F481050

General Info

Members Datasets Scaffolds Average Seq Length
793 375 793 143

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100097908|Ga0070704_1000979084
Length 141
Sequence MLISGRCHCGNIFFALDWRPEPSEIPARACTCSFCAKHGGVWTSCPTGSLTVSVKDRTRASNAFGTKTSEFHVCAGCGVVPVVTSRIDGCLYAVVSVNAFENVEPALLRRAPATSEGESERARLSRRKRNWIADVRFEATS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
222 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
250 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
370 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
371 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0
Rhizoplane 5.3
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007558 3300001977 Bacteria 1657
2 JGI24743J22301_10020738 3300001991 Bacteria 1252
3 JGI24749J21850_1011267 3300002076 Bacteria 1255
4 JGI24744J21845_10037300 3300002077 Bacteria 916
5 JGI24033J26618_1006993 3300002155 Bacteria 1275
6 JGI25156J39149_1000422 3300002705 Bacteria 26284
7 JGI25156J39149_1002686 3300002705 Bacteria 6235
8 JGI25162J39368_1000402 3300002737 Bacteria 35934
9 JGI25154J39366_1003396 3300002738 Bacteria 3367
10 JGI25157J39369_1000344 3300002741 Bacteria 32837
11 JGI25157J39369_1000452 3300002741 Bacteria 26160
12 JGI25164J39214_1000117 3300002772 Bacteria 76695
13 JGI25406J46586_10085542 3300003203 Bacteria 959
14 JGI25165J46597_1000235 3300003214 Bacteria 76684
15 rootL2_10184296 3300003322 Bacteria 2487
16 Ga0055539_1007503 3300003752 Bacteria 1378
17 Ga0055527_1000176 3300003760 Bacteria 43621
18 Ga0055535_1000373 3300003761 Bacteria 42794
19 Ga0055535_1001357 3300003761 Bacteria 12869
20 Ga0055535_1001457 3300003761 Bacteria 11944
21 Ga0055542_1000394 3300003762 Bacteria 43618
22 Ga0055542_1000429 3300003762 Bacteria 40523
23 Ga0055542_1000734 3300003762 Bacteria 25435
24 Ga0055529_1000314 3300003763 Bacteria 55435
25 Ga0055529_1000420 3300003763 Bacteria 43618
26 Ga0065714_10245078 3300005288 Unclassified 787
27 Ga0065712_10089646 3300005290 Bacteria 2460
28 Ga0065715_10027211 3300005293 Bacteria 1511
29 Ga0065707_10006489 3300005295 Bacteria 3037
30 Ga0070658_10107426 3300005327 Bacteria 2309
31 Ga0070658_10163615 3300005327 Bacteria 1867
32 Ga0070658_10345229 3300005327 Bacteria 1273
33 Ga0070676_10258923 3300005328 Unclassified 1164
34 Ga0070676_10485658 3300005328 Unclassified 874
35 Ga0070683_100003464 3300005329 Bacteria 12824
36 Ga0070683_100025910 3300005329 Bacteria 5273
37 Ga0070683_100082486 3300005329 Unclassified 3011
38 Ga0070683_100357389 3300005329 Bacteria 1391
39 Ga0070690_100047859 3300005330 Unclassified 2721
40 Ga0070690_100048274 3300005330 Bacteria 2710
41 Ga0070690_100316195 3300005330 Unclassified 1124
42 Ga0070670_100032959 3300005331 Bacteria 4464
43 Ga0070677_10151564 3300005333 Unclassified 1079
44 Ga0068869_100026763 3300005334 Bacteria 4016
45 Ga0068869_100170955 3300005334 Bacteria 1698
46 Ga0068869_100194521 3300005334 Bacteria 1596
47 Ga0070666_10011790 3300005335 Bacteria 5494
48 Ga0070666_10021776 3300005335 Bacteria 4155
49 Ga0070666_10022990 3300005335 Bacteria 4053
50 Ga0070666_10136972 3300005335 Bacteria 1704
51 Ga0070682_100977856 3300005337 Bacteria 701
52 Ga0070682_101003966 3300005337 Bacteria 693
53 Ga0068868_100334951 3300005338 Unclassified 1292
54 Ga0068868_100370168 3300005338 Bacteria 1231
55 Ga0068868_101101993 3300005338 Bacteria 730
56 Ga0070660_100043886 3300005339 Bacteria 3417
57 Ga0070660_100352488 3300005339 Bacteria 1212
58 Ga0070687_100591171 3300005343 Bacteria 761
59 Ga0070661_100003414 3300005344 Bacteria 10969
60 Ga0070661_100025041 3300005344 Bacteria 4285
61 Ga0070661_100051345 3300005344 Bacteria 3018
62 Ga0070692_10021235 3300005345 Bacteria 3157
63 Ga0070692_10037570 3300005345 Bacteria 2462
64 Ga0070668_100949977 3300005347 Bacteria 770
65 Ga0070669_100248271 3300005353 Bacteria 1416
66 Ga0070669_100293418 3300005353 Bacteria 1306
67 Ga0070669_101338911 3300005353 Unclassified 620
68 Ga0070675_100293758 3300005354 Bacteria 1430
69 Ga0070671_100180737 3300005355 Bacteria 1786
70 Ga0070671_100232292 3300005355 Bacteria 1565
71 Ga0070671_100448204 3300005355 Bacteria 1107
72 Ga0070671_101266504 3300005355 Bacteria 650
73 Ga0070674_100009860 3300005356 Bacteria 5744
74 Ga0070674_100093255 3300005356 Bacteria 2178
75 Ga0070673_100164482 3300005364 Bacteria 1889
76 Ga0070673_100509329 3300005364 Unclassified 1089
77 Ga0070673_100606181 3300005364 Bacteria 999
78 Ga0070673_101141041 3300005364 Unclassified 729
79 Ga0070673_101263127 3300005364 Unclassified 693
80 Ga0070688_100009252 3300005365 Bacteria 5378
81 Ga0070688_100176149 3300005365 Bacteria 1480
82 Ga0070659_100019972 3300005366 Bacteria 5086
83 Ga0070659_100257812 3300005366 Bacteria 1446
84 Ga0070659_100580793 3300005366 Bacteria 962
85 Ga0070667_100002375 3300005367 Bacteria 16490
86 Ga0070667_100011716 3300005367 Bacteria 7246
87 Ga0070667_100102615 3300005367 Bacteria 2472
88 Ga0070667_100418160 3300005367 Unclassified 1222
89 Ga0070667_102026964 3300005367 Unclassified 542
90 Ga0070703_10062236 3300005406 Bacteria 1224
91 Ga0070709_10014153 3300005434 Bacteria 4506
92 Ga0070709_10391042 3300005434 Bacteria 1036
93 Ga0070709_11261766 3300005434 Bacteria 595
94 Ga0070714_100008518 3300005435 Bacteria 8016
95 Ga0070714_100042466 3300005435 Bacteria 3842
96 Ga0070714_100514706 3300005435 Bacteria 1142
97 Ga0070714_101701944 3300005435 Unclassified 616
98 Ga0070713_100782981 3300005436 Bacteria 914
99 Ga0070701_10637746 3300005438 Bacteria 710
100 Ga0070701_10739669 3300005438 Bacteria 665
101 Ga0070705_101004722 3300005440 Bacteria 677
102 Ga0070700_100029662 3300005441 Bacteria 3263
103 Ga0070700_100882965 3300005441 Unclassified 727
104 Ga0070694_100117108 3300005444 Bacteria 1907
105 Ga0070694_100203647 3300005444 Bacteria 1476
106 Ga0070708_100688920 3300005445 Bacteria 962
107 Ga0070663_100041181 3300005455 Bacteria 3238
108 Ga0070678_100003914 3300005456 Bacteria 8372
109 Ga0070678_100242295 3300005456 Bacteria 1508
110 Ga0070678_100603462 3300005456 Bacteria 980
111 Ga0070678_100913043 3300005456 Bacteria 803
112 Ga0070662_100097562 3300005457 Bacteria 2218
113 Ga0070662_100317083 3300005457 Bacteria 1270
114 Ga0070662_100510172 3300005457 Bacteria 1004
115 Ga0070681_10165120 3300005458 Bacteria 2137
116 Ga0070681_10209064 3300005458 Bacteria 1868
117 Ga0070681_10990304 3300005458 Unclassified 760
118 Ga0070681_11176051 3300005458 Bacteria 689
119 Ga0068867_100000972 3300005459 Bacteria 19561
120 Ga0068867_100477680 3300005459 Unclassified 1067
121 Ga0068867_100488254 3300005459 Bacteria 1056
122 Ga0070685_10003125 3300005466 Bacteria 8420
123 Ga0070706_100004142 3300005467 Bacteria 14100
124 Ga0070698_100120422 3300005471 Unclassified 2585
125 Ga0070699_101754439 3300005518 Bacteria 568
126 Ga0070679_100304129 3300005530 Bacteria 1545
127 Ga0070679_100421460 3300005530 Bacteria 1280
128 Ga0070684_100045842 3300005535 Bacteria 3787
129 Ga0070684_100244768 3300005535 Bacteria 1639
130 Ga0070684_100713366 3300005535 Bacteria 935
131 Ga0070697_100006292 3300005536 Bacteria 9189
132 Ga0070697_101395056 3300005536 Bacteria 626
133 Ga0068853_100024919 3300005539 Bacteria 5020
134 Ga0068853_100029510 3300005539 Bacteria 4625
135 Ga0070672_100018183 3300005543 Bacteria 5075
136 Ga0070672_101055550 3300005543 Bacteria 721
137 Ga0070686_100013353 3300005544 Bacteria 4699
138 Ga0070695_100057747 3300005545 Bacteria 2508
139 Ga0070695_100721366 3300005545 Bacteria 793
140 Ga0070696_100219854 3300005546 Bacteria 1425
141 Ga0070696_101766458 3300005546 Bacteria 534
142 Ga0070693_100121360 3300005547 Bacteria 1621
143 Ga0070693_100152035 3300005547 Bacteria 1467
144 Ga0070693_100265291 3300005547 Bacteria 1144
145 Ga0070693_100441979 3300005547 Bacteria 911
146 Ga0070665_100002162 3300005548 Bacteria 21925
147 Ga0070665_100063714 3300005548 Bacteria 3696
148 Ga0070665_100165548 3300005548 Bacteria 2213
149 Ga0070665_101076639 3300005548 Unclassified 815
150 Ga0070665_101195281 3300005548 Unclassified 771
151 Ga0070704_100097908 3300005549 Bacteria 2203
152 Ga0070704_100401299 3300005549 Bacteria 1170
153 Ga0068855_100260077 3300005563 Bacteria 1934
154 Ga0068855_100273060 3300005563 Bacteria 1880
155 Ga0068855_100430672 3300005563 Bacteria 1442
156 Ga0068855_100500166 3300005563 Bacteria 1321
157 Ga0068855_101320896 3300005563 Bacteria 746
158 Ga0068855_101959031 3300005563 Bacteria 592
159 Ga0070664_100070162 3300005564 Bacteria 3000
160 Ga0070664_100163183 3300005564 Bacteria 1972
161 Ga0070664_100401528 3300005564 Bacteria 1253
162 Ga0068857_100000326 3300005577 Bacteria 32742
163 Ga0068857_100054631 3300005577 Bacteria 3544
164 Ga0068857_100622968 3300005577 Bacteria 1021
165 Ga0068854_100042838 3300005578 Bacteria 3205
166 Ga0068854_100068312 3300005578 Bacteria 2591
167 Ga0068854_100073728 3300005578 Bacteria 2502
168 Ga0068854_100082771 3300005578 Bacteria 2372
169 Ga0068854_100141979 3300005578 Bacteria 1844
170 Ga0068856_100009494 3300005614 Bacteria 9446
171 Ga0068856_100018785 3300005614 Bacteria 6704
172 Ga0068856_100062403 3300005614 Bacteria 3681
173 Ga0068856_100486292 3300005614 Bacteria 1255
174 Ga0068852_100008993 3300005616 Bacteria 7394
175 Ga0068852_100012746 3300005616 Bacteria 6400
176 Ga0068852_100029985 3300005616 Bacteria 4473
177 Ga0068852_100040930 3300005616 Bacteria 3913
178 Ga0068852_100041158 3300005616 Bacteria 3903
179 Ga0068852_100077840 3300005616 Bacteria 2933
180 Ga0068859_100045135 3300005617 Bacteria 4428
181 Ga0068859_100068339 3300005617 Bacteria 3587
182 Ga0068859_100225195 3300005617 Bacteria 1963
183 Ga0068859_100624374 3300005617 Bacteria 1170
184 Ga0068859_101031056 3300005617 Unclassified 904
185 Ga0068864_100223733 3300005618 Bacteria 1737
186 Ga0068864_100239894 3300005618 Bacteria 1679
187 Ga0068861_100001475 3300005719 Bacteria 14922
188 Ga0068851_10014726 3300005834 Unclassified 3717
189 Ga0068851_10052504 3300005834 Bacteria 2072
190 Ga0068870_10007140 3300005840 Bacteria 4968
191 Ga0068870_10284449 3300005840 Unclassified 1038
192 Ga0068863_100001209 3300005841 Bacteria 25805
193 Ga0068863_100077461 3300005841 Bacteria 3147
194 Ga0068863_100089587 3300005841 Bacteria 2917
195 Ga0068863_100420079 3300005841 Unclassified 1310
196 Ga0068863_100814101 3300005841 Bacteria 932
197 Ga0068858_100015154 3300005842 Bacteria 7250
198 Ga0068858_100255585 3300005842 Bacteria 1665
199 Ga0068858_101187026 3300005842 Unclassified 750
200 Ga0068860_100003093 3300005843 Bacteria 17217
201 Ga0068860_100010328 3300005843 Bacteria 9232
202 Ga0068860_100058142 3300005843 Bacteria 3676
203 Ga0068860_100392001 3300005843 Bacteria 1372
204 Ga0068862_100041253 3300005844 Bacteria 3926
205 Ga0068862_100129847 3300005844 Bacteria 2228
206 Ga0068862_100288476 3300005844 Bacteria 1506
207 Ga0068862_100542586 3300005844 Bacteria 1109
208 Ga0081455_10322416 3300005937 Bacteria 1100
209 Ga0081539_10001060 3300005985 Bacteria 50269
210 Ga0070715_10033608 3300006163 Bacteria 2097
211 Ga0070716_100022733 3300006173 Bacteria 3317
212 Ga0070712_100126840 3300006175 Bacteria 1929
