F481050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 793 | 375 | 793 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100097908|Ga0070704_1000979084 |
| Length | 141 |
| Sequence | MLISGRCHCGNIFFALDWRPEPSEIPARACTCSFCAKHGGVWTSCPTGSLTVSVKDRTRASNAFGTKTSEFHVCAGCGVVPVVTSRIDGCLYAVVSVNAFENVEPALLRRAPATSEGESERARLSRRKRNWIADVRFEATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 215 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 222 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 250 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 251 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 367 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 370 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.67 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 87.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1007558 | 3300001977 | Bacteria | 1657 |
| 2 | JGI24743J22301_10020738 | 3300001991 | Bacteria | 1252 |
| 3 | JGI24749J21850_1011267 | 3300002076 | Bacteria | 1255 |
| 4 | JGI24744J21845_10037300 | 3300002077 | Bacteria | 916 |
| 5 | JGI24033J26618_1006993 | 3300002155 | Bacteria | 1275 |
| 6 | JGI25156J39149_1000422 | 3300002705 | Bacteria | 26284 |
| 7 | JGI25156J39149_1002686 | 3300002705 | Bacteria | 6235 |
| 8 | JGI25162J39368_1000402 | 3300002737 | Bacteria | 35934 |
| 9 | JGI25154J39366_1003396 | 3300002738 | Bacteria | 3367 |
| 10 | JGI25157J39369_1000344 | 3300002741 | Bacteria | 32837 |
| 11 | JGI25157J39369_1000452 | 3300002741 | Bacteria | 26160 |
| 12 | JGI25164J39214_1000117 | 3300002772 | Bacteria | 76695 |
| 13 | JGI25406J46586_10085542 | 3300003203 | Bacteria | 959 |
| 14 | JGI25165J46597_1000235 | 3300003214 | Bacteria | 76684 |
| 15 | rootL2_10184296 | 3300003322 | Bacteria | 2487 |
| 16 | Ga0055539_1007503 | 3300003752 | Bacteria | 1378 |
| 17 | Ga0055527_1000176 | 3300003760 | Bacteria | 43621 |
| 18 | Ga0055535_1000373 | 3300003761 | Bacteria | 42794 |
| 19 | Ga0055535_1001357 | 3300003761 | Bacteria | 12869 |
| 20 | Ga0055535_1001457 | 3300003761 | Bacteria | 11944 |
| 21 | Ga0055542_1000394 | 3300003762 | Bacteria | 43618 |
| 22 | Ga0055542_1000429 | 3300003762 | Bacteria | 40523 |
| 23 | Ga0055542_1000734 | 3300003762 | Bacteria | 25435 |
| 24 | Ga0055529_1000314 | 3300003763 | Bacteria | 55435 |
| 25 | Ga0055529_1000420 | 3300003763 | Bacteria | 43618 |
| 26 | Ga0065714_10245078 | 3300005288 | Unclassified | 787 |
| 27 | Ga0065712_10089646 | 3300005290 | Bacteria | 2460 |
| 28 | Ga0065715_10027211 | 3300005293 | Bacteria | 1511 |
| 29 | Ga0065707_10006489 | 3300005295 | Bacteria | 3037 |
| 30 | Ga0070658_10107426 | 3300005327 | Bacteria | 2309 |
| 31 | Ga0070658_10163615 | 3300005327 | Bacteria | 1867 |
| 32 | Ga0070658_10345229 | 3300005327 | Bacteria | 1273 |
| 33 | Ga0070676_10258923 | 3300005328 | Unclassified | 1164 |
| 34 | Ga0070676_10485658 | 3300005328 | Unclassified | 874 |
| 35 | Ga0070683_100003464 | 3300005329 | Bacteria | 12824 |
| 36 | Ga0070683_100025910 | 3300005329 | Bacteria | 5273 |
| 37 | Ga0070683_100082486 | 3300005329 | Unclassified | 3011 |
| 38 | Ga0070683_100357389 | 3300005329 | Bacteria | 1391 |
| 39 | Ga0070690_100047859 | 3300005330 | Unclassified | 2721 |
| 40 | Ga0070690_100048274 | 3300005330 | Bacteria | 2710 |
| 41 | Ga0070690_100316195 | 3300005330 | Unclassified | 1124 |
| 42 | Ga0070670_100032959 | 3300005331 | Bacteria | 4464 |
| 43 | Ga0070677_10151564 | 3300005333 | Unclassified | 1079 |
| 44 | Ga0068869_100026763 | 3300005334 | Bacteria | 4016 |
| 45 | Ga0068869_100170955 | 3300005334 | Bacteria | 1698 |
| 46 | Ga0068869_100194521 | 3300005334 | Bacteria | 1596 |
| 47 | Ga0070666_10011790 | 3300005335 | Bacteria | 5494 |
| 48 | Ga0070666_10021776 | 3300005335 | Bacteria | 4155 |
| 49 | Ga0070666_10022990 | 3300005335 | Bacteria | 4053 |
| 50 | Ga0070666_10136972 | 3300005335 | Bacteria | 1704 |
| 51 | Ga0070682_100977856 | 3300005337 | Bacteria | 701 |
| 52 | Ga0070682_101003966 | 3300005337 | Bacteria | 693 |
| 53 | Ga0068868_100334951 | 3300005338 | Unclassified | 1292 |
| 54 | Ga0068868_100370168 | 3300005338 | Bacteria | 1231 |
| 55 | Ga0068868_101101993 | 3300005338 | Bacteria | 730 |
| 56 | Ga0070660_100043886 | 3300005339 | Bacteria | 3417 |
| 57 | Ga0070660_100352488 | 3300005339 | Bacteria | 1212 |
| 58 | Ga0070687_100591171 | 3300005343 | Bacteria | 761 |
| 59 | Ga0070661_100003414 | 3300005344 | Bacteria | 10969 |
| 60 | Ga0070661_100025041 | 3300005344 | Bacteria | 4285 |
| 61 | Ga0070661_100051345 | 3300005344 | Bacteria | 3018 |
| 62 | Ga0070692_10021235 | 3300005345 | Bacteria | 3157 |
| 63 | Ga0070692_10037570 | 3300005345 | Bacteria | 2462 |
| 64 | Ga0070668_100949977 | 3300005347 | Bacteria | 770 |
| 65 | Ga0070669_100248271 | 3300005353 | Bacteria | 1416 |
| 66 | Ga0070669_100293418 | 3300005353 | Bacteria | 1306 |
| 67 | Ga0070669_101338911 | 3300005353 | Unclassified | 620 |
| 68 | Ga0070675_100293758 | 3300005354 | Bacteria | 1430 |
| 69 | Ga0070671_100180737 | 3300005355 | Bacteria | 1786 |
| 70 | Ga0070671_100232292 | 3300005355 | Bacteria | 1565 |
| 71 | Ga0070671_100448204 | 3300005355 | Bacteria | 1107 |
| 72 | Ga0070671_101266504 | 3300005355 | Bacteria | 650 |
| 73 | Ga0070674_100009860 | 3300005356 | Bacteria | 5744 |
| 74 | Ga0070674_100093255 | 3300005356 | Bacteria | 2178 |
| 75 | Ga0070673_100164482 | 3300005364 | Bacteria | 1889 |
| 76 | Ga0070673_100509329 | 3300005364 | Unclassified | 1089 |
| 77 | Ga0070673_100606181 | 3300005364 | Bacteria | 999 |
| 78 | Ga0070673_101141041 | 3300005364 | Unclassified | 729 |
| 79 | Ga0070673_101263127 | 3300005364 | Unclassified | 693 |
| 80 | Ga0070688_100009252 | 3300005365 | Bacteria | 5378 |
| 81 | Ga0070688_100176149 | 3300005365 | Bacteria | 1480 |
| 82 | Ga0070659_100019972 | 3300005366 | Bacteria | 5086 |
| 83 | Ga0070659_100257812 | 3300005366 | Bacteria | 1446 |
| 84 | Ga0070659_100580793 | 3300005366 | Bacteria | 962 |
| 85 | Ga0070667_100002375 | 3300005367 | Bacteria | 16490 |
| 86 | Ga0070667_100011716 | 3300005367 | Bacteria | 7246 |
| 87 | Ga0070667_100102615 | 3300005367 | Bacteria | 2472 |
| 88 | Ga0070667_100418160 | 3300005367 | Unclassified | 1222 |
| 89 | Ga0070667_102026964 | 3300005367 | Unclassified | 542 |
| 90 | Ga0070703_10062236 | 3300005406 | Bacteria | 1224 |
| 91 | Ga0070709_10014153 | 3300005434 | Bacteria | 4506 |
| 92 | Ga0070709_10391042 | 3300005434 | Bacteria | 1036 |
| 93 | Ga0070709_11261766 | 3300005434 | Bacteria | 595 |
| 94 | Ga0070714_100008518 | 3300005435 | Bacteria | 8016 |
| 95 | Ga0070714_100042466 | 3300005435 | Bacteria | 3842 |
| 96 | Ga0070714_100514706 | 3300005435 | Bacteria | 1142 |
| 97 | Ga0070714_101701944 | 3300005435 | Unclassified | 616 |
| 98 | Ga0070713_100782981 | 3300005436 | Bacteria | 914 |
| 99 | Ga0070701_10637746 | 3300005438 | Bacteria | 710 |
| 100 | Ga0070701_10739669 | 3300005438 | Bacteria | 665 |
| 101 | Ga0070705_101004722 | 3300005440 | Bacteria | 677 |
| 102 | Ga0070700_100029662 | 3300005441 | Bacteria | 3263 |
| 103 | Ga0070700_100882965 | 3300005441 | Unclassified | 727 |
| 104 | Ga0070694_100117108 | 3300005444 | Bacteria | 1907 |
| 105 | Ga0070694_100203647 | 3300005444 | Bacteria | 1476 |
| 106 | Ga0070708_100688920 | 3300005445 | Bacteria | 962 |
| 107 | Ga0070663_100041181 | 3300005455 | Bacteria | 3238 |
| 108 | Ga0070678_100003914 | 3300005456 | Bacteria | 8372 |
| 109 | Ga0070678_100242295 | 3300005456 | Bacteria | 1508 |
| 110 | Ga0070678_100603462 | 3300005456 | Bacteria | 980 |
| 111 | Ga0070678_100913043 | 3300005456 | Bacteria | 803 |
| 112 | Ga0070662_100097562 | 3300005457 | Bacteria | 2218 |
| 113 | Ga0070662_100317083 | 3300005457 | Bacteria | 1270 |
| 114 | Ga0070662_100510172 | 3300005457 | Bacteria | 1004 |
| 115 | Ga0070681_10165120 | 3300005458 | Bacteria | 2137 |
| 116 | Ga0070681_10209064 | 3300005458 | Bacteria | 1868 |
| 117 | Ga0070681_10990304 | 3300005458 | Unclassified | 760 |
| 118 | Ga0070681_11176051 | 3300005458 | Bacteria | 689 |
| 119 | Ga0068867_100000972 | 3300005459 | Bacteria | 19561 |
| 120 | Ga0068867_100477680 | 3300005459 | Unclassified | 1067 |
| 121 | Ga0068867_100488254 | 3300005459 | Bacteria | 1056 |
| 122 | Ga0070685_10003125 | 3300005466 | Bacteria | 8420 |
| 123 | Ga0070706_100004142 | 3300005467 | Bacteria | 14100 |
| 124 | Ga0070698_100120422 | 3300005471 | Unclassified | 2585 |
| 125 | Ga0070699_101754439 | 3300005518 | Bacteria | 568 |
| 126 | Ga0070679_100304129 | 3300005530 | Bacteria | 1545 |
| 127 | Ga0070679_100421460 | 3300005530 | Bacteria | 1280 |
| 128 | Ga0070684_100045842 | 3300005535 | Bacteria | 3787 |
| 129 | Ga0070684_100244768 | 3300005535 | Bacteria | 1639 |
| 130 | Ga0070684_100713366 | 3300005535 | Bacteria | 935 |
| 131 | Ga0070697_100006292 | 3300005536 | Bacteria | 9189 |
| 132 | Ga0070697_101395056 | 3300005536 | Bacteria | 626 |
| 133 | Ga0068853_100024919 | 3300005539 | Bacteria | 5020 |
| 134 | Ga0068853_100029510 | 3300005539 | Bacteria | 4625 |
| 135 | Ga0070672_100018183 | 3300005543 | Bacteria | 5075 |
| 136 | Ga0070672_101055550 | 3300005543 | Bacteria | 721 |
| 137 | Ga0070686_100013353 | 3300005544 | Bacteria | 4699 |
| 138 | Ga0070695_100057747 | 3300005545 | Bacteria | 2508 |
| 139 | Ga0070695_100721366 | 3300005545 | Bacteria | 793 |
| 140 | Ga0070696_100219854 | 3300005546 | Bacteria | 1425 |
| 141 | Ga0070696_101766458 | 3300005546 | Bacteria | 534 |
| 142 | Ga0070693_100121360 | 3300005547 | Bacteria | 1621 |
| 143 | Ga0070693_100152035 | 3300005547 | Bacteria | 1467 |
| 144 | Ga0070693_100265291 | 3300005547 | Bacteria | 1144 |
| 145 | Ga0070693_100441979 | 3300005547 | Bacteria | 911 |
| 146 | Ga0070665_100002162 | 3300005548 | Bacteria | 21925 |
| 147 | Ga0070665_100063714 | 3300005548 | Bacteria | 3696 |
| 148 | Ga0070665_100165548 | 3300005548 | Bacteria | 2213 |
| 149 | Ga0070665_101076639 | 3300005548 | Unclassified | 815 |
| 150 | Ga0070665_101195281 | 3300005548 | Unclassified | 771 |
| 151 | Ga0070704_100097908 | 3300005549 | Bacteria | 2203 |
| 152 | Ga0070704_100401299 | 3300005549 | Bacteria | 1170 |
| 153 | Ga0068855_100260077 | 3300005563 | Bacteria | 1934 |
| 154 | Ga0068855_100273060 | 3300005563 | Bacteria | 1880 |
| 155 | Ga0068855_100430672 | 3300005563 | Bacteria | 1442 |
| 156 | Ga0068855_100500166 | 3300005563 | Bacteria | 1321 |
| 157 | Ga0068855_101320896 | 3300005563 | Bacteria | 746 |
| 158 | Ga0068855_101959031 | 3300005563 | Bacteria | 592 |
| 159 | Ga0070664_100070162 | 3300005564 | Bacteria | 3000 |
| 160 | Ga0070664_100163183 | 3300005564 | Bacteria | 1972 |
| 161 | Ga0070664_100401528 | 3300005564 | Bacteria | 1253 |
| 162 | Ga0068857_100000326 | 3300005577 | Bacteria | 32742 |
| 163 | Ga0068857_100054631 | 3300005577 | Bacteria | 3544 |
| 164 | Ga0068857_100622968 | 3300005577 | Bacteria | 1021 |
| 165 | Ga0068854_100042838 | 3300005578 | Bacteria | 3205 |
| 166 | Ga0068854_100068312 | 3300005578 | Bacteria | 2591 |
| 167 | Ga0068854_100073728 | 3300005578 | Bacteria | 2502 |
| 168 | Ga0068854_100082771 | 3300005578 | Bacteria | 2372 |
| 169 | Ga0068854_100141979 | 3300005578 | Bacteria | 1844 |
| 170 | Ga0068856_100009494 | 3300005614 | Bacteria | 9446 |
| 171 | Ga0068856_100018785 | 3300005614 | Bacteria | 6704 |
| 172 | Ga0068856_100062403 | 3300005614 | Bacteria | 3681 |
| 173 | Ga0068856_100486292 | 3300005614 | Bacteria | 1255 |
| 174 | Ga0068852_100008993 | 3300005616 | Bacteria | 7394 |
| 175 | Ga0068852_100012746 | 3300005616 | Bacteria | 6400 |
| 176 | Ga0068852_100029985 | 3300005616 | Bacteria | 4473 |
| 177 | Ga0068852_100040930 | 3300005616 | Bacteria | 3913 |
| 178 | Ga0068852_100041158 | 3300005616 | Bacteria | 3903 |
| 179 | Ga0068852_100077840 | 3300005616 | Bacteria | 2933 |
| 180 | Ga0068859_100045135 | 3300005617 | Bacteria | 4428 |
| 181 | Ga0068859_100068339 | 3300005617 | Bacteria | 3587 |
| 182 | Ga0068859_100225195 | 3300005617 | Bacteria | 1963 |
| 183 | Ga0068859_100624374 | 3300005617 | Bacteria | 1170 |
| 184 | Ga0068859_101031056 | 3300005617 | Unclassified | 904 |
| 185 | Ga0068864_100223733 | 3300005618 | Bacteria | 1737 |
| 186 | Ga0068864_100239894 | 3300005618 | Bacteria | 1679 |
| 187 | Ga0068861_100001475 | 3300005719 | Bacteria | 14922 |
| 188 | Ga0068851_10014726 | 3300005834 | Unclassified | 3717 |
| 189 | Ga0068851_10052504 | 3300005834 | Bacteria | 2072 |
| 190 | Ga0068870_10007140 | 3300005840 | Bacteria | 4968 |
| 191 | Ga0068870_10284449 | 3300005840 | Unclassified | 1038 |
| 192 | Ga0068863_100001209 | 3300005841 | Bacteria | 25805 |
| 193 | Ga0068863_100077461 | 3300005841 | Bacteria | 3147 |
| 194 | Ga0068863_100089587 | 3300005841 | Bacteria | 2917 |
| 195 | Ga0068863_100420079 | 3300005841 | Unclassified | 1310 |
| 196 | Ga0068863_100814101 | 3300005841 | Bacteria | 932 |
| 197 | Ga0068858_100015154 | 3300005842 | Bacteria | 7250 |
| 198 | Ga0068858_100255585 | 3300005842 | Bacteria | 1665 |
| 199 | Ga0068858_101187026 | 3300005842 | Unclassified | 750 |
| 200 | Ga0068860_100003093 | 3300005843 | Bacteria | 17217 |
| 201 | Ga0068860_100010328 | 3300005843 | Bacteria | 9232 |
| 202 | Ga0068860_100058142 | 3300005843 | Bacteria | 3676 |
| 203 | Ga0068860_100392001 | 3300005843 | Bacteria | 1372 |
| 204 | Ga0068862_100041253 | 3300005844 | Bacteria | 3926 |
| 205 | Ga0068862_100129847 | 3300005844 | Bacteria | 2228 |
| 206 | Ga0068862_100288476 | 3300005844 | Bacteria | 1506 |
| 207 | Ga0068862_100542586 | 3300005844 | Bacteria | 1109 |
| 208 | Ga0081455_10322416 | 3300005937 | Bacteria | 1100 |
