metagRoot

F481028

General Info

Members	Datasets	Scaffolds	Average Seq Length
792	558	566	273

Family's Representative Sequence

Representative Sequence	3300035090\|Ga0373949_0006316\|Ga0373949_0006316_303_1220
Length	305
Sequence	MADDVHAPAQAPLPAAIVIGTTAEAPRRLTPGGALRRAGFYALVAAIVLYAVFPFYYAILTSLKSGSELFRIDYFPFRWEFGNYASVFRGQPFGTNILNSLIVATSVVALSLFLGVTAAFALARIQFRGRSTLLVTILGVSMFPQVAVLSGMFQLIRILHQFNHLGALVISYMIFTLPFTVWVLTTFMRELPKELEEAAILDGATAWTIVRRVFLPLMWPALVTTGLLAFIAAWNEFLFALTFTLTNDERTVPVGIAVMSGASAHETPWGNIMAASVIVTVPLVILVLIFQRRIVSGLTAGAVKG

Samples

	Sample ID	Description	Type	Environment
1	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
2	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
3	2510917027	Brevibacillus sp. CF112	Isolate	Rhizosphere
4	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
5	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
6	2512564013	Brevibacillus sp. BC25	Isolate	Rhizosphere
7	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
8	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
9	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
10	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
11	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
12	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
13	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
14	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
15	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
16	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
17	2522572158	Azospirillum halopraeferens DSM 3675	Isolate	Unclassified
18	2534681786	Brucella suis 92/29	Isolate	Unclassified
19	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
20	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
21	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
22	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
23	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
24	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
25	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
26	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
27	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
28	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
29	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
30	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
31	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
32	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
33	2597490356	Azospirillum brasilense sp7	Isolate	Unclassified
34	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
35	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
36	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
37	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
38	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
39	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
40	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
41	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
42	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
43	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
44	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
45	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
46	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
47	2718217882	Rhizobium sp. N741	Isolate	Nodule
48	2718217927	Rhizobium sp. N324	Isolate	Nodule
49	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
50	2718218009	Rhizobium sp. N561	Isolate	Nodule
51	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
52	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
53	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
54	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
55	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
56	2718218363	Rhizobium sp. N113	Isolate	Nodule
57	2718218365	Rhizobium sp. N731	Isolate	Nodule
58	2718218366	Rhizobium sp. N621	Isolate	Nodule
59	2718218423	Rhizobium sp. N941	Isolate	Nodule
60	2721755514	Rhizobium sp. N6212	Isolate	Nodule
61	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
62	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
63	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
64	2721755809	Rhizobium sp. N541	Isolate	Nodule
65	2721755810	Rhizobium sp. N871	Isolate	Nodule
66	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
67	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
68	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
69	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
70	2728369365	Rhizobium sp. N1341	Isolate	Nodule
71	2728369397	Rhizobium sp. N1314	Isolate	Nodule
72	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
73	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
74	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
75	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
76	2791355260	Rhizobium sp. L9	Isolate	Nodule
77	2791355261	Rhizobium sp. J15	Isolate	Nodule
78	2791355262	Rhizobium sp. M1	Isolate	Nodule
79	2791355264	Rhizobium sp. S9	Isolate	Nodule
80	2791355266	Rhizobium sp. L43	Isolate	Nodule
81	2791355267	Rhizobium sp. L18	Isolate	Nodule
82	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
83	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
84	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
85	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
86	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
87	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
88	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
89	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
90	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
91	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
92	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
93	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
94	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
95	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
96	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
97	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
98	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
99	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
100	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
101	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
102	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
103	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
104	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
105	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
106	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
107	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
108	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
109	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
110	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
111	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
112	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
113	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
114	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
115	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
116	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
117	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
118	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
119	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
120	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
121	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
122	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
123	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
124	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
125	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
126	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
127	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
128	2842333319	Skermanella aerolata SEMIA 4010	Isolate	Nodule
129	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
130	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
131	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
132	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
133	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
134	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
135	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
136	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
137	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
138	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
139	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
140	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
141	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
142	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
143	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
144	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
145	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
146	2846952575	Azospirillum brasilense sp7	Isolate	Unclassified
147	2848858292	Azospirillum brasilense Az39	Isolate	Unclassified
148	2854681122	Luteovulum sphaeroides SCJ	Isolate	Unclassified
149	2857465823	Brevibacillus sp. R-74266	Isolate	Unclassified
150	2857591370	Brevibacillus sp. R-71934	Isolate	Unclassified
151	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
152	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
153	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
154	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
155	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
156	2898907183	Brevibacillus sp. SYP-B805	Isolate	Rhizosphere
157	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
158	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
159	2909042592	Labrys sp. LIt4	Isolate	Nodule
160	2915597211	Brevibacillus brevis Ag35	Isolate	Nodule
161	2915606848	Brevibacillus sp. HD1.4A	Isolate	Rhizosphere
162	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
163	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
164	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
165	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
166	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
167	2919414237	Neobacillus niacini 3240	Isolate	Rhizosphere
168	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
169	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
170	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
171	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
172	2929183550	Brevibacillus sp. R-71971 Hybrid assembly	Isolate	Unclassified
173	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
174	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
175	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
176	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
177	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
178	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
179	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
180	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
181	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
182	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
183	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
184	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
185	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
186	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
187	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
188	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
189	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
190	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
191	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
192	2990275345	Bacillus sp. SLBN-46	Isolate	Unclassified
193	2996887358	Rhizobium sp. R711	Isolate	Nodule
194	2996893221	Rhizobium sp. R635	Isolate	Nodule
195	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
196	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
197	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
198	3006973921	Bacillus sp. FJAT-49736	Isolate	Rhizosphere
199	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
200	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
201	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
202	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
203	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
204	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
205	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
206	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
207	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
208	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
209	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
210	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
211	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
212	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
213	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
214	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
215	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
216	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
217	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
218	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
219	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
220	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
221	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
222	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
223	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
224	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
225	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
226	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
227	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
228	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
229	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
230	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
231	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
232	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
233	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
234	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
235	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
236	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
237	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
238	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
239	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
240	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
241	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
242	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
243	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
244	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
245	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
246	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
247	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
248	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
249	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
250	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
251	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
252	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
253	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
254	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
255	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
256	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
257	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
258	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
259	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
260	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
261	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
262	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
263	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
264	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
265	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
266	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
267	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
268	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
269	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
270	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
271	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
272	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
273	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
274	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
275	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
276	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
277	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
278	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
279	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
280	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
281	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
282	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
283	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
284	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
285	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
286	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
287	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
288	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
289	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
290	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
291	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
292	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
293	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
294	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
295	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
296	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
297	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
298	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
299	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
301	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
302	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
304	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
306	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
307	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
309	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
310	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
343	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
344	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
345	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
349	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
350	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
351	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
352	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
353	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
354	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
355	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
356	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
357	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
358	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
359	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
360	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
361	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
362	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
363	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
364	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
365	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
366	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
367	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
368	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
369	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
370	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
371	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
372	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
373	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
374	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
375	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
376	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
377	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
378	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
379	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
380	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
381	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
382	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
383	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
384	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
385	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
386	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
387	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
388	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
389	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
390	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
391	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
392	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
393	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
394	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
395	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
396	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
397	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
398	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
399	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
400	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
401	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
402	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
403	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
404	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
405	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
406	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
407	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
408	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
409	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
410	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
411	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
412	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
413	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
414	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
415	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
416	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
417	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
418	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
419	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
420	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
421	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
422	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
423	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
424	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
425	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
426	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
427	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
428	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
429	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
430	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
431	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
432	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
433	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
434	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
435	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
436	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
437	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
438	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
439	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
440	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
441	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
442	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
443	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
444	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
445	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
446	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
447	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
448	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
449	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
450	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
451	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
452	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
453	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
454	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
455	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
456	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
457	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
458	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
459	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
460	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
461	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
462	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
463	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
464	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
465	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
466	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
467	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
468	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
469	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
470	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
471	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
472	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
473	3300049524	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control	Metagenome	Rhizosphere
474	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
475	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
476	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
477	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
478	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
479	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
480	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
481	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
482	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
483	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
484	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
485	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
486	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
487	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
488	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
489	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
490	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
491	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
492	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
493	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
494	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
495	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
496	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
497	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
498	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
500	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
501	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
502	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
503	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
504	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
505	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
506	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
507	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
508	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
509	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
510	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
511	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
512	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
513	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
514	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
515	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
516	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
517	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
518	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
519	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
520	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
521	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
522	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
523	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
524	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
525	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
526	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
527	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
528	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
529	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
530	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
531	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
532	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
533	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
534	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
535	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
536	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
537	8005258706	Rhizobium sp. R693	Isolate	Nodule
538	8005275841	Rhizobium sp. N4311	Isolate	Nodule
539	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
540	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
541	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
542	8005321885	Rhizobium sp. R72	Isolate	Nodule
543	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
544	8005382845	Rhizobium sp. R634	Isolate	Nodule
545	8005395548	Rhizobium sp. R339	Isolate	Nodule
546	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
547	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
548	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
549	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
550	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
551	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
552	8007371054	Clostridium sp. YIM B02515	Isolate	Unclassified
553	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
554	8018176218	Rhizobium sp. N122	Isolate	Nodule
555	8024501048	Rhizobium sp. H4	Isolate	Nodule
556	8054280661	Metabacillus kandeliae GX 13764	Isolate	Rhizosphere
557	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
558	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	71.09
Metatranscriptomes	0.51
Isolates	28.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0.76
Bulb	0
Endosphere	20.33
Nodule	17.05
Rhizoplane	1.01
Rhizosphere	46.72
Stem	0
Stem Tuber	0
Unclassified	14.14