213 Ga0070712_100405948 3300006175 Bacteria 1126
214 Ga0097621_101073359 3300006237 Unclassified 755
215 Ga0068871_100008475 3300006358 Bacteria 7395
216 Ga0068871_100100426 3300006358 Bacteria 2424
217 Ga0068871_100877540 3300006358 Bacteria 830
218 Ga0075433_10746566 3300006852 Bacteria 856
219 Ga0075433_11181822 3300006852 Bacteria 664
220 Ga0075434_100254337 3300006871 Bacteria 1776
221 Ga0075434_100402127 3300006871 Bacteria 1390
222 Ga0075434_100657747 3300006871 Unclassified 1066
223 Ga0075434_101830962 3300006871 Bacteria 614
224 Ga0068865_100002022 3300006881 Bacteria 11969
225 Ga0068865_100059254 3300006881 Bacteria 2677
226 Ga0068865_100500331 3300006881 Bacteria 1013
227 Ga0068865_102172513 3300006881 Bacteria 505
228 Ga0075436_100002182 3300006914 Bacteria 13495
229 Ga0075436_100003801 3300006914 Bacteria 10357
230 Ga0075436_100404014 3300006914 Bacteria 990
231 Ga0097620_100045135 3300006931 Bacteria 4428
232 Ga0097620_100068344 3300006931 Bacteria 3587
233 Ga0097620_100225199 3300006931 Bacteria 1963
234 Ga0097620_100624386 3300006931 Bacteria 1170
235 Ga0097620_101030968 3300006931 Unclassified 904
236 Ga0075435_100081101 3300007076 Bacteria 2664
237 Ga0075435_100082677 3300007076 Bacteria 2640
238 Ga0105240_10015929 3300009093 Bacteria 10197
239 Ga0105240_10043124 3300009093 Bacteria 5743
240 Ga0105240_10135863 3300009093 Bacteria 2945
241 Ga0105240_10610206 3300009093 Bacteria 1200
242 Ga0111539_10583046 3300009094 Bacteria 1302
243 Ga0111539_10930291 3300009094 Bacteria 1011
244 Ga0111539_11825661 3300009094 Bacteria 705
245 Ga0105245_10545935 3300009098 Bacteria 1180
246 Ga0105245_10977201 3300009098 Bacteria 890
247 Ga0105245_12024563 3300009098 Bacteria 629
248 Ga0105247_10137500 3300009101 Bacteria 1598
249 Ga0105247_10274953 3300009101 Bacteria 1160
250 Ga0105247_10385720 3300009101 Unclassified 995
251 Ga0114129_10825660 3300009147 Bacteria 1180
252 Ga0105243_10102966 3300009148 Bacteria 2373
253 Ga0105243_10640941 3300009148 Bacteria 1028
254 Ga0105243_10932940 3300009148 Bacteria 866
255 Ga0105241_10064038 3300009174 Bacteria 2838
256 Ga0105241_10446717 3300009174 Bacteria 1143
257 Ga0105241_10519560 3300009174 Bacteria 1064
258 Ga0105242_10017478 3300009176 Bacteria 5590
259 Ga0105242_10755552 3300009176 Bacteria 958
260 Ga0105242_11056370 3300009176 Unclassified 823
261 Ga0105242_11213531 3300009176 Bacteria 774
262 Ga0105248_10097107 3300009177 Bacteria 3319
263 Ga0105248_10398106 3300009177 Bacteria 1551
264 Ga0105248_10496639 3300009177 Bacteria 1375
265 Ga0105237_10050461 3300009545 Bacteria 4180
266 Ga0105237_10138562 3300009545 Bacteria 2428
267 Ga0105237_10847938 3300009545 Bacteria 921
268 Ga0105238_10001691 3300009551 Bacteria 22202
269 Ga0105238_10250523 3300009551 Bacteria 1749
270 Ga0105238_10773008 3300009551 Unclassified 975
271 Ga0105238_12016354 3300009551 Bacteria 611
272 Ga0105249_10437597 3300009553 Bacteria 1344
273 Ga0105249_10484395 3300009553 Unclassified 1280
274 Ga0105249_12287212 3300009553 Bacteria 613
275 Ga0105239_10359672 3300010375 Unclassified 1644
276 Ga0105239_10430395 3300010375 Bacteria 1496
277 Ga0105239_10454722 3300010375 Bacteria 1453
278 Ga0105239_11036072 3300010375 Bacteria 944
279 Ga0105246_10264782 3300011119 Bacteria 1371
280 Ga0105246_10798193 3300011119 Bacteria 837
281 Ga0105246_10830229 3300011119 Unclassified 823
282 Ga0105246_11391362 3300011119 Bacteria 654
283 Ga0157373_10016576 3300013100 Bacteria 5372
284 Ga0157373_10109438 3300013100 Bacteria 1943
285 Ga0157373_10286346 3300013100 Bacteria 1168
286 Ga0157373_10427991 3300013100 Unclassified 951
287 Ga0157371_10488444 3300013102 Bacteria 908
288 Ga0157370_10224406 3300013104 Bacteria 1740
289 Ga0157370_10612529 3300013104 Bacteria 996
290 Ga0157369_10018256 3300013105 Bacteria 7867
291 Ga0157369_10036084 3300013105 Bacteria 5419
292 Ga0157369_10603273 3300013105 Bacteria 1133
293 Ga0157374_10006253 3300013296 Bacteria 10101
294 Ga0157374_10074892 3300013296 Bacteria 3198
295 Ga0157374_10087010 3300013296 Bacteria 2974
296 Ga0157374_10119604 3300013296 Bacteria 2541
297 Ga0157374_10648193 3300013296 Unclassified 1068
298 Ga0157374_12034314 3300013296 Bacteria 601
299 Ga0157378_10004305 3300013297 Bacteria 12535
300 Ga0157378_10013363 3300013297 Bacteria 7175
301 Ga0157378_10099232 3300013297 Bacteria 2656
302 Ga0157378_10117837 3300013297 Bacteria 2443
303 Ga0157378_10720271 3300013297 Unclassified 1018
304 Ga0157378_10762121 3300013297 Unclassified 991
305 Ga0157378_11156194 3300013297 Bacteria 812
306 Ga0163162_10010945 3300013306 Bacteria 8833
307 Ga0163162_10027941 3300013306 Bacteria 5580
308 Ga0163162_10672689 3300013306 Bacteria 1158
309 Ga0163162_10788824 3300013306 Bacteria 1068
310 Ga0157372_10001402 3300013307 Bacteria 25982
311 Ga0157372_10013916 3300013307 Bacteria 8597
312 Ga0157372_10135958 3300013307 Bacteria 2830
313 Ga0157372_10151943 3300013307 Bacteria 2673
314 Ga0157372_10199667 3300013307 Bacteria 2316
315 Ga0157375_10068642 3300013308 Bacteria 3548
316 Ga0157375_10189409 3300013308 Bacteria 2211
317 Ga0157375_10295469 3300013308 Unclassified 1783
318 Ga0163163_10015144 3300014325 Bacteria 7120
319 Ga0163163_10970658 3300014325 Unclassified 913
320 Ga0182008_10002400 3300014497 Bacteria 11778
321 Ga0182008_10222319 3300014497 Bacteria 966
322 Ga0182008_10684357 3300014497 Unclassified 584
323 Ga0157377_10385437 3300014745 Bacteria 950
324 Ga0157377_10578002 3300014745 Bacteria 798
325 Ga0157379_10237318 3300014968 Bacteria 1653
326 Ga0157379_10826622 3300014968 Unclassified 875
327 Ga0157376_10005225 3300014969 Bacteria 9064
328 Ga0157376_10195117 3300014969 Bacteria 1859
329 Ga0182006_1086248 3300015261 Bacteria 1137
330 Ga0182007_10000225 3300015262 Bacteria 37944
331 Ga0182005_1067500 3300015265 Bacteria 980
332 Ga0163161_10090859 3300017792 Bacteria 2259
333 Ga0163161_10095622 3300017792 Bacteria 2204
334 Ga0163161_10280852 3300017792 Bacteria 1306
335 Ga0163161_10325319 3300017792 Bacteria 1216
336 Ga0163161_10924557 3300017792 Bacteria 740
337 Ga0213872_10000003 3300021361 Bacteria 366948
338 Ga0213872_10000163 3300021361 Bacteria 61122
339 Ga0209674_100197 3300025226 Bacteria 62877
340 Ga0209674_100550 3300025226 Bacteria 14925
341 Ga0209672_100008 3300025228 Bacteria 946876
342 Ga0209672_100089 3300025228 Bacteria 120658
343 Ga0207427_100051 3300025231 Bacteria 218792
344 Ga0209437_100152 3300025233 Bacteria 154551
345 Ga0209258_100004 3300025242 Bacteria 1376422
346 Ga0209258_100008 3300025242 Bacteria 1009355
347 Ga0209258_100090 3300025242 Bacteria 232619
348 Ga0209258_100101 3300025242 Bacteria 210252
349 Ga0209646_1010457 3300025246 Bacteria 1453
350 Ga0209026_1000294 3300025250 Bacteria 55402
351 Ga0209677_100976 3300025253 Bacteria 13869
352 Ga0209148_1000041 3300025254 Bacteria 469323
353 Ga0209148_1000065 3300025254 Bacteria 344489
354 Ga0209148_1000079 3300025254 Bacteria 288992
355 Ga0209759_1000165 3300025256 Bacteria 113117
356 Ga0209759_1000449 3300025256 Bacteria 47711
357 Ga0209233_1000099 3300025261 Bacteria 293995
358 Ga0209455_1000007 3300025272 Bacteria 1157983
359 Ga0209455_1000016 3300025272 Bacteria 753097
360 Ga0209455_1003591 3300025272 Bacteria 5411
361 Ga0207697_10006661 3300025315 Bacteria 5204
362 Ga0207656_10053200 3300025321 Bacteria 1756
363 Ga0207656_10193070 3300025321 Bacteria 981
364 Ga0207682_10001376 3300025893 Bacteria 11224
365 Ga0207692_10005132 3300025898 Bacteria 5225
366 Ga0207692_10238084 3300025898 Bacteria 1086
367 Ga0207680_10010766 3300025903 Bacteria 4589
368 Ga0207680_10031055 3300025903 Bacteria 3022
369 Ga0207680_10126455 3300025903 Bacteria 1679
370 Ga0207680_10127575 3300025903 Bacteria 1672
371 Ga0207647_10002041 3300025904 Bacteria 15436
372 Ga0207685_10114061 3300025905 Bacteria 1176
373 Ga0207699_10080050 3300025906 Bacteria 2023
374 Ga0207645_10211491 3300025907 Bacteria 1277
375 Ga0207645_10477290 3300025907 Bacteria 843
376 Ga0207645_10555372 3300025907 Bacteria 779
377 Ga0207643_10343970 3300025908 Bacteria 935
378 Ga0207705_10229565 3300025909 Bacteria 1411
379 Ga0207684_10065597 3300025910 Bacteria 3083
380 Ga0207684_10111746 3300025910 Bacteria 2339
381 Ga0207684_10112125 3300025910 Bacteria 2335
382 Ga0207654_10025864 3300025911 Bacteria 3172
383 Ga0207654_10065161 3300025911 Bacteria 2144
384 Ga0207654_10210426 3300025911 Bacteria 1285
385 Ga0207707_10086551 3300025912 Bacteria 2738
386 Ga0207707_10195489 3300025912 Bacteria 1764
387 Ga0207707_10411794 3300025912 Bacteria 1160
388 Ga0207695_10004315 3300025913 Bacteria 19489
389 Ga0207695_10037880 3300025913 Bacteria 5200
390 Ga0207695_10069691 3300025913 Bacteria 3597
391 Ga0207695_11075378 3300025913 Bacteria 684
392 Ga0207671_10001967 3300025914 Bacteria 22671
393 Ga0207693_10117198 3300025915 Bacteria 2091
394 Ga0207693_10233690 3300025915 Bacteria 1444
395 Ga0207663_10158917 3300025916 Bacteria 1593
396 Ga0207663_10261507 3300025916 Bacteria 1278
397 Ga0207663_10639702 3300025916 Bacteria 839
398 Ga0207660_10859090 3300025917 Unclassified 740
399 Ga0207657_10016926 3300025919 Bacteria 7015
400 Ga0207657_10060723 3300025919 Bacteria 3243
401 Ga0207657_10181521 3300025919 Bacteria 1701
402 Ga0207649_10003824 3300025920 Bacteria 8209
403 Ga0207649_10052176 3300025920 Bacteria 2536
404 Ga0207649_10098218 3300025920 Bacteria 1932
405 Ga0207649_10205341 3300025920 Bacteria 1394
406 Ga0207649_11082204 3300025920 Bacteria 632
407 Ga0207652_10103390 3300025921 Bacteria 2518
408 Ga0207652_10296919 3300025921 Bacteria 1458
409 Ga0207646_11579509 3300025922 Unclassified 566
410 Ga0207681_10233523 3300025923 Bacteria 1428
411 Ga0207694_10016968 3300025924 Bacteria 5500
412 Ga0207694_10106953 3300025924 Bacteria 2222
413 Ga0207694_10730288 3300025924 Bacteria 836
414 Ga0207650_10030941 3300025925 Bacteria 3861
415 Ga0207650_10218977 3300025925 Bacteria 1531
416 Ga0207659_10031067 3300025926 Bacteria 3653
417 Ga0207687_10027388 3300025927 Bacteria 3824
418 Ga0207700_10259433 3300025928 Bacteria 1487
419 Ga0207664_10021580 3300025929 Bacteria 4792
420 Ga0207664_10024484 3300025929 Bacteria 4536
421 Ga0207664_11180427 3300025929 Bacteria 683
422 Ga0207644_10176701 3300025931 Unclassified 1671
423 Ga0207644_10226831 3300025931 Bacteria 1483
424 Ga0207644_10584598 3300025931 Unclassified 926
425 Ga0207690_10583142 3300025932 Bacteria 911
426 Ga0207706_10204462 3300025933 Bacteria 1732
427 Ga0207706_10457347 3300025933 Bacteria 1104
428 Ga0207706_11120903 3300025933 Unclassified 657
429 Ga0207709_10388111 3300025935 Bacteria 1064
430 Ga0207709_10456495 3300025935 Bacteria 989
431 Ga0207669_10028296 3300025937 Bacteria 3082
432 Ga0207669_10069073 3300025937 Bacteria 2209
433 Ga0207704_10172505 3300025938 Bacteria 1553
434 Ga0207704_10298455 3300025938 Unclassified 1233
435 Ga0207704_10367795 3300025938 Bacteria 1125
436 Ga0207691_10041207 3300025940 Bacteria 4264
437 Ga0207691_10116859 3300025940 Bacteria 2367
438 Ga0207691_10205823 3300025940 Bacteria 1711
439 Ga0207711_10001632 3300025941 Bacteria 20702
440 Ga0207711_10338023 3300025941 Bacteria 1393