| 209 | Ga0081539_10001060 | 3300005985 | Bacteria | 50269 |
| 210 | Ga0070715_10033608 | 3300006163 | Bacteria | 2097 |
| 211 | Ga0070716_100022733 | 3300006173 | Bacteria | 3317 |
| 212 | Ga0070712_100126840 | 3300006175 | Bacteria | 1929 |
| 213 | Ga0070712_100405948 | 3300006175 | Bacteria | 1126 |
| 214 | Ga0097621_101073359 | 3300006237 | Unclassified | 755 |
| 215 | Ga0068871_100008475 | 3300006358 | Bacteria | 7395 |
| 216 | Ga0068871_100100426 | 3300006358 | Bacteria | 2424 |
| 217 | Ga0068871_100877540 | 3300006358 | Bacteria | 830 |
| 218 | Ga0075433_10746566 | 3300006852 | Bacteria | 856 |
| 219 | Ga0075433_11181822 | 3300006852 | Bacteria | 664 |
| 220 | Ga0075434_100254337 | 3300006871 | Bacteria | 1776 |
| 221 | Ga0075434_100402127 | 3300006871 | Bacteria | 1390 |
| 222 | Ga0075434_100657747 | 3300006871 | Unclassified | 1066 |
| 223 | Ga0075434_101830962 | 3300006871 | Bacteria | 614 |
| 224 | Ga0068865_100002022 | 3300006881 | Bacteria | 11969 |
| 225 | Ga0068865_100059254 | 3300006881 | Bacteria | 2677 |
| 226 | Ga0068865_100500331 | 3300006881 | Bacteria | 1013 |
| 227 | Ga0068865_102172513 | 3300006881 | Bacteria | 505 |
| 228 | Ga0075436_100002182 | 3300006914 | Bacteria | 13495 |
| 229 | Ga0075436_100003801 | 3300006914 | Bacteria | 10357 |
| 230 | Ga0075436_100404014 | 3300006914 | Bacteria | 990 |
| 231 | Ga0097620_100045135 | 3300006931 | Bacteria | 4428 |
| 232 | Ga0097620_100068344 | 3300006931 | Bacteria | 3587 |
| 233 | Ga0097620_100225199 | 3300006931 | Bacteria | 1963 |
| 234 | Ga0097620_100624386 | 3300006931 | Bacteria | 1170 |
| 235 | Ga0097620_101030968 | 3300006931 | Unclassified | 904 |
| 236 | Ga0075435_100081101 | 3300007076 | Bacteria | 2664 |
| 237 | Ga0075435_100082677 | 3300007076 | Bacteria | 2640 |
| 238 | Ga0105240_10015929 | 3300009093 | Bacteria | 10197 |
| 239 | Ga0105240_10043124 | 3300009093 | Bacteria | 5743 |
| 240 | Ga0105240_10135863 | 3300009093 | Bacteria | 2945 |
| 241 | Ga0105240_10610206 | 3300009093 | Bacteria | 1200 |
| 242 | Ga0111539_10583046 | 3300009094 | Bacteria | 1302 |
| 243 | Ga0111539_10930291 | 3300009094 | Bacteria | 1011 |
| 244 | Ga0111539_11825661 | 3300009094 | Bacteria | 705 |
| 245 | Ga0105245_10545935 | 3300009098 | Bacteria | 1180 |
| 246 | Ga0105245_10977201 | 3300009098 | Bacteria | 890 |
| 247 | Ga0105245_12024563 | 3300009098 | Bacteria | 629 |
| 248 | Ga0105247_10137500 | 3300009101 | Bacteria | 1598 |
| 249 | Ga0105247_10274953 | 3300009101 | Bacteria | 1160 |
| 250 | Ga0105247_10385720 | 3300009101 | Unclassified | 995 |
| 251 | Ga0114129_10825660 | 3300009147 | Bacteria | 1180 |
| 252 | Ga0105243_10102966 | 3300009148 | Bacteria | 2373 |
| 253 | Ga0105243_10640941 | 3300009148 | Bacteria | 1028 |
| 254 | Ga0105243_10932940 | 3300009148 | Bacteria | 866 |
| 255 | Ga0105241_10064038 | 3300009174 | Bacteria | 2838 |
| 256 | Ga0105241_10446717 | 3300009174 | Bacteria | 1143 |
| 257 | Ga0105241_10519560 | 3300009174 | Bacteria | 1064 |
| 258 | Ga0105242_10017478 | 3300009176 | Bacteria | 5590 |
| 259 | Ga0105242_10755552 | 3300009176 | Bacteria | 958 |
| 260 | Ga0105242_11056370 | 3300009176 | Unclassified | 823 |
| 261 | Ga0105242_11213531 | 3300009176 | Bacteria | 774 |
| 262 | Ga0105248_10097107 | 3300009177 | Bacteria | 3319 |
| 263 | Ga0105248_10398106 | 3300009177 | Bacteria | 1551 |
| 264 | Ga0105248_10496639 | 3300009177 | Bacteria | 1375 |
| 265 | Ga0105237_10050461 | 3300009545 | Bacteria | 4180 |
| 266 | Ga0105237_10138562 | 3300009545 | Bacteria | 2428 |
| 267 | Ga0105237_10847938 | 3300009545 | Bacteria | 921 |
| 268 | Ga0105238_10001691 | 3300009551 | Bacteria | 22202 |
| 269 | Ga0105238_10250523 | 3300009551 | Bacteria | 1749 |
| 270 | Ga0105238_10773008 | 3300009551 | Unclassified | 975 |
| 271 | Ga0105238_12016354 | 3300009551 | Bacteria | 611 |
| 272 | Ga0105249_10437597 | 3300009553 | Bacteria | 1344 |
| 273 | Ga0105249_10484395 | 3300009553 | Unclassified | 1280 |
| 274 | Ga0105249_12287212 | 3300009553 | Bacteria | 613 |
| 275 | Ga0105239_10359672 | 3300010375 | Unclassified | 1644 |
| 276 | Ga0105239_10430395 | 3300010375 | Bacteria | 1496 |
| 277 | Ga0105239_10454722 | 3300010375 | Bacteria | 1453 |
| 278 | Ga0105239_11036072 | 3300010375 | Bacteria | 944 |
| 279 | Ga0105246_10264782 | 3300011119 | Bacteria | 1371 |
| 280 | Ga0105246_10798193 | 3300011119 | Bacteria | 837 |
| 281 | Ga0105246_10830229 | 3300011119 | Unclassified | 823 |
| 282 | Ga0105246_11391362 | 3300011119 | Bacteria | 654 |
| 283 | Ga0157373_10016576 | 3300013100 | Bacteria | 5372 |
| 284 | Ga0157373_10109438 | 3300013100 | Bacteria | 1943 |
| 285 | Ga0157373_10286346 | 3300013100 | Bacteria | 1168 |
| 286 | Ga0157373_10427991 | 3300013100 | Unclassified | 951 |
| 287 | Ga0157371_10488444 | 3300013102 | Bacteria | 908 |
| 288 | Ga0157370_10224406 | 3300013104 | Bacteria | 1740 |
| 289 | Ga0157370_10612529 | 3300013104 | Bacteria | 996 |
| 290 | Ga0157369_10018256 | 3300013105 | Bacteria | 7867 |
| 291 | Ga0157369_10036084 | 3300013105 | Bacteria | 5419 |
| 292 | Ga0157369_10603273 | 3300013105 | Bacteria | 1133 |
| 293 | Ga0157374_10006253 | 3300013296 | Bacteria | 10101 |
| 294 | Ga0157374_10074892 | 3300013296 | Bacteria | 3198 |
| 295 | Ga0157374_10087010 | 3300013296 | Bacteria | 2974 |
| 296 | Ga0157374_10119604 | 3300013296 | Bacteria | 2541 |
| 297 | Ga0157374_10648193 | 3300013296 | Unclassified | 1068 |
| 298 | Ga0157374_12034314 | 3300013296 | Bacteria | 601 |
| 299 | Ga0157378_10004305 | 3300013297 | Bacteria | 12535 |
| 300 | Ga0157378_10013363 | 3300013297 | Bacteria | 7175 |
| 301 | Ga0157378_10099232 | 3300013297 | Bacteria | 2656 |
| 302 | Ga0157378_10117837 | 3300013297 | Bacteria | 2443 |
| 303 | Ga0157378_10720271 | 3300013297 | Unclassified | 1018 |
| 304 | Ga0157378_10762121 | 3300013297 | Unclassified | 991 |
| 305 | Ga0157378_11156194 | 3300013297 | Bacteria | 812 |
| 306 | Ga0163162_10010945 | 3300013306 | Bacteria | 8833 |
| 307 | Ga0163162_10027941 | 3300013306 | Bacteria | 5580 |
| 308 | Ga0163162_10672689 | 3300013306 | Bacteria | 1158 |
| 309 | Ga0163162_10788824 | 3300013306 | Bacteria | 1068 |
| 310 | Ga0157372_10001402 | 3300013307 | Bacteria | 25982 |
| 311 | Ga0157372_10013916 | 3300013307 | Bacteria | 8597 |
| 312 | Ga0157372_10135958 | 3300013307 | Bacteria | 2830 |
| 313 | Ga0157372_10151943 | 3300013307 | Bacteria | 2673 |
| 314 | Ga0157372_10199667 | 3300013307 | Bacteria | 2316 |
| 315 | Ga0157375_10068642 | 3300013308 | Bacteria | 3548 |
| 316 | Ga0157375_10189409 | 3300013308 | Bacteria | 2211 |
| 317 | Ga0157375_10295469 | 3300013308 | Unclassified | 1783 |
| 318 | Ga0163163_10015144 | 3300014325 | Bacteria | 7120 |
| 319 | Ga0163163_10970658 | 3300014325 | Unclassified | 913 |
| 320 | Ga0182008_10002400 | 3300014497 | Bacteria | 11778 |
| 321 | Ga0182008_10222319 | 3300014497 | Bacteria | 966 |
| 322 | Ga0182008_10684357 | 3300014497 | Unclassified | 584 |
| 323 | Ga0157377_10385437 | 3300014745 | Bacteria | 950 |
| 324 | Ga0157377_10578002 | 3300014745 | Bacteria | 798 |
| 325 | Ga0157379_10237318 | 3300014968 | Bacteria | 1653 |
| 326 | Ga0157379_10826622 | 3300014968 | Unclassified | 875 |
| 327 | Ga0157376_10005225 | 3300014969 | Bacteria | 9064 |
| 328 | Ga0157376_10195117 | 3300014969 | Bacteria | 1859 |
| 329 | Ga0182006_1086248 | 3300015261 | Bacteria | 1137 |
| 330 | Ga0182007_10000225 | 3300015262 | Bacteria | 37944 |
| 331 | Ga0182005_1067500 | 3300015265 | Bacteria | 980 |
| 332 | Ga0163161_10090859 | 3300017792 | Bacteria | 2259 |
| 333 | Ga0163161_10095622 | 3300017792 | Bacteria | 2204 |
| 334 | Ga0163161_10280852 | 3300017792 | Bacteria | 1306 |
| 335 | Ga0163161_10325319 | 3300017792 | Bacteria | 1216 |
| 336 | Ga0163161_10924557 | 3300017792 | Bacteria | 740 |
| 337 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 338 | Ga0213872_10000163 | 3300021361 | Bacteria | 61122 |
| 339 | Ga0209674_100197 | 3300025226 | Bacteria | 62877 |
| 340 | Ga0209674_100550 | 3300025226 | Bacteria | 14925 |
| 341 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 342 | Ga0209672_100089 | 3300025228 | Bacteria | 120658 |
| 343 | Ga0207427_100051 | 3300025231 | Bacteria | 218792 |
| 344 | Ga0209437_100152 | 3300025233 | Bacteria | 154551 |
| 345 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 346 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 347 | Ga0209258_100090 | 3300025242 | Bacteria | 232619 |
| 348 | Ga0209258_100101 | 3300025242 | Bacteria | 210252 |
| 349 | Ga0209646_1010457 | 3300025246 | Bacteria | 1453 |
| 350 | Ga0209026_1000294 | 3300025250 | Bacteria | 55402 |
| 351 | Ga0209677_100976 | 3300025253 | Bacteria | 13869 |
| 352 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 353 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 354 | Ga0209148_1000079 | 3300025254 | Bacteria | 288992 |
| 355 | Ga0209759_1000165 | 3300025256 | Bacteria | 113117 |
| 356 | Ga0209759_1000449 | 3300025256 | Bacteria | 47711 |
| 357 | Ga0209233_1000099 | 3300025261 | Bacteria | 293995 |
| 358 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 359 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 360 | Ga0209455_1003591 | 3300025272 | Bacteria | 5411 |
| 361 | Ga0207697_10006661 | 3300025315 | Bacteria | 5204 |
| 362 | Ga0207656_10053200 | 3300025321 | Bacteria | 1756 |
| 363 | Ga0207656_10193070 | 3300025321 | Bacteria | 981 |
| 364 | Ga0207682_10001376 | 3300025893 | Bacteria | 11224 |
| 365 | Ga0207692_10005132 | 3300025898 | Bacteria | 5225 |
| 366 | Ga0207692_10238084 | 3300025898 | Bacteria | 1086 |
| 367 | Ga0207680_10010766 | 3300025903 | Bacteria | 4589 |
| 368 | Ga0207680_10031055 | 3300025903 | Bacteria | 3022 |
| 369 | Ga0207680_10126455 | 3300025903 | Bacteria | 1679 |
| 370 | Ga0207680_10127575 | 3300025903 | Bacteria | 1672 |
| 371 | Ga0207647_10002041 | 3300025904 | Bacteria | 15436 |
| 372 | Ga0207685_10114061 | 3300025905 | Bacteria | 1176 |
| 373 | Ga0207699_10080050 | 3300025906 | Bacteria | 2023 |
| 374 | Ga0207645_10211491 | 3300025907 | Bacteria | 1277 |
| 375 | Ga0207645_10477290 | 3300025907 | Bacteria | 843 |
| 376 | Ga0207645_10555372 | 3300025907 | Bacteria | 779 |
| 377 | Ga0207643_10343970 | 3300025908 | Bacteria | 935 |
| 378 | Ga0207705_10229565 | 3300025909 | Bacteria | 1411 |
| 379 | Ga0207684_10065597 | 3300025910 | Bacteria | 3083 |
| 380 | Ga0207684_10111746 | 3300025910 | Bacteria | 2339 |
| 381 | Ga0207684_10112125 | 3300025910 | Bacteria | 2335 |
| 382 | Ga0207654_10025864 | 3300025911 | Bacteria | 3172 |
| 383 | Ga0207654_10065161 | 3300025911 | Bacteria | 2144 |
| 384 | Ga0207654_10210426 | 3300025911 | Bacteria | 1285 |
| 385 | Ga0207707_10086551 | 3300025912 | Bacteria | 2738 |
| 386 | Ga0207707_10195489 | 3300025912 | Bacteria | 1764 |
| 387 | Ga0207707_10411794 | 3300025912 | Bacteria | 1160 |
| 388 | Ga0207695_10004315 | 3300025913 | Bacteria | 19489 |
| 389 | Ga0207695_10037880 | 3300025913 | Bacteria | 5200 |
| 390 | Ga0207695_10069691 | 3300025913 | Bacteria | 3597 |
| 391 | Ga0207695_11075378 | 3300025913 | Bacteria | 684 |
| 392 | Ga0207671_10001967 | 3300025914 | Bacteria | 22671 |
| 393 | Ga0207693_10117198 | 3300025915 | Bacteria | 2091 |
| 394 | Ga0207693_10233690 | 3300025915 | Bacteria | 1444 |
| 395 | Ga0207663_10158917 | 3300025916 | Bacteria | 1593 |
| 396 | Ga0207663_10261507 | 3300025916 | Bacteria | 1278 |
| 397 | Ga0207663_10639702 | 3300025916 | Bacteria | 839 |
| 398 | Ga0207660_10859090 | 3300025917 | Unclassified | 740 |
| 399 | Ga0207657_10016926 | 3300025919 | Bacteria | 7015 |
| 400 | Ga0207657_10060723 | 3300025919 | Bacteria | 3243 |
| 401 | Ga0207657_10181521 | 3300025919 | Bacteria | 1701 |
| 402 | Ga0207649_10003824 | 3300025920 | Bacteria | 8209 |
| 403 | Ga0207649_10052176 | 3300025920 | Bacteria | 2536 |
| 404 | Ga0207649_10098218 | 3300025920 | Bacteria | 1932 |
| 405 | Ga0207649_10205341 | 3300025920 | Bacteria | 1394 |
| 406 | Ga0207649_11082204 | 3300025920 | Bacteria | 632 |
| 407 | Ga0207652_10103390 | 3300025921 | Bacteria | 2518 |
| 408 | Ga0207652_10296919 | 3300025921 | Bacteria | 1458 |
| 409 | Ga0207646_11579509 | 3300025922 | Unclassified | 566 |
| 410 | Ga0207681_10233523 | 3300025923 | Bacteria | 1428 |
| 411 | Ga0207694_10016968 | 3300025924 | Bacteria | 5500 |
| 412 | Ga0207694_10106953 | 3300025924 | Bacteria | 2222 |
| 413 | Ga0207694_10730288 | 3300025924 | Bacteria | 836 |
| 414 | Ga0207650_10030941 | 3300025925 | Bacteria | 3861 |
| 415 | Ga0207650_10218977 | 3300025925 | Bacteria | 1531 |
| 416 | Ga0207659_10031067 | 3300025926 | Bacteria | 3653 |
| 417 | Ga0207687_10027388 | 3300025927 | Bacteria | 3824 |
| 418 | Ga0207700_10259433 | 3300025928 | Bacteria | 1487 |
| 419 | Ga0207664_10021580 | 3300025929 | Bacteria | 4792 |
| 420 | Ga0207664_10024484 | 3300025929 | Bacteria | 4536 |
| 421 | Ga0207664_11180427 | 3300025929 | Bacteria | 683 |
| 422 | Ga0207644_10176701 | 3300025931 | Unclassified | 1671 |
| 423 | Ga0207644_10226831 | 3300025931 | Bacteria | 1483 |
| 424 | Ga0207644_10584598 | 3300025931 | Unclassified | 926 |
| 425 | Ga0207690_10583142 | 3300025932 | Bacteria | 911 |
| 426 | Ga0207706_10204462 | 3300025933 | Bacteria | 1732 |
| 427 | Ga0207706_10457347 | 3300025933 | Bacteria | 1104 |
| 428 | Ga0207706_11120903 | 3300025933 | Unclassified | 657 |
| 429 | Ga0207709_10388111 | 3300025935 | Bacteria | 1064 |
| 430 | Ga0207709_10456495 | 3300025935 | Bacteria | 989 |
| 431 | Ga0207669_10028296 | 3300025937 | Bacteria | 3082 |