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25156J39149_1000151	3300002705	Bacteria	51549
2	JGI25154J39366_1000881	3300002738	Bacteria	12856
3	JGI25158J39367_1000155	3300002739	Bacteria	16080
4	JGI25157J39369_1000193	3300002741	Bacteria	51549
5	JGI25152J39213_1000741	3300002773	Bacteria	16678
6	JGI25152J39213_1003577	3300002773	Bacteria	5262
7	JGI25152J39213_1007263	3300002773	Bacteria	2894
8	JGI25152J39213_1008310	3300002773	Bacteria	2586
9	JGI25150J39212_1000164	3300002774	Bacteria	37406
10	JGI25150J39212_1008877	3300002774	Bacteria	1943
11	JGI25150J39212_1009279	3300002774	Bacteria	1883
12	JGI25150J39212_1012793	3300002774	Bacteria	1472
13	JGI25159J45721_1002060	3300002987	Bacteria	7945
14	JGI25159J45721_1012077	3300002987	Bacteria	2079
15	JGI25159J45721_1022354	3300002987	Bacteria	1171
16	JGI25151J46595_10000201	3300003187	Bacteria	73412
17	JGI25151J46595_10001754	3300003187	Bacteria	14052
18	JGI25151J46595_10007042	3300003187	Bacteria	5562
19	JGI25151J46595_10010370	3300003187	Bacteria	4340
20	JGI25151J46595_10038938	3300003187	Bacteria	1762
21	JGI25153J46596_10000223	3300003215	Bacteria	49001
22	JGI25153J46596_10000641	3300003215	Bacteria	21344
23	JGI25153J46596_10003581	3300003215	Bacteria	8629
24	JGI25153J46596_10016931	3300003215	Bacteria	2894
25	JGI25153J46596_10019591	3300003215	Bacteria	2586
26	rootL2_10004230	3300003322	Bacteria	6386
27	rootH1_10020005	3300003323	Bacteria	2235
28	rootH1_10042812	3300003323	Bacteria	2208
29	rootH1_10074181	3300003323	Bacteria	1085
30	JGI25160J50197_1002466	3300003354	Bacteria	8610
31	JGI25160J50197_1006362	3300003354	Bacteria	4791
32	JGI25161J50226_1000025	3300003374	Bacteria	148471
33	JGI25161J50226_1001853	3300003374	Bacteria	5919
34	Ga0055539_1000768	3300003752	Bacteria	7769
35	Ga0055535_1007708	3300003761	Bacteria	2025
36	Ga0055526_1000437	3300003771	Bacteria	33303
37	Ga0055526_1001701	3300003771	Bacteria	15369
38	Ga0055526_1007747	3300003771	Bacteria	5512
39	Ga0055526_1016113	3300003771	Bacteria	2949
40	Ga0055524_1002501	3300003775	Bacteria	9451
41	Ga0055524_1017183	3300003775	Bacteria	2562
42	Ga0055528_1001223	3300003790	Bacteria	16414
43	Ga0055528_1001284	3300003790	Bacteria	15768
44	Ga0055540_1014171	3300003792	Bacteria	2391
45	Ga0058692_1000427	3300003856	Bacteria	19380
46	Ga0058692_1004100	3300003856	Bacteria	4375
47	Ga0055543_1000427	3300004625	Bacteria	26126
48	Ga0055543_1003318	3300004625	Bacteria	4817
49	Ga0065165_1010076	3300005262	Bacteria	4145
50	Ga0065712_10126895	3300005290	Bacteria	1596
51	Ga0065715_10007470	3300005293	Bacteria	2987
52	Ga0070690_100009031	3300005330	Bacteria	5764
53	Ga0070690_100017026	3300005330	Bacteria	4363
54	Ga0068869_100010892	3300005334	Bacteria	5948
55	Ga0068869_100091789	3300005334	Bacteria	2285
56	Ga0070666_10258097	3300005335	Bacteria	1235
57	Ga0070682_100242623	3300005337	Bacteria	1294
58	Ga0070689_100007290	3300005340	Bacteria	7713
59	Ga0070689_100055388	3300005340	Bacteria	3073
60	Ga0070689_100120917	3300005340	Bacteria	2091
61	Ga0070687_100151731	3300005343	Bacteria	1361
62	Ga0070661_100004138	3300005344	Bacteria	10004
63	Ga0070668_100035874	3300005347	Bacteria	3784
64	Ga0070669_100077317	3300005353	Bacteria	2472
65	Ga0070669_100255455	3300005353	Bacteria	1397
66	Ga0070671_100011357	3300005355	Bacteria	7160
67	Ga0070688_100176062	3300005365	Bacteria	1480
68	Ga0070659_100002424	3300005366	Bacteria	13249
69	Ga0070659_100152671	3300005366	Bacteria	1885
70	Ga0070700_100030440	3300005441	Bacteria	3226
71	Ga0070663_100005375	3300005455	Bacteria	7607
72	Ga0070678_100159707	3300005456	Bacteria	1825
73	Ga0070662_100114821	3300005457	Bacteria	2056
74	Ga0068867_100000031	3300005459	Bacteria	85969
75	Ga0070706_100034063	3300005467	Bacteria	4702
76	Ga0070706_100055271	3300005467	Bacteria	3664
77	Ga0070707_100097947	3300005468	Bacteria	2841
78	Ga0070699_100103821	3300005518	Bacteria	2492
79	Ga0070684_100261293	3300005535	Bacteria	1584
80	Ga0068853_100057149	3300005539	Bacteria	3366
81	Ga0070696_100112267	3300005546	Bacteria	1964
82	Ga0068855_100232673	3300005563	Bacteria	2062
83	Ga0070664_100003257	3300005564	Bacteria	13114
84	Ga0068857_100048312	3300005577	Bacteria	3778
85	Ga0068857_100670623	3300005577	Bacteria	984
86	Ga0068856_100001527	3300005614	Bacteria	24261
87	Ga0070702_100021213	3300005615	Bacteria	3415
88	Ga0068852_100453358	3300005616	Bacteria	1270
89	Ga0068864_100371001	3300005618	Bacteria	1354
90	Ga0068861_100020341	3300005719	Bacteria	4752
91	Ga0068851_10149159	3300005834	Bacteria	1277
92	Ga0068863_100036977	3300005841	Bacteria	4649
93	Ga0068860_100056641	3300005843	Bacteria	3726
94	Ga0081455_10095025	3300005937	Bacteria	2406
95	Ga0081455_10176996	3300005937	Bacteria	1619
96	Ga0081538_10005839	3300005981	Bacteria	10967
97	Ga0081538_10011678	3300005981	Bacteria	7097
98	Ga0081538_10026117	3300005981	Bacteria	4094
99	Ga0081540_1020078	3300005983	Bacteria	4033
100	Ga0081540_1031991	3300005983	Bacteria	2880
101	Ga0070717_10120378	3300006028	Bacteria	2248
102	Ga0070717_10232162	3300006028	Bacteria	1625
103	Ga0075365_10000324	3300006038	Bacteria	16910
104	Ga0075365_10003997	3300006038	Bacteria	7731
105	Ga0075368_10001302	3300006042	Bacteria	7904
106	Ga0075362_10005020	3300006177	Bacteria	4805
107	Ga0075367_10001155	3300006178	Bacteria	11021
108	Ga0075369_10021602	3300006186	Bacteria	2647
109	Ga0075369_10027867	3300006186	Bacteria	2364
110	Ga0075369_10095826	3300006186	Bacteria	1328
111	Ga0075366_10010388	3300006195	Bacteria	5227
112	Ga0075366_10043272	3300006195	Bacteria	2667
113	Ga0075366_10174442	3300006195	Bacteria	1305
114	Ga0075370_10013860	3300006353	Bacteria	4289
115	Ga0075370_10052839	3300006353	Bacteria	2306
116	Ga0075370_10149298	3300006353	Bacteria	1369
117	Ga0075370_10167727	3300006353	Bacteria	1290
118	Ga0099826_10016091	3300006948	Bacteria	5645
119	Ga0099794_10083093	3300007265	Bacteria	1582
120	Ga0105250_10006715	3300009092	Bacteria	5000
121	Ga0105240_10005002	3300009093	Bacteria	19900
122	Ga0105240_10158769	3300009093	Bacteria	2688
123	Ga0111539_10000090	3300009094	Bacteria	94888
124	Ga0105245_10023813	3300009098	Bacteria	5375
125	Ga0105245_10093894	3300009098	Bacteria	2765
126	Ga0114129_10207258	3300009147	Bacteria	2652
127	Ga0114129_10347143	3300009147	Bacteria	1967
128	Ga0114129_10414098	3300009147	Bacteria	1774
129	Ga0105243_10005259	3300009148	Bacteria	10125
130	Ga0105243_10016832	3300009148	Bacteria	5526
131	Ga0105243_10203668	3300009148	Bacteria	1737
132	Ga0105242_10239730	3300009176	Bacteria	1630
133	Ga0105237_10000585	3300009545	Bacteria	50881
134	Ga0105238_10060888	3300009551	Bacteria	3778
135	Ga0105238_10066584	3300009551	Bacteria	3603
136	Ga0105249_10249195	3300009553	Bacteria	1760
137	Ga0123341_1001196	3300009765	Bacteria	18826
138	Ga0123342_1023700	3300009766	Bacteria	3944
139	Ga0123342_1040462	3300009766	Bacteria	1725
140	Ga0105239_10000598	3300010375	Bacteria	51483
141	Ga0105239_10555538	3300010375	Bacteria	1308
142	Ga0157373_10015096	3300013100	Bacteria	5648
143	Ga0157371_10000002	3300013102	Bacteria	665040
144	Ga0157371_10036742	3300013102	Bacteria	3508
145	Ga0157370_10000286	3300013104	Bacteria	64173
146	Ga0157369_10053572	3300013105	Bacteria	4359
147	Ga0157380_10196728	3300014326	Bacteria	1785
148	Ga0157377_10000428	3300014745	Bacteria	18177
149	Ga0213876_10007873	3300021384	Bacteria	5779
150	Ga0213876_10008967	3300021384	Bacteria	5391
151	Ga0209436_100017	3300025208	Bacteria	116238
152	Ga0209258_101466	3300025242	Bacteria	8199
153	Ga0207425_1000055	3300025245	Bacteria	152820
154	Ga0207425_1000121	3300025245	Bacteria	73749
155	Ga0207425_1000399	3300025245	Bacteria	29266
156	Ga0207425_1003344	3300025245	Bacteria	5179
157	Ga0207425_1003788	3300025245	Bacteria	4722
158	Ga0209646_1000261	3300025246	Bacteria	51612
159	Ga0209026_1000317	3300025250	Bacteria	51612
160	Ga0209677_100101	3300025253	Bacteria	91739
161	Ga0209759_1000422	3300025256	Bacteria	51612
162	Ga0209129_1000012	3300025258	Bacteria	541516
163	Ga0209129_1000029	3300025258	Bacteria	401149
164	Ga0209129_1000613	3300025258	Bacteria	24014
165	Ga0209129_1001106	3300025258	Bacteria	15713
166	Ga0209129_1004513	3300025258	Bacteria	5396
167	Ga0209129_1004811	3300025258	Bacteria	5091
168	Ga0209129_1007974	3300025258	Bacteria	3028
169	Ga0209565_1028096	3300025263	Bacteria	1114
170	Ga0209455_1024083	3300025272	Bacteria	1129
171	Ga0209673_1000105	3300025273	Bacteria	186267
172	Ga0209673_1000248	3300025273	Bacteria	102571
173	Ga0209673_1002738	3300025273	Bacteria	11593
174	Ga0209673_1002873	3300025273	Bacteria	10960
175	Ga0209673_1007020	3300025273	Bacteria	5295
176	Ga0209673_1013885	3300025273	Bacteria	3153
177	Ga0209673_1014458	3300025273	Bacteria	3052
178	Ga0209673_1018566	3300025273	Bacteria	2524
179	Ga0209673_1021064	3300025273	Bacteria	2290
180	Ga0209673_1024227	3300025273	Bacteria	2044
181	Ga0209130_1000001	3300025284	Bacteria	831557
182	Ga0209130_1000308	3300025284	Bacteria	58836
183	Ga0209130_1003197	3300025284	Bacteria	7232
184	Ga0209025_1000070	3300025294	Bacteria	287776
185	Ga0209025_1000456	3300025294	Bacteria	79848
186	Ga0209025_1001055	3300025294	Bacteria	40178
187	Ga0209025_1003568	3300025294	Bacteria	14560
188	Ga0209025_1003844	3300025294	Bacteria	13648
189	Ga0209025_1005517	3300025294	Bacteria	10270
190	Ga0209025_1011892	3300025294	Bacteria	5664
191	Ga0209025_1012157	3300025294	Bacteria	5559
192	Ga0209025_1044134	3300025294	Bacteria	1868
193	Ga0209564_1000022	3300025295	Bacteria	555109
194	Ga0209564_1000913	3300025295	Bacteria	38633
195	Ga0209564_1004080	3300025295	Bacteria	9203
196	Ga0209564_1008676	3300025295	Bacteria	4968
197	Ga0209564_1017050	3300025295	Bacteria	2856
198	Ga0209564_1026461	3300025295	Bacteria	1915
199	Ga0209758_1000094	3300025297	Bacteria	241068
200	Ga0209758_1000099	3300025297	Bacteria	230054
201	Ga0209758_1000380	3300025297	Bacteria	77252
202	Ga0209758_1001339	3300025297	Bacteria	29798
203	Ga0209758_1001563	3300025297	Bacteria	26250
204	Ga0209758_1003926	3300025297	Bacteria	12967
205	Ga0209758_1005128	3300025297	Bacteria	10344
206	Ga0209758_1008014	3300025297	Bacteria	6983
207	Ga0209758_1037226	3300025297	Bacteria	1883
208	Ga0209050_1000330	3300025298	Bacteria	94431
209	Ga0209050_1022534	3300025298	Bacteria	2254
210	Ga0209256_1000281	3300025299	Bacteria	89636
211	Ga0209256_1008087	3300025299	Bacteria	4968
212	Ga0209256_1015840	3300025299	Bacteria	2612
213	Ga0209256_1038728	3300025299	Bacteria	1232
214	Ga0207426_1000005	3300025302	Bacteria	1037188
215	Ga0207426_1000046	3300025302	Bacteria	422271
216	Ga0207426_1000088	3300025302	Bacteria	287526
217	Ga0207426_1000109	3300025302	Bacteria	238665
218	Ga0207426_1001714	3300025302	Bacteria	16806
219	Ga0209051_1000027	3300025303	Bacteria	412172
220	Ga0209051_1001918	3300025303	Bacteria	16139
221	Ga0209051_1002669	3300025303	Bacteria	12484
222	Ga0209051_1032954	3300025303	Bacteria	1967
223	Ga0209051_1073476	3300025303	Bacteria	1018
224	Ga0209257_1010769	3300025304	Bacteria	4548
225	Ga0209257_1014592	3300025304	Bacteria	3361
226	Ga0207656_10127452	3300025321	Bacteria	1190
227	Ga0207695_10002838	3300025913	Bacteria	25163
228	Ga0207695_10015162	3300025913	Bacteria	9087
229	Ga0207657_10036596	3300025919	Bacteria	4391
230	Ga0207649_10003749	3300025920	Bacteria	8289
231	Ga0207681_10113810	3300025923	Bacteria	1973
232	Ga0207694_10168443	3300025924	Bacteria	1772
233	Ga0207694_10439786	3300025924	Bacteria	1088
234	Ga0207687_10057866	3300025927	Bacteria	2725
235	Ga0207687_10064006	3300025927	Bacteria	2606
236	Ga0207644_10012434	3300025931	Bacteria	5653
237	Ga0207690_10001027	3300025932	Bacteria	17879
238	Ga0207690_10130104	3300025932	Bacteria	1841
239	Ga0207706_10142291	3300025933	Bacteria	2110
240	Ga0207709_10001383	3300025935	Bacteria	16988
241	Ga0207709_10202657	3300025935	Bacteria	1418
242	Ga0207670_10003655	3300025936	Bacteria	8165
243	Ga0207670_10038245	3300025936	Bacteria	3133
244	Ga0207670_10096215	3300025936	Bacteria	2105
245	Ga0207669_10212854	3300025937	Bacteria	1412
246	Ga0207689_10014466	3300025942	Bacteria	6712
247	Ga0207689_10020081	3300025942	Bacteria	5625
248	Ga0207689_10199222	3300025942	Bacteria	1653
249	Ga0207679_10000181	3300025945	Bacteria	51923