441 Ga0207711_10360409 3300025941 Bacteria 1347
442 Ga0207689_10006092 3300025942 Bacteria 10666
443 Ga0207689_10007213 3300025942 Bacteria 9764
444 Ga0207689_10039336 3300025942 Bacteria 3915
445 Ga0207689_10046845 3300025942 Bacteria 3571
446 Ga0207661_10038131 3300025944 Bacteria 3764
447 Ga0207661_10365712 3300025944 Bacteria 1303
448 Ga0207679_10007632 3300025945 Bacteria 6871
449 Ga0207679_10024072 3300025945 Bacteria 4171
450 Ga0207679_10104704 3300025945 Bacteria 2220
451 Ga0207667_10021483 3300025949 Bacteria 7150
452 Ga0207667_10049769 3300025949 Bacteria 4424
453 Ga0207667_10091823 3300025949 Bacteria 3136
454 Ga0207667_10465221 3300025949 Bacteria 1284
455 Ga0207667_10675614 3300025949 Bacteria 1037
456 Ga0207651_10195168 3300025960 Bacteria 1618
457 Ga0207651_10534442 3300025960 Bacteria 1018
458 Ga0207651_10632237 3300025960 Unclassified 938
459 Ga0207651_11019928 3300025960 Bacteria 740
460 Ga0207712_10076717 3300025961 Bacteria 2420
461 Ga0207668_10020310 3300025972 Bacteria 4218
462 Ga0207668_10721481 3300025972 Bacteria 877
463 Ga0207640_10033678 3300025981 Bacteria 3190
464 Ga0207640_10101086 3300025981 Bacteria 2022
465 Ga0207640_10236284 3300025981 Bacteria 1409
466 Ga0207640_10284688 3300025981 Bacteria 1300
467 Ga0207658_10001646 3300025986 Bacteria 17075
468 Ga0207658_10488004 3300025986 Bacteria 1096
469 Ga0207658_11901723 3300025986 Unclassified 542
470 Ga0207677_10036448 3300026023 Bacteria 3206
471 Ga0207677_10059006 3300026023 Bacteria 2645
472 Ga0207677_10090597 3300026023 Bacteria 2223
473 Ga0207677_10225256 3300026023 Unclassified 1506
474 Ga0207677_10269330 3300026023 Bacteria 1392
475 Ga0207703_10010103 3300026035 Bacteria 7397
476 Ga0207703_10093670 3300026035 Bacteria 2530
477 Ga0207703_10177774 3300026035 Bacteria 1876
478 Ga0207703_10202419 3300026035 Bacteria 1765
479 Ga0207639_10064678 3300026041 Bacteria 2836
480 Ga0207639_10117882 3300026041 Bacteria 2176
481 Ga0207639_10181849 3300026041 Bacteria 1789
482 Ga0207639_10716042 3300026041 Bacteria 929
483 Ga0207678_10625799 3300026067 Bacteria 945
484 Ga0207702_10011615 3300026078 Bacteria 7339
485 Ga0207702_10041675 3300026078 Bacteria 3850
486 Ga0207702_10065195 3300026078 Bacteria 3119
487 Ga0207702_10196080 3300026078 Bacteria 1869
488 Ga0207702_10687283 3300026078 Bacteria 1008
489 Ga0207702_11927376 3300026078 Unclassified 582
490 Ga0207648_10000584 3300026089 Bacteria 40877
491 Ga0207648_10065781 3300026089 Bacteria 3161
492 Ga0207648_10097042 3300026089 Bacteria 2579
493 Ga0207648_10258224 3300026089 Bacteria 1554
494 Ga0207648_11019406 3300026089 Unclassified 775
495 Ga0207676_10761978 3300026095 Bacteria 942
496 Ga0207674_10000180 3300026116 Bacteria 77710
497 Ga0207674_10378082 3300026116 Bacteria 1369
498 Ga0207674_10699996 3300026116 Bacteria 978
499 Ga0207675_100001346 3300026118 Bacteria 24652
500 Ga0207675_100003447 3300026118 Bacteria 15462
501 Ga0207683_10018175 3300026121 Bacteria 5996
502 Ga0207683_10366952 3300026121 Bacteria 1322
503 Ga0207683_10497753 3300026121 Unclassified 1125
504 Ga0207698_10014775 3300026142 Bacteria 5204
505 Ga0207698_10138604 3300026142 Unclassified 2091
506 Ga0207428_10021199 3300027907 Bacteria 5504
507 Ga0207428_11006721 3300027907 Bacteria 585
508 Ga0268266_10058477 3300028379 Bacteria 3319
509 Ga0268266_10276030 3300028379 Bacteria 1561
510 Ga0268266_11724988 3300028379 Unclassified 601
511 Ga0268265_10052583 3300028380 Bacteria 3081
512 Ga0268265_10066305 3300028380 Bacteria 2790
513 Ga0268265_10619080 3300028380 Bacteria 1037
514 Ga0268264_10018918 3300028381 Bacteria 5631
515 Ga0268264_10143956 3300028381 Bacteria 2129
516 Ga0268264_10223578 3300028381 Bacteria 1734
517 Ga0268264_10240352 3300028381 Bacteria 1677
518 Ga0268264_11158834 3300028381 Unclassified 782
519 Ga0307517_10033524 3300028786 Bacteria 5894
520 Ga0307517_10091529 3300028786 Unclassified 2483
521 Ga0265330_10226473 3300031235 Unclassified 789
522 Ga0265328_10012522 3300031239 Bacteria 3374
523 Ga0307408_100585413 3300031548 Bacteria 989
524 Ga0307408_101953921 3300031548 Bacteria 563
525 Ga0316575_10003499 3300031665 Bacteria 5424
526 Ga0316579_10006852 3300031691 Bacteria 4672
527 Ga0265342_10021550 3300031712 Bacteria 4113
528 Ga0316578_10041003 3300031728 Bacteria 2680
529 Ga0307405_11575633 3300031731 Bacteria 579
530 Ga0307413_11372624 3300031824 Unclassified 621
531 Ga0307406_10005996 3300031901 Bacteria 6672
532 Ga0316583_10020650 3300032133 Bacteria 2359
533 Ga0316580_10051806 3300032139 Bacteria 1265
534 Ga0373926_0007635 3300035083 Bacteria 3600
535 Ga0373944_0239253 3300035089 Bacteria 667
536 Ga0373923_0450568 3300035111 Unclassified 624
537 Ga0373936_0016812 3300035113 Bacteria 2816
538 Ga0373936_0047102 3300035113 Bacteria 1739
539 Ga0373945_0043061 3300035116 Bacteria 1637
540 Ga0373945_0089204 3300035116 Bacteria 1192
541 Ga0373945_0133457 3300035116 Bacteria 996
542 Ga0373956_0485269 3300035119 Bacteria 590
543 Ga0373943_0000144 3300035170 Bacteria 27337
544 Ga0373946_0043239 3300035171 Bacteria 1855
545 Ga0373946_0084921 3300035171 Bacteria 1393
546 Ga0373955_0738471 3300035172 Bacteria 605
547 Ga0373931_0038823 3300035691 Bacteria 2493
548 Ga0373931_0123378 3300035691 Bacteria 1483
549 Ga0373935_0031185 3300035692 Bacteria 3307
550 Ga0373927_0000227 3300035695 Bacteria 44543
551 Ga0373927_0056944 3300035695 Bacteria 2528
552 Ga0373927_0120097 3300035695 Bacteria 1715
553 Ga0373933_0736086 3300035724 Bacteria 649
554 Ga0373947_0000318 3300035725 Bacteria 27274
555 Ga0373947_1186982 3300035725 Bacteria 520
556 Ga0373937_0282985 3300036401 Unclassified 1566
557 Ga0373937_0462156 3300036401 Bacteria 1205
558 Ga0373937_1600451 3300036401 Unclassified 599
559 Ga0316584_0670491 3300036712 Bacteria 713
560 Ga0373925_0024617 3300037068 Bacteria 4396
561 Ga0373925_0117516 3300037068 Bacteria 2061
562 Ga0373925_1059003 3300037068 Unclassified 667
563 Ga0373925_1317195 3300037068 Bacteria 592
564 Ga0395899_0003165 3300037312 Bacteria 13064
565 Ga0395900_0392372 3300037418 Bacteria 1354
566 Ga0395898_0000013 3300037466 Bacteria 458788
567 Ga0395898_0000058 3300037466 Bacteria 277701
568 Ga0395898_0859077 3300037466 Bacteria 846
569 Ga0395905_0723692 3300037471 Unclassified 897
570 Ga0395905_0827817 3300037471 Bacteria 828
571 Ga0316581_0029004 3300037588 Bacteria 1660
572 Ga0436364_0460231 3300037853 Bacteria 636
573 Ga0395901_0027626 3300038443 Bacteria 5831
574 Ga0395901_0280270 3300038443 Bacteria 1732
575 Ga0395901_0309889 3300038443 Bacteria 1635
576 Ga0436365_1185547 3300039437 Bacteria 620
577 Ga0436361_0408289 3300039447 Bacteria 30886
578 Ga0436361_0647550 3300039447 Bacteria 693
579 Ga0436361_1061851 3300039447 Bacteria 60009
580 Ga0436361_1151650 3300039447 Bacteria 3135
581 Ga0451849_0692289 3300041505 Bacteria 690
582 Ga0439443_007133 3300042003 Bacteria 1549
583 Ga0439435_0000668 3300042436 Bacteria 5670
584 Ga0451577_0249416 3300042876 Bacteria 1607
585 Ga0466969_0011924 3300044656 Bacteria 4595
586 Ga0466972_0011770 3300044658 Bacteria 4393
587 Ga0466975_0170554 3300044661 Bacteria 1499
588 Ga0466965_0039410 3300044683 Bacteria 2323
589 Ga0466961_0000535 3300044693 Bacteria 24166
590 Ga0466961_0018288 3300044693 Bacteria 4505
591 Ga0466961_0104062 3300044693 Bacteria 1787
592 Ga0466971_0090085 3300044719 Bacteria 1404
593 Ga0466970_0000347 3300044765 Bacteria 22532
594 Ga0466970_0004001 3300044765 Bacteria 7230
595 Ga0466957_0001515 3300044842 Bacteria 12203
596 Ga0466959_0001224 3300045049 Bacteria 15500
597 Ga0466959_0008354 3300045049 Bacteria 7315
598 Ga0451576_0611952 3300045051 Bacteria 1145
599 Ga0466958_0013812 3300045836 Bacteria 4604
600 Ga0466967_0033521 3300045976 Bacteria 4348
601 Ga0495617_028444 3300046452 Bacteria 1878
602 Ga0495627_135860 3300046453 Bacteria 690
603 Ga0495592_0111505 3300046454 Bacteria 1935
604 Ga0495592_0153548 3300046454 Bacteria 1590
605 Ga0495603_0313452 3300046455 Bacteria 901
606 Ga0495603_0433650 3300046455 Bacteria 753
607 Ga0495590_0002936 3300046457 Bacteria 7018
608 Ga0495629_0150890 3300046459 Bacteria 1615
609 Ga0495629_0321511 3300046459 Unclassified 1058
610 Ga0495651_0096575 3300046462 Bacteria 2208
611 Ga0495580_0057935 3300046472 Bacteria 2726
612 Ga0495605_0152786 3300046474 Bacteria 1029
613 Ga0495639_0001048 3300046475 Bacteria 12464
614 Ga0495662_0056812 3300046476 Bacteria 1890
615 Ga0495662_0076915 3300046476 Bacteria 1621
616 Ga0495664_0022059 3300046477 Bacteria 3684
617 Ga0495664_0184942 3300046477 Bacteria 1263
618 Ga0495584_0486353 3300046491 Bacteria 628
619 Ga0495585_0052822 3300046492 Bacteria 2249
620 Ga0495606_0502671 3300046507 Bacteria 612
621 Ga0495616_0070065 3300046513 Bacteria 1698
622 Ga0495618_0008560 3300046514 Bacteria 6178
623 Ga0495618_0296755 3300046514 Bacteria 1005
624 Ga0495618_0319818 3300046514 Bacteria 961
625 Ga0495628_0032340 3300046516 Bacteria 4223
626 Ga0495628_0043271 3300046516 Bacteria 3588
627 Ga0495628_1092827 3300046516 Unclassified 545
628 Ga0495630_0000460 3300046517 Bacteria 30750
629 Ga0495630_0049702 3300046517 Bacteria 3138
630 Ga0495631_0073578 3300046518 Bacteria 1475
631 Ga0495642_0416435 3300046528 Unclassified 593
632 Ga0495652_0205047 3300046529 Bacteria 1493
633 Ga0495652_0249116 3300046529 Bacteria 1317
634 Ga0495652_0356081 3300046529 Bacteria 1047
635 Ga0495652_0623858 3300046529 Bacteria 733
636 Ga0495665_0011893 3300046531 Bacteria 4712
637 Ga0495665_0015225 3300046531 Bacteria 4143
638 Ga0495640_0022904 3300046533 Bacteria 4562
639 Ga0495640_0067599 3300046533 Bacteria 2406
640 Ga0495586_0239182 3300046535 Bacteria 1035
641 Ga0495586_0259408 3300046535 Bacteria 992
642 Ga0495621_0009424 3300046539 Bacteria 2963
643 Ga0495621_0099348 3300046539 Unclassified 1106
644 Ga0495621_0119973 3300046539 Bacteria 1015
645 Ga0495621_0207108 3300046539 Bacteria 790
646 Ga0495621_0351117 3300046539 Unclassified 619
647 Ga0495645_0003040 3300046543 Bacteria 11354
648 Ga0495645_0333548 3300046543 Bacteria 981
649 Ga0495633_0047090 3300046558 Bacteria 2038
650 Ga0495656_0010263 3300046615 Bacteria 3398
651 Ga0495656_0010373 3300046615 Bacteria 3387
652 Ga0495634_0088624 3300046642 Bacteria 2012
653 Ga0495611_0031872 3300046648 Bacteria 2322
654 Ga0495635_0008319 3300046663 Bacteria 7243
655 Ga0495635_0206764 3300046663 Bacteria 1330
656 Ga0495659_0046384 3300046664 Bacteria 1568
657 Ga0495588_0028535 3300046674 Bacteria 2793
658 Ga0495657_0456808 3300046675 Archaea 747
659 Ga0495599_0028768 3300046678 Unclassified 3482
660 Ga0495599_0225868 3300046678 Bacteria 1144
661 Ga0495647_0041383 3300046681 Bacteria 1754
662 Ga0495647_0097526 3300046681 Bacteria 1213
663 Ga0495658_0175848 3300046683 Bacteria 1326
664 Ga0495658_0533064 3300046683 Bacteria 752
665 Ga0495613_0029168 3300046689 Unclassified 4103
666 Ga0495613_0036947 3300046689 Bacteria 3621
667 Ga0495624_0000895 3300046690 Bacteria 23654
668 Ga0495624_0401192 3300046690 Bacteria 823
669 Ga0495670_0036200 3300046691 Bacteria 2459
670 Ga0495670_0477958 3300046691 Unclassified 676
671 Ga0495589_0090201 3300046794 Bacteria 1488
672 Ga0495600_0286723 3300046809 Bacteria 1041