| 432 | Ga0207669_10069073 | 3300025937 | Bacteria | 2209 |
| 433 | Ga0207704_10172505 | 3300025938 | Bacteria | 1553 |
| 434 | Ga0207704_10298455 | 3300025938 | Unclassified | 1233 |
| 435 | Ga0207704_10367795 | 3300025938 | Bacteria | 1125 |
| 436 | Ga0207691_10041207 | 3300025940 | Bacteria | 4264 |
| 437 | Ga0207691_10116859 | 3300025940 | Bacteria | 2367 |
| 438 | Ga0207691_10205823 | 3300025940 | Bacteria | 1711 |
| 439 | Ga0207711_10001632 | 3300025941 | Bacteria | 20702 |
| 440 | Ga0207711_10338023 | 3300025941 | Bacteria | 1393 |
| 441 | Ga0207711_10360409 | 3300025941 | Bacteria | 1347 |
| 442 | Ga0207689_10006092 | 3300025942 | Bacteria | 10666 |
| 443 | Ga0207689_10007213 | 3300025942 | Bacteria | 9764 |
| 444 | Ga0207689_10039336 | 3300025942 | Bacteria | 3915 |
| 445 | Ga0207689_10046845 | 3300025942 | Bacteria | 3571 |
| 446 | Ga0207661_10038131 | 3300025944 | Bacteria | 3764 |
| 447 | Ga0207661_10365712 | 3300025944 | Bacteria | 1303 |
| 448 | Ga0207679_10007632 | 3300025945 | Bacteria | 6871 |
| 449 | Ga0207679_10024072 | 3300025945 | Bacteria | 4171 |
| 450 | Ga0207679_10104704 | 3300025945 | Bacteria | 2220 |
| 451 | Ga0207667_10021483 | 3300025949 | Bacteria | 7150 |
| 452 | Ga0207667_10049769 | 3300025949 | Bacteria | 4424 |
| 453 | Ga0207667_10091823 | 3300025949 | Bacteria | 3136 |
| 454 | Ga0207667_10465221 | 3300025949 | Bacteria | 1284 |
| 455 | Ga0207667_10675614 | 3300025949 | Bacteria | 1037 |
| 456 | Ga0207651_10195168 | 3300025960 | Bacteria | 1618 |
| 457 | Ga0207651_10534442 | 3300025960 | Bacteria | 1018 |
| 458 | Ga0207651_10632237 | 3300025960 | Unclassified | 938 |
| 459 | Ga0207651_11019928 | 3300025960 | Bacteria | 740 |
| 460 | Ga0207712_10076717 | 3300025961 | Bacteria | 2420 |
| 461 | Ga0207668_10020310 | 3300025972 | Bacteria | 4218 |
| 462 | Ga0207668_10721481 | 3300025972 | Bacteria | 877 |
| 463 | Ga0207640_10033678 | 3300025981 | Bacteria | 3190 |
| 464 | Ga0207640_10101086 | 3300025981 | Bacteria | 2022 |
| 465 | Ga0207640_10236284 | 3300025981 | Bacteria | 1409 |
| 466 | Ga0207640_10284688 | 3300025981 | Bacteria | 1300 |
| 467 | Ga0207658_10001646 | 3300025986 | Bacteria | 17075 |
| 468 | Ga0207658_10488004 | 3300025986 | Bacteria | 1096 |
| 469 | Ga0207658_11901723 | 3300025986 | Unclassified | 542 |
| 470 | Ga0207677_10036448 | 3300026023 | Bacteria | 3206 |
| 471 | Ga0207677_10059006 | 3300026023 | Bacteria | 2645 |
| 472 | Ga0207677_10090597 | 3300026023 | Bacteria | 2223 |
| 473 | Ga0207677_10225256 | 3300026023 | Unclassified | 1506 |
| 474 | Ga0207677_10269330 | 3300026023 | Bacteria | 1392 |
| 475 | Ga0207703_10010103 | 3300026035 | Bacteria | 7397 |
| 476 | Ga0207703_10093670 | 3300026035 | Bacteria | 2530 |
| 477 | Ga0207703_10177774 | 3300026035 | Bacteria | 1876 |
| 478 | Ga0207703_10202419 | 3300026035 | Bacteria | 1765 |
| 479 | Ga0207639_10064678 | 3300026041 | Bacteria | 2836 |
| 480 | Ga0207639_10117882 | 3300026041 | Bacteria | 2176 |
| 481 | Ga0207639_10181849 | 3300026041 | Bacteria | 1789 |
| 482 | Ga0207639_10716042 | 3300026041 | Bacteria | 929 |
| 483 | Ga0207678_10625799 | 3300026067 | Bacteria | 945 |
| 484 | Ga0207702_10011615 | 3300026078 | Bacteria | 7339 |
| 485 | Ga0207702_10041675 | 3300026078 | Bacteria | 3850 |
| 486 | Ga0207702_10065195 | 3300026078 | Bacteria | 3119 |
| 487 | Ga0207702_10196080 | 3300026078 | Bacteria | 1869 |
| 488 | Ga0207702_10687283 | 3300026078 | Bacteria | 1008 |
| 489 | Ga0207702_11927376 | 3300026078 | Unclassified | 582 |
| 490 | Ga0207648_10000584 | 3300026089 | Bacteria | 40877 |
| 491 | Ga0207648_10065781 | 3300026089 | Bacteria | 3161 |
| 492 | Ga0207648_10097042 | 3300026089 | Bacteria | 2579 |
| 493 | Ga0207648_10258224 | 3300026089 | Bacteria | 1554 |
| 494 | Ga0207648_11019406 | 3300026089 | Unclassified | 775 |
| 495 | Ga0207676_10761978 | 3300026095 | Bacteria | 942 |
| 496 | Ga0207674_10000180 | 3300026116 | Bacteria | 77710 |
| 497 | Ga0207674_10378082 | 3300026116 | Bacteria | 1369 |
| 498 | Ga0207674_10699996 | 3300026116 | Bacteria | 978 |
| 499 | Ga0207675_100001346 | 3300026118 | Bacteria | 24652 |
| 500 | Ga0207675_100003447 | 3300026118 | Bacteria | 15462 |
| 501 | Ga0207683_10018175 | 3300026121 | Bacteria | 5996 |
| 502 | Ga0207683_10366952 | 3300026121 | Bacteria | 1322 |
| 503 | Ga0207683_10497753 | 3300026121 | Unclassified | 1125 |
| 504 | Ga0207698_10014775 | 3300026142 | Bacteria | 5204 |
| 505 | Ga0207698_10138604 | 3300026142 | Unclassified | 2091 |
| 506 | Ga0207428_10021199 | 3300027907 | Bacteria | 5504 |
| 507 | Ga0207428_11006721 | 3300027907 | Bacteria | 585 |
| 508 | Ga0268266_10058477 | 3300028379 | Bacteria | 3319 |
| 509 | Ga0268266_10276030 | 3300028379 | Bacteria | 1561 |
| 510 | Ga0268266_11724988 | 3300028379 | Unclassified | 601 |
| 511 | Ga0268265_10052583 | 3300028380 | Bacteria | 3081 |
| 512 | Ga0268265_10066305 | 3300028380 | Bacteria | 2790 |
| 513 | Ga0268265_10619080 | 3300028380 | Bacteria | 1037 |
| 514 | Ga0268264_10018918 | 3300028381 | Bacteria | 5631 |
| 515 | Ga0268264_10143956 | 3300028381 | Bacteria | 2129 |
| 516 | Ga0268264_10223578 | 3300028381 | Bacteria | 1734 |
| 517 | Ga0268264_10240352 | 3300028381 | Bacteria | 1677 |
| 518 | Ga0268264_11158834 | 3300028381 | Unclassified | 782 |
| 519 | Ga0307517_10033524 | 3300028786 | Bacteria | 5894 |
| 520 | Ga0307517_10091529 | 3300028786 | Unclassified | 2483 |
| 521 | Ga0265330_10226473 | 3300031235 | Unclassified | 789 |
| 522 | Ga0265328_10012522 | 3300031239 | Bacteria | 3374 |
| 523 | Ga0307408_100585413 | 3300031548 | Bacteria | 989 |
| 524 | Ga0307408_101953921 | 3300031548 | Bacteria | 563 |
| 525 | Ga0316575_10003499 | 3300031665 | Bacteria | 5424 |
| 526 | Ga0316579_10006852 | 3300031691 | Bacteria | 4672 |
| 527 | Ga0265342_10021550 | 3300031712 | Bacteria | 4113 |
| 528 | Ga0316578_10041003 | 3300031728 | Bacteria | 2680 |
| 529 | Ga0307405_11575633 | 3300031731 | Bacteria | 579 |
| 530 | Ga0307413_11372624 | 3300031824 | Unclassified | 621 |
| 531 | Ga0307406_10005996 | 3300031901 | Bacteria | 6672 |
| 532 | Ga0316583_10020650 | 3300032133 | Bacteria | 2359 |
| 533 | Ga0316580_10051806 | 3300032139 | Bacteria | 1265 |
| 534 | Ga0373926_0007635 | 3300035083 | Bacteria | 3600 |
| 535 | Ga0373944_0239253 | 3300035089 | Bacteria | 667 |
| 536 | Ga0373923_0450568 | 3300035111 | Unclassified | 624 |
| 537 | Ga0373936_0016812 | 3300035113 | Bacteria | 2816 |
| 538 | Ga0373936_0047102 | 3300035113 | Bacteria | 1739 |
| 539 | Ga0373945_0043061 | 3300035116 | Bacteria | 1637 |
| 540 | Ga0373945_0089204 | 3300035116 | Bacteria | 1192 |
| 541 | Ga0373945_0133457 | 3300035116 | Bacteria | 996 |
| 542 | Ga0373956_0485269 | 3300035119 | Bacteria | 590 |
| 543 | Ga0373943_0000144 | 3300035170 | Bacteria | 27337 |
| 544 | Ga0373946_0043239 | 3300035171 | Bacteria | 1855 |
| 545 | Ga0373946_0084921 | 3300035171 | Bacteria | 1393 |
| 546 | Ga0373955_0738471 | 3300035172 | Bacteria | 605 |
| 547 | Ga0373931_0038823 | 3300035691 | Bacteria | 2493 |
| 548 | Ga0373931_0123378 | 3300035691 | Bacteria | 1483 |
| 549 | Ga0373935_0031185 | 3300035692 | Bacteria | 3307 |
| 550 | Ga0373927_0000227 | 3300035695 | Bacteria | 44543 |
| 551 | Ga0373927_0056944 | 3300035695 | Bacteria | 2528 |
| 552 | Ga0373927_0120097 | 3300035695 | Bacteria | 1715 |
| 553 | Ga0373933_0736086 | 3300035724 | Bacteria | 649 |
| 554 | Ga0373947_0000318 | 3300035725 | Bacteria | 27274 |
| 555 | Ga0373947_1186982 | 3300035725 | Bacteria | 520 |
| 556 | Ga0373937_0282985 | 3300036401 | Unclassified | 1566 |
| 557 | Ga0373937_0462156 | 3300036401 | Bacteria | 1205 |
| 558 | Ga0373937_1600451 | 3300036401 | Unclassified | 599 |
| 559 | Ga0316584_0670491 | 3300036712 | Bacteria | 713 |
| 560 | Ga0373925_0024617 | 3300037068 | Bacteria | 4396 |
| 561 | Ga0373925_0117516 | 3300037068 | Bacteria | 2061 |
| 562 | Ga0373925_1059003 | 3300037068 | Unclassified | 667 |
| 563 | Ga0373925_1317195 | 3300037068 | Bacteria | 592 |
| 564 | Ga0395899_0003165 | 3300037312 | Bacteria | 13064 |
| 565 | Ga0395900_0392372 | 3300037418 | Bacteria | 1354 |
| 566 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 567 | Ga0395898_0000058 | 3300037466 | Bacteria | 277701 |
| 568 | Ga0395898_0859077 | 3300037466 | Bacteria | 846 |
| 569 | Ga0395905_0723692 | 3300037471 | Unclassified | 897 |
| 570 | Ga0395905_0827817 | 3300037471 | Bacteria | 828 |
| 571 | Ga0316581_0029004 | 3300037588 | Bacteria | 1660 |
| 572 | Ga0436364_0460231 | 3300037853 | Bacteria | 636 |
| 573 | Ga0395901_0027626 | 3300038443 | Bacteria | 5831 |
| 574 | Ga0395901_0280270 | 3300038443 | Bacteria | 1732 |
| 575 | Ga0395901_0309889 | 3300038443 | Bacteria | 1635 |
| 576 | Ga0436365_1185547 | 3300039437 | Bacteria | 620 |
| 577 | Ga0436361_0408289 | 3300039447 | Bacteria | 30886 |
| 578 | Ga0436361_0647550 | 3300039447 | Bacteria | 693 |
| 579 | Ga0436361_1061851 | 3300039447 | Bacteria | 60009 |
| 580 | Ga0436361_1151650 | 3300039447 | Bacteria | 3135 |
| 581 | Ga0451849_0692289 | 3300041505 | Bacteria | 690 |
| 582 | Ga0439443_007133 | 3300042003 | Bacteria | 1549 |
| 583 | Ga0439435_0000668 | 3300042436 | Bacteria | 5670 |
| 584 | Ga0451577_0249416 | 3300042876 | Bacteria | 1607 |
| 585 | Ga0466969_0011924 | 3300044656 | Bacteria | 4595 |
| 586 | Ga0466972_0011770 | 3300044658 | Bacteria | 4393 |
| 587 | Ga0466975_0170554 | 3300044661 | Bacteria | 1499 |
| 588 | Ga0466965_0039410 | 3300044683 | Bacteria | 2323 |
| 589 | Ga0466961_0000535 | 3300044693 | Bacteria | 24166 |
| 590 | Ga0466961_0018288 | 3300044693 | Bacteria | 4505 |
| 591 | Ga0466961_0104062 | 3300044693 | Bacteria | 1787 |
| 592 | Ga0466971_0090085 | 3300044719 | Bacteria | 1404 |
| 593 | Ga0466970_0000347 | 3300044765 | Bacteria | 22532 |
| 594 | Ga0466970_0004001 | 3300044765 | Bacteria | 7230 |
| 595 | Ga0466957_0001515 | 3300044842 | Bacteria | 12203 |
| 596 | Ga0466959_0001224 | 3300045049 | Bacteria | 15500 |
| 597 | Ga0466959_0008354 | 3300045049 | Bacteria | 7315 |
| 598 | Ga0451576_0611952 | 3300045051 | Bacteria | 1145 |
| 599 | Ga0466958_0013812 | 3300045836 | Bacteria | 4604 |
| 600 | Ga0466967_0033521 | 3300045976 | Bacteria | 4348 |
| 601 | Ga0495617_028444 | 3300046452 | Bacteria | 1878 |
| 602 | Ga0495627_135860 | 3300046453 | Bacteria | 690 |
| 603 | Ga0495592_0111505 | 3300046454 | Bacteria | 1935 |
| 604 | Ga0495592_0153548 | 3300046454 | Bacteria | 1590 |
| 605 | Ga0495603_0313452 | 3300046455 | Bacteria | 901 |
| 606 | Ga0495603_0433650 | 3300046455 | Bacteria | 753 |
| 607 | Ga0495590_0002936 | 3300046457 | Bacteria | 7018 |
| 608 | Ga0495629_0150890 | 3300046459 | Bacteria | 1615 |
| 609 | Ga0495629_0321511 | 3300046459 | Unclassified | 1058 |
| 610 | Ga0495651_0096575 | 3300046462 | Bacteria | 2208 |
| 611 | Ga0495580_0057935 | 3300046472 | Bacteria | 2726 |
| 612 | Ga0495605_0152786 | 3300046474 | Bacteria | 1029 |
| 613 | Ga0495639_0001048 | 3300046475 | Bacteria | 12464 |
| 614 | Ga0495662_0056812 | 3300046476 | Bacteria | 1890 |
| 615 | Ga0495662_0076915 | 3300046476 | Bacteria | 1621 |
| 616 | Ga0495664_0022059 | 3300046477 | Bacteria | 3684 |
| 617 | Ga0495664_0184942 | 3300046477 | Bacteria | 1263 |
| 618 | Ga0495584_0486353 | 3300046491 | Bacteria | 628 |
| 619 | Ga0495585_0052822 | 3300046492 | Bacteria | 2249 |
| 620 | Ga0495606_0502671 | 3300046507 | Bacteria | 612 |
| 621 | Ga0495616_0070065 | 3300046513 | Bacteria | 1698 |
| 622 | Ga0495618_0008560 | 3300046514 | Bacteria | 6178 |
| 623 | Ga0495618_0296755 | 3300046514 | Bacteria | 1005 |
| 624 | Ga0495618_0319818 | 3300046514 | Bacteria | 961 |
| 625 | Ga0495628_0032340 | 3300046516 | Bacteria | 4223 |
| 626 | Ga0495628_0043271 | 3300046516 | Bacteria | 3588 |
| 627 | Ga0495628_1092827 | 3300046516 | Unclassified | 545 |
| 628 | Ga0495630_0000460 | 3300046517 | Bacteria | 30750 |
| 629 | Ga0495630_0049702 | 3300046517 | Bacteria | 3138 |
| 630 | Ga0495631_0073578 | 3300046518 | Bacteria | 1475 |
| 631 | Ga0495642_0416435 | 3300046528 | Unclassified | 593 |
| 632 | Ga0495652_0205047 | 3300046529 | Bacteria | 1493 |
| 633 | Ga0495652_0249116 | 3300046529 | Bacteria | 1317 |
| 634 | Ga0495652_0356081 | 3300046529 | Bacteria | 1047 |
| 635 | Ga0495652_0623858 | 3300046529 | Bacteria | 733 |
| 636 | Ga0495665_0011893 | 3300046531 | Bacteria | 4712 |
| 637 | Ga0495665_0015225 | 3300046531 | Bacteria | 4143 |
| 638 | Ga0495640_0022904 | 3300046533 | Bacteria | 4562 |
| 639 | Ga0495640_0067599 | 3300046533 | Bacteria | 2406 |
| 640 | Ga0495586_0239182 | 3300046535 | Bacteria | 1035 |
| 641 | Ga0495586_0259408 | 3300046535 | Bacteria | 992 |
| 642 | Ga0495621_0009424 | 3300046539 | Bacteria | 2963 |
| 643 | Ga0495621_0099348 | 3300046539 | Unclassified | 1106 |
| 644 | Ga0495621_0119973 | 3300046539 | Bacteria | 1015 |
| 645 | Ga0495621_0207108 | 3300046539 | Bacteria | 790 |
| 646 | Ga0495621_0351117 | 3300046539 | Unclassified | 619 |
| 647 | Ga0495645_0003040 | 3300046543 | Bacteria | 11354 |
| 648 | Ga0495645_0333548 | 3300046543 | Bacteria | 981 |
| 649 | Ga0495633_0047090 | 3300046558 | Bacteria | 2038 |
| 650 | Ga0495656_0010263 | 3300046615 | Bacteria | 3398 |
| 651 | Ga0495656_0010373 | 3300046615 | Bacteria | 3387 |
| 652 | Ga0495634_0088624 | 3300046642 | Bacteria | 2012 |
| 653 | Ga0495611_0031872 | 3300046648 | Bacteria | 2322 |
| 654 | Ga0495635_0008319 | 3300046663 | Bacteria | 7243 |
| 655 | Ga0495635_0206764 | 3300046663 | Bacteria | 1330 |
| 656 | Ga0495659_0046384 | 3300046664 | Bacteria | 1568 |