250	Ga0207679_10000402	3300025945	Bacteria	31013
251	Ga0207667_10067131	3300025949	Bacteria	3736
252	Ga0207667_10108465	3300025949	Bacteria	2864
253	Ga0207712_10053862	3300025961	Bacteria	2824
254	Ga0207668_10059458	3300025972	Bacteria	2678
255	Ga0207658_10163331	3300025986	Bacteria	1827
256	Ga0207703_10346357	3300026035	Bacteria	1367
257	Ga0207639_10324471	3300026041	Bacteria	1368
258	Ga0207678_10003746	3300026067	Bacteria	13682
259	Ga0207678_10076924	3300026067	Bacteria	2858
260	Ga0207708_10038150	3300026075	Bacteria	3660
261	Ga0207702_10001644	3300026078	Bacteria	22095
262	Ga0207641_10028105	3300026088	Bacteria	4645
263	Ga0207648_10000267	3300026089	Bacteria	56681
264	Ga0207676_10252668	3300026095	Bacteria	1588
265	Ga0207674_10006094	3300026116	Bacteria	14255
266	Ga0207675_100007581	3300026118	Bacteria	10251
267	Ga0207675_100092114	3300026118	Bacteria	2851
268	Ga0207683_10194174	3300026121	Bacteria	1844
269	Ga0207698_10018302	3300026142	Bacteria	4770
270	Ga0209371_1000012	3300027312	Bacteria	748304
271	Ga0209371_1002204	3300027312	Bacteria	11321
272	Ga0209282_1000140	3300027666	Bacteria	42807
273	Ga0209282_1013861	3300027666	Bacteria	5129
274	Ga0209813_10012515	3300027866	Bacteria	2246
275	Ga0207428_10000055	3300027907	Bacteria	166460
276	Ga0268266_10009914	3300028379	Bacteria	8368
277	Ga0268266_10363623	3300028379	Bacteria	1362
278	Ga0268265_10437208	3300028380	Bacteria	1219
279	Ga0268264_10040720	3300028381	Bacteria	3839
280	Ga0307515_10009675	3300028794	Bacteria	18595
281	Ga0268256_1000013	3300030500	Bacteria	752103
282	Ga0268256_1008850	3300030500	Bacteria	3407
283	Ga0316181_1032962	3300030744	Bacteria	4798
284	Ga0265332_10002486	3300031238	Bacteria	9379
285	Ga0307513_10121087	3300031456	Bacteria	2584
286	Ga0307513_10297313	3300031456	Bacteria	1383
287	Ga0307509_10015289	3300031507	Bacteria	8965
288	Ga0307509_10088756	3300031507	Bacteria	3173
289	Ga0307509_10105003	3300031507	Bacteria	2848
290	Ga0307408_100070206	3300031548	Bacteria	2586
291	Ga0307408_100110618	3300031548	Bacteria	2110
292	Ga0307408_100529615	3300031548	Bacteria	1036
293	Ga0307508_10026198	3300031616	Bacteria	5285
294	Ga0307508_10031308	3300031616	Bacteria	4809
295	Ga0307508_10275886	3300031616	Bacteria	1275
296	Ga0316575_10000325	3300031665	Bacteria	13470
297	Ga0316575_10001656	3300031665	Bacteria	7284
298	Ga0316575_10010575	3300031665	Bacteria	3396
299	Ga0316579_10015394	3300031691	Bacteria	3321
300	Ga0316576_10347970	3300031727	Bacteria	1103
301	Ga0316578_10018507	3300031728	Bacteria	3819
302	Ga0316578_10047213	3300031728	Bacteria	2512
303	Ga0307405_10254679	3300031731	Bacteria	1308
304	Ga0316577_10023866	3300031733	Bacteria	3395
305	Ga0307413_10007513	3300031824	Bacteria	5069
306	Ga0307407_10109860	3300031903	Bacteria	1729
307	Ga0307409_100071502	3300031995	Bacteria	2759
308	Ga0307416_100157051	3300032002	Bacteria	2096
309	Ga0316583_10033979	3300032133	Bacteria	1809
310	Ga0316585_10006494	3300032137	Bacteria	3345
311	Ga0316585_10011878	3300032137	Bacteria	2572
312	Ga0316580_10007769	3300032139	Bacteria	3200
313	Ga0316580_10009836	3300032139	Bacteria	2879
314	Ga0316592_1002180	3300033524	Bacteria	3339
315	Ga0316592_1002899	3300033524	Bacteria	3022
316	Ga0316586_1001675	3300033527	Bacteria	2611
317	Ga0316596_1003612	3300033541	Bacteria	3408
318	Ga0373958_0065806	3300034819	Unclassified	795
319	Ga0373949_0006316	3300035090	Bacteria	2612
320	Ga0373923_0128990	3300035111	Bacteria	1135
321	Ga0373939_0150785	3300035114	Unclassified	846
322	Ga0373957_0050076	3300035120	Bacteria	1596
323	Ga0316574_0000156	3300035398	Bacteria	22140
324	Ga0316574_0023120	3300035398	Bacteria	3709
325	Ga0316574_0073880	3300035398	Bacteria	2157
326	Ga0373933_0160030	3300035724	Bacteria	1429
327	Ga0373937_0004717	3300036401	Bacteria	11591
328	Ga0316582_0002472	3300036647	Bacteria	8695
329	Ga0316582_0030642	3300036647	Bacteria	3278
330	Ga0316582_0047003	3300036647	Bacteria	2723
331	Ga0316582_0090921	3300036647	Bacteria	2009
332	Ga0316584_0019975	3300036712	Bacteria	4849
333	Ga0316584_0069644	3300036712	Bacteria	2637
334	Ga0395899_0003257	3300037312	Bacteria	12872
335	Ga0395900_0004883	3300037418	Bacteria	14118
336	Ga0395900_0192356	3300037418	Bacteria	2069
337	Ga0395898_0013033	3300037466	Bacteria	8566
338	Ga0395905_0011844	3300037471	Bacteria	8419
339	Ga0395905_0012204	3300037471	Bacteria	8275
340	Ga0395905_0075362	3300037471	Bacteria	3162
341	Ga0395905_0207542	3300037471	Bacteria	1836
342	Ga0395905_0237720	3300037471	Bacteria	1702
343	Ga0395905_0281347	3300037471	Bacteria	1549
344	Ga0395905_0346445	3300037471	Bacteria	1377
345	Ga0436364_0257313	3300037853	Bacteria	2251
346	Ga0436364_0542050	3300037853	Bacteria	4863
347	Ga0436364_0714801	3300037853	Unclassified	1610
348	Ga0436364_1050664	3300037853	Bacteria	9873
349	Ga0395901_0005276	3300038443	Bacteria	13053
350	Ga0436365_0726759	3300039437	Bacteria	15841
351	Ga0436360_1072920	3300039438	Bacteria	2179
352	Ga0436361_0843254	3300039447	Bacteria	1910
353	Ga0439439_0025769	3300041406	Bacteria	1481
354	Ga0439465_0005437	3300041413	Bacteria	4066
355	Ga0439465_0034912	3300041413	Bacteria	1611
356	Ga0451807_0135153	3300041486	Bacteria	2462
357	Ga0451833_0597096	3300041491	Bacteria	7098
358	Ga0451839_1654917	3300041496	Bacteria	2362
359	Ga0451841_1218714	3300041498	Bacteria	1748
360	Ga0451847_0566501	3300041503	Bacteria	7256
361	Ga0451849_0018498	3300041505	Bacteria	6116
362	Ga0451851_0412562	3300041507	Bacteria	7459
363	Ga0451843_0214266	3300041509	Bacteria	6858
364	Ga0451853_3725632	3300041512	Bacteria	5266
365	Ga0439445_0039247	3300042004	Bacteria	1254
366	Ga0466969_0000523	3300044656	Bacteria	21109
367	Ga0466969_0014044	3300044656	Bacteria	4214
368	Ga0466969_0049098	3300044656	Bacteria	2083
369	Ga0466969_0088396	3300044656	Bacteria	1470
370	Ga0466973_0016101	3300044659	Bacteria	7080
371	Ga0453683_0005133	3300044673	Bacteria	9181
372	Ga0466965_0008183	3300044683	Bacteria	4829
373	Ga0466965_0014708	3300044683	Bacteria	3705
374	Ga0466965_0048124	3300044683	Bacteria	2112
375	Ga0466965_0051494	3300044683	Bacteria	2042
376	Ga0466966_0002161	3300044684	Bacteria	12753
377	Ga0466966_0009142	3300044684	Bacteria	6562
378	Ga0466966_0053019	3300044684	Bacteria	2574
379	Ga0466961_0000575	3300044693	Bacteria	23320
380	Ga0466961_0009887	3300044693	Bacteria	6077
381	Ga0466961_0056648	3300044693	Bacteria	2497
382	Ga0466961_0115190	3300044693	Bacteria	1689
383	Ga0466963_0000439	3300044694	Bacteria	19211
384	Ga0466963_0009068	3300044694	Bacteria	5979
385	Ga0466963_0379983	3300044694	Bacteria	996
386	Ga0466964_0000873	3300044706	Bacteria	9878
387	Ga0466964_0001505	3300044706	Bacteria	8003
388	Ga0466964_0008165	3300044706	Bacteria	3930
389	Ga0453684_0269922	3300044712	Bacteria	1944
390	Ga0466971_0007760	3300044719	Bacteria	4677
391	Ga0466971_0009844	3300044719	Bacteria	4174
392	Ga0466968_0014482	3300044735	Bacteria	3118
393	Ga0466968_0034507	3300044735	Bacteria	2111
394	Ga0466970_0021337	3300044765	Bacteria	3373
395	Ga0466957_0002451	3300044842	Bacteria	9964
396	Ga0466957_0008606	3300044842	Bacteria	5806
397	Ga0466957_0046372	3300044842	Bacteria	2638
398	Ga0466959_0000779	3300045049	Bacteria	18693
399	Ga0466959_0002827	3300045049	Bacteria	11179
400	Ga0466959_0012530	3300045049	Bacteria	6129
401	Ga0466958_0076338	3300045836	Bacteria	2056
402	Ga0466958_0128235	3300045836	Bacteria	1591
403	Ga0466967_0028666	3300045976	Bacteria	4651
404	Ga0466967_0053057	3300045976	Bacteria	3562
405	Ga0466967_0127723	3300045976	Bacteria	2357
406	Ga0495603_0211586	3300046455	Bacteria	1120
407	Ga0495638_0080524	3300046460	Bacteria	1979
408	Ga0495638_0101916	3300046460	Bacteria	1716
409	Ga0495653_0055182	3300046463	Bacteria	3033
410	Ga0495650_0019768	3300046471	Bacteria	3303
411	Ga0495650_0022636	3300046471	Bacteria	3010
412	Ga0495664_0011673	3300046477	Bacteria	4958
413	Ga0495585_0024274	3300046492	Bacteria	3478
414	Ga0495607_0075555	3300046501	Bacteria	1867
415	Ga0495606_0029712	3300046507	Bacteria	3831
416	Ga0495606_0058987	3300046507	Bacteria	2464
417	Ga0495606_0154699	3300046507	Bacteria	1343
418	Ga0495608_0006956	3300046511	Bacteria	8009
419	Ga0495610_0008510	3300046512	Bacteria	6627
420	Ga0495610_0030206	3300046512	Bacteria	2843
421	Ga0495610_0094389	3300046512	Bacteria	1350
422	Ga0495620_0027742	3300046515	Bacteria	2645
423	Ga0495620_0036105	3300046515	Bacteria	2215
424	Ga0495628_0016127	3300046516	Bacteria	6234
425	Ga0495631_0028769	3300046518	Bacteria	2533
426	Ga0495632_0075823	3300046519	Bacteria	1609
427	Ga0495632_0142676	3300046519	Bacteria	1110
428	Ga0495643_0011465	3300046522	Bacteria	5398
429	Ga0495643_0028951	3300046522	Bacteria	3101
430	Ga0495643_0237805	3300046522	Bacteria	856
431	Ga0495640_0111015	3300046533	Bacteria	1792
432	Ga0495587_0003049	3300046536	Bacteria	11195
433	Ga0495609_0116415	3300046538	Bacteria	1151
434	Ga0495597_0041847	3300046542	Bacteria	2045
435	Ga0495645_0010433	3300046543	Bacteria	6511
436	Ga0495668_0042921	3300046616	Bacteria	2516
437	Ga0495668_0085380	3300046616	Bacteria	1731
438	Ga0495625_0003525	3300046660	Bacteria	15498
439	Ga0495625_0006084	3300046660	Bacteria	10824
440	Ga0495635_0034301	3300046663	Bacteria	3520
441	Ga0495661_0220368	3300046665	Bacteria	983
442	Ga0495588_0002140	3300046674	Bacteria	8455
443	Ga0495599_0022510	3300046678	Bacteria	3935
444	Ga0495623_0012770	3300046679	Bacteria	5438
445	Ga0495646_0028806	3300046680	Bacteria	3474
446	Ga0495649_0206007	3300046694	Bacteria	1020
447	Ga0495604_0006132	3300047317	Bacteria	9544
448	Ga0495636_0043889	3300047318	Bacteria	1861
449	Ga0495674_0042128	3300047319	Bacteria	4074
450	Ga0495674_0263956	3300047319	Bacteria	1414
451	Ga0495672_0020169	3300047320	Bacteria	4376
452	Ga0495680_0113196	3300047322	Bacteria	2009
453	Ga0495675_0016248	3300047444	Bacteria	4707
454	Ga0495681_0000886	3300047470	Bacteria	23149
455	Ga0495684_0017004	3300047471	Bacteria	5604
456	Ga0495686_0017763	3300047472	Bacteria	4787
457	Ga0495602_0008701	3300048088	Bacteria	10593
458	Ga0496106_0000978	3300048909	Bacteria	20830
459	Ga0496110_0000603	3300048913	Bacteria	24725
460	Ga0496110_0099222	3300048913	Bacteria	2611
461	Ga0496112_0133836	3300048915	Bacteria	2450
462	Ga0496116_0000026	3300048919	Bacteria	450803
463	Ga0496116_0001460	3300048919	Bacteria	26485
464	Ga0496116_0069740	3300048919	Bacteria	2234
465	Ga0496116_0139969	3300048919	Bacteria	1363
466	Ga0496117_0000016	3300048920	Bacteria	523642
467	Ga0496117_0031273	3300048920	Bacteria	4068
468	Ga0496117_0056074	3300048920	Bacteria	2748
469	Ga0496117_0203102	3300048920	Bacteria	1118
470	Ga0496118_0000535	3300048921	Bacteria	62444
471	Ga0496118_0063043	3300048921	Bacteria	2730
472	Ga0496119_0034808	3300048922	Bacteria	3308
473	Ga0496119_0159560	3300048922	Bacteria	1201
474	Ga0496120_0000056	3300048923	Bacteria	180367
475	Ga0496122_0000002	3300048925	Bacteria	905834
476	Ga0496122_0052653	3300048925	Bacteria	3078
477	Ga0496122_0067160	3300048925	Bacteria	2585
478	Ga0496123_0000002	3300048926	Bacteria	1811682
479	Ga0496124_0079808	3300048927	Bacteria	2694
480	Ga0496124_0154303	3300048927	Bacteria	1797
481	Ga0496125_0027958	3300048928	Bacteria	5101
482	Ga0496126_0000059	3300048929	Bacteria	267449
483	Ga0496126_0061258	3300048929	Bacteria	3380
484	Ga0495682_0117237	3300049460	Bacteria	954
485	Ga0501291_009331	3300049514	Bacteria	1374
486	Ga0501301_001225	3300049524	Bacteria	1614
487	Ga0501303_001095	3300049526	Bacteria	2029
488	Ga0501034_0132549	3300049571	Bacteria	2475
489	Ga0501036_0045628	3300049572	Bacteria	3712
490	Ga0501037_0071809	3300049573	Bacteria	2518
491	Ga0501038_0176349	3300049574	Bacteria	1727
492	Ga0501039_0076967	3300049575	Bacteria	2594
493	Ga0501041_0098060	3300049577	Bacteria	1812
494	Ga0501042_0053135	3300049578	Bacteria	2890
495	Ga0501042_0188445	3300049578	Bacteria	1488
496	Ga0501043_0093000	3300049579	Bacteria	2371
497	Ga0501046_0117996	3300049580	Bacteria	2021
498	Ga0501046_0136736	3300049580	Bacteria	1856
499	Ga0501067_0105086	3300049583	Bacteria	1569
500	Ga0501068_0077424	3300049584	Bacteria	2037
501	Ga0501071_0133499	3300049587	Bacteria	1845
502	Ga0501072_0014436	3300049588	Bacteria	6052
503	Ga0501075_0096743	3300049591	Bacteria	2240