673 Ga0495600_0466130 3300046809 Bacteria 780
674 Ga0495600_0523167 3300046809 Bacteria 727
675 Ga0495660_0047087 3300046810 Bacteria 2363
676 Ga0495581_0001700 3300047315 Bacteria 12251
677 Ga0495581_0115636 3300047315 Bacteria 1560
678 Ga0495636_0316253 3300047318 Bacteria 732
679 Ga0495674_0025064 3300047319 Bacteria 5474
680 Ga0495672_0084979 3300047320 Bacteria 1754
681 Ga0495676_0054763 3300047321 Bacteria 3168
682 Ga0495680_0279848 3300047322 Bacteria 1176
683 Ga0495673_0033331 3300047469 Bacteria 2391
684 Ga0495684_0001671 3300047471 Bacteria 17824
685 Ga0495684_0012792 3300047471 Bacteria 6475
686 Ga0495684_0066998 3300047471 Bacteria 2730
687 Ga0495686_0460053 3300047472 Bacteria 675
688 Ga0495593_0039096 3300047673 Bacteria 2560
689 Ga0495602_1042723 3300048088 Unclassified 538
690 Ga0495602_1069548 3300048088 Bacteria 530
691 Ga0495615_0003003 3300048090 Bacteria 2780
692 Ga0495615_0285168 3300048090 Bacteria 531
693 Ga0496100_0003967 3300048903 Bacteria 7778
694 Ga0496102_0000994 3300048905 Bacteria 26666
695 Ga0496102_1686250 3300048905 Bacteria 552
696 Ga0496103_0017088 3300048906 Bacteria 4338
697 Ga0496104_0000657 3300048907 Bacteria 29650
698 Ga0496104_0008348 3300048907 Bacteria 9201
699 Ga0496104_0012907 3300048907 Bacteria 7523
700 Ga0496104_0020758 3300048907 Bacteria 6024
701 Ga0496104_0070361 3300048907 Bacteria 3326
702 Ga0496105_0001560 3300048908 Bacteria 16228
703 Ga0496105_0007805 3300048908 Bacteria 8306
704 Ga0496105_0097024 3300048908 Bacteria 2434
705 Ga0496105_0379200 3300048908 Bacteria 1125
706 Ga0496106_0007931 3300048909 Bacteria 7844
707 Ga0496106_0042963 3300048909 Bacteria 3390
708 Ga0496106_0170072 3300048909 Bacteria 1727
709 Ga0496106_1263946 3300048909 Bacteria 574
710 Ga0496107_0090582 3300048910 Bacteria 2234
711 Ga0496108_0003424 3300048911 Bacteria 12729
712 Ga0496108_0005441 3300048911 Bacteria 10289
713 Ga0496108_0034043 3300048911 Bacteria 4232
714 Ga0496109_0002056 3300048912 Bacteria 16687
715 Ga0496109_0005269 3300048912 Bacteria 10803
716 Ga0496110_0007968 3300048913 Bacteria 8485
717 Ga0496110_0015577 3300048913 Bacteria 6332
718 Ga0496110_0041091 3300048913 Bacteria 4033
719 Ga0496110_0065837 3300048913 Bacteria 3203
720 Ga0496110_0381707 3300048913 Bacteria 1284
721 Ga0496111_0003114 3300048914 Bacteria 10202
722 Ga0496111_0029149 3300048914 Bacteria 3918
723 Ga0496111_0070447 3300048914 Bacteria 2543
724 Ga0496111_0107366 3300048914 Bacteria 2055
725 Ga0496111_0233204 3300048914 Bacteria 1367
726 Ga0496112_1611858 3300048915 Unclassified 562
727 Ga0496112_1691615 3300048915 Unclassified 545
728 Ga0496113_0029631 3300048916 Bacteria 3956
729 Ga0496113_0116740 3300048916 Bacteria 2083
730 Ga0496113_0245115 3300048916 Bacteria 1430
731 Ga0496113_0751346 3300048916 Unclassified 776
732 Ga0496114_0028014 3300048917 Bacteria 4619
733 Ga0496115_0060669 3300048918 Bacteria 3048
734 Ga0496115_0354118 3300048918 Bacteria 1197
735 Ga0496117_0005496 3300048920 Bacteria 13284
736 Ga0496118_0001246 3300048921 Bacteria 39116
737 Ga0496118_0379450 3300048921 Bacteria 742
738 Ga0501033_0623629 3300049570 Bacteria 738
739 Ga0501036_1326535 3300049572 Bacteria 584
740 Ga0501040_0048686 3300049576 Bacteria 2896
741 Ga0501040_0516892 3300049576 Unclassified 861
742 Ga0501042_1210301 3300049578 Bacteria 551
743 Ga0501048_0176832 3300049582 Bacteria 1512
744 Ga0501067_0028701 3300049583 Bacteria 3083
745 Ga0501068_0135075 3300049584 Bacteria 1544
746 Ga0501069_0001252 3300049585 Bacteria 12431
747 Ga0501069_0110445 3300049585 Bacteria 1566
748 Ga0501070_0000975 3300049586 Bacteria 25701
749 Ga0501071_0377625 3300049587 Bacteria 1080
750 Ga0501072_0074230 3300049588 Bacteria 2689
751 Ga0501072_0108564 3300049588 Bacteria 2208
752 Ga0501073_0429890 3300049589 Bacteria 912
753 Ga0501074_0001937 3300049590 Bacteria 14220
754 Ga0501075_0378220 3300049591 Bacteria 1080
755 Ga0501076_0519913 3300049592 Bacteria 981
756 Ga0501076_0571342 3300049592 Unclassified 932
757 Ga0501079_0199262 3300049741 Bacteria 1563
758 Ga0501079_0746348 3300049741 Bacteria 770
759 Ga0501080_0042208 3300049742 Bacteria 4248
760 Ga0501080_0682983 3300049742 Bacteria 906
761 Ga0501083_0002623 3300049744 Bacteria 12390
762 Ga0501035_0535963 3300049822 Unclassified 960
763 Ga0501044_0202668 3300049823 Bacteria 1942
764 Ga0501044_0235188 3300049823 Bacteria 1778
765 nmdc:mga06r32_71340_c1 3300050510 Bacteria 3361
766 nmdc:mga08y16_12031_c2 3300050511 Bacteria 6431
767 nmdc:mga08y16_2052421_c1 3300050511 Bacteria 520
768 nmdc:mga08y16_931592_c1 3300050511 Bacteria 853
769 nmdc:mga0n895_1153427_c1 3300050512 Unclassified 750
770 nmdc:mga0n895_217394_c1 3300050512 Bacteria 1940
771 nmdc:mga0n895_399039_c1 3300050512 Bacteria 1391
772 nmdc:mga0rr50_91268_c1 3300050513 Bacteria 2372
773 nmdc:mga08x19_4495_c1 3300050514 Bacteria 8267
774 nmdc:mga08x19_544375_c1 3300050514 Bacteria 821
775 nmdc:mga08x19_602801_c1 3300050514 Bacteria 778
776 nmdc:mga08x19_65691_c1 3300050514 Bacteria 2357
777 nmdc:mga08x19_86373_c1 3300050514 Bacteria 2065
778 nmdc:mga0a205_42957_c1 3300050515 Bacteria 4357
779 Ga0495601_0010085 3300053077 Bacteria 5609
780 Ga0495601_0020426 3300053077 Bacteria 4045
781 Ga0495601_0020946 3300053077 Bacteria 3998
782 Ga0495612_0005114 3300053078 Bacteria 5423
783 Ga0495612_0105716 3300053078 Bacteria 1201
784 Ga0500646_0048397 3300053090 Bacteria 1219
785 Ga0500566_0351867 3300053094 Bacteria 675
786 Ga0500658_0155354 3300053134 Bacteria 1033
787 Ga0500588_0400268 3300053146 Unclassified 523
788 Ga0500627_0189190 3300053158 Bacteria 925
789 Ga0500630_135918 3300053159 Unclassified 1066
790 Ga0501084_0232713 3300054114 Bacteria 1555
791 Ga0590074_011785 3300059423 Bacteria 1466
792 Ga0501082_0710891 3300060353 Unclassified 879
793 Ga0466962_0137365 3300061719 Bacteria 1183

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10932940 Ga0105243_109329401 129
2 3300013306 Ga0163162_10672689 Ga0163162_106726892 129
3 3300026041 Ga0207639_10117882 Ga0207639_101178821 138
4 3300049585 Ga0501069_0110445 Ga0501069_0110445_692_1108 138
5 3300002705 JGI25156J39149_1000422 JGI25156J39149_100042217 139
6 3300002705 JGI25156J39149_1002686 JGI25156J39149_10026861 139
7 3300002737 JGI25162J39368_1000402 JGI25162J39368_100040226 139
8 3300002738 JGI25154J39366_1003396 JGI25154J39366_10033964 139
9 3300002741 JGI25157J39369_1000344 JGI25157J39369_100034418 139
10 3300002741 JGI25157J39369_1000452 JGI25157J39369_10004524 139
11 3300002772 JGI25164J39214_1000117 JGI25164J39214_100011743 139
12 3300003214 JGI25165J46597_1000235 JGI25165J46597_100023542 139
13 3300003752 Ga0055539_1007503 Ga0055539_10075033 139
14 3300003760 Ga0055527_1000176 Ga0055527_100017624 139
15 3300003761 Ga0055535_1000373 Ga0055535_100037324 139
16 3300003761 Ga0055535_1001357 Ga0055535_10013574 139
17 3300003761 Ga0055535_1001457 Ga0055535_100145710 139
18 3300003762 Ga0055542_1000394 Ga0055542_100039422 139
19 3300003762 Ga0055542_1000429 Ga0055542_10004296 139
20 3300003762 Ga0055542_1000734 Ga0055542_100073421 139
21 3300003763 Ga0055529_1000314 Ga0055529_100031421 139
22 3300003763 Ga0055529_1000420 Ga0055529_100042022 139
23 3300005327 Ga0070658_10163615 Ga0070658_101636152 139
24 3300005330 Ga0070690_100316195 Ga0070690_1003161952 139
25 3300005344 Ga0070661_100025041 Ga0070661_1000250414 139
26 3300005345 Ga0070692_10037570 Ga0070692_100375701 139
27 3300005364 Ga0070673_100509329 Ga0070673_1005093292 139
28 3300005434 Ga0070709_11261766 Ga0070709_112617662 139
29 3300005438 Ga0070701_10739669 Ga0070701_107396692 139
30 3300005441 Ga0070700_100882965 Ga0070700_1008829652 139
31 3300005547 Ga0070693_100441979 Ga0070693_1004419791 139
32 3300005549 Ga0070704_100401299 Ga0070704_1004012992 139
33 3300005578 Ga0068854_100068312 Ga0068854_1000683122 139
34 3300005616 Ga0068852_100041158 Ga0068852_1000411584 139
35 3300005617 Ga0068859_100624374 Ga0068859_1006243743 139
36 3300005618 Ga0068864_100223733 Ga0068864_1002237333 139
37 3300005841 Ga0068863_100077461 Ga0068863_1000774613 139
38 3300005841 Ga0068863_100814101 Ga0068863_1008141012 139
39 3300006871 Ga0075434_100657747 Ga0075434_1006577472 139
40 3300006914 Ga0075436_100003801 Ga0075436_10000380112 139
41 3300006931 Ga0097620_100624386 Ga0097620_1006243863 139
42 3300009094 Ga0111539_10930291 Ga0111539_109302912 139
43 3300009174 Ga0105241_10446717 Ga0105241_104467172 139
44 3300009551 Ga0105238_10001691 Ga0105238_100016917 139
45 3300010375 Ga0105239_10454722 Ga0105239_104547222 139
46 3300013100 Ga0157373_10109438 Ga0157373_101094382 139
47 3300013104 Ga0157370_10612529 Ga0157370_106125292 139
48 3300013307 Ga0157372_10001402 Ga0157372_100014024 139
49 3300013308 Ga0157375_10189409 Ga0157375_101894094 139
50 3300025226 Ga0209674_100197 Ga0209674_10019749 139
51 3300025226 Ga0209674_100550 Ga0209674_10055012 139
52 3300025228 Ga0209672_100008 Ga0209672_100008293 139
53 3300025228 Ga0209672_100089 Ga0209672_10008932 139
54 3300025231 Ga0207427_100051 Ga0207427_10005195 139
55 3300025233 Ga0209437_100152 Ga0209437_10015242 139
56 3300025242 Ga0209258_100004 Ga0209258_100004897 139
57 3300025242 Ga0209258_100008 Ga0209258_100008522 139
58 3300025242 Ga0209258_100090 Ga0209258_10009085 139
59 3300025242 Ga0209258_100101 Ga0209258_10010131 139
60 3300025246 Ga0209646_1010457 Ga0209646_10104572 139
61 3300025250 Ga0209026_1000294 Ga0209026_100029432 139
62 3300025253 Ga0209677_100976 Ga0209677_1009763 139
63 3300025254 Ga0209148_1000041 Ga0209148_100004124 139
64 3300025254 Ga0209148_1000065 Ga0209148_100006585 139
65 3300025254 Ga0209148_1000079 Ga0209148_1000079155 139
66 3300025256 Ga0209759_1000165 Ga0209759_100016511 139
67 3300025256 Ga0209759_1000449 Ga0209759_100044922 139
68 3300025261 Ga0209233_1000099 Ga0209233_1000099159 139
69 3300025272 Ga0209455_1000007 Ga0209455_1000007642 139
70 3300025272 Ga0209455_1000016 Ga0209455_1000016156 139
71 3300025272 Ga0209455_1003591 Ga0209455_10035915 139
72 3300025909 Ga0207705_10229565 Ga0207705_102295652 139
73 3300025911 Ga0207654_10025864 Ga0207654_100258643 139
74 3300025913 Ga0207695_10004315 Ga0207695_100043154 139
75 3300025914 Ga0207671_10001967 Ga0207671_1000196715 139
76 3300025920 Ga0207649_10052176 Ga0207649_100521762 139
77 3300025924 Ga0207694_10106953 Ga0207694_101069532 139
78 3300025940 Ga0207691_10116859 Ga0207691_101168592 139
79 3300025949 Ga0207667_10091823 Ga0207667_100918232 139
80 3300025960 Ga0207651_10195168 Ga0207651_101951682 139
81 3300025981 Ga0207640_10236284 Ga0207640_102362842 139
82 3300025986 Ga0207658_11901723 Ga0207658_119017231 139
83 3300026067 Ga0207678_10625799 Ga0207678_106257992 139
84 3300026078 Ga0207702_10041675 Ga0207702_100416753 139
85 3300026089 Ga0207648_10258224 Ga0207648_102582243 139
86 3300026095 Ga0207676_10761978 Ga0207676_107619782 139
87 3300027907 Ga0207428_10021199 Ga0207428_100211992 139
88 3300031548 Ga0307408_100585413 Ga0307408_1005854132 139
89 3300031712 Ga0265342_10021550 Ga0265342_100215503 139
90 3300037312 Ga0395899_0003165 Ga0395899_0003165_6096_6551 139