| 657 | Ga0495588_0028535 | 3300046674 | Bacteria | 2793 |
| 658 | Ga0495657_0456808 | 3300046675 | Archaea | 747 |
| 659 | Ga0495599_0028768 | 3300046678 | Unclassified | 3482 |
| 660 | Ga0495599_0225868 | 3300046678 | Bacteria | 1144 |
| 661 | Ga0495647_0041383 | 3300046681 | Bacteria | 1754 |
| 662 | Ga0495647_0097526 | 3300046681 | Bacteria | 1213 |
| 663 | Ga0495658_0175848 | 3300046683 | Bacteria | 1326 |
| 664 | Ga0495658_0533064 | 3300046683 | Bacteria | 752 |
| 665 | Ga0495613_0029168 | 3300046689 | Unclassified | 4103 |
| 666 | Ga0495613_0036947 | 3300046689 | Bacteria | 3621 |
| 667 | Ga0495624_0000895 | 3300046690 | Bacteria | 23654 |
| 668 | Ga0495624_0401192 | 3300046690 | Bacteria | 823 |
| 669 | Ga0495670_0036200 | 3300046691 | Bacteria | 2459 |
| 670 | Ga0495670_0477958 | 3300046691 | Unclassified | 676 |
| 671 | Ga0495589_0090201 | 3300046794 | Bacteria | 1488 |
| 672 | Ga0495600_0286723 | 3300046809 | Bacteria | 1041 |
| 673 | Ga0495600_0466130 | 3300046809 | Bacteria | 780 |
| 674 | Ga0495600_0523167 | 3300046809 | Bacteria | 727 |
| 675 | Ga0495660_0047087 | 3300046810 | Bacteria | 2363 |
| 676 | Ga0495581_0001700 | 3300047315 | Bacteria | 12251 |
| 677 | Ga0495581_0115636 | 3300047315 | Bacteria | 1560 |
| 678 | Ga0495636_0316253 | 3300047318 | Bacteria | 732 |
| 679 | Ga0495674_0025064 | 3300047319 | Bacteria | 5474 |
| 680 | Ga0495672_0084979 | 3300047320 | Bacteria | 1754 |
| 681 | Ga0495676_0054763 | 3300047321 | Bacteria | 3168 |
| 682 | Ga0495680_0279848 | 3300047322 | Bacteria | 1176 |
| 683 | Ga0495673_0033331 | 3300047469 | Bacteria | 2391 |
| 684 | Ga0495684_0001671 | 3300047471 | Bacteria | 17824 |
| 685 | Ga0495684_0012792 | 3300047471 | Bacteria | 6475 |
| 686 | Ga0495684_0066998 | 3300047471 | Bacteria | 2730 |
| 687 | Ga0495686_0460053 | 3300047472 | Bacteria | 675 |
| 688 | Ga0495593_0039096 | 3300047673 | Bacteria | 2560 |
| 689 | Ga0495602_1042723 | 3300048088 | Unclassified | 538 |
| 690 | Ga0495602_1069548 | 3300048088 | Bacteria | 530 |
| 691 | Ga0495615_0003003 | 3300048090 | Bacteria | 2780 |
| 692 | Ga0495615_0285168 | 3300048090 | Bacteria | 531 |
| 693 | Ga0496100_0003967 | 3300048903 | Bacteria | 7778 |
| 694 | Ga0496102_0000994 | 3300048905 | Bacteria | 26666 |
| 695 | Ga0496102_1686250 | 3300048905 | Bacteria | 552 |
| 696 | Ga0496103_0017088 | 3300048906 | Bacteria | 4338 |
| 697 | Ga0496104_0000657 | 3300048907 | Bacteria | 29650 |
| 698 | Ga0496104_0008348 | 3300048907 | Bacteria | 9201 |
| 699 | Ga0496104_0012907 | 3300048907 | Bacteria | 7523 |
| 700 | Ga0496104_0020758 | 3300048907 | Bacteria | 6024 |
| 701 | Ga0496104_0070361 | 3300048907 | Bacteria | 3326 |
| 702 | Ga0496105_0001560 | 3300048908 | Bacteria | 16228 |
| 703 | Ga0496105_0007805 | 3300048908 | Bacteria | 8306 |
| 704 | Ga0496105_0097024 | 3300048908 | Bacteria | 2434 |
| 705 | Ga0496105_0379200 | 3300048908 | Bacteria | 1125 |
| 706 | Ga0496106_0007931 | 3300048909 | Bacteria | 7844 |
| 707 | Ga0496106_0042963 | 3300048909 | Bacteria | 3390 |
| 708 | Ga0496106_0170072 | 3300048909 | Bacteria | 1727 |
| 709 | Ga0496106_1263946 | 3300048909 | Bacteria | 574 |
| 710 | Ga0496107_0090582 | 3300048910 | Bacteria | 2234 |
| 711 | Ga0496108_0003424 | 3300048911 | Bacteria | 12729 |
| 712 | Ga0496108_0005441 | 3300048911 | Bacteria | 10289 |
| 713 | Ga0496108_0034043 | 3300048911 | Bacteria | 4232 |
| 714 | Ga0496109_0002056 | 3300048912 | Bacteria | 16687 |
| 715 | Ga0496109_0005269 | 3300048912 | Bacteria | 10803 |
| 716 | Ga0496110_0007968 | 3300048913 | Bacteria | 8485 |
| 717 | Ga0496110_0015577 | 3300048913 | Bacteria | 6332 |
| 718 | Ga0496110_0041091 | 3300048913 | Bacteria | 4033 |
| 719 | Ga0496110_0065837 | 3300048913 | Bacteria | 3203 |
| 720 | Ga0496110_0381707 | 3300048913 | Bacteria | 1284 |
| 721 | Ga0496111_0003114 | 3300048914 | Bacteria | 10202 |
| 722 | Ga0496111_0029149 | 3300048914 | Bacteria | 3918 |
| 723 | Ga0496111_0070447 | 3300048914 | Bacteria | 2543 |
| 724 | Ga0496111_0107366 | 3300048914 | Bacteria | 2055 |
| 725 | Ga0496111_0233204 | 3300048914 | Bacteria | 1367 |
| 726 | Ga0496112_1611858 | 3300048915 | Unclassified | 562 |
| 727 | Ga0496112_1691615 | 3300048915 | Unclassified | 545 |
| 728 | Ga0496113_0029631 | 3300048916 | Bacteria | 3956 |
| 729 | Ga0496113_0116740 | 3300048916 | Bacteria | 2083 |
| 730 | Ga0496113_0245115 | 3300048916 | Bacteria | 1430 |
| 731 | Ga0496113_0751346 | 3300048916 | Unclassified | 776 |
| 732 | Ga0496114_0028014 | 3300048917 | Bacteria | 4619 |
| 733 | Ga0496115_0060669 | 3300048918 | Bacteria | 3048 |
| 734 | Ga0496115_0354118 | 3300048918 | Bacteria | 1197 |
| 735 | Ga0496117_0005496 | 3300048920 | Bacteria | 13284 |
| 736 | Ga0496118_0001246 | 3300048921 | Bacteria | 39116 |
| 737 | Ga0496118_0379450 | 3300048921 | Bacteria | 742 |
| 738 | Ga0501033_0623629 | 3300049570 | Bacteria | 738 |
| 739 | Ga0501036_1326535 | 3300049572 | Bacteria | 584 |
| 740 | Ga0501040_0048686 | 3300049576 | Bacteria | 2896 |
| 741 | Ga0501040_0516892 | 3300049576 | Unclassified | 861 |
| 742 | Ga0501042_1210301 | 3300049578 | Bacteria | 551 |
| 743 | Ga0501048_0176832 | 3300049582 | Bacteria | 1512 |
| 744 | Ga0501067_0028701 | 3300049583 | Bacteria | 3083 |
| 745 | Ga0501068_0135075 | 3300049584 | Bacteria | 1544 |
| 746 | Ga0501069_0001252 | 3300049585 | Bacteria | 12431 |
| 747 | Ga0501069_0110445 | 3300049585 | Bacteria | 1566 |
| 748 | Ga0501070_0000975 | 3300049586 | Bacteria | 25701 |
| 749 | Ga0501071_0377625 | 3300049587 | Bacteria | 1080 |
| 750 | Ga0501072_0074230 | 3300049588 | Bacteria | 2689 |
| 751 | Ga0501072_0108564 | 3300049588 | Bacteria | 2208 |
| 752 | Ga0501073_0429890 | 3300049589 | Bacteria | 912 |
| 753 | Ga0501074_0001937 | 3300049590 | Bacteria | 14220 |
| 754 | Ga0501075_0378220 | 3300049591 | Bacteria | 1080 |
| 755 | Ga0501076_0519913 | 3300049592 | Bacteria | 981 |
| 756 | Ga0501076_0571342 | 3300049592 | Unclassified | 932 |
| 757 | Ga0501079_0199262 | 3300049741 | Bacteria | 1563 |
| 758 | Ga0501079_0746348 | 3300049741 | Bacteria | 770 |
| 759 | Ga0501080_0042208 | 3300049742 | Bacteria | 4248 |
| 760 | Ga0501080_0682983 | 3300049742 | Bacteria | 906 |
| 761 | Ga0501083_0002623 | 3300049744 | Bacteria | 12390 |
| 762 | Ga0501035_0535963 | 3300049822 | Unclassified | 960 |
| 763 | Ga0501044_0202668 | 3300049823 | Bacteria | 1942 |
| 764 | Ga0501044_0235188 | 3300049823 | Bacteria | 1778 |
| 765 | nmdc:mga06r32_71340_c1 | 3300050510 | Bacteria | 3361 |
| 766 | nmdc:mga08y16_12031_c2 | 3300050511 | Bacteria | 6431 |
| 767 | nmdc:mga08y16_2052421_c1 | 3300050511 | Bacteria | 520 |
| 768 | nmdc:mga08y16_931592_c1 | 3300050511 | Bacteria | 853 |
| 769 | nmdc:mga0n895_1153427_c1 | 3300050512 | Unclassified | 750 |
| 770 | nmdc:mga0n895_217394_c1 | 3300050512 | Bacteria | 1940 |
| 771 | nmdc:mga0n895_399039_c1 | 3300050512 | Bacteria | 1391 |
| 772 | nmdc:mga0rr50_91268_c1 | 3300050513 | Bacteria | 2372 |
| 773 | nmdc:mga08x19_4495_c1 | 3300050514 | Bacteria | 8267 |
| 774 | nmdc:mga08x19_544375_c1 | 3300050514 | Bacteria | 821 |
| 775 | nmdc:mga08x19_602801_c1 | 3300050514 | Bacteria | 778 |
| 776 | nmdc:mga08x19_65691_c1 | 3300050514 | Bacteria | 2357 |
| 777 | nmdc:mga08x19_86373_c1 | 3300050514 | Bacteria | 2065 |
| 778 | nmdc:mga0a205_42957_c1 | 3300050515 | Bacteria | 4357 |
| 779 | Ga0495601_0010085 | 3300053077 | Bacteria | 5609 |
| 780 | Ga0495601_0020426 | 3300053077 | Bacteria | 4045 |
| 781 | Ga0495601_0020946 | 3300053077 | Bacteria | 3998 |
| 782 | Ga0495612_0005114 | 3300053078 | Bacteria | 5423 |
| 783 | Ga0495612_0105716 | 3300053078 | Bacteria | 1201 |
| 784 | Ga0500646_0048397 | 3300053090 | Bacteria | 1219 |
| 785 | Ga0500566_0351867 | 3300053094 | Bacteria | 675 |
| 786 | Ga0500658_0155354 | 3300053134 | Bacteria | 1033 |
| 787 | Ga0500588_0400268 | 3300053146 | Unclassified | 523 |
| 788 | Ga0500627_0189190 | 3300053158 | Bacteria | 925 |
| 789 | Ga0500630_135918 | 3300053159 | Unclassified | 1066 |
| 790 | Ga0501084_0232713 | 3300054114 | Bacteria | 1555 |
| 791 | Ga0590074_011785 | 3300059423 | Bacteria | 1466 |
| 792 | Ga0501082_0710891 | 3300060353 | Unclassified | 879 |
| 793 | Ga0466962_0137365 | 3300061719 | Bacteria | 1183 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10932940 | Ga0105243_109329401 | 129 |
| 2 | 3300013306 | Ga0163162_10672689 | Ga0163162_106726892 | 129 |
| 3 | 3300026041 | Ga0207639_10117882 | Ga0207639_101178821 | 138 |
| 4 | 3300049585 | Ga0501069_0110445 | Ga0501069_0110445_692_1108 | 138 |
| 5 | 3300002705 | JGI25156J39149_1000422 | JGI25156J39149_100042217 | 139 |
| 6 | 3300002705 | JGI25156J39149_1002686 | JGI25156J39149_10026861 | 139 |
| 7 | 3300002737 | JGI25162J39368_1000402 | JGI25162J39368_100040226 | 139 |
| 8 | 3300002738 | JGI25154J39366_1003396 | JGI25154J39366_10033964 | 139 |
| 9 | 3300002741 | JGI25157J39369_1000344 | JGI25157J39369_100034418 | 139 |
| 10 | 3300002741 | JGI25157J39369_1000452 | JGI25157J39369_10004524 | 139 |
| 11 | 3300002772 | JGI25164J39214_1000117 | JGI25164J39214_100011743 | 139 |
| 12 | 3300003214 | JGI25165J46597_1000235 | JGI25165J46597_100023542 | 139 |
| 13 | 3300003752 | Ga0055539_1007503 | Ga0055539_10075033 | 139 |
| 14 | 3300003760 | Ga0055527_1000176 | Ga0055527_100017624 | 139 |
| 15 | 3300003761 | Ga0055535_1000373 | Ga0055535_100037324 | 139 |
| 16 | 3300003761 | Ga0055535_1001357 | Ga0055535_10013574 | 139 |
| 17 | 3300003761 | Ga0055535_1001457 | Ga0055535_100145710 | 139 |
| 18 | 3300003762 | Ga0055542_1000394 | Ga0055542_100039422 | 139 |
| 19 | 3300003762 | Ga0055542_1000429 | Ga0055542_10004296 | 139 |
| 20 | 3300003762 | Ga0055542_1000734 | Ga0055542_100073421 | 139 |
| 21 | 3300003763 | Ga0055529_1000314 | Ga0055529_100031421 | 139 |
| 22 | 3300003763 | Ga0055529_1000420 | Ga0055529_100042022 | 139 |
| 23 | 3300005327 | Ga0070658_10163615 | Ga0070658_101636152 | 139 |
| 24 | 3300005330 | Ga0070690_100316195 | Ga0070690_1003161952 | 139 |
| 25 | 3300005344 | Ga0070661_100025041 | Ga0070661_1000250414 | 139 |
| 26 | 3300005345 | Ga0070692_10037570 | Ga0070692_100375701 | 139 |
| 27 | 3300005364 | Ga0070673_100509329 | Ga0070673_1005093292 | 139 |
| 28 | 3300005434 | Ga0070709_11261766 | Ga0070709_112617662 | 139 |
| 29 | 3300005438 | Ga0070701_10739669 | Ga0070701_107396692 | 139 |
| 30 | 3300005441 | Ga0070700_100882965 | Ga0070700_1008829652 | 139 |
| 31 | 3300005547 | Ga0070693_100441979 | Ga0070693_1004419791 | 139 |
| 32 | 3300005549 | Ga0070704_100401299 | Ga0070704_1004012992 | 139 |
| 33 | 3300005578 | Ga0068854_100068312 | Ga0068854_1000683122 | 139 |
| 34 | 3300005616 | Ga0068852_100041158 | Ga0068852_1000411584 | 139 |
| 35 | 3300005617 | Ga0068859_100624374 | Ga0068859_1006243743 | 139 |
| 36 | 3300005618 | Ga0068864_100223733 | Ga0068864_1002237333 | 139 |
| 37 | 3300005841 | Ga0068863_100077461 | Ga0068863_1000774613 | 139 |
| 38 | 3300005841 | Ga0068863_100814101 | Ga0068863_1008141012 | 139 |
| 39 | 3300006871 | Ga0075434_100657747 | Ga0075434_1006577472 | 139 |
| 40 | 3300006914 | Ga0075436_100003801 | Ga0075436_10000380112 | 139 |
| 41 | 3300006931 | Ga0097620_100624386 | Ga0097620_1006243863 | 139 |
| 42 | 3300009094 | Ga0111539_10930291 | Ga0111539_109302912 | 139 |
| 43 | 3300009174 | Ga0105241_10446717 | Ga0105241_104467172 | 139 |
| 44 | 3300009551 | Ga0105238_10001691 | Ga0105238_100016917 | 139 |
| 45 | 3300010375 | Ga0105239_10454722 | Ga0105239_104547222 | 139 |
| 46 | 3300013100 | Ga0157373_10109438 | Ga0157373_101094382 | 139 |
| 47 | 3300013104 | Ga0157370_10612529 | Ga0157370_106125292 | 139 |
| 48 | 3300013307 | Ga0157372_10001402 | Ga0157372_100014024 | 139 |
| 49 | 3300013308 | Ga0157375_10189409 | Ga0157375_101894094 | 139 |
| 50 | 3300025226 | Ga0209674_100197 | Ga0209674_10019749 | 139 |
| 51 | 3300025226 | Ga0209674_100550 | Ga0209674_10055012 | 139 |
| 52 | 3300025228 | Ga0209672_100008 | Ga0209672_100008293 | 139 |
| 53 | 3300025228 | Ga0209672_100089 | Ga0209672_10008932 | 139 |
| 54 | 3300025231 | Ga0207427_100051 | Ga0207427_10005195 | 139 |
| 55 | 3300025233 | Ga0209437_100152 | Ga0209437_10015242 | 139 |
| 56 | 3300025242 | Ga0209258_100004 | Ga0209258_100004897 | 139 |
| 57 | 3300025242 | Ga0209258_100008 | Ga0209258_100008522 | 139 |
| 58 | 3300025242 | Ga0209258_100090 | Ga0209258_10009085 | 139 |
| 59 | 3300025242 | Ga0209258_100101 | Ga0209258_10010131 | 139 |
| 60 | 3300025246 | Ga0209646_1010457 | Ga0209646_10104572 | 139 |
| 61 | 3300025250 | Ga0209026_1000294 | Ga0209026_100029432 | 139 |
| 62 | 3300025253 | Ga0209677_100976 | Ga0209677_1009763 | 139 |
| 63 | 3300025254 | Ga0209148_1000041 | Ga0209148_100004124 | 139 |
| 64 | 3300025254 | Ga0209148_1000065 | Ga0209148_100006585 | 139 |
| 65 | 3300025254 | Ga0209148_1000079 | Ga0209148_1000079155 | 139 |
| 66 | 3300025256 | Ga0209759_1000165 | Ga0209759_100016511 | 139 |
| 67 | 3300025256 | Ga0209759_1000449 | Ga0209759_100044922 | 139 |
| 68 | 3300025261 | Ga0209233_1000099 | Ga0209233_1000099159 | 139 |
| 69 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007642 | 139 |
| 70 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016156 | 139 |
| 71 | 3300025272 | Ga0209455_1003591 | Ga0209455_10035915 | 139 |
| 72 | 3300025909 | Ga0207705_10229565 | Ga0207705_102295652 | 139 |
| 73 | 3300025911 | Ga0207654_10025864 | Ga0207654_100258643 | 139 |
| 74 | 3300025913 | Ga0207695_10004315 | Ga0207695_100043154 | 139 |
| 75 | 3300025914 | Ga0207671_10001967 | Ga0207671_1000196715 | 139 |
