 2935608549 2935610904 251
778 iso_pu_bacteria 2935819856 2935820388 251
779 iso_pu_bacteria 2935847175 2935849602 251
780 iso_pu_bacteria 2935908558 2935911625 251
781 iso_pu_bacteria 2935916978 2935919279 251
782 iso_pu_bacteria 2935926038 2935928654 251
783 iso_pu_bacteria 2935934488 2935938299 251
784 iso_pu_bacteria 2935942939 2935945809 251
785 iso_pu_bacteria 2935951376 2935954584 251
786 iso_pu_bacteria 2935959822 2935963187 251
787 iso_pu_bacteria 2935967501 2935970471 251
788 iso_pu_bacteria 2935975950 2935979287 251
789 iso_pu_bacteria 8019619141 8019626343 251
790 iso_pu_bacteria 8019629233 8019636151 251
791 iso_pu_bacteria 8019659431 8019663918 251
792 iso_pu_bacteria 8019668869 8019673547 251
793 iso_pu_bacteria 8019678201 8019682585 251
794 iso_pu_bacteria 8019687851 8019688266 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02107

FlgH

Flagellar L-ring protein

102

286

0.91

Feature Viewer

pLDDT pTM Quality
65.59 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map