91 3300037466 Ga0395898_0000013 Ga0395898_0000013_22026_22481 139
92 3300037466 Ga0395898_0000058 Ga0395898_0000058_20176_20616 139
93 3300038443 Ga0395901_0027626 Ga0395901_0027626_1766_2206 139
94 3300038443 Ga0395901_0280270 Ga0395901_0280270_974_1429 139
95 3300042003 Ga0439443_007133 Ga0439443_007133_123_542 139
96 3300042436 Ga0439435_0000668 Ga0439435_0000668_5064_5483 139
97 3300044656 Ga0466969_0011924 Ga0466969_0011924_708_1148 139
98 3300044661 Ga0466975_0170554 Ga0466975_0170554_858_1298 139
99 3300044683 Ga0466965_0039410 Ga0466965_0039410_993_1433 139
100 3300044693 Ga0466961_0000535 Ga0466961_0000535_17437_17901 139
101 3300044693 Ga0466961_0018288 Ga0466961_0018288_727_1167 139
102 3300044693 Ga0466961_0104062 Ga0466961_0104062_852_1292 139
103 3300044719 Ga0466971_0090085 Ga0466971_0090085_648_1088 139
104 3300044765 Ga0466970_0004001 Ga0466970_0004001_2393_2833 139
105 3300044842 Ga0466957_0001515 Ga0466957_0001515_7916_8356 139
106 3300045049 Ga0466959_0008354 Ga0466959_0008354_1759_2199 139
107 3300045836 Ga0466958_0013812 Ga0466958_0013812_3523_3963 139
108 3300045976 Ga0466967_0033521 Ga0466967_0033521_1517_1981 139
109 3300046539 Ga0495621_0099348 Ga0495621_0099348_458_877 139
110 3300049570 Ga0501033_0623629 Ga0501033_0623629_284_703 139
111 3300049576 Ga0501040_0048686 Ga0501040_0048686_986_1405 139
112 3300050510 nmdc:mga06r32_71340_c1 nmdc:mga06r32_71340_c1_189_608 139
113 3300050511 nmdc:mga08y16_12031_c2 nmdc:mga08y16_12031_c2_5767_6186 139
114 3300050511 nmdc:mga08y16_931592_c1 nmdc:mga08y16_931592_c1_41_460 139
115 3300050512 nmdc:mga0n895_1153427_c1 nmdc:mga0n895_1153427_c1_265_684 139
116 3300050514 nmdc:mga08x19_602801_c1 nmdc:mga08x19_602801_c1_293_715 139
117 3300050514 nmdc:mga08x19_65691_c1 nmdc:mga08x19_65691_c1_1910_2329 139
118 3300061719 Ga0466962_0137365 Ga0466962_0137365_356_796 139
119 3300003203 JGI25406J46586_10085542 JGI25406J46586_100855422 140
120 3300005327 Ga0070658_10345229 Ga0070658_103452292 140
121 3300005334 Ga0068869_100170955 Ga0068869_1001709552 140
122 3300005335 Ga0070666_10021776 Ga0070666_100217763 140
123 3300005338 Ga0068868_101101993 Ga0068868_1011019932 140
124 3300005347 Ga0070668_100949977 Ga0070668_1009499771 140
125 3300005353 Ga0070669_101338911 Ga0070669_1013389111 140
126 3300005364 Ga0070673_100606181 Ga0070673_1006061812 140
127 3300005434 Ga0070709_10391042 Ga0070709_103910421 140
128 3300005435 Ga0070714_101701944 Ga0070714_1017019441 140
129 3300005438 Ga0070701_10637746 Ga0070701_106377461 140
130 3300005457 Ga0070662_100510172 Ga0070662_1005101721 140
131 3300005458 Ga0070681_10165120 Ga0070681_101651203 140
132 3300005547 Ga0070693_100265291 Ga0070693_1002652912 140
133 3300005549 Ga0070704_100097908 Ga0070704_1000979084 140
134 3300005564 Ga0070664_100163183 Ga0070664_1001631832 140
135 3300005578 Ga0068854_100082771 Ga0068854_1000827712 140
136 3300005614 Ga0068856_100062403 Ga0068856_1000624033 140
137 3300005842 Ga0068858_100015154 Ga0068858_1000151543 140
138 3300005843 Ga0068860_100392001 Ga0068860_1003920011 140
139 3300005985 Ga0081539_10001060 Ga0081539_1000106016 140
140 3300006881 Ga0068865_100500331 Ga0068865_1005003312 140
141 3300009093 Ga0105240_10135863 Ga0105240_101358632 140
142 3300009101 Ga0105247_10274953 Ga0105247_102749531 140
143 3300009176 Ga0105242_11213531 Ga0105242_112135312 140
144 3300009545 Ga0105237_10050461 Ga0105237_100504613 140
145 3300009553 Ga0105249_12287212 Ga0105249_122872122 140
146 3300011119 Ga0105246_10264782 Ga0105246_102647822 140
147 3300011119 Ga0105246_10798193 Ga0105246_107981932 140
148 3300013104 Ga0157370_10224406 Ga0157370_102244062 140
149 3300025903 Ga0207680_10031055 Ga0207680_100310553 140
150 3300025912 Ga0207707_10086551 Ga0207707_100865512 140
151 3300025919 Ga0207657_10016926 Ga0207657_100169263 140
152 3300025933 Ga0207706_10204462 Ga0207706_102044622 140
153 3300025933 Ga0207706_10457347 Ga0207706_104573472 140
154 3300025938 Ga0207704_10367795 Ga0207704_103677952 140
155 3300025981 Ga0207640_10101086 Ga0207640_101010861 140
156 3300026023 Ga0207677_10269330 Ga0207677_102693302 140
157 3300026035 Ga0207703_10093670 Ga0207703_100936703 140
158 3300026078 Ga0207702_10196080 Ga0207702_101960802 140
159 3300026089 Ga0207648_10065781 Ga0207648_100657812 140
160 3300028381 Ga0268264_10223578 Ga0268264_102235782 140
161 3300028786 Ga0307517_10091529 Ga0307517_100915292 140
162 3300031548 Ga0307408_101953921 Ga0307408_1019539211 140
163 3300045051 Ga0451576_0611952 Ga0451576_0611952_303_725 140
164 3300053090 Ga0500646_0048397 Ga0500646_0048397_395_823 140
165 3300053146 Ga0500588_0400268 Ga0500588_0400268_16_444 140
166 3300001977 JGI24746J21847_1007558 JGI24746J21847_10075583 141
167 3300001991 JGI24743J22301_10020738 JGI24743J22301_100207382 141
168 3300002076 JGI24749J21850_1011267 JGI24749J21850_10112671 141
169 3300002077 JGI24744J21845_10037300 JGI24744J21845_100373002 141
170 3300002155 JGI24033J26618_1006993 JGI24033J26618_10069932 141
171 3300003322 rootL2_10184296 rootL2_101842965 141
172 3300005288 Ga0065714_10245078 Ga0065714_102450782 141
173 3300005290 Ga0065712_10089646 Ga0065712_100896464 141
174 3300005293 Ga0065715_10027211 Ga0065715_100272112 141
175 3300005295 Ga0065707_10006489 Ga0065707_100064892 141
176 3300005327 Ga0070658_10107426 Ga0070658_101074262 141
177 3300005328 Ga0070676_10258923 Ga0070676_102589232 141
178 3300005328 Ga0070676_10485658 Ga0070676_104856582 141
179 3300005329 Ga0070683_100003464 Ga0070683_10000346414 141
180 3300005329 Ga0070683_100025910 Ga0070683_1000259106 141
181 3300005329 Ga0070683_100082486 Ga0070683_1000824865 141
182 3300005329 Ga0070683_100357389 Ga0070683_1003573892 141
183 3300005330 Ga0070690_100047859 Ga0070690_1000478592 141
184 3300005330 Ga0070690_100048274 Ga0070690_1000482742 141
185 3300005331 Ga0070670_100032959 Ga0070670_1000329598 141
186 3300005333 Ga0070677_10151564 Ga0070677_101515643 141
187 3300005334 Ga0068869_100026763 Ga0068869_1000267636 141
188 3300005334 Ga0068869_100194521 Ga0068869_1001945212 141
189 3300005335 Ga0070666_10011790 Ga0070666_100117907 141
190 3300005335 Ga0070666_10022990 Ga0070666_100229902 141
191 3300005335 Ga0070666_10136972 Ga0070666_101369723 141
192 3300005337 Ga0070682_100977856 Ga0070682_1009778562 141
193 3300005337 Ga0070682_101003966 Ga0070682_1010039662 141
194 3300005338 Ga0068868_100334951 Ga0068868_1003349513 141
195 3300005338 Ga0068868_100370168 Ga0068868_1003701682 141
196 3300005339 Ga0070660_100043886 Ga0070660_1000438862 141
197 3300005339 Ga0070660_100352488 Ga0070660_1003524881 141
198 3300005343 Ga0070687_100591171 Ga0070687_1005911712 141
199 3300005344 Ga0070661_100003414 Ga0070661_10000341416 141
200 3300005344 Ga0070661_100051345 Ga0070661_1000513454 141
201 3300005345 Ga0070692_10021235 Ga0070692_100212353 141
202 3300005353 Ga0070669_100248271 Ga0070669_1002482713 141
203 3300005353 Ga0070669_100293418 Ga0070669_1002934182 141
204 3300005354 Ga0070675_100293758 Ga0070675_1002937583 141
205 3300005355 Ga0070671_100180737 Ga0070671_1001807374 141
206 3300005355 Ga0070671_100232292 Ga0070671_1002322923 141
207 3300005355 Ga0070671_100448204 Ga0070671_1004482041 141
208 3300005355 Ga0070671_101266504 Ga0070671_1012665041 141
209 3300005356 Ga0070674_100009860 Ga0070674_1000098607 141
210 3300005356 Ga0070674_100093255 Ga0070674_1000932553 141
211 3300005364 Ga0070673_100164482 Ga0070673_1001644821 141
212 3300005364 Ga0070673_101141041 Ga0070673_1011410411 141
213 3300005364 Ga0070673_101263127 Ga0070673_1012631271 141
214 3300005365 Ga0070688_100009252 Ga0070688_1000092525 141
215 3300005365 Ga0070688_100176149 Ga0070688_1001761491 141
216 3300005366 Ga0070659_100019972 Ga0070659_1000199723 141
217 3300005366 Ga0070659_100257812 Ga0070659_1002578122 141
218 3300005366 Ga0070659_100580793 Ga0070659_1005807932 141
219 3300005367 Ga0070667_100002375 Ga0070667_1000023752 141
220 3300005367 Ga0070667_100011716 Ga0070667_1000117165 141
221 3300005367 Ga0070667_100102615 Ga0070667_1001026152 141
222 3300005367 Ga0070667_100418160 Ga0070667_1004181602 141
223 3300005367 Ga0070667_102026964 Ga0070667_1020269641 141
224 3300005406 Ga0070703_10062236 Ga0070703_100622361 141
225 3300005434 Ga0070709_10014153 Ga0070709_100141532 141
226 3300005435 Ga0070714_100008518 Ga0070714_1000085186 141
227 3300005435 Ga0070714_100042466 Ga0070714_1000424663 141
228 3300005435 Ga0070714_100514706 Ga0070714_1005147062 141
229 3300005436 Ga0070713_100782981 Ga0070713_1007829811 141
230 3300005440 Ga0070705_101004722 Ga0070705_1010047222 141
231 3300005441 Ga0070700_100029662 Ga0070700_1000296625 141
232 3300005444 Ga0070694_100117108 Ga0070694_1001171081 141
233 3300005444 Ga0070694_100203647 Ga0070694_1002036472 141
234 3300005445 Ga0070708_100688920 Ga0070708_1006889202 141
235 3300005455 Ga0070663_100041181 Ga0070663_1000411816 141
236 3300005456 Ga0070678_100003914 Ga0070678_1000039145 141
237 3300005456 Ga0070678_100242295 Ga0070678_1002422953 141
238 3300005456 Ga0070678_100603462 Ga0070678_1006034621 141
239 3300005456 Ga0070678_100913043 Ga0070678_1009130431 141
240 3300005457 Ga0070662_100097562 Ga0070662_1000975623 141
241 3300005457 Ga0070662_100317083 Ga0070662_1003170832 141
242 3300005458 Ga0070681_10209064 Ga0070681_102090643 141
243 3300005458 Ga0070681_10990304 Ga0070681_109903042 141
244 3300005458 Ga0070681_11176051 Ga0070681_111760511 141
245 3300005459 Ga0068867_100000972 Ga0068867_1000009725 141
246 3300005459 Ga0068867_100477680 Ga0068867_1004776802 141
247 3300005459 Ga0068867_100488254 Ga0068867_1004882542 141
248 3300005466 Ga0070685_10003125 Ga0070685_100031256 141
249 3300005467 Ga0070706_100004142 Ga0070706_10000414211 141
250 3300005471 Ga0070698_100120422 Ga0070698_1001204221 141
251 3300005518 Ga0070699_101754439 Ga0070699_1017544391 141
252 3300005530 Ga0070679_100304129 Ga0070679_1003041292 141
253 3300005530 Ga0070679_100421460 Ga0070679_1004214601 141
254 3300005535 Ga0070684_100045842 Ga0070684_1000458424 141
255 3300005535 Ga0070684_100244768 Ga0070684_1002447681 141
256 3300005535 Ga0070684_100713366 Ga0070684_1007133661 141
257 3300005536 Ga0070697_100006292 Ga0070697_1000062929 141
258 3300005536 Ga0070697_101395056 Ga0070697_1013950561 141
259 3300005539 Ga0068853_100024919 Ga0068853_1000249197 141
260 3300005539 Ga0068853_100029510 Ga0068853_1000295105 141
261 3300005543 Ga0070672_100018183 Ga0070672_1000181834 141
262 3300005543 Ga0070672_101055550 Ga0070672_1010555502 141
263 3300005544 Ga0070686_100013353 Ga0070686_1000133532 141
264 3300005545 Ga0070695_100057747 Ga0070695_1000577472 141
265 3300005545 Ga0070695_100721366 Ga0070695_1007213661 141
266 3300005546 Ga0070696_100219854 Ga0070696_1002198541 141
267 3300005546 Ga0070696_101766458 Ga0070696_1017664581 141
268 3300005547 Ga0070693_100121360 Ga0070693_1001213603 141
269 3300005547 Ga0070693_100152035 Ga0070693_1001520352 141
270 3300005548 Ga0070665_100002162 Ga0070665_10000216215 141
271 3300005548 Ga0070665_100063714 Ga0070665_1000637142 141
272 3300005548 Ga0070665_100165548 Ga0070665_1001655482 141