| 76 | 3300025920 | Ga0207649_10052176 | Ga0207649_100521762 | 139 |
| 77 | 3300025924 | Ga0207694_10106953 | Ga0207694_101069532 | 139 |
| 78 | 3300025940 | Ga0207691_10116859 | Ga0207691_101168592 | 139 |
| 79 | 3300025949 | Ga0207667_10091823 | Ga0207667_100918232 | 139 |
| 80 | 3300025960 | Ga0207651_10195168 | Ga0207651_101951682 | 139 |
| 81 | 3300025981 | Ga0207640_10236284 | Ga0207640_102362842 | 139 |
| 82 | 3300025986 | Ga0207658_11901723 | Ga0207658_119017231 | 139 |
| 83 | 3300026067 | Ga0207678_10625799 | Ga0207678_106257992 | 139 |
| 84 | 3300026078 | Ga0207702_10041675 | Ga0207702_100416753 | 139 |
| 85 | 3300026089 | Ga0207648_10258224 | Ga0207648_102582243 | 139 |
| 86 | 3300026095 | Ga0207676_10761978 | Ga0207676_107619782 | 139 |
| 87 | 3300027907 | Ga0207428_10021199 | Ga0207428_100211992 | 139 |
| 88 | 3300031548 | Ga0307408_100585413 | Ga0307408_1005854132 | 139 |
| 89 | 3300031712 | Ga0265342_10021550 | Ga0265342_100215503 | 139 |
| 90 | 3300037312 | Ga0395899_0003165 | Ga0395899_0003165_6096_6551 | 139 |
| 91 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_22026_22481 | 139 |
| 92 | 3300037466 | Ga0395898_0000058 | Ga0395898_0000058_20176_20616 | 139 |
| 93 | 3300038443 | Ga0395901_0027626 | Ga0395901_0027626_1766_2206 | 139 |
| 94 | 3300038443 | Ga0395901_0280270 | Ga0395901_0280270_974_1429 | 139 |
| 95 | 3300042003 | Ga0439443_007133 | Ga0439443_007133_123_542 | 139 |
| 96 | 3300042436 | Ga0439435_0000668 | Ga0439435_0000668_5064_5483 | 139 |
| 97 | 3300044656 | Ga0466969_0011924 | Ga0466969_0011924_708_1148 | 139 |
| 98 | 3300044661 | Ga0466975_0170554 | Ga0466975_0170554_858_1298 | 139 |
| 99 | 3300044683 | Ga0466965_0039410 | Ga0466965_0039410_993_1433 | 139 |
| 100 | 3300044693 | Ga0466961_0000535 | Ga0466961_0000535_17437_17901 | 139 |
| 101 | 3300044693 | Ga0466961_0018288 | Ga0466961_0018288_727_1167 | 139 |
| 102 | 3300044693 | Ga0466961_0104062 | Ga0466961_0104062_852_1292 | 139 |
| 103 | 3300044719 | Ga0466971_0090085 | Ga0466971_0090085_648_1088 | 139 |
| 104 | 3300044765 | Ga0466970_0004001 | Ga0466970_0004001_2393_2833 | 139 |
| 105 | 3300044842 | Ga0466957_0001515 | Ga0466957_0001515_7916_8356 | 139 |
| 106 | 3300045049 | Ga0466959_0008354 | Ga0466959_0008354_1759_2199 | 139 |
| 107 | 3300045836 | Ga0466958_0013812 | Ga0466958_0013812_3523_3963 | 139 |
| 108 | 3300045976 | Ga0466967_0033521 | Ga0466967_0033521_1517_1981 | 139 |
| 109 | 3300046539 | Ga0495621_0099348 | Ga0495621_0099348_458_877 | 139 |
| 110 | 3300049570 | Ga0501033_0623629 | Ga0501033_0623629_284_703 | 139 |
| 111 | 3300049576 | Ga0501040_0048686 | Ga0501040_0048686_986_1405 | 139 |
| 112 | 3300050510 | nmdc:mga06r32_71340_c1 | nmdc:mga06r32_71340_c1_189_608 | 139 |
| 113 | 3300050511 | nmdc:mga08y16_12031_c2 | nmdc:mga08y16_12031_c2_5767_6186 | 139 |
| 114 | 3300050511 | nmdc:mga08y16_931592_c1 | nmdc:mga08y16_931592_c1_41_460 | 139 |
| 115 | 3300050512 | nmdc:mga0n895_1153427_c1 | nmdc:mga0n895_1153427_c1_265_684 | 139 |
| 116 | 3300050514 | nmdc:mga08x19_602801_c1 | nmdc:mga08x19_602801_c1_293_715 | 139 |
| 117 | 3300050514 | nmdc:mga08x19_65691_c1 | nmdc:mga08x19_65691_c1_1910_2329 | 139 |
| 118 | 3300061719 | Ga0466962_0137365 | Ga0466962_0137365_356_796 | 139 |
| 119 | 3300003203 | JGI25406J46586_10085542 | JGI25406J46586_100855422 | 140 |
| 120 | 3300005327 | Ga0070658_10345229 | Ga0070658_103452292 | 140 |
| 121 | 3300005334 | Ga0068869_100170955 | Ga0068869_1001709552 | 140 |
| 122 | 3300005335 | Ga0070666_10021776 | Ga0070666_100217763 | 140 |
| 123 | 3300005338 | Ga0068868_101101993 | Ga0068868_1011019932 | 140 |
| 124 | 3300005347 | Ga0070668_100949977 | Ga0070668_1009499771 | 140 |
| 125 | 3300005353 | Ga0070669_101338911 | Ga0070669_1013389111 | 140 |
| 126 | 3300005364 | Ga0070673_100606181 | Ga0070673_1006061812 | 140 |
| 127 | 3300005434 | Ga0070709_10391042 | Ga0070709_103910421 | 140 |
| 128 | 3300005435 | Ga0070714_101701944 | Ga0070714_1017019441 | 140 |
| 129 | 3300005438 | Ga0070701_10637746 | Ga0070701_106377461 | 140 |
| 130 | 3300005457 | Ga0070662_100510172 | Ga0070662_1005101721 | 140 |
| 131 | 3300005458 | Ga0070681_10165120 | Ga0070681_101651203 | 140 |
| 132 | 3300005547 | Ga0070693_100265291 | Ga0070693_1002652912 | 140 |
| 133 | 3300005549 | Ga0070704_100097908 | Ga0070704_1000979084 | 140 |
| 134 | 3300005564 | Ga0070664_100163183 | Ga0070664_1001631832 | 140 |
| 135 | 3300005578 | Ga0068854_100082771 | Ga0068854_1000827712 | 140 |
| 136 | 3300005614 | Ga0068856_100062403 | Ga0068856_1000624033 | 140 |
| 137 | 3300005842 | Ga0068858_100015154 | Ga0068858_1000151543 | 140 |
| 138 | 3300005843 | Ga0068860_100392001 | Ga0068860_1003920011 | 140 |
| 139 | 3300005985 | Ga0081539_10001060 | Ga0081539_1000106016 | 140 |
| 140 | 3300006881 | Ga0068865_100500331 | Ga0068865_1005003312 | 140 |
| 141 | 3300009093 | Ga0105240_10135863 | Ga0105240_101358632 | 140 |
| 142 | 3300009101 | Ga0105247_10274953 | Ga0105247_102749531 | 140 |
| 143 | 3300009176 | Ga0105242_11213531 | Ga0105242_112135312 | 140 |
| 144 | 3300009545 | Ga0105237_10050461 | Ga0105237_100504613 | 140 |
| 145 | 3300009553 | Ga0105249_12287212 | Ga0105249_122872122 | 140 |
| 146 | 3300011119 | Ga0105246_10264782 | Ga0105246_102647822 | 140 |
| 147 | 3300011119 | Ga0105246_10798193 | Ga0105246_107981932 | 140 |
| 148 | 3300013104 | Ga0157370_10224406 | Ga0157370_102244062 | 140 |
| 149 | 3300025903 | Ga0207680_10031055 | Ga0207680_100310553 | 140 |
| 150 | 3300025912 | Ga0207707_10086551 | Ga0207707_100865512 | 140 |
| 151 | 3300025919 | Ga0207657_10016926 | Ga0207657_100169263 | 140 |
| 152 | 3300025933 | Ga0207706_10204462 | Ga0207706_102044622 | 140 |
| 153 | 3300025933 | Ga0207706_10457347 | Ga0207706_104573472 | 140 |
| 154 | 3300025938 | Ga0207704_10367795 | Ga0207704_103677952 | 140 |
| 155 | 3300025981 | Ga0207640_10101086 | Ga0207640_101010861 | 140 |
| 156 | 3300026023 | Ga0207677_10269330 | Ga0207677_102693302 | 140 |
| 157 | 3300026035 | Ga0207703_10093670 | Ga0207703_100936703 | 140 |
| 158 | 3300026078 | Ga0207702_10196080 | Ga0207702_101960802 | 140 |
| 159 | 3300026089 | Ga0207648_10065781 | Ga0207648_100657812 | 140 |
| 160 | 3300028381 | Ga0268264_10223578 | Ga0268264_102235782 | 140 |
| 161 | 3300028786 | Ga0307517_10091529 | Ga0307517_100915292 | 140 |
| 162 | 3300031548 | Ga0307408_101953921 | Ga0307408_1019539211 | 140 |
| 163 | 3300045051 | Ga0451576_0611952 | Ga0451576_0611952_303_725 | 140 |
| 164 | 3300053090 | Ga0500646_0048397 | Ga0500646_0048397_395_823 | 140 |
| 165 | 3300053146 | Ga0500588_0400268 | Ga0500588_0400268_16_444 | 140 |
| 166 | 3300001977 | JGI24746J21847_1007558 | JGI24746J21847_10075583 | 141 |
| 167 | 3300001991 | JGI24743J22301_10020738 | JGI24743J22301_100207382 | 141 |
| 168 | 3300002076 | JGI24749J21850_1011267 | JGI24749J21850_10112671 | 141 |
| 169 | 3300002077 | JGI24744J21845_10037300 | JGI24744J21845_100373002 | 141 |
| 170 | 3300002155 | JGI24033J26618_1006993 | JGI24033J26618_10069932 | 141 |
| 171 | 3300003322 | rootL2_10184296 | rootL2_101842965 | 141 |
| 172 | 3300005288 | Ga0065714_10245078 | Ga0065714_102450782 | 141 |
| 173 | 3300005290 | Ga0065712_10089646 | Ga0065712_100896464 | 141 |
| 174 | 3300005293 | Ga0065715_10027211 | Ga0065715_100272112 | 141 |
| 175 | 3300005295 | Ga0065707_10006489 | Ga0065707_100064892 | 141 |
| 176 | 3300005327 | Ga0070658_10107426 | Ga0070658_101074262 | 141 |
| 177 | 3300005328 | Ga0070676_10258923 | Ga0070676_102589232 | 141 |
| 178 | 3300005328 | Ga0070676_10485658 | Ga0070676_104856582 | 141 |
| 179 | 3300005329 | Ga0070683_100003464 | Ga0070683_10000346414 | 141 |
| 180 | 3300005329 | Ga0070683_100025910 | Ga0070683_1000259106 | 141 |
| 181 | 3300005329 | Ga0070683_100082486 | Ga0070683_1000824865 | 141 |
| 182 | 3300005329 | Ga0070683_100357389 | Ga0070683_1003573892 | 141 |
| 183 | 3300005330 | Ga0070690_100047859 | Ga0070690_1000478592 | 141 |
| 184 | 3300005330 | Ga0070690_100048274 | Ga0070690_1000482742 | 141 |
| 185 | 3300005331 | Ga0070670_100032959 | Ga0070670_1000329598 | 141 |
| 186 | 3300005333 | Ga0070677_10151564 | Ga0070677_101515643 | 141 |
| 187 | 3300005334 | Ga0068869_100026763 | Ga0068869_1000267636 | 141 |
| 188 | 3300005334 | Ga0068869_100194521 | Ga0068869_1001945212 | 141 |
| 189 | 3300005335 | Ga0070666_10011790 | Ga0070666_100117907 | 141 |
| 190 | 3300005335 | Ga0070666_10022990 | Ga0070666_100229902 | 141 |
| 191 | 3300005335 | Ga0070666_10136972 | Ga0070666_101369723 | 141 |
| 192 | 3300005337 | Ga0070682_100977856 | Ga0070682_1009778562 | 141 |
| 193 | 3300005337 | Ga0070682_101003966 | Ga0070682_1010039662 | 141 |
| 194 | 3300005338 | Ga0068868_100334951 | Ga0068868_1003349513 | 141 |
| 195 | 3300005338 | Ga0068868_100370168 | Ga0068868_1003701682 | 141 |
| 196 | 3300005339 | Ga0070660_100043886 | Ga0070660_1000438862 | 141 |
| 197 | 3300005339 | Ga0070660_100352488 | Ga0070660_1003524881 | 141 |
| 198 | 3300005343 | Ga0070687_100591171 | Ga0070687_1005911712 | 141 |
| 199 | 3300005344 | Ga0070661_100003414 | Ga0070661_10000341416 | 141 |
| 200 | 3300005344 | Ga0070661_100051345 | Ga0070661_1000513454 | 141 |
| 201 | 3300005345 | Ga0070692_10021235 | Ga0070692_100212353 | 141 |
| 202 | 3300005353 | Ga0070669_100248271 | Ga0070669_1002482713 | 141 |
| 203 | 3300005353 | Ga0070669_100293418 | Ga0070669_1002934182 | 141 |
| 204 | 3300005354 | Ga0070675_100293758 | Ga0070675_1002937583 | 141 |
| 205 | 3300005355 | Ga0070671_100180737 | Ga0070671_1001807374 | 141 |
| 206 | 3300005355 | Ga0070671_100232292 | Ga0070671_1002322923 | 141 |
| 207 | 3300005355 | Ga0070671_100448204 | Ga0070671_1004482041 | 141 |
| 208 | 3300005355 | Ga0070671_101266504 | Ga0070671_1012665041 | 141 |
| 209 | 3300005356 | Ga0070674_100009860 | Ga0070674_1000098607 | 141 |
| 210 | 3300005356 | Ga0070674_100093255 | Ga0070674_1000932553 | 141 |
| 211 | 3300005364 | Ga0070673_100164482 | Ga0070673_1001644821 | 141 |
| 212 | 3300005364 | Ga0070673_101141041 | Ga0070673_1011410411 | 141 |
| 213 | 3300005364 | Ga0070673_101263127 | Ga0070673_1012631271 | 141 |
| 214 | 3300005365 | Ga0070688_100009252 | Ga0070688_1000092525 | 141 |
| 215 | 3300005365 | Ga0070688_100176149 | Ga0070688_1001761491 | 141 |
| 216 | 3300005366 | Ga0070659_100019972 | Ga0070659_1000199723 | 141 |
| 217 | 3300005366 | Ga0070659_100257812 | Ga0070659_1002578122 | 141 |
| 218 | 3300005366 | Ga0070659_100580793 | Ga0070659_1005807932 | 141 |
| 219 | 3300005367 | Ga0070667_100002375 | Ga0070667_1000023752 | 141 |
| 220 | 3300005367 | Ga0070667_100011716 | Ga0070667_1000117165 | 141 |
| 221 | 3300005367 | Ga0070667_100102615 | Ga0070667_1001026152 | 141 |
| 222 | 3300005367 | Ga0070667_100418160 | Ga0070667_1004181602 | 141 |
| 223 | 3300005367 | Ga0070667_102026964 | Ga0070667_1020269641 | 141 |
| 224 | 3300005406 | Ga0070703_10062236 | Ga0070703_100622361 | 141 |
| 225 | 3300005434 | Ga0070709_10014153 | Ga0070709_100141532 | 141 |
| 226 | 3300005435 | Ga0070714_100008518 | Ga0070714_1000085186 | 141 |
| 227 | 3300005435 | Ga0070714_100042466 | Ga0070714_1000424663 | 141 |
| 228 | 3300005435 | Ga0070714_100514706 | Ga0070714_1005147062 | 141 |
| 229 | 3300005436 | Ga0070713_100782981 | Ga0070713_1007829811 | 141 |
| 230 | 3300005440 | Ga0070705_101004722 | Ga0070705_1010047222 | 141 |
| 231 | 3300005441 | Ga0070700_100029662 | Ga0070700_1000296625 | 141 |
| 232 | 3300005444 | Ga0070694_100117108 | Ga0070694_1001171081 | 141 |
| 233 | 3300005444 | Ga0070694_100203647 | Ga0070694_1002036472 | 141 |
| 234 | 3300005445 | Ga0070708_100688920 | Ga0070708_1006889202 | 141 |
| 235 | 3300005455 | Ga0070663_100041181 | Ga0070663_1000411816 | 141 |
| 236 | 3300005456 | Ga0070678_100003914 | Ga0070678_1000039145 | 141 |
| 237 | 3300005456 | Ga0070678_100242295 | Ga0070678_1002422953 | 141 |
| 238 | 3300005456 | Ga0070678_100603462 | Ga0070678_1006034621 | 141 |
| 239 | 3300005456 | Ga0070678_100913043 | Ga0070678_1009130431 | 141 |
| 240 | 3300005457 | Ga0070662_100097562 | Ga0070662_1000975623 | 141 |
| 241 | 3300005457 | Ga0070662_100317083 | Ga0070662_1003170832 | 141 |
| 242 | 3300005458 | Ga0070681_10209064 | Ga0070681_102090643 | 141 |
| 243 | 3300005458 | Ga0070681_10990304 | Ga0070681_109903042 | 141 |
| 244 | 3300005458 | Ga0070681_11176051 | Ga0070681_111760511 | 141 |
| 245 | 3300005459 | Ga0068867_100000972 | Ga0068867_1000009725 | 141 |
| 246 | 3300005459 | Ga0068867_100477680 | Ga0068867_1004776802 | 141 |
| 247 | 3300005459 | Ga0068867_100488254 | Ga0068867_1004882542 | 141 |
| 248 | 3300005466 | Ga0070685_10003125 | Ga0070685_100031256 | 141 |
| 249 | 3300005467 | Ga0070706_100004142 | Ga0070706_10000414211 | 141 |
| 250 | 3300005471 | Ga0070698_100120422 | Ga0070698_1001204221 | 141 |
| 251 | 3300005518 | Ga0070699_101754439 | Ga0070699_1017544391 | 141 |
| 252 | 3300005530 | Ga0070679_100304129 | Ga0070679_1003041292 | 141 |
| 253 | 3300005530 | Ga0070679_100421460 | Ga0070679_1004214601 | 141 |
| 254 | 3300005535 | Ga0070684_100045842 | Ga0070684_1000458424 | 141 |
| 255 | 3300005535 | Ga0070684_100244768 | Ga0070684_1002447681 | 141 |
| 256 | 3300005535 | Ga0070684_100713366 | Ga0070684_1007133661 | 141 |
| 257 | 3300005536 | Ga0070697_100006292 | Ga0070697_1000062929 | 141 |
| 258 | 3300005536 | Ga0070697_101395056 | Ga0070697_1013950561 | 141 |
| 259 | 3300005539 | Ga0068853_100024919 | Ga0068853_1000249197 | 141 |
| 260 | 3300005539 | Ga0068853_100029510 | Ga0068853_1000295105 | 141 |
| 261 | 3300005543 | Ga0070672_100018183 | Ga0070672_1000181834 | 141 |