504	Ga0501075_0403436	3300049591	Bacteria	1042
505	Ga0501076_0060501	3300049592	Bacteria	3013
506	Ga0501076_0105417	3300049592	Bacteria	2275
507	Ga0501077_0053366	3300049593	Bacteria	2566
508	Ga0501077_0199967	3300049593	Bacteria	1269
509	Ga0501079_0063490	3300049741	Bacteria	2849
510	Ga0501079_0424016	3300049741	Bacteria	1044
511	Ga0501080_0214655	3300049742	Bacteria	1763
512	Ga0501080_0353235	3300049742	Bacteria	1327
513	Ga0501081_0016474	3300049743	Bacteria	4887
514	Ga0501262_006293	3300049759	Bacteria	1418
515	Ga0501267_004716	3300049764	Bacteria	1275
516	Ga0501273_004612	3300049770	Bacteria	1522
517	Ga0501035_0133433	3300049822	Bacteria	2163
518	Ga0501044_0010919	3300049823	Bacteria	9858
519	Ga0501045_0002902	3300049824	Bacteria	11712
520	nmdc:mga03683_74378_c1	3300050489	Bacteria	1457
521	nmdc:mga00v17_23338_c1	3300050491	Bacteria	3577
522	nmdc:mga00v17_3_c1	3300050491	Bacteria	242367
523	nmdc:mga0yw44_6299_c1	3300050492	Bacteria	5722
524	nmdc:mga0k408_126639_c1	3300050493	Bacteria	1515
525	nmdc:mga0k408_51874_c1	3300050493	Bacteria	2377
526	nmdc:mga0k408_6650_c1	3300050493	Bacteria	6165
527	nmdc:mga06z11_28346_c1	3300050494	Bacteria	2686
528	nmdc:mga07m45_39571_c1	3300050496	Bacteria	2635
529	nmdc:mga05p37_26728_c1	3300050507	Bacteria	7018
530	nmdc:mga0qj67_150771_c1	3300050509	Bacteria	1886
531	nmdc:mga06r32_66011_c1	3300050510	Bacteria	3491
532	nmdc:mga08y16_37_c1	3300050511	Bacteria	150340
533	nmdc:mga0rr50_356173_c1	3300050513	Bacteria	1231
534	nmdc:mga0sz30_1077_c1	3300050516	Bacteria	9822
535	nmdc:mga0sz30_11101_c1	3300050516	Bacteria	3467
536	nmdc:mga0sz30_80468_c1	3300050516	Bacteria	1409
537	Ga0495601_0007601	3300053077	Bacteria	6365
538	Ga0495612_0008439	3300053078	Bacteria	4179
539	Ga0495619_0236927	3300053085	Bacteria	1264
540	Ga0500578_0000715	3300053086	Bacteria	39417
541	Ga0500578_0084600	3300053086	Bacteria	2015
542	Ga0500566_0093299	3300053094	Bacteria	1661
543	Ga0500569_004319	3300053109	Bacteria	2978
544	Ga0500614_001427	3300053123	Bacteria	5727
545	Ga0500642_0005282	3300053130	Bacteria	4153
546	Ga0500655_006863	3300053133	Bacteria	2049
547	Ga0500658_0011141	3300053134	Bacteria	3311
548	Ga0500561_0000032	3300053137	Bacteria	28548
549	Ga0500568_0010926	3300053139	Bacteria	4233
550	Ga0500568_0023353	3300053139	Bacteria	2630
551	Ga0500603_007252	3300053150	Bacteria	2431
552	Ga0500616_0015769	3300053153	Bacteria	4313
553	Ga0500616_0029535	3300053153	Bacteria	3015
554	Ga0500616_0030131	3300053153	Bacteria	2982
555	Ga0500622_0005307	3300053156	Bacteria	7769
556	Ga0500622_0035542	3300053156	Bacteria	2607
557	Ga0500624_000321	3300053157	Bacteria	16362
558	Ga0500636_0000170	3300053177	Bacteria	34142
559	Ga0500636_0017055	3300053177	Bacteria	4284
560	Ga0500636_0035568	3300053177	Bacteria	2947
561	Ga0501084_0158807	3300054114	Bacteria	1907
562	Ga0590071_001290	3300059421	Bacteria	6716
563	Ga0501082_0037360	3300060353	Bacteria	4186
564	Ga0466962_0122591	3300061719	Bacteria	1254
565	Ga0530510_0062217	3300061734	Bacteria	2702
566	Ga0530510_0065196	3300061734	Bacteria	2639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300034819	Ga0373958_0065806	Ga0373958_0065806_147_773	188
2	3300035398	Ga0316574_0000156	Ga0316574_0000156_25_726	209
3	3300049571	Ga0501034_0132549	Ga0501034_0132549_1429_2265	213
4	3300053085	Ga0495619_0236927	Ga0495619_0236927_12_743	220
5	3300037853	Ga0436364_1050664	Ga0436364_1050664_3151_3894	224
6	3300039447	Ga0436361_0843254	Ga0436361_0843254_29_772	224
7	3300047318	Ga0495636_0043889	Ga0495636_0043889_775_1521	225
8	3300046522	Ga0495643_0237805	Ga0495643_0237805_101_844	226
9	3300049593	Ga0501077_0199967	Ga0501077_0199967_341_1078	226
10	3300049741	Ga0501079_0424016	Ga0501079_0424016_21_758	226
11	3300049583	Ga0501067_0105086	Ga0501067_0105086_563_1399	227
12	3300049524	Ga0501301_001225	Ga0501301_001225_358_1182	228
13	3300013102	Ga0157371_10036742	Ga0157371_100367421	230
14	3300048919	Ga0496116_0000026	Ga0496116_0000026_324124_324957	230
15	3300048922	Ga0496119_0159560	Ga0496119_0159560_201_1034	230
16	3300048925	Ga0496122_0067160	Ga0496122_0067160_638_1471	230
17	3300048929	Ga0496126_0000059	Ga0496126_0000059_23821_24654	230
18	3300044693	Ga0466961_0009887	Ga0466961_0009887_5276_6055	231
19	3300053177	Ga0500636_0035568	Ga0500636_0035568_433_1266	231
20	3300049759	Ga0501262_006293	Ga0501262_006293_558_1394	232
21	3300049770	Ga0501273_004612	Ga0501273_004612_126_962	232
22	3300031616	Ga0307508_10026198	Ga0307508_100261985	234
23	3300046460	Ga0495638_0101916	Ga0495638_0101916_769_1620	234
24	3300002987	JGI25159J45721_1012077	JGI25159J45721_10120771	235
25	3300003187	JGI25151J46595_10001754	JGI25151J46595_100017547	235
26	3300005937	Ga0081455_10176996	Ga0081455_101769961	235
27	3300005983	Ga0081540_1031991	Ga0081540_10319912	235
28	3300025284	Ga0209130_1003197	Ga0209130_10031972	235
29	3300025294	Ga0209025_1003568	Ga0209025_10035687	235
30	3300025297	Ga0209758_1003926	Ga0209758_10039264	235
31	3300025302	Ga0207426_1000046	Ga0207426_100004667	235
32	3300046512	Ga0495610_0030206	Ga0495610_0030206_1061_1900	235
33	3300049460	Ga0495682_0117237	Ga0495682_0117237_98_937	235
34	3300031456	Ga0307513_10121087	Ga0307513_101210871	236
35	3300050509	nmdc:mga0qj67_150771_c1	nmdc:mga0qj67_150771_c1_849_1679	236
36	3300050510	nmdc:mga06r32_66011_c1	nmdc:mga06r32_66011_c1_2398_3228	236
37	3300053153	Ga0500616_0030131	Ga0500616_0030131_1140_1976	236
38	3300005343	Ga0070687_100151731	Ga0070687_1001517312	237
39	3300006028	Ga0070717_10120378	Ga0070717_101203782	237
40	3300028381	Ga0268264_10040720	Ga0268264_100407203	237
41	3300031507	Ga0307509_10015289	Ga0307509_100152896	237
42	3300031665	Ga0316575_10001656	Ga0316575_100016562	237
43	3300031665	Ga0316575_10000325	Ga0316575_100003253	238
44	3300039437	Ga0436365_0726759	Ga0436365_0726759_12425_13210	238
45	3300005456	Ga0070678_100159707	Ga0070678_1001597072	239
46	3300026121	Ga0207683_10194174	Ga0207683_101941742	239
47	3300028379	Ga0268266_10363623	Ga0268266_103636232	239
48	3300031616	Ga0307508_10275886	Ga0307508_102758861	239
49	3300005330	Ga0070690_100009031	Ga0070690_1000090314	240
50	3300006195	Ga0075366_10174442	Ga0075366_101744422	240
51	3300026118	Ga0207675_100092114	Ga0207675_1000921141	240
52	3300036647	Ga0316582_0002472	Ga0316582_0002472_3720_4526	240
53	3300036712	Ga0316584_0019975	Ga0316584_0019975_1613_2419	240
54	3300036712	Ga0316584_0069644	Ga0316584_0069644_21_827	240
55	3300046471	Ga0495650_0019768	Ga0495650_0019768_30_869	241
56	3300009176	Ga0105242_10239730	Ga0105242_102397301	242
57	3300036647	Ga0316582_0090921	Ga0316582_0090921_953_1771	243
58	3300025932	Ga0207690_10130104	Ga0207690_101301042	244
59	3300037853	Ga0436364_0714801	Ga0436364_0714801_192_995	244
60	3300046538	Ga0495609_0116415	Ga0495609_0116415_64_891	244
61	3300046665	Ga0495661_0220368	Ga0495661_0220368_17_844	244
62	3300048920	Ga0496117_0203102	Ga0496117_0203102_175_996	244
63	3300003187	JGI25151J46595_10010370	JGI25151J46595_100103703	245
64	3300003856	Ga0058692_1000427	Ga0058692_100042723	245
65	3300003856	Ga0058692_1004100	Ga0058692_10041005	245
66	3300005290	Ga0065712_10126895	Ga0065712_101268952	245
67	3300005293	Ga0065715_10007470	Ga0065715_100074701	245
68	3300005618	Ga0068864_100371001	Ga0068864_1003710012	245
69	3300009147	Ga0114129_10347143	Ga0114129_103471432	245
70	3300025294	Ga0209025_1003844	Ga0209025_10038444	245
71	3300026095	Ga0207676_10252668	Ga0207676_102526682	245
72	3300027312	Ga0209371_1000012	Ga0209371_1000012184	245
73	3300027312	Ga0209371_1002204	Ga0209371_10022044	245
74	3300030500	Ga0268256_1000013	Ga0268256_1000013184	245
75	3300030500	Ga0268256_1008850	Ga0268256_10088504	245
76	3300048913	Ga0496110_0099222	Ga0496110_0099222_358_1191	245
77	3300048915	Ga0496112_0133836	Ga0496112_0133836_1307_2140	245
78	3300037418	Ga0395900_0192356	Ga0395900_0192356_983_1801	246
79	3300037471	Ga0395905_0012204	Ga0395905_0012204_3797_4615	246
80	iso_pu_bacteria	2510917027	2511181225	247
81	iso_pu_bacteria	2512564013	2512637955	247
82	iso_pu_bacteria	2857465823	2857469173	247
83	iso_pu_bacteria	2857591370	2857595411	247
84	iso_pu_bacteria	2898907183	2898909675	247
85	iso_pu_bacteria	2915597211	2915601393	247
86	iso_pu_bacteria	2915606848	2915609930	247
87	iso_pu_bacteria	2919414237	2919417815	247
88	iso_pu_bacteria	2929183550	2929186549	247
89	iso_pu_bacteria	8054280661	8054283046	247
90	3300044656	Ga0466969_0000523	Ga0466969_0000523_18215_19045	248
91	3300044659	Ga0466973_0016101	Ga0466973_0016101_1770_2600	248
92	3300044694	Ga0466963_0000439	Ga0466963_0000439_54_884	248
93	3300044706	Ga0466964_0008165	Ga0466964_0008165_1080_1910	248
94	3300044735	Ga0466968_0034507	Ga0466968_0034507_880_1710	248
95	3300044842	Ga0466957_0008606	Ga0466957_0008606_4401_5231	248
96	3300045049	Ga0466959_0012530	Ga0466959_0012530_4789_5619	248
97	3300045836	Ga0466958_0076338	Ga0466958_0076338_261_1091	248
98	3300049742	Ga0501080_0214655	Ga0501080_0214655_909_1745	248
99	3300061719	Ga0466962_0122591	Ga0466962_0122591_383_1213	248
100	iso_pu_bacteria	2522572158	2523104509	248
101	iso_pu_bacteria	3006973921	3006977121	248
102	3300005535	Ga0070684_100261293	Ga0070684_1002612932	249
103	3300035114	Ga0373939_0150785	Ga0373939_0150785_18_836	249
104	3300044735	Ga0466968_0014482	Ga0466968_0014482_1323_2192	249
105	iso_pu_bacteria	2848858292	2848863192	250
106	iso_pu_bacteria	2909042592	2909043519	250
107	3300005337	Ga0070682_100242623	Ga0070682_1002426231	251
108	3300009098	Ga0105245_10023813	Ga0105245_100238132	251
109	3300010375	Ga0105239_10555538	Ga0105239_105555382	251
110	3300031507	Ga0307509_10088756	Ga0307509_100887563	251
111	3300035111	Ga0373923_0128990	Ga0373923_0128990_33_857	251
112	3300035120	Ga0373957_0050076	Ga0373957_0050076_460_1284	251
113	3300035724	Ga0373933_0160030	Ga0373933_0160030_262_1086	251
114	3300036401	Ga0373937_0004717	Ga0373937_0004717_6983_7807	251
115	3300041486	Ga0451807_0135153	Ga0451807_0135153_641_1453	251
116	3300044694	Ga0466963_0379983	Ga0466963_0379983_135_971	251
117	3300046463	Ga0495653_0055182	Ga0495653_0055182_1872_2696	251
118	3300046471	Ga0495650_0022636	Ga0495650_0022636_1901_2737	251
119	3300046477	Ga0495664_0011673	Ga0495664_0011673_1826_2650	251
120	3300046511	Ga0495608_0006956	Ga0495608_0006956_2379_3203	251
121	3300046516	Ga0495628_0016127	Ga0495628_0016127_2989_3813	251
122	3300046533	Ga0495640_0111015	Ga0495640_0111015_944_1768	251
123	3300046536	Ga0495587_0003049	Ga0495587_0003049_2712_3536	251
124	3300046543	Ga0495645_0010433	Ga0495645_0010433_3016_3840	251
125	3300046663	Ga0495635_0034301	Ga0495635_0034301_1241_2065	251
126	3300046678	Ga0495599_0022510	Ga0495599_0022510_2700_3524	251
127	3300046679	Ga0495623_0012770	Ga0495623_0012770_430_1254	251
128	3300046680	Ga0495646_0028806	Ga0495646_0028806_2422_3246	251
129	3300047317	Ga0495604_0006132	Ga0495604_0006132_6585_7409	251
130	3300047319	Ga0495674_0042128	Ga0495674_0042128_967_1791	251
131	3300047319	Ga0495674_0263956	Ga0495674_0263956_556_1380	251
132	3300047322	Ga0495680_0113196	Ga0495680_0113196_1131_1955	251
133	3300047444	Ga0495675_0016248	Ga0495675_0016248_2740_3564	251
134	3300047471	Ga0495684_0017004	Ga0495684_0017004_3944_4768	251
135	3300048088	Ga0495602_0008701	Ga0495602_0008701_7068_7892	251
136	3300048913	Ga0496110_0000603	Ga0496110_0000603_13701_14528	251
137	3300053077	Ga0495601_0007601	Ga0495601_0007601_2630_3454	251
138	3300053078	Ga0495612_0008439	Ga0495612_0008439_2608_3432	251
139	3300053133	Ga0500655_006863	Ga0500655_006863_1210_2022	251
140	iso_pu_bacteria	2597490356	2599103838	251
141	iso_pu_bacteria	2837651117	2837653526	251
142	iso_pu_bacteria	2846952575	2846957526	251
143	iso_pu_bacteria	2894817345	2894819816	251
144	iso_pu_bacteria	2908669403	2908672944	251
145	iso_pu_bacteria	8007371054	8007371962	251
146	3300006028	Ga0070717_10232162	Ga0070717_102321622	252
147	3300037471	Ga0395905_0281347	Ga0395905_0281347_281_1096	252
148	3300044656	Ga0466969_0049098	Ga0466969_0049098_546_1397	252
149	3300044683	Ga0466965_0008183	Ga0466965_0008183_3520_4371	252
150	3300044683	Ga0466965_0051494	Ga0466965_0051494_12_845	252
151	3300044684	Ga0466966_0009142	Ga0466966_0009142_5344_6195	252