273 3300005548 Ga0070665_101076639 Ga0070665_1010766392 141
274 3300005548 Ga0070665_101195281 Ga0070665_1011952811 141
275 3300005563 Ga0068855_100260077 Ga0068855_1002600772 141
276 3300005563 Ga0068855_100273060 Ga0068855_1002730603 141
277 3300005563 Ga0068855_100430672 Ga0068855_1004306722 141
278 3300005563 Ga0068855_100500166 Ga0068855_1005001662 141
279 3300005563 Ga0068855_101320896 Ga0068855_1013208962 141
280 3300005563 Ga0068855_101959031 Ga0068855_1019590312 141
281 3300005564 Ga0070664_100070162 Ga0070664_1000701623 141
282 3300005564 Ga0070664_100401528 Ga0070664_1004015281 141
283 3300005577 Ga0068857_100000326 Ga0068857_10000032628 141
284 3300005577 Ga0068857_100054631 Ga0068857_1000546313 141
285 3300005577 Ga0068857_100622968 Ga0068857_1006229682 141
286 3300005578 Ga0068854_100042838 Ga0068854_1000428382 141
287 3300005578 Ga0068854_100073728 Ga0068854_1000737283 141
288 3300005578 Ga0068854_100141979 Ga0068854_1001419793 141
289 3300005614 Ga0068856_100009494 Ga0068856_10000949411 141
290 3300005614 Ga0068856_100018785 Ga0068856_1000187853 141
291 3300005614 Ga0068856_100486292 Ga0068856_1004862923 141
292 3300005616 Ga0068852_100008993 Ga0068852_1000089939 141
293 3300005616 Ga0068852_100012746 Ga0068852_1000127463 141
294 3300005616 Ga0068852_100029985 Ga0068852_1000299856 141
295 3300005616 Ga0068852_100040930 Ga0068852_1000409302 141
296 3300005616 Ga0068852_100077840 Ga0068852_1000778403 141
297 3300005617 Ga0068859_100045135 Ga0068859_1000451353 141
298 3300005617 Ga0068859_100068339 Ga0068859_1000683396 141
299 3300005617 Ga0068859_100225195 Ga0068859_1002251953 141
300 3300005617 Ga0068859_101031056 Ga0068859_1010310562 141
301 3300005618 Ga0068864_100239894 Ga0068864_1002398943 141
302 3300005719 Ga0068861_100001475 Ga0068861_1000014758 141
303 3300005834 Ga0068851_10014726 Ga0068851_100147265 141
304 3300005834 Ga0068851_10052504 Ga0068851_100525043 141
305 3300005840 Ga0068870_10007140 Ga0068870_1000714010 141
306 3300005840 Ga0068870_10284449 Ga0068870_102844492 141
307 3300005841 Ga0068863_100001209 Ga0068863_10000120913 141
308 3300005841 Ga0068863_100089587 Ga0068863_1000895874 141
309 3300005841 Ga0068863_100420079 Ga0068863_1004200793 141
310 3300005842 Ga0068858_100255585 Ga0068858_1002555852 141
311 3300005842 Ga0068858_101187026 Ga0068858_1011870262 141
312 3300005843 Ga0068860_100003093 Ga0068860_10000309317 141
313 3300005843 Ga0068860_100010328 Ga0068860_1000103288 141
314 3300005843 Ga0068860_100058142 Ga0068860_1000581422 141
315 3300005844 Ga0068862_100041253 Ga0068862_1000412533 141
316 3300005844 Ga0068862_100129847 Ga0068862_1001298473 141
317 3300005844 Ga0068862_100288476 Ga0068862_1002884762 141
318 3300005844 Ga0068862_100542586 Ga0068862_1005425861 141
319 3300005937 Ga0081455_10322416 Ga0081455_103224161 141
320 3300006163 Ga0070715_10033608 Ga0070715_100336082 141
321 3300006173 Ga0070716_100022733 Ga0070716_1000227331 141
322 3300006175 Ga0070712_100126840 Ga0070712_1001268402 141
323 3300006175 Ga0070712_100405948 Ga0070712_1004059482 141
324 3300006237 Ga0097621_101073359 Ga0097621_1010733592 141
325 3300006358 Ga0068871_100008475 Ga0068871_1000084751 141
326 3300006358 Ga0068871_100100426 Ga0068871_1001004263 141
327 3300006358 Ga0068871_100877540 Ga0068871_1008775402 141
328 3300006852 Ga0075433_10746566 Ga0075433_107465662 141
329 3300006852 Ga0075433_11181822 Ga0075433_111818222 141
330 3300006871 Ga0075434_100254337 Ga0075434_1002543372 141
331 3300006871 Ga0075434_100402127 Ga0075434_1004021272 141
332 3300006871 Ga0075434_101830962 Ga0075434_1018309621 141
333 3300006881 Ga0068865_100002022 Ga0068865_1000020228 141
334 3300006881 Ga0068865_100059254 Ga0068865_1000592542 141
335 3300006881 Ga0068865_102172513 Ga0068865_1021725131 141
336 3300006914 Ga0075436_100002182 Ga0075436_10000218221 141
337 3300006914 Ga0075436_100404014 Ga0075436_1004040142 141
338 3300006931 Ga0097620_100045135 Ga0097620_1000451357 141
339 3300006931 Ga0097620_100068344 Ga0097620_1000683446 141
340 3300006931 Ga0097620_100225199 Ga0097620_1002251993 141
341 3300006931 Ga0097620_101030968 Ga0097620_1010309682 141
342 3300007076 Ga0075435_100081101 Ga0075435_1000811012 141
343 3300007076 Ga0075435_100082677 Ga0075435_1000826772 141
344 3300009093 Ga0105240_10015929 Ga0105240_1001592911 141
345 3300009093 Ga0105240_10043124 Ga0105240_100431244 141
346 3300009093 Ga0105240_10610206 Ga0105240_106102062 141
347 3300009094 Ga0111539_10583046 Ga0111539_105830462 141
348 3300009094 Ga0111539_11825661 Ga0111539_118256612 141
349 3300009098 Ga0105245_10545935 Ga0105245_105459352 141
350 3300009098 Ga0105245_10977201 Ga0105245_109772012 141
351 3300009098 Ga0105245_12024563 Ga0105245_120245631 141
352 3300009101 Ga0105247_10137500 Ga0105247_101375001 141
353 3300009101 Ga0105247_10385720 Ga0105247_103857201 141
354 3300009147 Ga0114129_10825660 Ga0114129_108256602 141
355 3300009148 Ga0105243_10102966 Ga0105243_101029664 141
356 3300009148 Ga0105243_10640941 Ga0105243_106409412 141
357 3300009174 Ga0105241_10064038 Ga0105241_100640385 141
358 3300009174 Ga0105241_10519560 Ga0105241_105195602 141
359 3300009176 Ga0105242_10017478 Ga0105242_100174787 141
360 3300009176 Ga0105242_10755552 Ga0105242_107555522 141
361 3300009176 Ga0105242_11056370 Ga0105242_110563702 141
362 3300009177 Ga0105248_10097107 Ga0105248_100971076 141
363 3300009177 Ga0105248_10398106 Ga0105248_103981062 141
364 3300009177 Ga0105248_10496639 Ga0105248_104966392 141
365 3300009545 Ga0105237_10138562 Ga0105237_101385626 141
366 3300009545 Ga0105237_10847938 Ga0105237_108479382 141
367 3300009551 Ga0105238_10250523 Ga0105238_102505233 141
368 3300009551 Ga0105238_10773008 Ga0105238_107730082 141
369 3300009551 Ga0105238_12016354 Ga0105238_120163541 141
370 3300009553 Ga0105249_10437597 Ga0105249_104375972 141
371 3300009553 Ga0105249_10484395 Ga0105249_104843952 141
372 3300010375 Ga0105239_10359672 Ga0105239_103596722 141
373 3300010375 Ga0105239_10430395 Ga0105239_104303952 141
374 3300010375 Ga0105239_11036072 Ga0105239_110360722 141
375 3300011119 Ga0105246_10830229 Ga0105246_108302292 141
376 3300011119 Ga0105246_11391362 Ga0105246_113913621 141
377 3300013100 Ga0157373_10016576 Ga0157373_100165762 141
378 3300013100 Ga0157373_10286346 Ga0157373_102863462 141
379 3300013100 Ga0157373_10427991 Ga0157373_104279912 141
380 3300013102 Ga0157371_10488444 Ga0157371_104884442 141
381 3300013105 Ga0157369_10018256 Ga0157369_100182565 141
382 3300013105 Ga0157369_10036084 Ga0157369_100360849 141
383 3300013105 Ga0157369_10603273 Ga0157369_106032732 141
384 3300013296 Ga0157374_10006253 Ga0157374_100062531 141
385 3300013296 Ga0157374_10074892 Ga0157374_100748923 141
386 3300013296 Ga0157374_10087010 Ga0157374_100870102 141
387 3300013296 Ga0157374_10119604 Ga0157374_101196042 141
388 3300013296 Ga0157374_10648193 Ga0157374_106481931 141
389 3300013296 Ga0157374_12034314 Ga0157374_120343141 141
390 3300013297 Ga0157378_10004305 Ga0157378_1000430516 141
391 3300013297 Ga0157378_10013363 Ga0157378_1001336311 141
392 3300013297 Ga0157378_10099232 Ga0157378_100992324 141
393 3300013297 Ga0157378_10117837 Ga0157378_101178374 141
394 3300013297 Ga0157378_10720271 Ga0157378_107202711 141
395 3300013297 Ga0157378_10762121 Ga0157378_107621211 141
396 3300013297 Ga0157378_11156194 Ga0157378_111561941 141
397 3300013306 Ga0163162_10010945 Ga0163162_1001094513 141
398 3300013306 Ga0163162_10027941 Ga0163162_100279415 141
399 3300013306 Ga0163162_10788824 Ga0163162_107888241 141
400 3300013307 Ga0157372_10013916 Ga0157372_1001391610 141
401 3300013307 Ga0157372_10135958 Ga0157372_101359583 141
402 3300013307 Ga0157372_10151943 Ga0157372_101519433 141
403 3300013307 Ga0157372_10199667 Ga0157372_101996672 141
404 3300013308 Ga0157375_10068642 Ga0157375_100686425 141
405 3300013308 Ga0157375_10295469 Ga0157375_102954694 141
406 3300014325 Ga0163163_10015144 Ga0163163_1001514410 141
407 3300014325 Ga0163163_10970658 Ga0163163_109706582 141
408 3300014497 Ga0182008_10002400 Ga0182008_100024002 141
409 3300014497 Ga0182008_10222319 Ga0182008_102223192 141
410 3300014497 Ga0182008_10684357 Ga0182008_106843571 141
411 3300014745 Ga0157377_10385437 Ga0157377_103854372 141
412 3300014745 Ga0157377_10578002 Ga0157377_105780022 141
413 3300014968 Ga0157379_10237318 Ga0157379_102373183 141
414 3300014968 Ga0157379_10826622 Ga0157379_108266222 141
415 3300014969 Ga0157376_10005225 Ga0157376_100052259 141
416 3300014969 Ga0157376_10195117 Ga0157376_101951173 141
417 3300015261 Ga0182006_1086248 Ga0182006_10862482 141
418 3300015262 Ga0182007_10000225 Ga0182007_1000022516 141
419 3300015265 Ga0182005_1067500 Ga0182005_10675002 141
420 3300017792 Ga0163161_10090859 Ga0163161_100908594 141
421 3300017792 Ga0163161_10095622 Ga0163161_100956222 141
422 3300017792 Ga0163161_10280852 Ga0163161_102808521 141
423 3300017792 Ga0163161_10325319 Ga0163161_103253192 141
424 3300017792 Ga0163161_10924557 Ga0163161_109245571 141
425 3300021361 Ga0213872_10000003 Ga0213872_10000003225 141
426 3300021361 Ga0213872_10000163 Ga0213872_1000016326 141
427 3300025315 Ga0207697_10006661 Ga0207697_100066612 141
428 3300025321 Ga0207656_10053200 Ga0207656_100532003 141
429 3300025321 Ga0207656_10193070 Ga0207656_101930702 141
430 3300025893 Ga0207682_10001376 Ga0207682_1000137615 141
431 3300025898 Ga0207692_10005132 Ga0207692_100051327 141
432 3300025898 Ga0207692_10238084 Ga0207692_102380841 141
433 3300025903 Ga0207680_10010766 Ga0207680_100107662 141
434 3300025903 Ga0207680_10126455 Ga0207680_101264553 141
435 3300025903 Ga0207680_10127575 Ga0207680_101275752 141
436 3300025904 Ga0207647_10002041 Ga0207647_100020414 141
437 3300025905 Ga0207685_10114061 Ga0207685_101140612 141
438 3300025906 Ga0207699_10080050 Ga0207699_100800503 141
439 3300025907 Ga0207645_10211491 Ga0207645_102114912 141
440 3300025907 Ga0207645_10477290 Ga0207645_104772902 141
441 3300025907 Ga0207645_10555372 Ga0207645_105553722 141
442 3300025908 Ga0207643_10343970 Ga0207643_103439702 141
443 3300025910 Ga0207684_10065597 Ga0207684_100655974 141
444 3300025910 Ga0207684_10111746 Ga0207684_101117463 141
445 3300025910 Ga0207684_10112125 Ga0207684_101121252 141
446 3300025911 Ga0207654_10065161 Ga0207654_100651613 141
447 3300025911 Ga0207654_10210426 Ga0207654_102104261 141
448 3300025912 Ga0207707_10195489 Ga0207707_101954893 141
449 3300025912 Ga0207707_10411794 Ga0207707_104117942 141
450 3300025913 Ga0207695_10037880 Ga0207695_100378802 141
451 3300025913 Ga0207695_10069691 Ga0207695_100696913 141
452 3300025913 Ga0207695_11075378 Ga0207695_110753781 141
453 3300025915 Ga0207693_10117198 Ga0207693_101171982 141
454 3300025915 Ga0207693_10233690 Ga0207693_102336902 141
455 3300025916 Ga0207663_10158917 Ga0207663_101589171 141
456 3300025916 Ga0207663_10261507 Ga0207663_102615071 141
457 3300025916 Ga0207663_10639702 Ga0207663_106397022 141
458 3300025917 Ga0207660_10859090 Ga0207660_108590901 141
459 3300025919 Ga0207657_10060723 Ga0207657_100607236 141
460 3300025919 Ga0207657_10181521 Ga0207657_101815213 141