| 262 | 3300005543 | Ga0070672_101055550 | Ga0070672_1010555502 | 141 |
| 263 | 3300005544 | Ga0070686_100013353 | Ga0070686_1000133532 | 141 |
| 264 | 3300005545 | Ga0070695_100057747 | Ga0070695_1000577472 | 141 |
| 265 | 3300005545 | Ga0070695_100721366 | Ga0070695_1007213661 | 141 |
| 266 | 3300005546 | Ga0070696_100219854 | Ga0070696_1002198541 | 141 |
| 267 | 3300005546 | Ga0070696_101766458 | Ga0070696_1017664581 | 141 |
| 268 | 3300005547 | Ga0070693_100121360 | Ga0070693_1001213603 | 141 |
| 269 | 3300005547 | Ga0070693_100152035 | Ga0070693_1001520352 | 141 |
| 270 | 3300005548 | Ga0070665_100002162 | Ga0070665_10000216215 | 141 |
| 271 | 3300005548 | Ga0070665_100063714 | Ga0070665_1000637142 | 141 |
| 272 | 3300005548 | Ga0070665_100165548 | Ga0070665_1001655482 | 141 |
| 273 | 3300005548 | Ga0070665_101076639 | Ga0070665_1010766392 | 141 |
| 274 | 3300005548 | Ga0070665_101195281 | Ga0070665_1011952811 | 141 |
| 275 | 3300005563 | Ga0068855_100260077 | Ga0068855_1002600772 | 141 |
| 276 | 3300005563 | Ga0068855_100273060 | Ga0068855_1002730603 | 141 |
| 277 | 3300005563 | Ga0068855_100430672 | Ga0068855_1004306722 | 141 |
| 278 | 3300005563 | Ga0068855_100500166 | Ga0068855_1005001662 | 141 |
| 279 | 3300005563 | Ga0068855_101320896 | Ga0068855_1013208962 | 141 |
| 280 | 3300005563 | Ga0068855_101959031 | Ga0068855_1019590312 | 141 |
| 281 | 3300005564 | Ga0070664_100070162 | Ga0070664_1000701623 | 141 |
| 282 | 3300005564 | Ga0070664_100401528 | Ga0070664_1004015281 | 141 |
| 283 | 3300005577 | Ga0068857_100000326 | Ga0068857_10000032628 | 141 |
| 284 | 3300005577 | Ga0068857_100054631 | Ga0068857_1000546313 | 141 |
| 285 | 3300005577 | Ga0068857_100622968 | Ga0068857_1006229682 | 141 |
| 286 | 3300005578 | Ga0068854_100042838 | Ga0068854_1000428382 | 141 |
| 287 | 3300005578 | Ga0068854_100073728 | Ga0068854_1000737283 | 141 |
| 288 | 3300005578 | Ga0068854_100141979 | Ga0068854_1001419793 | 141 |
| 289 | 3300005614 | Ga0068856_100009494 | Ga0068856_10000949411 | 141 |
| 290 | 3300005614 | Ga0068856_100018785 | Ga0068856_1000187853 | 141 |
| 291 | 3300005614 | Ga0068856_100486292 | Ga0068856_1004862923 | 141 |
| 292 | 3300005616 | Ga0068852_100008993 | Ga0068852_1000089939 | 141 |
| 293 | 3300005616 | Ga0068852_100012746 | Ga0068852_1000127463 | 141 |
| 294 | 3300005616 | Ga0068852_100029985 | Ga0068852_1000299856 | 141 |
| 295 | 3300005616 | Ga0068852_100040930 | Ga0068852_1000409302 | 141 |
| 296 | 3300005616 | Ga0068852_100077840 | Ga0068852_1000778403 | 141 |
| 297 | 3300005617 | Ga0068859_100045135 | Ga0068859_1000451353 | 141 |
| 298 | 3300005617 | Ga0068859_100068339 | Ga0068859_1000683396 | 141 |
| 299 | 3300005617 | Ga0068859_100225195 | Ga0068859_1002251953 | 141 |
| 300 | 3300005617 | Ga0068859_101031056 | Ga0068859_1010310562 | 141 |
| 301 | 3300005618 | Ga0068864_100239894 | Ga0068864_1002398943 | 141 |
| 302 | 3300005719 | Ga0068861_100001475 | Ga0068861_1000014758 | 141 |
| 303 | 3300005834 | Ga0068851_10014726 | Ga0068851_100147265 | 141 |
| 304 | 3300005834 | Ga0068851_10052504 | Ga0068851_100525043 | 141 |
| 305 | 3300005840 | Ga0068870_10007140 | Ga0068870_1000714010 | 141 |
| 306 | 3300005840 | Ga0068870_10284449 | Ga0068870_102844492 | 141 |
| 307 | 3300005841 | Ga0068863_100001209 | Ga0068863_10000120913 | 141 |
| 308 | 3300005841 | Ga0068863_100089587 | Ga0068863_1000895874 | 141 |
| 309 | 3300005841 | Ga0068863_100420079 | Ga0068863_1004200793 | 141 |
| 310 | 3300005842 | Ga0068858_100255585 | Ga0068858_1002555852 | 141 |
| 311 | 3300005842 | Ga0068858_101187026 | Ga0068858_1011870262 | 141 |
| 312 | 3300005843 | Ga0068860_100003093 | Ga0068860_10000309317 | 141 |
| 313 | 3300005843 | Ga0068860_100010328 | Ga0068860_1000103288 | 141 |
| 314 | 3300005843 | Ga0068860_100058142 | Ga0068860_1000581422 | 141 |
| 315 | 3300005844 | Ga0068862_100041253 | Ga0068862_1000412533 | 141 |
| 316 | 3300005844 | Ga0068862_100129847 | Ga0068862_1001298473 | 141 |
| 317 | 3300005844 | Ga0068862_100288476 | Ga0068862_1002884762 | 141 |
| 318 | 3300005844 | Ga0068862_100542586 | Ga0068862_1005425861 | 141 |
| 319 | 3300005937 | Ga0081455_10322416 | Ga0081455_103224161 | 141 |
| 320 | 3300006163 | Ga0070715_10033608 | Ga0070715_100336082 | 141 |
| 321 | 3300006173 | Ga0070716_100022733 | Ga0070716_1000227331 | 141 |
| 322 | 3300006175 | Ga0070712_100126840 | Ga0070712_1001268402 | 141 |
| 323 | 3300006175 | Ga0070712_100405948 | Ga0070712_1004059482 | 141 |
| 324 | 3300006237 | Ga0097621_101073359 | Ga0097621_1010733592 | 141 |
| 325 | 3300006358 | Ga0068871_100008475 | Ga0068871_1000084751 | 141 |
| 326 | 3300006358 | Ga0068871_100100426 | Ga0068871_1001004263 | 141 |
| 327 | 3300006358 | Ga0068871_100877540 | Ga0068871_1008775402 | 141 |
| 328 | 3300006852 | Ga0075433_10746566 | Ga0075433_107465662 | 141 |
| 329 | 3300006852 | Ga0075433_11181822 | Ga0075433_111818222 | 141 |
| 330 | 3300006871 | Ga0075434_100254337 | Ga0075434_1002543372 | 141 |
| 331 | 3300006871 | Ga0075434_100402127 | Ga0075434_1004021272 | 141 |
| 332 | 3300006871 | Ga0075434_101830962 | Ga0075434_1018309621 | 141 |
| 333 | 3300006881 | Ga0068865_100002022 | Ga0068865_1000020228 | 141 |
| 334 | 3300006881 | Ga0068865_100059254 | Ga0068865_1000592542 | 141 |
| 335 | 3300006881 | Ga0068865_102172513 | Ga0068865_1021725131 | 141 |
| 336 | 3300006914 | Ga0075436_100002182 | Ga0075436_10000218221 | 141 |
| 337 | 3300006914 | Ga0075436_100404014 | Ga0075436_1004040142 | 141 |
| 338 | 3300006931 | Ga0097620_100045135 | Ga0097620_1000451357 | 141 |
| 339 | 3300006931 | Ga0097620_100068344 | Ga0097620_1000683446 | 141 |
| 340 | 3300006931 | Ga0097620_100225199 | Ga0097620_1002251993 | 141 |
| 341 | 3300006931 | Ga0097620_101030968 | Ga0097620_1010309682 | 141 |
| 342 | 3300007076 | Ga0075435_100081101 | Ga0075435_1000811012 | 141 |
| 343 | 3300007076 | Ga0075435_100082677 | Ga0075435_1000826772 | 141 |
| 344 | 3300009093 | Ga0105240_10015929 | Ga0105240_1001592911 | 141 |
| 345 | 3300009093 | Ga0105240_10043124 | Ga0105240_100431244 | 141 |
| 346 | 3300009093 | Ga0105240_10610206 | Ga0105240_106102062 | 141 |
| 347 | 3300009094 | Ga0111539_10583046 | Ga0111539_105830462 | 141 |
| 348 | 3300009094 | Ga0111539_11825661 | Ga0111539_118256612 | 141 |
| 349 | 3300009098 | Ga0105245_10545935 | Ga0105245_105459352 | 141 |
| 350 | 3300009098 | Ga0105245_10977201 | Ga0105245_109772012 | 141 |
| 351 | 3300009098 | Ga0105245_12024563 | Ga0105245_120245631 | 141 |
| 352 | 3300009101 | Ga0105247_10137500 | Ga0105247_101375001 | 141 |
| 353 | 3300009101 | Ga0105247_10385720 | Ga0105247_103857201 | 141 |
| 354 | 3300009147 | Ga0114129_10825660 | Ga0114129_108256602 | 141 |
| 355 | 3300009148 | Ga0105243_10102966 | Ga0105243_101029664 | 141 |
| 356 | 3300009148 | Ga0105243_10640941 | Ga0105243_106409412 | 141 |
| 357 | 3300009174 | Ga0105241_10064038 | Ga0105241_100640385 | 141 |
| 358 | 3300009174 | Ga0105241_10519560 | Ga0105241_105195602 | 141 |
| 359 | 3300009176 | Ga0105242_10017478 | Ga0105242_100174787 | 141 |
| 360 | 3300009176 | Ga0105242_10755552 | Ga0105242_107555522 | 141 |
| 361 | 3300009176 | Ga0105242_11056370 | Ga0105242_110563702 | 141 |
| 362 | 3300009177 | Ga0105248_10097107 | Ga0105248_100971076 | 141 |
| 363 | 3300009177 | Ga0105248_10398106 | Ga0105248_103981062 | 141 |
| 364 | 3300009177 | Ga0105248_10496639 | Ga0105248_104966392 | 141 |
| 365 | 3300009545 | Ga0105237_10138562 | Ga0105237_101385626 | 141 |
| 366 | 3300009545 | Ga0105237_10847938 | Ga0105237_108479382 | 141 |
| 367 | 3300009551 | Ga0105238_10250523 | Ga0105238_102505233 | 141 |
| 368 | 3300009551 | Ga0105238_10773008 | Ga0105238_107730082 | 141 |
| 369 | 3300009551 | Ga0105238_12016354 | Ga0105238_120163541 | 141 |
| 370 | 3300009553 | Ga0105249_10437597 | Ga0105249_104375972 | 141 |
| 371 | 3300009553 | Ga0105249_10484395 | Ga0105249_104843952 | 141 |
| 372 | 3300010375 | Ga0105239_10359672 | Ga0105239_103596722 | 141 |
| 373 | 3300010375 | Ga0105239_10430395 | Ga0105239_104303952 | 141 |
| 374 | 3300010375 | Ga0105239_11036072 | Ga0105239_110360722 | 141 |
| 375 | 3300011119 | Ga0105246_10830229 | Ga0105246_108302292 | 141 |
| 376 | 3300011119 | Ga0105246_11391362 | Ga0105246_113913621 | 141 |
| 377 | 3300013100 | Ga0157373_10016576 | Ga0157373_100165762 | 141 |
| 378 | 3300013100 | Ga0157373_10286346 | Ga0157373_102863462 | 141 |
| 379 | 3300013100 | Ga0157373_10427991 | Ga0157373_104279912 | 141 |
| 380 | 3300013102 | Ga0157371_10488444 | Ga0157371_104884442 | 141 |
| 381 | 3300013105 | Ga0157369_10018256 | Ga0157369_100182565 | 141 |
| 382 | 3300013105 | Ga0157369_10036084 | Ga0157369_100360849 | 141 |
| 383 | 3300013105 | Ga0157369_10603273 | Ga0157369_106032732 | 141 |
| 384 | 3300013296 | Ga0157374_10006253 | Ga0157374_100062531 | 141 |
| 385 | 3300013296 | Ga0157374_10074892 | Ga0157374_100748923 | 141 |
| 386 | 3300013296 | Ga0157374_10087010 | Ga0157374_100870102 | 141 |
| 387 | 3300013296 | Ga0157374_10119604 | Ga0157374_101196042 | 141 |
| 388 | 3300013296 | Ga0157374_10648193 | Ga0157374_106481931 | 141 |
| 389 | 3300013296 | Ga0157374_12034314 | Ga0157374_120343141 | 141 |
| 390 | 3300013297 | Ga0157378_10004305 | Ga0157378_1000430516 | 141 |
| 391 | 3300013297 | Ga0157378_10013363 | Ga0157378_1001336311 | 141 |
| 392 | 3300013297 | Ga0157378_10099232 | Ga0157378_100992324 | 141 |
| 393 | 3300013297 | Ga0157378_10117837 | Ga0157378_101178374 | 141 |
| 394 | 3300013297 | Ga0157378_10720271 | Ga0157378_107202711 | 141 |
| 395 | 3300013297 | Ga0157378_10762121 | Ga0157378_107621211 | 141 |
| 396 | 3300013297 | Ga0157378_11156194 | Ga0157378_111561941 | 141 |
| 397 | 3300013306 | Ga0163162_10010945 | Ga0163162_1001094513 | 141 |
| 398 | 3300013306 | Ga0163162_10027941 | Ga0163162_100279415 | 141 |
| 399 | 3300013306 | Ga0163162_10788824 | Ga0163162_107888241 | 141 |
| 400 | 3300013307 | Ga0157372_10013916 | Ga0157372_1001391610 | 141 |
| 401 | 3300013307 | Ga0157372_10135958 | Ga0157372_101359583 | 141 |
| 402 | 3300013307 | Ga0157372_10151943 | Ga0157372_101519433 | 141 |
| 403 | 3300013307 | Ga0157372_10199667 | Ga0157372_101996672 | 141 |
| 404 | 3300013308 | Ga0157375_10068642 | Ga0157375_100686425 | 141 |
| 405 | 3300013308 | Ga0157375_10295469 | Ga0157375_102954694 | 141 |
| 406 | 3300014325 | Ga0163163_10015144 | Ga0163163_1001514410 | 141 |
| 407 | 3300014325 | Ga0163163_10970658 | Ga0163163_109706582 | 141 |
| 408 | 3300014497 | Ga0182008_10002400 | Ga0182008_100024002 | 141 |
| 409 | 3300014497 | Ga0182008_10222319 | Ga0182008_102223192 | 141 |
| 410 | 3300014497 | Ga0182008_10684357 | Ga0182008_106843571 | 141 |
| 411 | 3300014745 | Ga0157377_10385437 | Ga0157377_103854372 | 141 |
| 412 | 3300014745 | Ga0157377_10578002 | Ga0157377_105780022 | 141 |
| 413 | 3300014968 | Ga0157379_10237318 | Ga0157379_102373183 | 141 |
| 414 | 3300014968 | Ga0157379_10826622 | Ga0157379_108266222 | 141 |
| 415 | 3300014969 | Ga0157376_10005225 | Ga0157376_100052259 | 141 |
| 416 | 3300014969 | Ga0157376_10195117 | Ga0157376_101951173 | 141 |
| 417 | 3300015261 | Ga0182006_1086248 | Ga0182006_10862482 | 141 |
| 418 | 3300015262 | Ga0182007_10000225 | Ga0182007_1000022516 | 141 |
| 419 | 3300015265 | Ga0182005_1067500 | Ga0182005_10675002 | 141 |
| 420 | 3300017792 | Ga0163161_10090859 | Ga0163161_100908594 | 141 |
| 421 | 3300017792 | Ga0163161_10095622 | Ga0163161_100956222 | 141 |
| 422 | 3300017792 | Ga0163161_10280852 | Ga0163161_102808521 | 141 |
| 423 | 3300017792 | Ga0163161_10325319 | Ga0163161_103253192 | 141 |
| 424 | 3300017792 | Ga0163161_10924557 | Ga0163161_109245571 | 141 |
| 425 | 3300021361 | Ga0213872_10000003 | Ga0213872_10000003225 | 141 |
| 426 | 3300021361 | Ga0213872_10000163 | Ga0213872_1000016326 | 141 |
| 427 | 3300025315 | Ga0207697_10006661 | Ga0207697_100066612 | 141 |
| 428 | 3300025321 | Ga0207656_10053200 | Ga0207656_100532003 | 141 |
| 429 | 3300025321 | Ga0207656_10193070 | Ga0207656_101930702 | 141 |
| 430 | 3300025893 | Ga0207682_10001376 | Ga0207682_1000137615 | 141 |
| 431 | 3300025898 | Ga0207692_10005132 | Ga0207692_100051327 | 141 |
| 432 | 3300025898 | Ga0207692_10238084 | Ga0207692_102380841 | 141 |
| 433 | 3300025903 | Ga0207680_10010766 | Ga0207680_100107662 | 141 |
| 434 | 3300025903 | Ga0207680_10126455 | Ga0207680_101264553 | 141 |
| 435 | 3300025903 | Ga0207680_10127575 | Ga0207680_101275752 | 141 |
| 436 | 3300025904 | Ga0207647_10002041 | Ga0207647_100020414 | 141 |
| 437 | 3300025905 | Ga0207685_10114061 | Ga0207685_101140612 | 141 |
| 438 | 3300025906 | Ga0207699_10080050 | Ga0207699_100800503 | 141 |
| 439 | 3300025907 | Ga0207645_10211491 | Ga0207645_102114912 | 141 |
| 440 | 3300025907 | Ga0207645_10477290 | Ga0207645_104772902 | 141 |
| 441 | 3300025907 | Ga0207645_10555372 | Ga0207645_105553722 | 141 |
| 442 | 3300025908 | Ga0207643_10343970 | Ga0207643_103439702 | 141 |
| 443 | 3300025910 | Ga0207684_10065597 | Ga0207684_100655974 | 141 |
| 444 | 3300025910 | Ga0207684_10111746 | Ga0207684_101117463 | 141 |
| 445 | 3300025910 | Ga0207684_10112125 | Ga0207684_101121252 | 141 |
| 446 | 3300025911 | Ga0207654_10065161 | Ga0207654_100651613 | 141 |
| 447 | 3300025911 | Ga0207654_10210426 | Ga0207654_102104261 | 141 |
| 448 | 3300025912 | Ga0207707_10195489 | Ga0207707_101954893 | 141 |
| 449 | 3300025912 | Ga0207707_10411794 | Ga0207707_104117942 | 141 |
| 450 | 3300025913 | Ga0207695_10037880 | Ga0207695_100378802 | 141 |
| 451 | 3300025913 | Ga0207695_10069691 | Ga0207695_100696913 | 141 |