152	3300044693	Ga0466961_0056648	Ga0466961_0056648_323_1174	252
153	3300044706	Ga0466964_0001505	Ga0466964_0001505_4681_5532	252
154	3300044719	Ga0466971_0009844	Ga0466971_0009844_869_1720	252
155	3300044842	Ga0466957_0002451	Ga0466957_0002451_450_1301	252
156	3300045976	Ga0466967_0127723	Ga0466967_0127723_1318_2169	252
157	iso_pu_bacteria	2534681786	2535486285	252
158	iso_pu_bacteria	2643221719	2644657651	252
159	iso_pu_bacteria	2818991272	2819243996	252
160	iso_pu_bacteria	2837678835	2837680987	252
161	iso_pu_bacteria	2854681122	2854681533	252
162	iso_pu_bacteria	2891048133	2891049203	252
163	iso_pu_bacteria	2919679072	2919681627	252
164	iso_pu_bacteria	2989776772	2989780535	252
165	iso_pu_bacteria	2990275345	2990280488	252
166	3300005937	Ga0081455_10095025	Ga0081455_100950252	253
167	3300031731	Ga0307405_10254679	Ga0307405_102546792	253
168	3300044673	Ga0453683_0005133	Ga0453683_0005133_4919_5752	253
169	iso_pu_bacteria	2509276021	2509390715	253
170	iso_pu_bacteria	2509276033	2509442104	253
171	iso_pu_bacteria	2510917030	2511198308	253
172	iso_pu_bacteria	2513237088	2513597974	253
173	iso_pu_bacteria	2513237103	2513714052	253
174	iso_pu_bacteria	2513237138	2513870027	253
175	iso_pu_bacteria	2513237143	2513901715	253
176	iso_pu_bacteria	2513237144	2513911620	253
177	iso_pu_bacteria	2513237146	2513927756	253
178	iso_pu_bacteria	2515075009	2515108721	253
179	iso_pu_bacteria	2515154134	2515738204	253
180	iso_pu_bacteria	2516653077	2517040654	253
181	iso_pu_bacteria	2519899620	2520380987	253
182	iso_pu_bacteria	2534681796	2535516942	253
183	iso_pu_bacteria	2582581294	2585202142	253
184	iso_pu_bacteria	2582581298	2585221755	253
185	iso_pu_bacteria	2582581304	2585255169	253
186	iso_pu_bacteria	2585427526	2585529989	253
187	iso_pu_bacteria	2585427528	2585543299	253
188	iso_pu_bacteria	2585427529	2585544075	253
189	iso_pu_bacteria	2585427593	2585841559	253
190	iso_pu_bacteria	2585427594	2585843304	253
191	iso_pu_bacteria	2599185170	2599416813	253
192	iso_pu_bacteria	2643221599	2644007191	253
193	iso_pu_bacteria	2718217882	2719184692	253
194	iso_pu_bacteria	2718217927	2719389327	253
195	iso_pu_bacteria	2718217997	2719668697	253
196	iso_pu_bacteria	2718218009	2719728712	253
197	iso_pu_bacteria	2718218199	2720489390	253
198	iso_pu_bacteria	2718218232	2720610063	253
199	iso_pu_bacteria	2718218233	2720617487	253
200	iso_pu_bacteria	2718218235	2720628633	253
201	iso_pu_bacteria	2718218269	2720772583	253
202	iso_pu_bacteria	2718218363	2721144403	253
203	iso_pu_bacteria	2718218365	2721156356	253
204	iso_pu_bacteria	2718218366	2721161773	253
205	iso_pu_bacteria	2718218423	2721402093	253
206	iso_pu_bacteria	2721755514	2722842918	253
207	iso_pu_bacteria	2721755556	2723030022	253
208	iso_pu_bacteria	2721755684	2723564427	253
209	iso_pu_bacteria	2721755685	2723569932	253
210	iso_pu_bacteria	2721755809	2724035926	253
211	iso_pu_bacteria	2721755810	2724041737	253
212	iso_pu_bacteria	2721755819	2724092612	253
213	iso_pu_bacteria	2721755822	2724101479	253
214	iso_pu_bacteria	2721755823	2724112996	253
215	iso_pu_bacteria	2728369352	2730110555	253
216	iso_pu_bacteria	2728369365	2730160807	253
217	iso_pu_bacteria	2728369397	2730295889	253
218	iso_pu_bacteria	2738541293	2738800161	253
219	iso_pu_bacteria	2738541333	2739035347	253
220	iso_pu_bacteria	2773857925	2774868779	253
221	iso_pu_bacteria	2791355259	2793315187	253
222	iso_pu_bacteria	2791355260	2793323773	253
223	iso_pu_bacteria	2791355261	2793331163	253
224	iso_pu_bacteria	2791355262	2793334022	253
225	iso_pu_bacteria	2791355264	2793345582	253
226	iso_pu_bacteria	2791355266	2793360100	253
227	iso_pu_bacteria	2791355267	2793368552	253
228	iso_pu_bacteria	2802429605	2805928502	253
229	iso_pu_bacteria	2802429606	2805934321	253
230	iso_pu_bacteria	2802429633	2806048060	253
231	iso_pu_bacteria	2802429636	2806069267	253
232	iso_pu_bacteria	2802429637	2806076992	253
233	iso_pu_bacteria	2821443989	2821447348	253
234	iso_pu_bacteria	2835312727	2835317846	253
235	iso_pu_bacteria	2838016132	2838020342	253
236	iso_pu_bacteria	2838022645	2838025295	253
237	iso_pu_bacteria	2838035591	2838036926	253
238	iso_pu_bacteria	2838048938	2838049784	253
239	iso_pu_bacteria	2838061910	2838062051	253
240	iso_pu_bacteria	2838068647	2838069592	253
241	iso_pu_bacteria	2838661181	2838662036	253
242	iso_pu_bacteria	2838668709	2838669434	253
243	iso_pu_bacteria	2838701080	2838701805	253
244	iso_pu_bacteria	2841864319	2841865972	253
245	iso_pu_bacteria	2842163707	2842164151	253
246	iso_pu_bacteria	2842192696	2842196074	253
247	iso_pu_bacteria	2842198810	2842200861	253
248	iso_pu_bacteria	2842205361	2842209757	253
249	iso_pu_bacteria	2842217011	2842219885	253
250	iso_pu_bacteria	2842250916	2842251771	253
251	iso_pu_bacteria	2842264693	2842264968	253
252	iso_pu_bacteria	2842278818	2842283211	253
253	iso_pu_bacteria	2842311132	2842313109	253
254	iso_pu_bacteria	2842317721	2842320171	253
255	iso_pu_bacteria	2842341865	2842341868	253
256	iso_pu_bacteria	2842363717	2842364218	253
257	iso_pu_bacteria	2842395702	2842397180	253
258	iso_pu_bacteria	2842402390	2842405791	253
259	iso_pu_bacteria	2842409023	2842412374	253
260	iso_pu_bacteria	2842415677	2842419020	253
261	iso_pu_bacteria	2842422224	2842422783	253
262	iso_pu_bacteria	2842428310	2842428978	253
263	iso_pu_bacteria	2842434925	2842435592	253
264	iso_pu_bacteria	2842441272	2842441546	253
265	iso_pu_bacteria	2842447887	2842448384	253
266	iso_pu_bacteria	2842462802	2842463403	253
267	iso_pu_bacteria	2842469257	2842469922	253
268	iso_pu_bacteria	2842489311	2842489747	253
269	iso_pu_bacteria	2842495871	2842498209	253
270	iso_pu_bacteria	2870068957	2870074582	253
271	iso_pu_bacteria	2882456835	2882462270	253
272	iso_pu_bacteria	2894232714	2894241790	253
273	iso_pu_bacteria	2919100787	2919103279	253
274	iso_pu_bacteria	2923556063	2923559165	253
275	iso_pu_bacteria	2933016740	2933018353	253
276	iso_pu_bacteria	2933599457	2933600255	253
277	iso_pu_bacteria	2935901341	2935903252	253
278	iso_pu_bacteria	2936367885	2936374477	253
279	iso_pu_bacteria	2936375103	2936376087	253
280	iso_pu_bacteria	2996887358	2996888955	253
281	iso_pu_bacteria	2996893221	2996897522	253
282	iso_pu_bacteria	3005445848	3005451595	253
283	iso_pu_bacteria	3005452660	3005454748	253
284	iso_pu_bacteria	639633055	639644809	253
285	iso_pu_bacteria	8005258706	8005260388	253
286	iso_pu_bacteria	8005275841	8005277670	253
287	iso_pu_bacteria	8005282627	8005285679	253
288	iso_pu_bacteria	8005289223	8005290478	253
289	iso_pu_bacteria	8005307578	8005308021	253
290	iso_pu_bacteria	8005321885	8005323482	253
291	iso_pu_bacteria	8005376324	8005379718	253
292	iso_pu_bacteria	8005382845	8005383313	253
293	iso_pu_bacteria	8005395548	8005398907	253
294	iso_pu_bacteria	8005430974	8005436737	253
295	iso_pu_bacteria	8005460587	8005467105	253
296	iso_pu_bacteria	8005542996	8005545753	253
297	iso_pu_bacteria	8005619151	8005624088	253
298	iso_pu_bacteria	8005626139	8005629352	253
299	iso_pu_bacteria	8005695170	8005697808	253
300	iso_pu_bacteria	8018176218	8018176220	253
301	iso_pu_bacteria	8024501048	8024507274	253
302	iso_pu_bacteria	8056375014	8056377891	253
303	iso_pu_bacteria	8057874678	8057878189	253
304	3300005459	Ga0068867_100000031	Ga0068867_10000003145	254
305	3300005616	Ga0068852_100453358	Ga0068852_1004533582	254
306	3300007265	Ga0099794_10083093	Ga0099794_100830932	254
307	3300009098	Ga0105245_10093894	Ga0105245_100938943	254
308	3300009148	Ga0105243_10005259	Ga0105243_100052599	254
309	3300014745	Ga0157377_10000428	Ga0157377_100004283	254
310	3300025927	Ga0207687_10057866	Ga0207687_100578663	254
311	3300025935	Ga0207709_10001383	Ga0207709_100013836	254
312	3300026089	Ga0207648_10000267	Ga0207648_1000026733	254
313	3300026142	Ga0207698_10018302	Ga0207698_100183021	254
314	iso_pu_bacteria	2510917028	2511182637	254
315	iso_pu_bacteria	2537561587	2537876832	254
316	iso_pu_bacteria	2554235003	2554245561	254
317	iso_pu_bacteria	2558860242	2559296609	254
318	iso_pu_bacteria	2599185210	2599602898	254
319	iso_pu_bacteria	2600255279	2601610505	254
320	iso_pu_bacteria	2600255308	2601747165	254
321	iso_pu_bacteria	2643221568	2643854125	254
322	iso_pu_bacteria	2643221582	2643917416	254
323	iso_pu_bacteria	2643221693	2644520738	254
324	iso_pu_bacteria	2808606387	2808987062	254
325	iso_pu_bacteria	2818991439	2819560633	254
326	iso_pu_bacteria	2838675328	2838677874	254
327	iso_pu_bacteria	2838714209	2838717221	254
328	iso_pu_bacteria	2838719591	2838722169	254
329	iso_pu_bacteria	2838724970	2838727970	254
330	iso_pu_bacteria	2841846520	2841849629	254
331	iso_pu_bacteria	2841859092	2841861333	254
332	iso_pu_bacteria	2842124991	2842127623	254
333	iso_pu_bacteria	2842130223	2842132767	254
334	iso_pu_bacteria	2842152218	2842154760	254
335	iso_pu_bacteria	2842170452	2842173259	254
336	iso_pu_bacteria	2842175837	2842178381	254
337	iso_pu_bacteria	2842187318	2842190329	254
338	iso_pu_bacteria	2842211629	2842214643	254
339	iso_pu_bacteria	2842224351	2842227362	254
340	iso_pu_bacteria	2842333319	2842337101	254
341	iso_pu_bacteria	2842515876	2842518400	254
342	iso_pu_bacteria	2891048133	2891050339	254
343	iso_pu_bacteria	2899845264	2899849916	254
344	iso_pu_bacteria	2919114240	2919117479	254
345	iso_pu_bacteria	2919166419	2919168513	254
346	iso_pu_bacteria	2926754445	2926758925	254
347	iso_pu_bacteria	2926760298	2926763561	254
348	iso_pu_bacteria	2933006813	2933009857	254
349	iso_pu_bacteria	2933011516	2933014027	254
350	iso_pu_bacteria	2933594066	2933595812	254
351	iso_pu_bacteria	2978969890	2978971196	254
352	iso_pu_bacteria	2979089926	2979091399	254
353	iso_pu_bacteria	2979095461	2979096922	254
354	iso_pu_bacteria	2979100975	2979101409	254
355	iso_pu_bacteria	2984509177	2984510639	254
356	iso_pu_bacteria	2984518228	2984518658	254
357	iso_pu_bacteria	2984537506	2984538988	254
358	iso_pu_bacteria	2984587000	2984588345	254
359	iso_pu_bacteria	2984601300	2984605685	254
360	iso_pu_bacteria	650716007	650843031	254
361	iso_pu_bacteria	8003570095	8003574258	254
362	3300036647	Ga0316582_0047003	Ga0316582_0047003_1620_2444	255
363	3300050516	nmdc:mga0sz30_80468_c1	nmdc:mga0sz30_80468_c1_43_873	255
364	iso_pu_bacteria	2671180139	2671692281	255
365	iso_pu_bacteria	2998344455	2998347826	255
366	3300025924	Ga0207694_10439786	Ga0207694_104397861	256
367	3300031507	Ga0307509_10105003	Ga0307509_101050032	256
368	3300037312	Ga0395899_0003257	Ga0395899_0003257_8662_9489	256
369	3300037418	Ga0395900_0004883	Ga0395900_0004883_11463_12290	256
370	3300037471	Ga0395905_0346445	Ga0395905_0346445_507_1334	256
371	3300050491	nmdc:mga00v17_23338_c1	nmdc:mga00v17_23338_c1_937_1764	256
372	3300059421	Ga0590071_001290	Ga0590071_001290_609_1436	256
373	3300002739	JGI25158J39367_1000155	JGI25158J39367_10001553	257
374	3300002773	JGI25152J39213_1000741	JGI25152J39213_10007416	257
375	3300002773	JGI25152J39213_1003577	JGI25152J39213_10035773	257
376	3300002773	JGI25152J39213_1007263	JGI25152J39213_10072633	257
377	3300002773	JGI25152J39213_1008310	JGI25152J39213_10083103	257
378	3300002774	JGI25150J39212_1000164	JGI25150J39212_100016418	257
379	3300002774	JGI25150J39212_1008877	JGI25150J39212_10088772	257
380	3300002774	JGI25150J39212_1009279	JGI25150J39212_10092792	257
381	3300002987	JGI25159J45721_1002060	JGI25159J45721_10020607	257
382	3300002987	JGI25159J45721_1022354	JGI25159J45721_10223542	257
383	3300003187	JGI25151J46595_10000201	JGI25151J46595_1000020153	257
384	3300003187	JGI25151J46595_10007042	JGI25151J46595_100070424	257
385	3300003187	JGI25151J46595_10038938	JGI25151J46595_100389382	257
386	3300003215	JGI25153J46596_10000641	JGI25153J46596_1000064114	257
387	3300003215	JGI25153J46596_10003581	JGI25153J46596_100035817	257
388	3300003215	JGI25153J46596_10016931	JGI25153J46596_100169313	257
389	3300003215	JGI25153J46596_10019591	JGI25153J46596_100195912	257
390	3300003354	JGI25160J50197_1002466	JGI25160J50197_10024667	257
391	3300003354	JGI25160J50197_1006362	JGI25160J50197_10063622	257
392	3300003374	JGI25161J50226_1000025	JGI25161J50226_10000253	257
393	3300003374	JGI25161J50226_1001853	JGI25161J50226_10018535	257
394	3300003771	Ga0055526_1000437	Ga0055526_100043731	257