461 3300025920 Ga0207649_10003824 Ga0207649_1000382411 141
462 3300025920 Ga0207649_10098218 Ga0207649_100982183 141
463 3300025920 Ga0207649_10205341 Ga0207649_102053412 141
464 3300025920 Ga0207649_11082204 Ga0207649_110822041 141
465 3300025921 Ga0207652_10103390 Ga0207652_101033903 141
466 3300025921 Ga0207652_10296919 Ga0207652_102969192 141
467 3300025922 Ga0207646_11579509 Ga0207646_115795091 141
468 3300025923 Ga0207681_10233523 Ga0207681_102335232 141
469 3300025924 Ga0207694_10016968 Ga0207694_100169681 141
470 3300025924 Ga0207694_10730288 Ga0207694_107302882 141
471 3300025925 Ga0207650_10030941 Ga0207650_100309416 141
472 3300025925 Ga0207650_10218977 Ga0207650_102189772 141
473 3300025926 Ga0207659_10031067 Ga0207659_100310672 141
474 3300025927 Ga0207687_10027388 Ga0207687_100273884 141
475 3300025928 Ga0207700_10259433 Ga0207700_102594333 141
476 3300025929 Ga0207664_10021580 Ga0207664_100215802 141
477 3300025929 Ga0207664_10024484 Ga0207664_100244843 141
478 3300025929 Ga0207664_11180427 Ga0207664_111804271 141
479 3300025931 Ga0207644_10176701 Ga0207644_101767012 141
480 3300025931 Ga0207644_10226831 Ga0207644_102268314 141
481 3300025931 Ga0207644_10584598 Ga0207644_105845982 141
482 3300025932 Ga0207690_10583142 Ga0207690_105831422 141
483 3300025933 Ga0207706_11120903 Ga0207706_111209031 141
484 3300025935 Ga0207709_10388111 Ga0207709_103881111 141
485 3300025935 Ga0207709_10456495 Ga0207709_104564951 141
486 3300025937 Ga0207669_10028296 Ga0207669_100282963 141
487 3300025937 Ga0207669_10069073 Ga0207669_100690733 141
488 3300025938 Ga0207704_10172505 Ga0207704_101725053 141
489 3300025938 Ga0207704_10298455 Ga0207704_102984553 141
490 3300025940 Ga0207691_10041207 Ga0207691_100412074 141
491 3300025940 Ga0207691_10205823 Ga0207691_102058232 141
492 3300025941 Ga0207711_10001632 Ga0207711_1000163212 141
493 3300025941 Ga0207711_10338023 Ga0207711_103380231 141
494 3300025941 Ga0207711_10360409 Ga0207711_103604092 141
495 3300025942 Ga0207689_10006092 Ga0207689_1000609211 141
496 3300025942 Ga0207689_10007213 Ga0207689_100072139 141
497 3300025942 Ga0207689_10039336 Ga0207689_100393363 141
498 3300025942 Ga0207689_10046845 Ga0207689_100468452 141
499 3300025944 Ga0207661_10038131 Ga0207661_100381316 141
500 3300025944 Ga0207661_10365712 Ga0207661_103657122 141
501 3300025945 Ga0207679_10007632 Ga0207679_1000763210 141
502 3300025945 Ga0207679_10024072 Ga0207679_100240726 141
503 3300025945 Ga0207679_10104704 Ga0207679_101047043 141
504 3300025949 Ga0207667_10021483 Ga0207667_1002148310 141
505 3300025949 Ga0207667_10049769 Ga0207667_100497693 141
506 3300025949 Ga0207667_10465221 Ga0207667_104652212 141
507 3300025949 Ga0207667_10675614 Ga0207667_106756142 141
508 3300025960 Ga0207651_10534442 Ga0207651_105344421 141
509 3300025960 Ga0207651_10632237 Ga0207651_106322372 141
510 3300025960 Ga0207651_11019928 Ga0207651_110199282 141
511 3300025961 Ga0207712_10076717 Ga0207712_100767173 141
512 3300025972 Ga0207668_10020310 Ga0207668_100203104 141
513 3300025972 Ga0207668_10721481 Ga0207668_107214812 141
514 3300025981 Ga0207640_10033678 Ga0207640_100336783 141
515 3300025981 Ga0207640_10284688 Ga0207640_102846883 141
516 3300025986 Ga0207658_10001646 Ga0207658_100016468 141
517 3300025986 Ga0207658_10488004 Ga0207658_104880042 141
518 3300026023 Ga0207677_10036448 Ga0207677_100364482 141
519 3300026023 Ga0207677_10059006 Ga0207677_100590063 141
520 3300026023 Ga0207677_10090597 Ga0207677_100905972 141
521 3300026023 Ga0207677_10225256 Ga0207677_102252562 141
522 3300026035 Ga0207703_10010103 Ga0207703_100101031 141
523 3300026035 Ga0207703_10177774 Ga0207703_101777742 141
524 3300026035 Ga0207703_10202419 Ga0207703_102024192 141
525 3300026041 Ga0207639_10064678 Ga0207639_100646783 141
526 3300026041 Ga0207639_10181849 Ga0207639_101818492 141
527 3300026041 Ga0207639_10716042 Ga0207639_107160422 141
528 3300026078 Ga0207702_10011615 Ga0207702_100116155 141
529 3300026078 Ga0207702_10065195 Ga0207702_100651953 141
530 3300026078 Ga0207702_10687283 Ga0207702_106872832 141
531 3300026078 Ga0207702_11927376 Ga0207702_119273761 141
532 3300026089 Ga0207648_10000584 Ga0207648_100005843 141
533 3300026089 Ga0207648_10097042 Ga0207648_100970425 141
534 3300026089 Ga0207648_11019406 Ga0207648_110194062 141
535 3300026116 Ga0207674_10000180 Ga0207674_1000018013 141
536 3300026116 Ga0207674_10378082 Ga0207674_103780822 141
537 3300026116 Ga0207674_10699996 Ga0207674_106999962 141
538 3300026118 Ga0207675_100001346 Ga0207675_1000013465 141
539 3300026118 Ga0207675_100003447 Ga0207675_10000344714 141
540 3300026121 Ga0207683_10018175 Ga0207683_100181755 141
541 3300026121 Ga0207683_10366952 Ga0207683_103669523 141
542 3300026121 Ga0207683_10497753 Ga0207683_104977533 141
543 3300026142 Ga0207698_10014775 Ga0207698_100147753 141
544 3300026142 Ga0207698_10138604 Ga0207698_101386044 141
545 3300027907 Ga0207428_11006721 Ga0207428_110067212 141
546 3300028379 Ga0268266_10058477 Ga0268266_100584772 141
547 3300028379 Ga0268266_10276030 Ga0268266_102760302 141
548 3300028379 Ga0268266_11724988 Ga0268266_117249882 141
549 3300028380 Ga0268265_10052583 Ga0268265_100525833 141
550 3300028380 Ga0268265_10066305 Ga0268265_100663052 141
551 3300028380 Ga0268265_10619080 Ga0268265_106190801 141
552 3300028381 Ga0268264_10018918 Ga0268264_100189188 141
553 3300028381 Ga0268264_10143956 Ga0268264_101439562 141
554 3300028381 Ga0268264_10240352 Ga0268264_102403521 141
555 3300028381 Ga0268264_11158834 Ga0268264_111588341 141
556 3300028786 Ga0307517_10033524 Ga0307517_100335243 141
557 3300031235 Ga0265330_10226473 Ga0265330_102264732 141
558 3300031239 Ga0265328_10012522 Ga0265328_100125223 141
559 3300031665 Ga0316575_10003499 Ga0316575_100034994 141
560 3300031691 Ga0316579_10006852 Ga0316579_100068525 141
561 3300031728 Ga0316578_10041003 Ga0316578_100410032 141
562 3300031731 Ga0307405_11575633 Ga0307405_115756332 141
563 3300031824 Ga0307413_11372624 Ga0307413_113726241 141
564 3300031901 Ga0307406_10005996 Ga0307406_100059961 141
565 3300032133 Ga0316583_10020650 Ga0316583_100206503 141
566 3300032139 Ga0316580_10051806 Ga0316580_100518062 141
567 3300035083 Ga0373926_0007635 Ga0373926_0007635_2200_2628 141
568 3300035089 Ga0373944_0239253 Ga0373944_0239253_24_452 141
569 3300035111 Ga0373923_0450568 Ga0373923_0450568_134_595 141
570 3300035113 Ga0373936_0016812 Ga0373936_0016812_785_1213 141
571 3300035113 Ga0373936_0047102 Ga0373936_0047102_548_991 141
572 3300035116 Ga0373945_0043061 Ga0373945_0043061_284_712 141
573 3300035116 Ga0373945_0089204 Ga0373945_0089204_565_1005 141
574 3300035116 Ga0373945_0133457 Ga0373945_0133457_90_515 141
575 3300035119 Ga0373956_0485269 Ga0373956_0485269_73_501 141
576 3300035170 Ga0373943_0000144 Ga0373943_0000144_19525_19953 141
577 3300035171 Ga0373946_0043239 Ga0373946_0043239_1385_1813 141
578 3300035171 Ga0373946_0084921 Ga0373946_0084921_824_1249 141
579 3300035172 Ga0373955_0738471 Ga0373955_0738471_50_478 141
580 3300035691 Ga0373931_0038823 Ga0373931_0038823_1358_1786 141
581 3300035691 Ga0373931_0123378 Ga0373931_0123378_177_602 141
582 3300035692 Ga0373935_0031185 Ga0373935_0031185_522_950 141
583 3300035695 Ga0373927_0000227 Ga0373927_0000227_43043_43471 141
584 3300035695 Ga0373927_0056944 Ga0373927_0056944_357_791 141
585 3300035695 Ga0373927_0120097 Ga0373927_0120097_883_1311 141
586 3300035724 Ga0373933_0736086 Ga0373933_0736086_123_623 141
587 3300035725 Ga0373947_0000318 Ga0373947_0000318_8816_9244 141
588 3300035725 Ga0373947_1186982 Ga0373947_1186982_71_499 141
589 3300036401 Ga0373937_0282985 Ga0373937_0282985_1045_1506 141
590 3300036401 Ga0373937_0462156 Ga0373937_0462156_626_1087 141
591 3300036401 Ga0373937_1600451 Ga0373937_1600451_96_530 141
592 3300036712 Ga0316584_0670491 Ga0316584_0670491_229_660 141
593 3300037068 Ga0373925_0024617 Ga0373925_0024617_2946_3374 141
594 3300037068 Ga0373925_0117516 Ga0373925_0117516_1501_1926 141
595 3300037068 Ga0373925_1059003 Ga0373925_1059003_106_588 141
596 3300037068 Ga0373925_1317195 Ga0373925_1317195_95_523 141
597 3300037418 Ga0395900_0392372 Ga0395900_0392372_303_746 141
598 3300037466 Ga0395898_0859077 Ga0395898_0859077_262_705 141
599 3300037471 Ga0395905_0723692 Ga0395905_0723692_345_788 141
600 3300037471 Ga0395905_0827817 Ga0395905_0827817_265_690 141
601 3300037588 Ga0316581_0029004 Ga0316581_0029004_225_656 141
602 3300037853 Ga0436364_0460231 Ga0436364_0460231_73_501 141
603 3300038443 Ga0395901_0309889 Ga0395901_0309889_141_566 141
604 3300039437 Ga0436365_1185547 Ga0436365_1185547_54_485 141
605 3300039447 Ga0436361_0408289 Ga0436361_0408289_17870_18298 141
606 3300039447 Ga0436361_0647550 Ga0436361_0647550_223_651 141
607 3300039447 Ga0436361_1061851 Ga0436361_1061851_16388_16816 141
608 3300039447 Ga0436361_1151650 Ga0436361_1151650_688_1116 141
609 3300041505 Ga0451849_0692289 Ga0451849_0692289_122_574 141
610 3300042876 Ga0451577_0249416 Ga0451577_0249416_1023_1484 141
611 3300044658 Ga0466972_0011770 Ga0466972_0011770_2967_3395 141
612 3300044765 Ga0466970_0000347 Ga0466970_0000347_7962_8390 141
613 3300045049 Ga0466959_0001224 Ga0466959_0001224_5744_6175 141
614 3300046452 Ga0495617_028444 Ga0495617_028444_1391_1819 141
615 3300046453 Ga0495627_135860 Ga0495627_135860_172_600 141
616 3300046454 Ga0495592_0111505 Ga0495592_0111505_339_770 141
617 3300046454 Ga0495592_0153548 Ga0495592_0153548_412_840 141
618 3300046455 Ga0495603_0313452 Ga0495603_0313452_448_876 141
619 3300046455 Ga0495603_0433650 Ga0495603_0433650_311_739 141
620 3300046457 Ga0495590_0002936 Ga0495590_0002936_5953_6393 141
621 3300046459 Ga0495629_0150890 Ga0495629_0150890_794_1222 141
622 3300046459 Ga0495629_0321511 Ga0495629_0321511_228_686 141
623 3300046462 Ga0495651_0096575 Ga0495651_0096575_511_948 141
624 3300046472 Ga0495580_0057935 Ga0495580_0057935_931_1359 141
625 3300046474 Ga0495605_0152786 Ga0495605_0152786_206_634 141
626 3300046475 Ga0495639_0001048 Ga0495639_0001048_4293_4751 141
627 3300046476 Ga0495662_0056812 Ga0495662_0056812_359_787 141
628 3300046476 Ga0495662_0076915 Ga0495662_0076915_1052_1480 141
629 3300046477 Ga0495664_0022059 Ga0495664_0022059_530_958 141
630 3300046477 Ga0495664_0184942 Ga0495664_0184942_588_1016 141
631 3300046491 Ga0495584_0486353 Ga0495584_0486353_81_509 141
632 3300046492 Ga0495585_0052822 Ga0495585_0052822_1398_1826 141
633 3300046507 Ga0495606_0502671 Ga0495606_0502671_134_562 141
634 3300046513 Ga0495616_0070065 Ga0495616_0070065_830_1258 141
635 3300046514 Ga0495618_0008560 Ga0495618_0008560_276_704 141
636 3300046514 Ga0495618_0296755 Ga0495618_0296755_543_980 141
637 3300046514 Ga0495618_0319818 Ga0495618_0319818_523_951 141
638 3300046516 Ga0495628_0032340 Ga0495628_0032340_2550_2978 141
639 3300046516 Ga0495628_0043271 Ga0495628_0043271_2479_2910 141
640 3300046516 Ga0495628_1092827 Ga0495628_1092827_71_514 141
641 3300046517 Ga0495630_0000460 Ga0495630_0000460_13511_13939 141
642 3300046517 Ga0495630_0049702 Ga0495630_0049702_1145_1573 141
643 3300046518 Ga0495631_0073578 Ga0495631_0073578_921_1349 141
644 3300046528 Ga0495642_0416435 Ga0495642_0416435_70_513 141
645 3300046529 Ga0495652_0205047 Ga0495652_0205047_850_1281 141
646 3300046529 Ga0495652_0249116 Ga0495652_0249116_329_757 141
647 3300046529 Ga0495652_0356081 Ga0495652_0356081_70_498 141
648 3300046529 Ga0495652_0623858 Ga0495652_0623858_172_600 141
649 3300046531 Ga0495665_0011893 Ga0495665_0011893_3248_3676 141
650 3300046531 Ga0495665_0015225 Ga0495665_0015225_2303_2734 141
651 3300046533 Ga0495640_0022904 Ga0495640_0022904_3463_3891 141
652 3300046533 Ga0495640_0067599 Ga0495640_0067599_766_1194 141
653 3300046535 Ga0495586_0239182 Ga0495586_0239182_328_756 141
654 3300046535 Ga0495586_0259408 Ga0495586_0259408_230_661 141
655 3300046539 Ga0495621_0009424 Ga0495621_0009424_715_1143 141
656 3300046539 Ga0495621_0119973 Ga0495621_0119973_369_797 141
657 3300046539 Ga0495621_0207108 Ga0495621_0207108_44_469 141
658 3300046539 Ga0495621_0351117 Ga0495621_0351117_108_557 141
659 3300046543 Ga0495645_0003040 Ga0495645_0003040_40_468 141
660 3300046543 Ga0495645_0333548 Ga0495645_0333548_264_692 141
661 3300046558 Ga0495633_0047090 Ga0495633_0047090_97_525 141
662 3300046615 Ga0495656_0010263 Ga0495656_0010263_1467_1895 141
663 3300046615 Ga0495656_0010373 Ga0495656_0010373_2550_2999 141
664 3300046642 Ga0495634_0088624 Ga0495634_0088624_1004_1432 141
665 3300046648 Ga0495611_0031872 Ga0495611_0031872_201_629 141
666 3300046663 Ga0495635_0008319 Ga0495635_0008319_6649_7077 141
667 3300046663 Ga0495635_0206764 Ga0495635_0206764_504_932 141
668 3300046664 Ga0495659_0046384 Ga0495659_0046384_355_783 141
669 3300046674 Ga0495588_0028535 Ga0495588_0028535_2239_2697 141
670 3300046675 Ga0495657_0456808 Ga0495657_0456808_216_674 141
671 3300046678 Ga0495599_0028768 Ga0495599_0028768_2856_3284 141
672 3300046678 Ga0495599_0225868 Ga0495599_0225868_492_923 141
673 3300046681 Ga0495647_0041383 Ga0495647_0041383_192_620 141
674 3300046681 Ga0495647_0097526 Ga0495647_0097526_699_1124 141
675 3300046683 Ga0495658_0175848 Ga0495658_0175848_739_1167 141
676 3300046683 Ga0495658_0533064 Ga0495658_0533064_222_647 141
677 3300046689 Ga0495613_0029168 Ga0495613_0029168_75_506 141
678 3300046689 Ga0495613_0036947 Ga0495613_0036947_1104_1532 141
679 3300046690 Ga0495624_0000895 Ga0495624_0000895_4539_4967 141
680 3300046690 Ga0495624_0401192 Ga0495624_0401192_168_596 141
681 3300046691 Ga0495670_0036200 Ga0495670_0036200_1572_2000 141
682 3300046691 Ga0495670_0477958 Ga0495670_0477958_38_496 141
683 3300046794 Ga0495589_0090201 Ga0495589_0090201_129_557 141
684 3300046809 Ga0495600_0286723 Ga0495600_0286723_253_696 141
685 3300046809 Ga0495600_0466130 Ga0495600_0466130_22_450 141
686 3300046809 Ga0495600_0523167 Ga0495600_0523167_116_577 141
687 3300046810 Ga0495660_0047087 Ga0495660_0047087_1508_1948 141
688 3300047315 Ga0495581_0001700 Ga0495581_0001700_11213_11641 141
689 3300047315 Ga0495581_0115636 Ga0495581_0115636_255_683 141
690 3300047318 Ga0495636_0316253 Ga0495636_0316253_77_505 141
691 3300047319 Ga0495674_0025064 Ga0495674_0025064_4440_4868 141
692 3300047320 Ga0495672_0084979 Ga0495672_0084979_84_512 141
693 3300047321 Ga0495676_0054763 Ga0495676_0054763_1947_2375 141
694 3300047322 Ga0495680_0279848 Ga0495680_0279848_120_548 141
695 3300047469 Ga0495673_0033331 Ga0495673_0033331_1412_1840 141
696 3300047471 Ga0495684_0001671 Ga0495684_0001671_10410_10838 141
697 3300047471 Ga0495684_0012792 Ga0495684_0012792_277_705 141
698 3300047471 Ga0495684_0066998 Ga0495684_0066998_1911_2339 141
699 3300047472 Ga0495686_0460053 Ga0495686_0460053_176_604 141
700 3300047673 Ga0495593_0039096 Ga0495593_0039096_38_466 141
701 3300048088 Ga0495602_1042723 Ga0495602_1042723_42_491 141
702 3300048088 Ga0495602_1069548 Ga0495602_1069548_56_517 141
703 3300048090 Ga0495615_0003003 Ga0495615_0003003_2229_2678 141
704 3300048090 Ga0495615_0285168 Ga0495615_0285168_30_458 141
705 3300048903 Ga0496100_0003967 Ga0496100_0003967_7213_7671 141
706 3300048905 Ga0496102_0000994 Ga0496102_0000994_25054_25512 141
707 3300048905 Ga0496102_1686250 Ga0496102_1686250_105_536 141
708 3300048906 Ga0496103_0017088 Ga0496103_0017088_179_637 141
709 3300048907 Ga0496104_0000657 Ga0496104_0000657_20595_21023 141
710 3300048907 Ga0496104_0008348 Ga0496104_0008348_7371_7802 141
711 3300048907 Ga0496104_0012907 Ga0496104_0012907_6308_6736 141
712 3300048907 Ga0496104_0020758 Ga0496104_0020758_653_1111 141
713 3300048907 Ga0496104_0070361 Ga0496104_0070361_2613_3038 141
714 3300048908 Ga0496105_0001560 Ga0496105_0001560_3405_3836 141
715 3300048908 Ga0496105_0007805 Ga0496105_0007805_6007_6465 141
716 3300048908 Ga0496105_0097024 Ga0496105_0097024_740_1165 141
717 3300048908 Ga0496105_0379200 Ga0496105_0379200_293_721 141
718 3300048909 Ga0496106_0007931 Ga0496106_0007931_660_1118 141
719 3300048909 Ga0496106_0042963 Ga0496106_0042963_978_1403 141
720 3300048909 Ga0496106_0170072 Ga0496106_0170072_720_1148 141
721 3300048909 Ga0496106_1263946 Ga0496106_1263946_66_494 141
722 3300048910 Ga0496107_0090582 Ga0496107_0090582_856_1281 141
723 3300048911 Ga0496108_0003424 Ga0496108_0003424_9938_10363 141
724 3300048911 Ga0496108_0005441 Ga0496108_0005441_6806_7237 141
725 3300048911 Ga0496108_0034043 Ga0496108_0034043_3129_3572 141
726 3300048912 Ga0496109_0002056 Ga0496109_0002056_13201_13632 141
727 3300048912 Ga0496109_0005269 Ga0496109_0005269_5531_5956 141
728 3300048913 Ga0496110_0007968 Ga0496110_0007968_3969_4400 141
729 3300048913 Ga0496110_0015577 Ga0496110_0015577_5042_5500 141
730 3300048913 Ga0496110_0041091 Ga0496110_0041091_2814_3239 141
731 3300048913 Ga0496110_0065837 Ga0496110_0065837_2217_2660 141
732 3300048913 Ga0496110_0381707 Ga0496110_0381707_23_451 141
733 3300048914 Ga0496111_0003114 Ga0496111_0003114_3503_3934 141
734 3300048914 Ga0496111_0029149 Ga0496111_0029149_937_1395 141
735 3300048914 Ga0496111_0070447 Ga0496111_0070447_259_702 141
736 3300048914 Ga0496111_0107366 Ga0496111_0107366_914_1339 141
737 3300048914 Ga0496111_0233204 Ga0496111_0233204_556_984 141
738 3300048915 Ga0496112_1611858 Ga0496112_1611858_36_494 141
739 3300048915 Ga0496112_1691615 Ga0496112_1691615_94_522 141
740 3300048916 Ga0496113_0029631 Ga0496113_0029631_89_517 141
741 3300048916 Ga0496113_0116740 Ga0496113_0116740_503_946 141
742 3300048916 Ga0496113_0245115 Ga0496113_0245115_771_1196 141
743 3300048916 Ga0496113_0751346 Ga0496113_0751346_225_683 141
744 3300048917 Ga0496114_0028014 Ga0496114_0028014_3705_4163 141
745 3300048918 Ga0496115_0060669 Ga0496115_0060669_184_612 141
746 3300048918 Ga0496115_0354118 Ga0496115_0354118_322_747 141
747 3300048920 Ga0496117_0005496 Ga0496117_0005496_564_992 141
748 3300048921 Ga0496118_0001246 Ga0496118_0001246_18510_18938 141
749 3300048921 Ga0496118_0379450 Ga0496118_0379450_210_683 141
750 3300049572 Ga0501036_1326535 Ga0501036_1326535_73_513 141
751 3300049576 Ga0501040_0516892 Ga0501040_0516892_10_435 141
752 3300049578 Ga0501042_1210301 Ga0501042_1210301_98_526 141
753 3300049582 Ga0501048_0176832 Ga0501048_0176832_37_465 141
754 3300049583 Ga0501067_0028701 Ga0501067_0028701_39_482 141
755 3300049584 Ga0501068_0135075 Ga0501068_0135075_1092_1532 141
756 3300049585 Ga0501069_0001252 Ga0501069_0001252_7996_8436 141
757 3300049586 Ga0501070_0000975 Ga0501070_0000975_17521_17961 141
758 3300049587 Ga0501071_0377625 Ga0501071_0377625_490_918 141
759 3300049588 Ga0501072_0074230 Ga0501072_0074230_1727_2155 141
760 3300049588 Ga0501072_0108564 Ga0501072_0108564_520_960 141
761 3300049589 Ga0501073_0429890 Ga0501073_0429890_399_839 141
762 3300049590 Ga0501074_0001937 Ga0501074_0001937_7875_8315 141
763 3300049591 Ga0501075_0378220 Ga0501075_0378220_178_606 141
764 3300049592 Ga0501076_0519913 Ga0501076_0519913_471_899 141
765 3300049592 Ga0501076_0571342 Ga0501076_0571342_422_862 141
766 3300049741 Ga0501079_0199262 Ga0501079_0199262_450_890 141
767 3300049741 Ga0501079_0746348 Ga0501079_0746348_59_487 141
768 3300049742 Ga0501080_0042208 Ga0501080_0042208_2557_2985 141
769 3300049742 Ga0501080_0682983 Ga0501080_0682983_68_508 141
770 3300049744 Ga0501083_0002623 Ga0501083_0002623_5787_6227 141
771 3300049822 Ga0501035_0535963 Ga0501035_0535963_122_562 141
772 3300049823 Ga0501044_0202668 Ga0501044_0202668_281_709 141
773 3300049823 Ga0501044_0235188 Ga0501044_0235188_1266_1706 141
774 3300050511 nmdc:mga08y16_2052421_c1 nmdc:mga08y16_2052421_c1_40_468 141
775 3300050512 nmdc:mga0n895_217394_c1 nmdc:mga0n895_217394_c1_447_875 141
776 3300050512 nmdc:mga0n895_399039_c1 nmdc:mga0n895_399039_c1_407_838 141
777 3300050513 nmdc:mga0rr50_91268_c1 nmdc:mga0rr50_91268_c1_77_529 141
778 3300050514 nmdc:mga08x19_4495_c1 nmdc:mga08x19_4495_c1_933_1385 141
779 3300050514 nmdc:mga08x19_544375_c1 nmdc:mga08x19_544375_c1_118_546 141
780 3300050514 nmdc:mga08x19_86373_c1 nmdc:mga08x19_86373_c1_1065_1499 141
781 3300050515 nmdc:mga0a205_42957_c1 nmdc:mga0a205_42957_c1_263_691 141
782 3300053077 Ga0495601_0010085 Ga0495601_0010085_4973_5404 141
783 3300053077 Ga0495601_0020426 Ga0495601_0020426_608_1036 141
784 3300053077 Ga0495601_0020946 Ga0495601_0020946_2661_3089 141
785 3300053078 Ga0495612_0005114 Ga0495612_0005114_469_897 141
786 3300053078 Ga0495612_0105716 Ga0495612_0105716_449_877 141
787 3300053094 Ga0500566_0351867 Ga0500566_0351867_61_489 141
788 3300053134 Ga0500658_0155354 Ga0500658_0155354_134_562 141
789 3300053158 Ga0500627_0189190 Ga0500627_0189190_292_723 141
790 3300053159 Ga0500630_135918 Ga0500630_135918_264_695 141
791 3300054114 Ga0501084_0232713 Ga0501084_0232713_407_835 141
792 3300059423 Ga0590074_011785 Ga0590074_011785_698_1132 141
793 3300060353 Ga0501082_0710891 Ga0501082_0710891_234_674 141

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7517 58 99
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7327 4 107
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.6864 60 101
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6818 4 107
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.6586 1 106
ID Description Score Start End Superfamily
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7599 4 113 2.170.150.70
af_A0A0P0Y585_51_153_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7573 58 88 2.40.70.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7423 5 113 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7363 4 104 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7311 4 107 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A536YZH5-F1-model_v4 CENP-V/GFA domain-containing protein 0.9846 1 139 GO:0016846
GO:0046872
AF-F8C8H7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9812 1 141 GO:0016846
GO:0046872
AF-A0A522JPP6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9781 1 141 GO:0016846
GO:0046872
AF-A0A1U9JPG2-F1-model_v4 CENP-V/GFA domain-containing protein 0.978 1 141 GO:0016846
GO:0046872
AF-F8C8H7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9744 1 141 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.09 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map