| 452 | 3300025913 | Ga0207695_11075378 | Ga0207695_110753781 | 141 |
| 453 | 3300025915 | Ga0207693_10117198 | Ga0207693_101171982 | 141 |
| 454 | 3300025915 | Ga0207693_10233690 | Ga0207693_102336902 | 141 |
| 455 | 3300025916 | Ga0207663_10158917 | Ga0207663_101589171 | 141 |
| 456 | 3300025916 | Ga0207663_10261507 | Ga0207663_102615071 | 141 |
| 457 | 3300025916 | Ga0207663_10639702 | Ga0207663_106397022 | 141 |
| 458 | 3300025917 | Ga0207660_10859090 | Ga0207660_108590901 | 141 |
| 459 | 3300025919 | Ga0207657_10060723 | Ga0207657_100607236 | 141 |
| 460 | 3300025919 | Ga0207657_10181521 | Ga0207657_101815213 | 141 |
| 461 | 3300025920 | Ga0207649_10003824 | Ga0207649_1000382411 | 141 |
| 462 | 3300025920 | Ga0207649_10098218 | Ga0207649_100982183 | 141 |
| 463 | 3300025920 | Ga0207649_10205341 | Ga0207649_102053412 | 141 |
| 464 | 3300025920 | Ga0207649_11082204 | Ga0207649_110822041 | 141 |
| 465 | 3300025921 | Ga0207652_10103390 | Ga0207652_101033903 | 141 |
| 466 | 3300025921 | Ga0207652_10296919 | Ga0207652_102969192 | 141 |
| 467 | 3300025922 | Ga0207646_11579509 | Ga0207646_115795091 | 141 |
| 468 | 3300025923 | Ga0207681_10233523 | Ga0207681_102335232 | 141 |
| 469 | 3300025924 | Ga0207694_10016968 | Ga0207694_100169681 | 141 |
| 470 | 3300025924 | Ga0207694_10730288 | Ga0207694_107302882 | 141 |
| 471 | 3300025925 | Ga0207650_10030941 | Ga0207650_100309416 | 141 |
| 472 | 3300025925 | Ga0207650_10218977 | Ga0207650_102189772 | 141 |
| 473 | 3300025926 | Ga0207659_10031067 | Ga0207659_100310672 | 141 |
| 474 | 3300025927 | Ga0207687_10027388 | Ga0207687_100273884 | 141 |
| 475 | 3300025928 | Ga0207700_10259433 | Ga0207700_102594333 | 141 |
| 476 | 3300025929 | Ga0207664_10021580 | Ga0207664_100215802 | 141 |
| 477 | 3300025929 | Ga0207664_10024484 | Ga0207664_100244843 | 141 |
| 478 | 3300025929 | Ga0207664_11180427 | Ga0207664_111804271 | 141 |
| 479 | 3300025931 | Ga0207644_10176701 | Ga0207644_101767012 | 141 |
| 480 | 3300025931 | Ga0207644_10226831 | Ga0207644_102268314 | 141 |
| 481 | 3300025931 | Ga0207644_10584598 | Ga0207644_105845982 | 141 |
| 482 | 3300025932 | Ga0207690_10583142 | Ga0207690_105831422 | 141 |
| 483 | 3300025933 | Ga0207706_11120903 | Ga0207706_111209031 | 141 |
| 484 | 3300025935 | Ga0207709_10388111 | Ga0207709_103881111 | 141 |
| 485 | 3300025935 | Ga0207709_10456495 | Ga0207709_104564951 | 141 |
| 486 | 3300025937 | Ga0207669_10028296 | Ga0207669_100282963 | 141 |
| 487 | 3300025937 | Ga0207669_10069073 | Ga0207669_100690733 | 141 |
| 488 | 3300025938 | Ga0207704_10172505 | Ga0207704_101725053 | 141 |
| 489 | 3300025938 | Ga0207704_10298455 | Ga0207704_102984553 | 141 |
| 490 | 3300025940 | Ga0207691_10041207 | Ga0207691_100412074 | 141 |
| 491 | 3300025940 | Ga0207691_10205823 | Ga0207691_102058232 | 141 |
| 492 | 3300025941 | Ga0207711_10001632 | Ga0207711_1000163212 | 141 |
| 493 | 3300025941 | Ga0207711_10338023 | Ga0207711_103380231 | 141 |
| 494 | 3300025941 | Ga0207711_10360409 | Ga0207711_103604092 | 141 |
| 495 | 3300025942 | Ga0207689_10006092 | Ga0207689_1000609211 | 141 |
| 496 | 3300025942 | Ga0207689_10007213 | Ga0207689_100072139 | 141 |
| 497 | 3300025942 | Ga0207689_10039336 | Ga0207689_100393363 | 141 |
| 498 | 3300025942 | Ga0207689_10046845 | Ga0207689_100468452 | 141 |
| 499 | 3300025944 | Ga0207661_10038131 | Ga0207661_100381316 | 141 |
| 500 | 3300025944 | Ga0207661_10365712 | Ga0207661_103657122 | 141 |
| 501 | 3300025945 | Ga0207679_10007632 | Ga0207679_1000763210 | 141 |
| 502 | 3300025945 | Ga0207679_10024072 | Ga0207679_100240726 | 141 |
| 503 | 3300025945 | Ga0207679_10104704 | Ga0207679_101047043 | 141 |
| 504 | 3300025949 | Ga0207667_10021483 | Ga0207667_1002148310 | 141 |
| 505 | 3300025949 | Ga0207667_10049769 | Ga0207667_100497693 | 141 |
| 506 | 3300025949 | Ga0207667_10465221 | Ga0207667_104652212 | 141 |
| 507 | 3300025949 | Ga0207667_10675614 | Ga0207667_106756142 | 141 |
| 508 | 3300025960 | Ga0207651_10534442 | Ga0207651_105344421 | 141 |
| 509 | 3300025960 | Ga0207651_10632237 | Ga0207651_106322372 | 141 |
| 510 | 3300025960 | Ga0207651_11019928 | Ga0207651_110199282 | 141 |
| 511 | 3300025961 | Ga0207712_10076717 | Ga0207712_100767173 | 141 |
| 512 | 3300025972 | Ga0207668_10020310 | Ga0207668_100203104 | 141 |
| 513 | 3300025972 | Ga0207668_10721481 | Ga0207668_107214812 | 141 |
| 514 | 3300025981 | Ga0207640_10033678 | Ga0207640_100336783 | 141 |
| 515 | 3300025981 | Ga0207640_10284688 | Ga0207640_102846883 | 141 |
| 516 | 3300025986 | Ga0207658_10001646 | Ga0207658_100016468 | 141 |
| 517 | 3300025986 | Ga0207658_10488004 | Ga0207658_104880042 | 141 |
| 518 | 3300026023 | Ga0207677_10036448 | Ga0207677_100364482 | 141 |
| 519 | 3300026023 | Ga0207677_10059006 | Ga0207677_100590063 | 141 |
| 520 | 3300026023 | Ga0207677_10090597 | Ga0207677_100905972 | 141 |
| 521 | 3300026023 | Ga0207677_10225256 | Ga0207677_102252562 | 141 |
| 522 | 3300026035 | Ga0207703_10010103 | Ga0207703_100101031 | 141 |
| 523 | 3300026035 | Ga0207703_10177774 | Ga0207703_101777742 | 141 |
| 524 | 3300026035 | Ga0207703_10202419 | Ga0207703_102024192 | 141 |
| 525 | 3300026041 | Ga0207639_10064678 | Ga0207639_100646783 | 141 |
| 526 | 3300026041 | Ga0207639_10181849 | Ga0207639_101818492 | 141 |
| 527 | 3300026041 | Ga0207639_10716042 | Ga0207639_107160422 | 141 |
| 528 | 3300026078 | Ga0207702_10011615 | Ga0207702_100116155 | 141 |
| 529 | 3300026078 | Ga0207702_10065195 | Ga0207702_100651953 | 141 |
| 530 | 3300026078 | Ga0207702_10687283 | Ga0207702_106872832 | 141 |
| 531 | 3300026078 | Ga0207702_11927376 | Ga0207702_119273761 | 141 |
| 532 | 3300026089 | Ga0207648_10000584 | Ga0207648_100005843 | 141 |
| 533 | 3300026089 | Ga0207648_10097042 | Ga0207648_100970425 | 141 |
| 534 | 3300026089 | Ga0207648_11019406 | Ga0207648_110194062 | 141 |
| 535 | 3300026116 | Ga0207674_10000180 | Ga0207674_1000018013 | 141 |
| 536 | 3300026116 | Ga0207674_10378082 | Ga0207674_103780822 | 141 |
| 537 | 3300026116 | Ga0207674_10699996 | Ga0207674_106999962 | 141 |
| 538 | 3300026118 | Ga0207675_100001346 | Ga0207675_1000013465 | 141 |
| 539 | 3300026118 | Ga0207675_100003447 | Ga0207675_10000344714 | 141 |
| 540 | 3300026121 | Ga0207683_10018175 | Ga0207683_100181755 | 141 |
| 541 | 3300026121 | Ga0207683_10366952 | Ga0207683_103669523 | 141 |
| 542 | 3300026121 | Ga0207683_10497753 | Ga0207683_104977533 | 141 |
| 543 | 3300026142 | Ga0207698_10014775 | Ga0207698_100147753 | 141 |
| 544 | 3300026142 | Ga0207698_10138604 | Ga0207698_101386044 | 141 |
| 545 | 3300027907 | Ga0207428_11006721 | Ga0207428_110067212 | 141 |
| 546 | 3300028379 | Ga0268266_10058477 | Ga0268266_100584772 | 141 |
| 547 | 3300028379 | Ga0268266_10276030 | Ga0268266_102760302 | 141 |
| 548 | 3300028379 | Ga0268266_11724988 | Ga0268266_117249882 | 141 |
| 549 | 3300028380 | Ga0268265_10052583 | Ga0268265_100525833 | 141 |
| 550 | 3300028380 | Ga0268265_10066305 | Ga0268265_100663052 | 141 |
| 551 | 3300028380 | Ga0268265_10619080 | Ga0268265_106190801 | 141 |
| 552 | 3300028381 | Ga0268264_10018918 | Ga0268264_100189188 | 141 |
| 553 | 3300028381 | Ga0268264_10143956 | Ga0268264_101439562 | 141 |
| 554 | 3300028381 | Ga0268264_10240352 | Ga0268264_102403521 | 141 |
| 555 | 3300028381 | Ga0268264_11158834 | Ga0268264_111588341 | 141 |
| 556 | 3300028786 | Ga0307517_10033524 | Ga0307517_100335243 | 141 |
| 557 | 3300031235 | Ga0265330_10226473 | Ga0265330_102264732 | 141 |
| 558 | 3300031239 | Ga0265328_10012522 | Ga0265328_100125223 | 141 |
| 559 | 3300031665 | Ga0316575_10003499 | Ga0316575_100034994 | 141 |
| 560 | 3300031691 | Ga0316579_10006852 | Ga0316579_100068525 | 141 |
| 561 | 3300031728 | Ga0316578_10041003 | Ga0316578_100410032 | 141 |
| 562 | 3300031731 | Ga0307405_11575633 | Ga0307405_115756332 | 141 |
| 563 | 3300031824 | Ga0307413_11372624 | Ga0307413_113726241 | 141 |
| 564 | 3300031901 | Ga0307406_10005996 | Ga0307406_100059961 | 141 |
| 565 | 3300032133 | Ga0316583_10020650 | Ga0316583_100206503 | 141 |
| 566 | 3300032139 | Ga0316580_10051806 | Ga0316580_100518062 | 141 |
| 567 | 3300035083 | Ga0373926_0007635 | Ga0373926_0007635_2200_2628 | 141 |
| 568 | 3300035089 | Ga0373944_0239253 | Ga0373944_0239253_24_452 | 141 |
| 569 | 3300035111 | Ga0373923_0450568 | Ga0373923_0450568_134_595 | 141 |
| 570 | 3300035113 | Ga0373936_0016812 | Ga0373936_0016812_785_1213 | 141 |
| 571 | 3300035113 | Ga0373936_0047102 | Ga0373936_0047102_548_991 | 141 |
| 572 | 3300035116 | Ga0373945_0043061 | Ga0373945_0043061_284_712 | 141 |
| 573 | 3300035116 | Ga0373945_0089204 | Ga0373945_0089204_565_1005 | 141 |
| 574 | 3300035116 | Ga0373945_0133457 | Ga0373945_0133457_90_515 | 141 |
| 575 | 3300035119 | Ga0373956_0485269 | Ga0373956_0485269_73_501 | 141 |
| 576 | 3300035170 | Ga0373943_0000144 | Ga0373943_0000144_19525_19953 | 141 |
| 577 | 3300035171 | Ga0373946_0043239 | Ga0373946_0043239_1385_1813 | 141 |
| 578 | 3300035171 | Ga0373946_0084921 | Ga0373946_0084921_824_1249 | 141 |
| 579 | 3300035172 | Ga0373955_0738471 | Ga0373955_0738471_50_478 | 141 |
| 580 | 3300035691 | Ga0373931_0038823 | Ga0373931_0038823_1358_1786 | 141 |
| 581 | 3300035691 | Ga0373931_0123378 | Ga0373931_0123378_177_602 | 141 |
| 582 | 3300035692 | Ga0373935_0031185 | Ga0373935_0031185_522_950 | 141 |
| 583 | 3300035695 | Ga0373927_0000227 | Ga0373927_0000227_43043_43471 | 141 |
| 584 | 3300035695 | Ga0373927_0056944 | Ga0373927_0056944_357_791 | 141 |
| 585 | 3300035695 | Ga0373927_0120097 | Ga0373927_0120097_883_1311 | 141 |
| 586 | 3300035724 | Ga0373933_0736086 | Ga0373933_0736086_123_623 | 141 |
| 587 | 3300035725 | Ga0373947_0000318 | Ga0373947_0000318_8816_9244 | 141 |
| 588 | 3300035725 | Ga0373947_1186982 | Ga0373947_1186982_71_499 | 141 |
| 589 | 3300036401 | Ga0373937_0282985 | Ga0373937_0282985_1045_1506 | 141 |
| 590 | 3300036401 | Ga0373937_0462156 | Ga0373937_0462156_626_1087 | 141 |
| 591 | 3300036401 | Ga0373937_1600451 | Ga0373937_1600451_96_530 | 141 |
| 592 | 3300036712 | Ga0316584_0670491 | Ga0316584_0670491_229_660 | 141 |
| 593 | 3300037068 | Ga0373925_0024617 | Ga0373925_0024617_2946_3374 | 141 |
| 594 | 3300037068 | Ga0373925_0117516 | Ga0373925_0117516_1501_1926 | 141 |
| 595 | 3300037068 | Ga0373925_1059003 | Ga0373925_1059003_106_588 | 141 |
| 596 | 3300037068 | Ga0373925_1317195 | Ga0373925_1317195_95_523 | 141 |
| 597 | 3300037418 | Ga0395900_0392372 | Ga0395900_0392372_303_746 | 141 |
| 598 | 3300037466 | Ga0395898_0859077 | Ga0395898_0859077_262_705 | 141 |
| 599 | 3300037471 | Ga0395905_0723692 | Ga0395905_0723692_345_788 | 141 |
| 600 | 3300037471 | Ga0395905_0827817 | Ga0395905_0827817_265_690 | 141 |
| 601 | 3300037588 | Ga0316581_0029004 | Ga0316581_0029004_225_656 | 141 |
| 602 | 3300037853 | Ga0436364_0460231 | Ga0436364_0460231_73_501 | 141 |
| 603 | 3300038443 | Ga0395901_0309889 | Ga0395901_0309889_141_566 | 141 |
| 604 | 3300039437 | Ga0436365_1185547 | Ga0436365_1185547_54_485 | 141 |
| 605 | 3300039447 | Ga0436361_0408289 | Ga0436361_0408289_17870_18298 | 141 |
| 606 | 3300039447 | Ga0436361_0647550 | Ga0436361_0647550_223_651 | 141 |
| 607 | 3300039447 | Ga0436361_1061851 | Ga0436361_1061851_16388_16816 | 141 |
| 608 | 3300039447 | Ga0436361_1151650 | Ga0436361_1151650_688_1116 | 141 |
| 609 | 3300041505 | Ga0451849_0692289 | Ga0451849_0692289_122_574 | 141 |
| 610 | 3300042876 | Ga0451577_0249416 | Ga0451577_0249416_1023_1484 | 141 |
| 611 | 3300044658 | Ga0466972_0011770 | Ga0466972_0011770_2967_3395 | 141 |
| 612 | 3300044765 | Ga0466970_0000347 | Ga0466970_0000347_7962_8390 | 141 |
| 613 | 3300045049 | Ga0466959_0001224 | Ga0466959_0001224_5744_6175 | 141 |
| 614 | 3300046452 | Ga0495617_028444 | Ga0495617_028444_1391_1819 | 141 |
| 615 | 3300046453 | Ga0495627_135860 | Ga0495627_135860_172_600 | 141 |
| 616 | 3300046454 | Ga0495592_0111505 | Ga0495592_0111505_339_770 | 141 |
| 617 | 3300046454 | Ga0495592_0153548 | Ga0495592_0153548_412_840 | 141 |
| 618 | 3300046455 | Ga0495603_0313452 | Ga0495603_0313452_448_876 | 141 |
| 619 | 3300046455 | Ga0495603_0433650 | Ga0495603_0433650_311_739 | 141 |
| 620 | 3300046457 | Ga0495590_0002936 | Ga0495590_0002936_5953_6393 | 141 |
| 621 | 3300046459 | Ga0495629_0150890 | Ga0495629_0150890_794_1222 | 141 |
| 622 | 3300046459 | Ga0495629_0321511 | Ga0495629_0321511_228_686 | 141 |
| 623 | 3300046462 | Ga0495651_0096575 | Ga0495651_0096575_511_948 | 141 |
| 624 | 3300046472 | Ga0495580_0057935 | Ga0495580_0057935_931_1359 | 141 |
| 625 | 3300046474 | Ga0495605_0152786 | Ga0495605_0152786_206_634 | 141 |
| 626 | 3300046475 | Ga0495639_0001048 | Ga0495639_0001048_4293_4751 | 141 |
| 627 | 3300046476 | Ga0495662_0056812 | Ga0495662_0056812_359_787 | 141 |
| 628 | 3300046476 | Ga0495662_0076915 | Ga0495662_0076915_1052_1480 | 141 |
| 629 | 3300046477 | Ga0495664_0022059 | Ga0495664_0022059_530_958 | 141 |
| 630 | 3300046477 | Ga0495664_0184942 | Ga0495664_0184942_588_1016 | 141 |
| 631 | 3300046491 | Ga0495584_0486353 | Ga0495584_0486353_81_509 | 141 |
| 632 | 3300046492 | Ga0495585_0052822 | Ga0495585_0052822_1398_1826 | 141 |
| 633 | 3300046507 | Ga0495606_0502671 | Ga0495606_0502671_134_562 | 141 |
| 634 | 3300046513 | Ga0495616_0070065 | Ga0495616_0070065_830_1258 | 141 |
| 635 | 3300046514 | Ga0495618_0008560 | Ga0495618_0008560_276_704 | 141 |
| 636 | 3300046514 | Ga0495618_0296755 | Ga0495618_0296755_543_980 | 141 |
| 637 | 3300046514 | Ga0495618_0319818 | Ga0495618_0319818_523_951 | 141 |