395	3300003771	Ga0055526_1007747	Ga0055526_10077472	257
396	3300003771	Ga0055526_1016113	Ga0055526_10161133	257
397	3300003775	Ga0055524_1002501	Ga0055524_10025019	257
398	3300003775	Ga0055524_1017183	Ga0055524_10171832	257
399	3300003790	Ga0055528_1001223	Ga0055528_10012233	257
400	3300003790	Ga0055528_1001284	Ga0055528_100128412	257
401	3300003792	Ga0055540_1014171	Ga0055540_10141712	257
402	3300004625	Ga0055543_1000427	Ga0055543_10004273	257
403	3300004625	Ga0055543_1003318	Ga0055543_10033183	257
404	3300005262	Ga0065165_1010076	Ga0065165_10100762	257
405	3300005335	Ga0070666_10258097	Ga0070666_102580972	257
406	3300005344	Ga0070661_100004138	Ga0070661_1000041384	257
407	3300005347	Ga0070668_100035874	Ga0070668_1000358743	257
408	3300005353	Ga0070669_100077317	Ga0070669_1000773172	257
409	3300005355	Ga0070671_100011357	Ga0070671_1000113576	257
410	3300005366	Ga0070659_100002424	Ga0070659_10000242410	257
411	3300005455	Ga0070663_100005375	Ga0070663_1000053756	257
412	3300005457	Ga0070662_100114821	Ga0070662_1001148212	257
413	3300005546	Ga0070696_100112267	Ga0070696_1001122672	257
414	3300005564	Ga0070664_100003257	Ga0070664_1000032573	257
415	3300005981	Ga0081538_10005839	Ga0081538_100058399	257
416	3300006038	Ga0075365_10000324	Ga0075365_100003245	257
417	3300006038	Ga0075365_10003997	Ga0075365_100039977	257
418	3300006178	Ga0075367_10001155	Ga0075367_1000115510	257
419	3300006186	Ga0075369_10021602	Ga0075369_100216022	257
420	3300006186	Ga0075369_10027867	Ga0075369_100278672	257
421	3300006186	Ga0075369_10095826	Ga0075369_100958262	257
422	3300006195	Ga0075366_10010388	Ga0075366_100103882	257
423	3300006353	Ga0075370_10052839	Ga0075370_100528393	257
424	3300006353	Ga0075370_10149298	Ga0075370_101492982	257
425	3300006353	Ga0075370_10167727	Ga0075370_101677272	257
426	3300009092	Ga0105250_10006715	Ga0105250_100067153	257
427	3300009093	Ga0105240_10005002	Ga0105240_100050026	257
428	3300009094	Ga0111539_10000090	Ga0111539_1000009047	257
429	3300009147	Ga0114129_10207258	Ga0114129_102072582	257
430	3300009545	Ga0105237_10000585	Ga0105237_1000058511	257
431	3300009551	Ga0105238_10060888	Ga0105238_100608882	257
432	3300009765	Ga0123341_1001196	Ga0123341_100119617	257
433	3300009766	Ga0123342_1023700	Ga0123342_10237003	257
434	3300009766	Ga0123342_1040462	Ga0123342_10404622	257
435	3300010375	Ga0105239_10000598	Ga0105239_1000059812	257
436	3300021384	Ga0213876_10007873	Ga0213876_100078733	257
437	3300025208	Ga0209436_100017	Ga0209436_10001758	257
438	3300025245	Ga0207425_1000055	Ga0207425_100005519	257
439	3300025245	Ga0207425_1000399	Ga0207425_10003993	257
440	3300025245	Ga0207425_1003344	Ga0207425_10033444	257
441	3300025245	Ga0207425_1003788	Ga0207425_10037883	257
442	3300025258	Ga0209129_1000029	Ga0209129_1000029220	257
443	3300025258	Ga0209129_1000613	Ga0209129_100061312	257
444	3300025258	Ga0209129_1001106	Ga0209129_10011062	257
445	3300025258	Ga0209129_1004513	Ga0209129_10045133	257
446	3300025258	Ga0209129_1004811	Ga0209129_10048113	257
447	3300025258	Ga0209129_1007974	Ga0209129_10079743	257
448	3300025273	Ga0209673_1000105	Ga0209673_100010573	257
449	3300025273	Ga0209673_1000248	Ga0209673_10002483	257
450	3300025273	Ga0209673_1002738	Ga0209673_10027389	257
451	3300025273	Ga0209673_1002873	Ga0209673_100287310	257
452	3300025273	Ga0209673_1013885	Ga0209673_10138853	257
453	3300025273	Ga0209673_1014458	Ga0209673_10144583	257
454	3300025273	Ga0209673_1018566	Ga0209673_10185662	257
455	3300025273	Ga0209673_1021064	Ga0209673_10210642	257
456	3300025284	Ga0209130_1000001	Ga0209130_100000176	257
457	3300025284	Ga0209130_1000308	Ga0209130_100030840	257
458	3300025294	Ga0209025_1000070	Ga0209025_1000070162	257
459	3300025294	Ga0209025_1000456	Ga0209025_100045652	257
460	3300025294	Ga0209025_1001055	Ga0209025_10010553	257
461	3300025294	Ga0209025_1005517	Ga0209025_10055173	257
462	3300025294	Ga0209025_1011892	Ga0209025_10118924	257
463	3300025294	Ga0209025_1012157	Ga0209025_10121571	257
464	3300025294	Ga0209025_1044134	Ga0209025_10441342	257
465	3300025295	Ga0209564_1000913	Ga0209564_100091317	257
466	3300025295	Ga0209564_1004080	Ga0209564_10040808	257
467	3300025295	Ga0209564_1008676	Ga0209564_10086762	257
468	3300025295	Ga0209564_1017050	Ga0209564_10170502	257
469	3300025295	Ga0209564_1026461	Ga0209564_10264612	257
470	3300025297	Ga0209758_1000094	Ga0209758_100009473	257
471	3300025297	Ga0209758_1000380	Ga0209758_100038070	257
472	3300025297	Ga0209758_1001339	Ga0209758_100133926	257
473	3300025297	Ga0209758_1001563	Ga0209758_100156318	257
474	3300025297	Ga0209758_1005128	Ga0209758_10051285	257
475	3300025297	Ga0209758_1008014	Ga0209758_10080148	257
476	3300025297	Ga0209758_1037226	Ga0209758_10372262	257
477	3300025298	Ga0209050_1022534	Ga0209050_10225342	257
478	3300025299	Ga0209256_1000281	Ga0209256_100028152	257
479	3300025299	Ga0209256_1008087	Ga0209256_10080872	257
480	3300025299	Ga0209256_1015840	Ga0209256_10158402	257
481	3300025302	Ga0207426_1000005	Ga0207426_1000005681	257
482	3300025302	Ga0207426_1000088	Ga0207426_1000088215	257
483	3300025302	Ga0207426_1000109	Ga0207426_1000109204	257
484	3300025302	Ga0207426_1001714	Ga0207426_10017141	257
485	3300025303	Ga0209051_1000027	Ga0209051_100002771	257
486	3300025303	Ga0209051_1002669	Ga0209051_100266911	257
487	3300025303	Ga0209051_1032954	Ga0209051_10329542	257
488	3300025303	Ga0209051_1073476	Ga0209051_10734762	257
489	3300025304	Ga0209257_1010769	Ga0209257_10107693	257
490	3300025304	Ga0209257_1014592	Ga0209257_10145923	257
491	3300025913	Ga0207695_10015162	Ga0207695_100151623	257
492	3300025919	Ga0207657_10036596	Ga0207657_100365963	257
493	3300025920	Ga0207649_10003749	Ga0207649_100037498	257
494	3300025924	Ga0207694_10168443	Ga0207694_101684432	257
495	3300025931	Ga0207644_10012434	Ga0207644_100124344	257
496	3300025932	Ga0207690_10001027	Ga0207690_1000102710	257
497	3300025933	Ga0207706_10142291	Ga0207706_101422912	257
498	3300025945	Ga0207679_10000181	Ga0207679_100001813	257
499	3300025945	Ga0207679_10000402	Ga0207679_100004023	257
500	3300025972	Ga0207668_10059458	Ga0207668_100594583	257
501	3300025986	Ga0207658_10163331	Ga0207658_101633312	257
502	3300026067	Ga0207678_10003746	Ga0207678_1000374611	257
503	3300026067	Ga0207678_10076924	Ga0207678_100769243	257
504	3300027907	Ga0207428_10000055	Ga0207428_1000005523	257
505	3300028380	Ga0268265_10437208	Ga0268265_104372082	257
506	3300031548	Ga0307408_100110618	Ga0307408_1001106182	257
507	3300031548	Ga0307408_100529615	Ga0307408_1005296152	257
508	3300031824	Ga0307413_10007513	Ga0307413_100075136	257
509	3300031903	Ga0307407_10109860	Ga0307407_101098602	257
510	3300031995	Ga0307409_100071502	Ga0307409_1000715022	257
511	3300032002	Ga0307416_100157051	Ga0307416_1001570512	257
512	3300037471	Ga0395905_0011844	Ga0395905_0011844_4358_5194	257
513	3300037853	Ga0436364_0257313	Ga0436364_0257313_420_1256	257
514	3300041406	Ga0439439_0025769	Ga0439439_0025769_547_1377	257
515	3300041413	Ga0439465_0005437	Ga0439465_0005437_2146_2976	257
516	3300041413	Ga0439465_0034912	Ga0439465_0034912_487_1317	257
517	3300041491	Ga0451833_0597096	Ga0451833_0597096_4862_5692	257
518	3300041496	Ga0451839_1654917	Ga0451839_1654917_642_1472	257
519	3300041498	Ga0451841_1218714	Ga0451841_1218714_858_1688	257
520	3300041503	Ga0451847_0566501	Ga0451847_0566501_1755_2585	257
521	3300041505	Ga0451849_0018498	Ga0451849_0018498_1344_2174	257
522	3300041507	Ga0451851_0412562	Ga0451851_0412562_1281_2111	257
523	3300041509	Ga0451843_0214266	Ga0451843_0214266_1356_2186	257
524	3300041512	Ga0451853_3725632	Ga0451853_3725632_1825_2655	257
525	3300042004	Ga0439445_0039247	Ga0439445_0039247_128_958	257
526	3300044656	Ga0466969_0014044	Ga0466969_0014044_2670_3500	257
527	3300044683	Ga0466965_0048124	Ga0466965_0048124_939_1769	257
528	3300044684	Ga0466966_0053019	Ga0466966_0053019_259_1089	257
529	3300044693	Ga0466961_0000575	Ga0466961_0000575_11053_11883	257
530	3300045049	Ga0466959_0002827	Ga0466959_0002827_3366_4196	257
531	3300046460	Ga0495638_0080524	Ga0495638_0080524_106_936	257
532	3300046492	Ga0495585_0024274	Ga0495585_0024274_779_1609	257
533	3300046501	Ga0495607_0075555	Ga0495607_0075555_1025_1855	257
534	3300046507	Ga0495606_0058987	Ga0495606_0058987_787_1617	257
535	3300046512	Ga0495610_0008510	Ga0495610_0008510_1544_2374	257
536	3300046512	Ga0495610_0094389	Ga0495610_0094389_37_867	257
537	3300046515	Ga0495620_0027742	Ga0495620_0027742_906_1736	257
538	3300046515	Ga0495620_0036105	Ga0495620_0036105_107_937	257
539	3300046518	Ga0495631_0028769	Ga0495631_0028769_1341_2171	257
540	3300046519	Ga0495632_0075823	Ga0495632_0075823_15_845	257
541	3300046519	Ga0495632_0142676	Ga0495632_0142676_261_1091	257
542	3300046522	Ga0495643_0011465	Ga0495643_0011465_1366_2196	257
543	3300046522	Ga0495643_0028951	Ga0495643_0028951_1848_2678	257
544	3300046542	Ga0495597_0041847	Ga0495597_0041847_989_1819	257
545	3300046616	Ga0495668_0042921	Ga0495668_0042921_1256_2086	257
546	3300046616	Ga0495668_0085380	Ga0495668_0085380_419_1249	257
547	3300046660	Ga0495625_0003525	Ga0495625_0003525_8933_9763	257
548	3300046660	Ga0495625_0006084	Ga0495625_0006084_5338_6168	257
549	3300046694	Ga0495649_0206007	Ga0495649_0206007_90_920	257
550	3300047320	Ga0495672_0020169	Ga0495672_0020169_2234_3064	257
551	3300047472	Ga0495686_0017763	Ga0495686_0017763_1125_1955	257
552	3300048909	Ga0496106_0000978	Ga0496106_0000978_11659_12489	257
553	3300048919	Ga0496116_0001460	Ga0496116_0001460_25635_26465	257
554	3300048920	Ga0496117_0056074	Ga0496117_0056074_583_1413	257
555	3300048921	Ga0496118_0063043	Ga0496118_0063043_290_1120	257
556	3300048925	Ga0496122_0052653	Ga0496122_0052653_839_1669	257
557	3300048927	Ga0496124_0079808	Ga0496124_0079808_431_1261	257
558	3300048928	Ga0496125_0027958	Ga0496125_0027958_1220_2050	257
559	3300049514	Ga0501291_009331	Ga0501291_009331_156_986	257
560	3300050489	nmdc:mga03683_74378_c1	nmdc:mga03683_74378_c1_329_1159	257
561	3300050493	nmdc:mga0k408_126639_c1	nmdc:mga0k408_126639_c1_200_1030	257
562	3300050493	nmdc:mga0k408_6650_c1	nmdc:mga0k408_6650_c1_1232_2062	257
563	3300050494	nmdc:mga06z11_28346_c1	nmdc:mga06z11_28346_c1_1233_2063	257
564	3300050496	nmdc:mga07m45_39571_c1	nmdc:mga07m45_39571_c1_135_965	257
565	3300050507	nmdc:mga05p37_26728_c1	nmdc:mga05p37_26728_c1_1450_2280	257
566	3300050511	nmdc:mga08y16_37_c1	nmdc:mga08y16_37_c1_143818_144648	257
567	3300050516	nmdc:mga0sz30_1077_c1	nmdc:mga0sz30_1077_c1_4093_4923	257
568	3300050516	nmdc:mga0sz30_11101_c1	nmdc:mga0sz30_11101_c1_1317_2147	257
569	3300053086	Ga0500578_0084600	Ga0500578_0084600_432_1262	257
570	3300053109	Ga0500569_004319	Ga0500569_004319_1194_2024	257
571	3300053134	Ga0500658_0011141	Ga0500658_0011141_1135_1965	257
572	3300053139	Ga0500568_0023353	Ga0500568_0023353_1391_2221	257
573	3300053153	Ga0500616_0015769	Ga0500616_0015769_2073_2903	257
574	3300053153	Ga0500616_0029535	Ga0500616_0029535_955_1785	257
575	3300053156	Ga0500622_0005307	Ga0500622_0005307_2418_3248	257
576	iso_pu_bacteria	2917832318	2917833064	257
577	iso_pu_bacteria	2919125081	2919127451	257
578	iso_pu_bacteria	2984504281	2984507182	257
579	iso_pu_bacteria	8016728285	8016730724	257
580	3300003323	rootH1_10074181	rootH1_100741811	258
581	3300005330	Ga0070690_100017026	Ga0070690_1000170263	258
582	3300005334	Ga0068869_100091789	Ga0068869_1000917892	258
583	3300005340	Ga0070689_100007290	Ga0070689_1000072902	258
584	3300005340	Ga0070689_100055388	Ga0070689_1000553883	258
585	3300005340	Ga0070689_100120917	Ga0070689_1001209173	258
586	3300005353	Ga0070669_100255455	Ga0070669_1002554552	258
587	3300005441	Ga0070700_100030440	Ga0070700_1000304403	258
588	3300005467	Ga0070706_100055271	Ga0070706_1000552712	258
589	3300005518	Ga0070699_100103821	Ga0070699_1001038212	258
590	3300005615	Ga0070702_100021213	Ga0070702_1000212133	258
591	3300005719	Ga0068861_100020341	Ga0068861_1000203412	258
592	3300006042	Ga0075368_10001302	Ga0075368_100013024	258
593	3300006177	Ga0075362_10005020	Ga0075362_100050202	258
594	3300006948	Ga0099826_10016091	Ga0099826_100160914	258
595	3300009148	Ga0105243_10016832	Ga0105243_100168322	258
596	3300009553	Ga0105249_10249195	Ga0105249_102491952	258
597	3300013100	Ga0157373_10015096	Ga0157373_100150963	258
598	3300013102	Ga0157371_10000002	Ga0157371_10000002441	258
599	3300013104	Ga0157370_10000286	Ga0157370_1000028621	258
600	3300014326	Ga0157380_10196728	Ga0157380_101967282	258
601	3300025923	Ga0207681_10113810	Ga0207681_101138102	258
602	3300025936	Ga0207670_10003655	Ga0207670_100036552	258
603	3300025936	Ga0207670_10038245	Ga0207670_100382452	258
604	3300025936	Ga0207670_10096215	Ga0207670_100962153	258
605	3300025937	Ga0207669_10212854	Ga0207669_102128542	258
606	3300025942	Ga0207689_10199222	Ga0207689_101992222	258
607	3300025961	Ga0207712_10053862	Ga0207712_100538622	258
608	3300026075	Ga0207708_10038150	Ga0207708_100381502	258
609	3300026118	Ga0207675_100007581	Ga0207675_1000075814	258
610	3300027666	Ga0209282_1000140	Ga0209282_100014011	258
611	3300027666	Ga0209282_1013861	Ga0209282_10138614	258
612	3300027866	Ga0209813_10012515	Ga0209813_100125152	258
613	3300028379	Ga0268266_10009914	Ga0268266_100099144	258
614	3300028794	Ga0307515_10009675	Ga0307515_100096752	258
615	3300030744	Ga0316181_1032962	Ga0316181_10329624	258
616	3300031238	Ga0265332_10002486	Ga0265332_100024866	258
617	3300031548	Ga0307408_100070206	Ga0307408_1000702062	258
618	3300031616	Ga0307508_10031308	Ga0307508_100313084	258
619	3300035090	Ga0373949_0006316	Ga0373949_0006316_303_1220	258
620	3300035398	Ga0316574_0073880	Ga0316574_0073880_142_975	258
621	3300044656	Ga0466969_0088396	Ga0466969_0088396_309_1142	258
622	3300044683	Ga0466965_0014708	Ga0466965_0014708_1090_1923	258
623	3300044684	Ga0466966_0002161	Ga0466966_0002161_6954_7787	258
624	3300044693	Ga0466961_0115190	Ga0466961_0115190_329_1162	258
625	3300044694	Ga0466963_0009068	Ga0466963_0009068_1229_2062	258
626	3300044706	Ga0466964_0000873	Ga0466964_0000873_3577_4410	258
627	3300044712	Ga0453684_0269922	Ga0453684_0269922_1045_1878	258
628	3300044719	Ga0466971_0007760	Ga0466971_0007760_2874_3707	258
629	3300044765	Ga0466970_0021337	Ga0466970_0021337_743_1576	258
630	3300044842	Ga0466957_0046372	Ga0466957_0046372_481_1314	258
631	3300045049	Ga0466959_0000779	Ga0466959_0000779_6447_7280	258
632	3300045836	Ga0466958_0128235	Ga0466958_0128235_528_1361	258
633	3300045976	Ga0466967_0053057	Ga0466967_0053057_1784_2617	258
634	3300046455	Ga0495603_0211586	Ga0495603_0211586_168_1034	258
635	3300046507	Ga0495606_0029712	Ga0495606_0029712_1161_1994	258
636	3300046674	Ga0495588_0002140	Ga0495588_0002140_7474_8307	258
637	3300047470	Ga0495681_0000886	Ga0495681_0000886_8242_9075	258
638	3300048919	Ga0496116_0069740	Ga0496116_0069740_956_1789	258
639	3300048919	Ga0496116_0139969	Ga0496116_0139969_73_906	258
640	3300048920	Ga0496117_0000016	Ga0496117_0000016_319718_320551	258
641	3300048920	Ga0496117_0031273	Ga0496117_0031273_1528_2361	258
642	3300048921	Ga0496118_0000535	Ga0496118_0000535_12089_12922	258
643	3300048922	Ga0496119_0034808	Ga0496119_0034808_2051_2884	258
644	3300048923	Ga0496120_0000056	Ga0496120_0000056_8695_9528	258
645	3300048925	Ga0496122_0000002	Ga0496122_0000002_320379_321212	258
646	3300048926	Ga0496123_0000002	Ga0496123_0000002_1490471_1491304	258
647	3300048926	Ga0496123_0000002	Ga0496123_0000002_320379_321212	258
648	3300048927	Ga0496124_0154303	Ga0496124_0154303_518_1351	258
649	3300048929	Ga0496126_0061258	Ga0496126_0061258_1210_2043	258
650	3300049764	Ga0501267_004716	Ga0501267_004716_357_1199	258
651	3300050491	nmdc:mga00v17_3_c1	nmdc:mga00v17_3_c1_99587_100420	258
652	3300050492	nmdc:mga0yw44_6299_c1	nmdc:mga0yw44_6299_c1_589_1422	258
653	3300050513	nmdc:mga0rr50_356173_c1	nmdc:mga0rr50_356173_c1_182_1045	258
654	3300053094	Ga0500566_0093299	Ga0500566_0093299_252_1091	258
655	3300053123	Ga0500614_001427	Ga0500614_001427_1511_2377	258
656	3300053130	Ga0500642_0005282	Ga0500642_0005282_1703_2560	258
657	3300053137	Ga0500561_0000032	Ga0500561_0000032_24790_25623	258
658	3300053139	Ga0500568_0010926	Ga0500568_0010926_366_1205	258
659	3300053150	Ga0500603_007252	Ga0500603_007252_327_1193	258
660	3300053157	Ga0500624_000321	Ga0500624_000321_15402_16235	258
661	3300053177	Ga0500636_0000170	Ga0500636_0000170_15322_16155	258
662	3300053177	Ga0500636_0017055	Ga0500636_0017055_2886_3752	258
663	iso_pu_bacteria	2821443989	2821447123	258
664	iso_pu_bacteria	2844533157	2844537256	258
665	3300003761	Ga0055535_1007708	Ga0055535_10077082	259
666	3300005334	Ga0068869_100010892	Ga0068869_1000108923	259
667	3300005366	Ga0070659_100152671	Ga0070659_1001526712	259
668	3300005467	Ga0070706_100034063	Ga0070706_1000340635	259
669	3300005468	Ga0070707_100097947	Ga0070707_1000979472	259
670	3300021384	Ga0213876_10008967	Ga0213876_100089672	259
671	3300025242	Ga0209258_101466	Ga0209258_1014664	259
672	3300025272	Ga0209455_1024083	Ga0209455_10240832	259
673	3300025303	Ga0209051_1001918	Ga0209051_10019187	259
674	3300025942	Ga0207689_10020081	Ga0207689_100200813	259
675	3300037471	Ga0395905_0075362	Ga0395905_0075362_1182_2024	259
676	3300037471	Ga0395905_0237720	Ga0395905_0237720_180_1022	259
677	3300037853	Ga0436364_0542050	Ga0436364_0542050_3216_4088	259
678	3300049526	Ga0501303_001095	Ga0501303_001095_970_1806	259
679	3300061734	Ga0530510_0065196	Ga0530510_0065196_1647_2483	259
680	iso_pu_bacteria	2585428057	2587725156	259
681	iso_pu_bacteria	2588253510	2588293779	259
682	iso_pu_bacteria	2643221592	2643970354	259
683	iso_pu_bacteria	2643221625	2644144012	259
684	iso_pu_bacteria	2643221648	2644275305	259
685	3300003322	rootL2_10004230	rootL2_100042302	260
686	3300005539	Ga0068853_100057149	Ga0068853_1000571493	260
687	3300005981	Ga0081538_10011678	Ga0081538_100116784	260
688	3300005981	Ga0081538_10026117	Ga0081538_100261172	260
689	3300005983	Ga0081540_1020078	Ga0081540_10200782	260
690	3300026035	Ga0207703_10346357	Ga0207703_103463572	260
691	3300031665	Ga0316575_10010575	Ga0316575_100105752	260
692	3300031691	Ga0316579_10015394	Ga0316579_100153943	260
693	3300031727	Ga0316576_10347970	Ga0316576_103479701	260
694	3300031728	Ga0316578_10018507	Ga0316578_100185073	260
695	3300031728	Ga0316578_10047213	Ga0316578_100472133	260
696	3300031733	Ga0316577_10023866	Ga0316577_100238663	260
697	3300032133	Ga0316583_10033979	Ga0316583_100339792	260
698	3300032137	Ga0316585_10006494	Ga0316585_100064943	260
699	3300032137	Ga0316585_10011878	Ga0316585_100118783	260
700	3300032139	Ga0316580_10007769	Ga0316580_100077693	260
701	3300032139	Ga0316580_10009836	Ga0316580_100098362	260
702	3300033524	Ga0316592_1002180	Ga0316592_10021803	260
703	3300033524	Ga0316592_1002899	Ga0316592_10028992	260
704	3300033527	Ga0316586_1001675	Ga0316586_10016753	260
705	3300033541	Ga0316596_1003612	Ga0316596_10036124	260
706	3300035398	Ga0316574_0023120	Ga0316574_0023120_676_1515	260
707	3300036647	Ga0316582_0030642	Ga0316582_0030642_887_1753	260
708	3300039438	Ga0436360_1072920	Ga0436360_1072920_676_1548	260
709	3300046507	Ga0495606_0154699	Ga0495606_0154699_463_1302	260
710	3300049572	Ga0501036_0045628	Ga0501036_0045628_2159_2998	260
711	3300049573	Ga0501037_0071809	Ga0501037_0071809_932_1771	260
712	3300049574	Ga0501038_0176349	Ga0501038_0176349_616_1455	260
713	3300049575	Ga0501039_0076967	Ga0501039_0076967_1077_1916	260
714	3300049577	Ga0501041_0098060	Ga0501041_0098060_532_1371	260
715	3300049578	Ga0501042_0053135	Ga0501042_0053135_1113_1952	260
716	3300049578	Ga0501042_0188445	Ga0501042_0188445_438_1277	260
717	3300049580	Ga0501046_0117996	Ga0501046_0117996_998_1837	260
718	3300049580	Ga0501046_0136736	Ga0501046_0136736_167_1006	260
719	3300049584	Ga0501068_0077424	Ga0501068_0077424_538_1377	260
720	3300049587	Ga0501071_0133499	Ga0501071_0133499_212_1051	260
721	3300049588	Ga0501072_0014436	Ga0501072_0014436_2154_2993	260
722	3300049591	Ga0501075_0096743	Ga0501075_0096743_385_1224	260
723	3300049591	Ga0501075_0403436	Ga0501075_0403436_75_914	260
724	3300049592	Ga0501076_0060501	Ga0501076_0060501_475_1314	260
725	3300049592	Ga0501076_0105417	Ga0501076_0105417_554_1393	260
726	3300049593	Ga0501077_0053366	Ga0501077_0053366_701_1540	260
727	3300049741	Ga0501079_0063490	Ga0501079_0063490_1186_2025	260
728	3300049742	Ga0501080_0353235	Ga0501080_0353235_254_1093	260
729	3300049743	Ga0501081_0016474	Ga0501081_0016474_2556_3395	260
730	3300049824	Ga0501045_0002902	Ga0501045_0002902_4789_5628	260
731	3300054114	Ga0501084_0158807	Ga0501084_0158807_539_1378	260
732	3300060353	Ga0501082_0037360	Ga0501082_0037360_1374_2213	260
733	3300061734	Ga0530510_0062217	Ga0530510_0062217_1716_2555	260
734	3300005841	Ga0068863_100036977	Ga0068863_1000369774	261
735	3300005843	Ga0068860_100056641	Ga0068860_1000566413	261
736	3300009147	Ga0114129_10414098	Ga0114129_104140982	261
737	3300009148	Ga0105243_10203668	Ga0105243_102036682	261
738	3300025927	Ga0207687_10064006	Ga0207687_100640063	261
739	3300025935	Ga0207709_10202657	Ga0207709_102026572	261
740	3300025942	Ga0207689_10014466	Ga0207689_100144663	261
741	3300026088	Ga0207641_10028105	Ga0207641_100281052	261
742	3300031456	Ga0307513_10297313	Ga0307513_102973132	262
743	3300006195	Ga0075366_10043272	Ga0075366_100432723	263
744	3300006353	Ga0075370_10013860	Ga0075370_100138602	263
745	3300025273	Ga0209673_1007020	Ga0209673_10070205	263
746	3300025298	Ga0209050_1000330	Ga0209050_100033037	263
747	3300025321	Ga0207656_10127452	Ga0207656_101274521	263
748	3300050493	nmdc:mga0k408_51874_c1	nmdc:mga0k408_51874_c1_465_1313	263
749	3300053086	Ga0500578_0000715	Ga0500578_0000715_12526_13374	263
750	3300053156	Ga0500622_0035542	Ga0500622_0035542_230_1078	263
751	3300002705	JGI25156J39149_1000151	JGI25156J39149_100015132	264
752	3300002738	JGI25154J39366_1000881	JGI25154J39366_10008812	264
753	3300002741	JGI25157J39369_1000193	JGI25157J39369_100019310	264
754	3300002774	JGI25150J39212_1012793	JGI25150J39212_10127932	264
755	3300003215	JGI25153J46596_10000223	JGI25153J46596_1000022337	264
756	3300003323	rootH1_10020005	rootH1_100200052	264
757	3300003323	rootH1_10042812	rootH1_100428122	264
758	3300003752	Ga0055539_1000768	Ga0055539_10007684	264
759	3300003771	Ga0055526_1001701	Ga0055526_10017013	264
760	3300005365	Ga0070688_100176062	Ga0070688_1001760622	264
761	3300005563	Ga0068855_100232673	Ga0068855_1002326732	264
762	3300005577	Ga0068857_100048312	Ga0068857_1000483122	264
763	3300005577	Ga0068857_100670623	Ga0068857_1006706231	264
764	3300005614	Ga0068856_100001527	Ga0068856_1000015279	264
765	3300005834	Ga0068851_10149159	Ga0068851_101491591	264
766	3300009093	Ga0105240_10158769	Ga0105240_101587693	264
767	3300009551	Ga0105238_10066584	Ga0105238_100665842	264
768	3300013105	Ga0157369_10053572	Ga0157369_100535724	264
769	3300025245	Ga0207425_1000121	Ga0207425_100012143	264
770	3300025246	Ga0209646_1000261	Ga0209646_100026130	264
771	3300025250	Ga0209026_1000317	Ga0209026_100031730	264
772	3300025253	Ga0209677_100101	Ga0209677_10010177	264
773	3300025256	Ga0209759_1000422	Ga0209759_100042230	264
774	3300025258	Ga0209129_1000012	Ga0209129_1000012319	264
775	3300025263	Ga0209565_1028096	Ga0209565_10280962	264
776	3300025273	Ga0209673_1024227	Ga0209673_10242272	264
777	3300025295	Ga0209564_1000022	Ga0209564_1000022195	264
778	3300025297	Ga0209758_1000099	Ga0209758_100009954	264
779	3300025299	Ga0209256_1038728	Ga0209256_10387282	264
780	3300025913	Ga0207695_10002838	Ga0207695_1000283811	264
781	3300025949	Ga0207667_10067131	Ga0207667_100671313	264
782	3300025949	Ga0207667_10108465	Ga0207667_101084652	264
783	3300026041	Ga0207639_10324471	Ga0207639_103244711	264
784	3300026078	Ga0207702_10001644	Ga0207702_100016449	264
785	3300026116	Ga0207674_10006094	Ga0207674_100060948	264
786	3300037466	Ga0395898_0013033	Ga0395898_0013033_6081_6932	264
787	3300037471	Ga0395905_0207542	Ga0395905_0207542_209_1060	264
788	3300038443	Ga0395901_0005276	Ga0395901_0005276_10801_11652	264
789	3300045976	Ga0466967_0028666	Ga0466967_0028666_3361_4212	264
790	3300049579	Ga0501043_0093000	Ga0501043_0093000_337_1188	264
791	3300049822	Ga0501035_0133433	Ga0501035_0133433_1069_1920	264
792	3300049823	Ga0501044_0010919	Ga0501044_0010919_3808_4659	264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

111

299

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7cad-assembly1.cif.gz_B	mycobacterium smegmatis sugabc complex	0.4987	15	264
4tqu-assembly1.cif.gz_N	crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate	0.4894	11	253
8hpn-assembly1.cif.gz_B	lpqy-sugabc in state 3	0.4764	15	255
7cad-assembly1.cif.gz_B	mycobacterium smegmatis sugabc complex	0.476	15	264
4jbw-assembly2.cif.gz_I	crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc	0.4754	7	251

ID	Description	Score	Start	End	Superfamily
af_P10906_2_274_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.5054	15	251	1.10.3720.10
af_P9WG01_5_265_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.4998	15	254	1.10.3720.10
af_P71896_49_286_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.4936	135	252	1.10.3720.10
af_L7N652_1_266_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.4907	1	254	1.10.3720.10
af_P77716_1_267_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.4903	15	251	1.10.3720.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2N1RZT4-F1-model_v4	Sugar ABC transporter permease	0.5587	8	264	GO:0005886 GO:0055085
AF-A0A0S2W628-F1-model_v4	ABC transmembrane type-1 domain-containing protein	0.5571	15	264	GO:0005886 GO:0055085
AF-A0A3N1N8R4-F1-model_v4	deleted	0.5551	11	261
AF-A0A419Y0Q8-F1-model_v4	deleted	0.555	2	261
AF-A0A4Q3G4D0-F1-model_v4	deleted	0.5519	9	262

Feature Viewer

pLDDT	pTM	Quality
77.28	0.63	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F481028

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

111

299

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map