| 638 | 3300046516 | Ga0495628_0032340 | Ga0495628_0032340_2550_2978 | 141 |
| 639 | 3300046516 | Ga0495628_0043271 | Ga0495628_0043271_2479_2910 | 141 |
| 640 | 3300046516 | Ga0495628_1092827 | Ga0495628_1092827_71_514 | 141 |
| 641 | 3300046517 | Ga0495630_0000460 | Ga0495630_0000460_13511_13939 | 141 |
| 642 | 3300046517 | Ga0495630_0049702 | Ga0495630_0049702_1145_1573 | 141 |
| 643 | 3300046518 | Ga0495631_0073578 | Ga0495631_0073578_921_1349 | 141 |
| 644 | 3300046528 | Ga0495642_0416435 | Ga0495642_0416435_70_513 | 141 |
| 645 | 3300046529 | Ga0495652_0205047 | Ga0495652_0205047_850_1281 | 141 |
| 646 | 3300046529 | Ga0495652_0249116 | Ga0495652_0249116_329_757 | 141 |
| 647 | 3300046529 | Ga0495652_0356081 | Ga0495652_0356081_70_498 | 141 |
| 648 | 3300046529 | Ga0495652_0623858 | Ga0495652_0623858_172_600 | 141 |
| 649 | 3300046531 | Ga0495665_0011893 | Ga0495665_0011893_3248_3676 | 141 |
| 650 | 3300046531 | Ga0495665_0015225 | Ga0495665_0015225_2303_2734 | 141 |
| 651 | 3300046533 | Ga0495640_0022904 | Ga0495640_0022904_3463_3891 | 141 |
| 652 | 3300046533 | Ga0495640_0067599 | Ga0495640_0067599_766_1194 | 141 |
| 653 | 3300046535 | Ga0495586_0239182 | Ga0495586_0239182_328_756 | 141 |
| 654 | 3300046535 | Ga0495586_0259408 | Ga0495586_0259408_230_661 | 141 |
| 655 | 3300046539 | Ga0495621_0009424 | Ga0495621_0009424_715_1143 | 141 |
| 656 | 3300046539 | Ga0495621_0119973 | Ga0495621_0119973_369_797 | 141 |
| 657 | 3300046539 | Ga0495621_0207108 | Ga0495621_0207108_44_469 | 141 |
| 658 | 3300046539 | Ga0495621_0351117 | Ga0495621_0351117_108_557 | 141 |
| 659 | 3300046543 | Ga0495645_0003040 | Ga0495645_0003040_40_468 | 141 |
| 660 | 3300046543 | Ga0495645_0333548 | Ga0495645_0333548_264_692 | 141 |
| 661 | 3300046558 | Ga0495633_0047090 | Ga0495633_0047090_97_525 | 141 |
| 662 | 3300046615 | Ga0495656_0010263 | Ga0495656_0010263_1467_1895 | 141 |
| 663 | 3300046615 | Ga0495656_0010373 | Ga0495656_0010373_2550_2999 | 141 |
| 664 | 3300046642 | Ga0495634_0088624 | Ga0495634_0088624_1004_1432 | 141 |
| 665 | 3300046648 | Ga0495611_0031872 | Ga0495611_0031872_201_629 | 141 |
| 666 | 3300046663 | Ga0495635_0008319 | Ga0495635_0008319_6649_7077 | 141 |
| 667 | 3300046663 | Ga0495635_0206764 | Ga0495635_0206764_504_932 | 141 |
| 668 | 3300046664 | Ga0495659_0046384 | Ga0495659_0046384_355_783 | 141 |
| 669 | 3300046674 | Ga0495588_0028535 | Ga0495588_0028535_2239_2697 | 141 |
| 670 | 3300046675 | Ga0495657_0456808 | Ga0495657_0456808_216_674 | 141 |
| 671 | 3300046678 | Ga0495599_0028768 | Ga0495599_0028768_2856_3284 | 141 |
| 672 | 3300046678 | Ga0495599_0225868 | Ga0495599_0225868_492_923 | 141 |
| 673 | 3300046681 | Ga0495647_0041383 | Ga0495647_0041383_192_620 | 141 |
| 674 | 3300046681 | Ga0495647_0097526 | Ga0495647_0097526_699_1124 | 141 |
| 675 | 3300046683 | Ga0495658_0175848 | Ga0495658_0175848_739_1167 | 141 |
| 676 | 3300046683 | Ga0495658_0533064 | Ga0495658_0533064_222_647 | 141 |
| 677 | 3300046689 | Ga0495613_0029168 | Ga0495613_0029168_75_506 | 141 |
| 678 | 3300046689 | Ga0495613_0036947 | Ga0495613_0036947_1104_1532 | 141 |
| 679 | 3300046690 | Ga0495624_0000895 | Ga0495624_0000895_4539_4967 | 141 |
| 680 | 3300046690 | Ga0495624_0401192 | Ga0495624_0401192_168_596 | 141 |
| 681 | 3300046691 | Ga0495670_0036200 | Ga0495670_0036200_1572_2000 | 141 |
| 682 | 3300046691 | Ga0495670_0477958 | Ga0495670_0477958_38_496 | 141 |
| 683 | 3300046794 | Ga0495589_0090201 | Ga0495589_0090201_129_557 | 141 |
| 684 | 3300046809 | Ga0495600_0286723 | Ga0495600_0286723_253_696 | 141 |
| 685 | 3300046809 | Ga0495600_0466130 | Ga0495600_0466130_22_450 | 141 |
| 686 | 3300046809 | Ga0495600_0523167 | Ga0495600_0523167_116_577 | 141 |
| 687 | 3300046810 | Ga0495660_0047087 | Ga0495660_0047087_1508_1948 | 141 |
| 688 | 3300047315 | Ga0495581_0001700 | Ga0495581_0001700_11213_11641 | 141 |
| 689 | 3300047315 | Ga0495581_0115636 | Ga0495581_0115636_255_683 | 141 |
| 690 | 3300047318 | Ga0495636_0316253 | Ga0495636_0316253_77_505 | 141 |
| 691 | 3300047319 | Ga0495674_0025064 | Ga0495674_0025064_4440_4868 | 141 |
| 692 | 3300047320 | Ga0495672_0084979 | Ga0495672_0084979_84_512 | 141 |
| 693 | 3300047321 | Ga0495676_0054763 | Ga0495676_0054763_1947_2375 | 141 |
| 694 | 3300047322 | Ga0495680_0279848 | Ga0495680_0279848_120_548 | 141 |
| 695 | 3300047469 | Ga0495673_0033331 | Ga0495673_0033331_1412_1840 | 141 |
| 696 | 3300047471 | Ga0495684_0001671 | Ga0495684_0001671_10410_10838 | 141 |
| 697 | 3300047471 | Ga0495684_0012792 | Ga0495684_0012792_277_705 | 141 |
| 698 | 3300047471 | Ga0495684_0066998 | Ga0495684_0066998_1911_2339 | 141 |
| 699 | 3300047472 | Ga0495686_0460053 | Ga0495686_0460053_176_604 | 141 |
| 700 | 3300047673 | Ga0495593_0039096 | Ga0495593_0039096_38_466 | 141 |
| 701 | 3300048088 | Ga0495602_1042723 | Ga0495602_1042723_42_491 | 141 |
| 702 | 3300048088 | Ga0495602_1069548 | Ga0495602_1069548_56_517 | 141 |
| 703 | 3300048090 | Ga0495615_0003003 | Ga0495615_0003003_2229_2678 | 141 |
| 704 | 3300048090 | Ga0495615_0285168 | Ga0495615_0285168_30_458 | 141 |
| 705 | 3300048903 | Ga0496100_0003967 | Ga0496100_0003967_7213_7671 | 141 |
| 706 | 3300048905 | Ga0496102_0000994 | Ga0496102_0000994_25054_25512 | 141 |
| 707 | 3300048905 | Ga0496102_1686250 | Ga0496102_1686250_105_536 | 141 |
| 708 | 3300048906 | Ga0496103_0017088 | Ga0496103_0017088_179_637 | 141 |
| 709 | 3300048907 | Ga0496104_0000657 | Ga0496104_0000657_20595_21023 | 141 |
| 710 | 3300048907 | Ga0496104_0008348 | Ga0496104_0008348_7371_7802 | 141 |
| 711 | 3300048907 | Ga0496104_0012907 | Ga0496104_0012907_6308_6736 | 141 |
| 712 | 3300048907 | Ga0496104_0020758 | Ga0496104_0020758_653_1111 | 141 |
| 713 | 3300048907 | Ga0496104_0070361 | Ga0496104_0070361_2613_3038 | 141 |
| 714 | 3300048908 | Ga0496105_0001560 | Ga0496105_0001560_3405_3836 | 141 |
| 715 | 3300048908 | Ga0496105_0007805 | Ga0496105_0007805_6007_6465 | 141 |
| 716 | 3300048908 | Ga0496105_0097024 | Ga0496105_0097024_740_1165 | 141 |
| 717 | 3300048908 | Ga0496105_0379200 | Ga0496105_0379200_293_721 | 141 |
| 718 | 3300048909 | Ga0496106_0007931 | Ga0496106_0007931_660_1118 | 141 |
| 719 | 3300048909 | Ga0496106_0042963 | Ga0496106_0042963_978_1403 | 141 |
| 720 | 3300048909 | Ga0496106_0170072 | Ga0496106_0170072_720_1148 | 141 |
| 721 | 3300048909 | Ga0496106_1263946 | Ga0496106_1263946_66_494 | 141 |
| 722 | 3300048910 | Ga0496107_0090582 | Ga0496107_0090582_856_1281 | 141 |
| 723 | 3300048911 | Ga0496108_0003424 | Ga0496108_0003424_9938_10363 | 141 |
| 724 | 3300048911 | Ga0496108_0005441 | Ga0496108_0005441_6806_7237 | 141 |
| 725 | 3300048911 | Ga0496108_0034043 | Ga0496108_0034043_3129_3572 | 141 |
| 726 | 3300048912 | Ga0496109_0002056 | Ga0496109_0002056_13201_13632 | 141 |
| 727 | 3300048912 | Ga0496109_0005269 | Ga0496109_0005269_5531_5956 | 141 |
| 728 | 3300048913 | Ga0496110_0007968 | Ga0496110_0007968_3969_4400 | 141 |
| 729 | 3300048913 | Ga0496110_0015577 | Ga0496110_0015577_5042_5500 | 141 |
| 730 | 3300048913 | Ga0496110_0041091 | Ga0496110_0041091_2814_3239 | 141 |
| 731 | 3300048913 | Ga0496110_0065837 | Ga0496110_0065837_2217_2660 | 141 |
| 732 | 3300048913 | Ga0496110_0381707 | Ga0496110_0381707_23_451 | 141 |
| 733 | 3300048914 | Ga0496111_0003114 | Ga0496111_0003114_3503_3934 | 141 |
| 734 | 3300048914 | Ga0496111_0029149 | Ga0496111_0029149_937_1395 | 141 |
| 735 | 3300048914 | Ga0496111_0070447 | Ga0496111_0070447_259_702 | 141 |
| 736 | 3300048914 | Ga0496111_0107366 | Ga0496111_0107366_914_1339 | 141 |
| 737 | 3300048914 | Ga0496111_0233204 | Ga0496111_0233204_556_984 | 141 |
| 738 | 3300048915 | Ga0496112_1611858 | Ga0496112_1611858_36_494 | 141 |
| 739 | 3300048915 | Ga0496112_1691615 | Ga0496112_1691615_94_522 | 141 |
| 740 | 3300048916 | Ga0496113_0029631 | Ga0496113_0029631_89_517 | 141 |
| 741 | 3300048916 | Ga0496113_0116740 | Ga0496113_0116740_503_946 | 141 |
| 742 | 3300048916 | Ga0496113_0245115 | Ga0496113_0245115_771_1196 | 141 |
| 743 | 3300048916 | Ga0496113_0751346 | Ga0496113_0751346_225_683 | 141 |
| 744 | 3300048917 | Ga0496114_0028014 | Ga0496114_0028014_3705_4163 | 141 |
| 745 | 3300048918 | Ga0496115_0060669 | Ga0496115_0060669_184_612 | 141 |
| 746 | 3300048918 | Ga0496115_0354118 | Ga0496115_0354118_322_747 | 141 |
| 747 | 3300048920 | Ga0496117_0005496 | Ga0496117_0005496_564_992 | 141 |
| 748 | 3300048921 | Ga0496118_0001246 | Ga0496118_0001246_18510_18938 | 141 |
| 749 | 3300048921 | Ga0496118_0379450 | Ga0496118_0379450_210_683 | 141 |
| 750 | 3300049572 | Ga0501036_1326535 | Ga0501036_1326535_73_513 | 141 |
| 751 | 3300049576 | Ga0501040_0516892 | Ga0501040_0516892_10_435 | 141 |
| 752 | 3300049578 | Ga0501042_1210301 | Ga0501042_1210301_98_526 | 141 |
| 753 | 3300049582 | Ga0501048_0176832 | Ga0501048_0176832_37_465 | 141 |
| 754 | 3300049583 | Ga0501067_0028701 | Ga0501067_0028701_39_482 | 141 |
| 755 | 3300049584 | Ga0501068_0135075 | Ga0501068_0135075_1092_1532 | 141 |
| 756 | 3300049585 | Ga0501069_0001252 | Ga0501069_0001252_7996_8436 | 141 |
| 757 | 3300049586 | Ga0501070_0000975 | Ga0501070_0000975_17521_17961 | 141 |
| 758 | 3300049587 | Ga0501071_0377625 | Ga0501071_0377625_490_918 | 141 |
| 759 | 3300049588 | Ga0501072_0074230 | Ga0501072_0074230_1727_2155 | 141 |
| 760 | 3300049588 | Ga0501072_0108564 | Ga0501072_0108564_520_960 | 141 |
| 761 | 3300049589 | Ga0501073_0429890 | Ga0501073_0429890_399_839 | 141 |
| 762 | 3300049590 | Ga0501074_0001937 | Ga0501074_0001937_7875_8315 | 141 |
| 763 | 3300049591 | Ga0501075_0378220 | Ga0501075_0378220_178_606 | 141 |
| 764 | 3300049592 | Ga0501076_0519913 | Ga0501076_0519913_471_899 | 141 |
| 765 | 3300049592 | Ga0501076_0571342 | Ga0501076_0571342_422_862 | 141 |
| 766 | 3300049741 | Ga0501079_0199262 | Ga0501079_0199262_450_890 | 141 |
| 767 | 3300049741 | Ga0501079_0746348 | Ga0501079_0746348_59_487 | 141 |
| 768 | 3300049742 | Ga0501080_0042208 | Ga0501080_0042208_2557_2985 | 141 |
| 769 | 3300049742 | Ga0501080_0682983 | Ga0501080_0682983_68_508 | 141 |
| 770 | 3300049744 | Ga0501083_0002623 | Ga0501083_0002623_5787_6227 | 141 |
| 771 | 3300049822 | Ga0501035_0535963 | Ga0501035_0535963_122_562 | 141 |
| 772 | 3300049823 | Ga0501044_0202668 | Ga0501044_0202668_281_709 | 141 |
| 773 | 3300049823 | Ga0501044_0235188 | Ga0501044_0235188_1266_1706 | 141 |
| 774 | 3300050511 | nmdc:mga08y16_2052421_c1 | nmdc:mga08y16_2052421_c1_40_468 | 141 |
| 775 | 3300050512 | nmdc:mga0n895_217394_c1 | nmdc:mga0n895_217394_c1_447_875 | 141 |
| 776 | 3300050512 | nmdc:mga0n895_399039_c1 | nmdc:mga0n895_399039_c1_407_838 | 141 |
| 777 | 3300050513 | nmdc:mga0rr50_91268_c1 | nmdc:mga0rr50_91268_c1_77_529 | 141 |
| 778 | 3300050514 | nmdc:mga08x19_4495_c1 | nmdc:mga08x19_4495_c1_933_1385 | 141 |
| 779 | 3300050514 | nmdc:mga08x19_544375_c1 | nmdc:mga08x19_544375_c1_118_546 | 141 |
| 780 | 3300050514 | nmdc:mga08x19_86373_c1 | nmdc:mga08x19_86373_c1_1065_1499 | 141 |
| 781 | 3300050515 | nmdc:mga0a205_42957_c1 | nmdc:mga0a205_42957_c1_263_691 | 141 |
| 782 | 3300053077 | Ga0495601_0010085 | Ga0495601_0010085_4973_5404 | 141 |
| 783 | 3300053077 | Ga0495601_0020426 | Ga0495601_0020426_608_1036 | 141 |
| 784 | 3300053077 | Ga0495601_0020946 | Ga0495601_0020946_2661_3089 | 141 |
| 785 | 3300053078 | Ga0495612_0005114 | Ga0495612_0005114_469_897 | 141 |
| 786 | 3300053078 | Ga0495612_0105716 | Ga0495612_0105716_449_877 | 141 |
| 787 | 3300053094 | Ga0500566_0351867 | Ga0500566_0351867_61_489 | 141 |
| 788 | 3300053134 | Ga0500658_0155354 | Ga0500658_0155354_134_562 | 141 |
| 789 | 3300053158 | Ga0500627_0189190 | Ga0500627_0189190_292_723 | 141 |
| 790 | 3300053159 | Ga0500630_135918 | Ga0500630_135918_264_695 | 141 |
| 791 | 3300054114 | Ga0501084_0232713 | Ga0501084_0232713_407_835 | 141 |
| 792 | 3300059423 | Ga0590074_011785 | Ga0590074_011785_698_1132 | 141 |
| 793 | 3300060353 | Ga0501082_0710891 | Ga0501082_0710891_234_674 | 141 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p1x-assembly1.cif.gz_AAA | tarm(se)_g117r-udp-glucose | 0.7517 | 58 | 99 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7327 | 4 | 107 |
| 7qnt-assembly1.cif.gz_AAA | tarm(se) native | 0.6864 | 60 | 101 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.6818 | 4 | 107 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.6586 | 1 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54X87_13_141_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7599 | 4 | 113 | 2.170.150.70 |
| af_A0A0P0Y585_51_153_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.7573 | 58 | 88 | 2.40.70.10 |
| af_Q54VC9_11_133_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7423 | 5 | 113 | 2.170.150.70 |
| af_A0A1D6EPM0_14_114_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7363 | 4 | 104 | 2.170.150.70 |
| 3facD00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7311 | 4 | 107 | 2.170.150.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536YZH5-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9846 | 1 | 139 |
GO:0016846
GO:0046872 |
| AF-F8C8H7-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9812 | 1 | 141 |
GO:0016846
GO:0046872 |
| AF-A0A522JPP6-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9781 | 1 | 141 |
GO:0016846
GO:0046872 |
| AF-A0A1U9JPG2-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.978 | 1 | 141 |
GO:0016846
GO:0046872 |
| AF-F8C8H7-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9744 | 1 | 141 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar