F480955

General Info

Members Datasets Scaffolds Average Seq Length
790 306 1580 329

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0472856|Ga0451853_0472856_161_1291
Length 376
Sequence VRSGKTPIGAAEGCGENPFGTSPRCSGASGTLQRTTMTKPPFLSSRRGAPALRRRCLAVLGLAVAMLGGGSAFAQTELKLGHVGEPGSLLAASTEEYAKRINARLAGKVKVVVYGSSQLGGDKEMLQKVKLGTLDMVLPSTVMSSEVDLFGIFEMPYLVKDREHMKRIEQAVFWPKLAPETEKKGLKVIAVWENGYRNITNNKRPIKTPDDLKGIKLRVPEGKWRVKMFQAYGANPSPMKFSELFTALQTGVMDGQENPLTQIYSAKLQEVQKYLSLSGHVYTPSYLIVGSRKWATLPADVRKVLEDTAKETQAFVYETAAHEETDLLGKLKQAGMQVNEVDKDAFFAASKPIYEEFSTEVAGAKALLDQAAALRK

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
243 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
306 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.13
Rhizoplane 2.03
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0472856 3300041512 Bacteria 1557
2 Ga0070658_10014541 3300005327 Bacteria 6317
3 Ga0070658_10045275 3300005327 Bacteria 3558
4 Ga0070658_10066518 3300005327 Bacteria 2944
5 Ga0070658_10084139 3300005327 Bacteria 2616
6 Ga0070658_10148900 3300005327 Bacteria 1959
7 Ga0070658_10150053 3300005327 Bacteria 1951
8 Ga0070658_10290901 3300005327 Bacteria 1392
9 Ga0070658_10352531 3300005327 Bacteria 1260
10 Ga0070676_10318666 3300005328 Bacteria 1059
11 Ga0070683_100014342 3300005329 Bacteria 6931
12 Ga0070683_100040826 3300005329 Bacteria 4266
13 Ga0070683_100057081 3300005329 Bacteria 3626
14 Ga0070683_100066241 3300005329 Bacteria 3364
15 Ga0070670_100031458 3300005331 Bacteria 4570
16 Ga0068869_100048924 3300005334 Bacteria 3059
17 Ga0068869_100268493 3300005334 Bacteria 1368
18 Ga0070666_10016572 3300005335 Bacteria 4715
19 Ga0070666_10043621 3300005335 Bacteria 3003
20 Ga0070680_100001220 3300005336 Bacteria 18520
21 Ga0070680_100069611 3300005336 Bacteria 2889
22 Ga0070680_100087094 3300005336 Bacteria 2582
23 Ga0070680_100116886 3300005336 Bacteria 2224
24 Ga0070680_100180216 3300005336 Bacteria 1779
25 Ga0070682_100010676 3300005337 Bacteria 5220
26 Ga0068868_100029461 3300005338 Bacteria 4204
27 Ga0068868_100080936 3300005338 Bacteria 2603
28 Ga0070660_100003047 3300005339 Bacteria 11529
29 Ga0070660_100011210 3300005339 Bacteria 6362
30 Ga0070660_100030341 3300005339 Bacteria 4056
31 Ga0070660_100048387 3300005339 Bacteria 3266
32 Ga0070689_100014168 3300005340 Bacteria 5787
33 Ga0070661_100000659 3300005344 Bacteria 25350
34 Ga0070661_100007548 3300005344 Bacteria 7503
35 Ga0070661_100033091 3300005344 Bacteria 3744
36 Ga0070661_100042473 3300005344 Bacteria 3318
37 Ga0070661_100099671 3300005344 Bacteria 2159
38 Ga0070661_100136587 3300005344 Bacteria 1845
39 Ga0070661_100172373 3300005344 Bacteria 1643
40 Ga0070692_10008294 3300005345 Bacteria 4630
41 Ga0070692_10024640 3300005345 Bacteria 2959
42 Ga0070692_10094067 3300005345 Bacteria 1633
43 Ga0070669_100034654 3300005353 Bacteria 3655
44 Ga0070669_100039097 3300005353 Bacteria 3446
45 Ga0070669_100105699 3300005353 Bacteria 2130
46 Ga0070675_100043993 3300005354 Bacteria 3652
47 Ga0070675_100287990 3300005354 Bacteria 1445
48 Ga0070671_100085165 3300005355 Bacteria 2644
49 Ga0070671_100099897 3300005355 Bacteria 2434
50 Ga0070671_100169857 3300005355 Bacteria 1844
51 Ga0070671_100220556 3300005355 Bacteria 1609
52 Ga0070673_100005875 3300005364 Bacteria 7915
53 Ga0070673_100039404 3300005364 Bacteria 3616
54 Ga0070673_100086495 3300005364 Bacteria 2554
55 Ga0070673_100307100 3300005364 Bacteria 1398
56 Ga0070659_100002518 3300005366 Bacteria 13010
57 Ga0070659_100021894 3300005366 Bacteria 4875
58 Ga0070659_100081540 3300005366 Bacteria 2584
59 Ga0070659_100127068 3300005366 Bacteria 2069
60 Ga0070659_100356057 3300005366 Bacteria 1229
61 Ga0070667_100097949 3300005367 Bacteria 2530
62 Ga0070667_100322768 3300005367 Bacteria 1393
63 Ga0070709_10039869 3300005434 Bacteria 2884
64 Ga0070709_10163923 3300005434 Bacteria 1548
65 Ga0070709_10258352 3300005434 Bacteria 1257
66 Ga0070714_100001230 3300005435 Bacteria 18485
67 Ga0070714_100012985 3300005435 Bacteria 6662
68 Ga0070714_100040709 3300005435 Bacteria 3917
69 Ga0070714_100176106 3300005435 Bacteria 1944
70 Ga0070714_100327199 3300005435 Bacteria 1434
71 Ga0070714_100441690 3300005435 Bacteria 1235
72 Ga0070713_100041327 3300005436 Bacteria 3756
73 Ga0070713_100044368 3300005436 Bacteria 3639
74 Ga0070713_100068647 3300005436 Bacteria 2987
75 Ga0070710_10023720 3300005437 Bacteria 3228
76 Ga0070701_10108773 3300005438 Bacteria 1546
77 Ga0070711_100019511 3300005439 Bacteria 4350
78 Ga0070711_100057157 3300005439 Bacteria 2700
79 Ga0070694_100120685 3300005444 Bacteria 1880
80 Ga0070708_100442065 3300005445 Bacteria 1227
81 Ga0070663_100002206 3300005455 Bacteria 10895
82 Ga0070663_100037714 3300005455 Bacteria 3367
83 Ga0070663_100054756 3300005455 Bacteria 2852
84 Ga0070663_100141109 3300005455 Bacteria 1840
85 Ga0070663_100192566 3300005455 Bacteria 1587
86 Ga0070663_100280446 3300005455 Bacteria 1328
87 Ga0070678_100146298 3300005456 Bacteria 1897
88 Ga0070662_100002542 3300005457 Bacteria 11237
89 Ga0070662_100082196 3300005457 Bacteria 2402
90 Ga0070681_10006079 3300005458 Bacteria 11708
91 Ga0070681_10017264 3300005458 Bacteria 7212
92 Ga0070681_10032524 3300005458 Bacteria 5235
93 Ga0070681_10051174 3300005458 Bacteria 4120
94 Ga0070681_10065111 3300005458 Bacteria 3614
95 Ga0070681_10081150 3300005458 Bacteria 3199
96 Ga0070681_10137047 3300005458 Bacteria 2378
97 Ga0070681_10247713 3300005458 Bacteria 1695
98 Ga0070681_10330544 3300005458 Bacteria 1434
99 Ga0068867_100100841 3300005459 Bacteria 2205
100 Ga0070685_10009162 3300005466 Bacteria 5109
101 Ga0070707_100252846 3300005468 Bacteria 1715
102 Ga0070699_100062841 3300005518 Bacteria 3219
103 Ga0070699_100091987 3300005518 Bacteria 2653
104 Ga0070699_100108419 3300005518 Bacteria 2437
105 Ga0070679_100002223 3300005530 Bacteria 17526
106 Ga0070679_100012385 3300005530 Bacteria 8149
107 Ga0070679_100012464 3300005530 Bacteria 8126
108 Ga0070679_100022596 3300005530 Bacteria 6148
109 Ga0070679_100028486 3300005530 Bacteria 5507
110 Ga0070679_100035984 3300005530 Bacteria 4913
111 Ga0070679_100039760 3300005530 Bacteria 4675
112 Ga0070679_100048642 3300005530 Bacteria 4224
113 Ga0070679_100049521 3300005530 Bacteria 4184
114 Ga0070679_100072269 3300005530 Bacteria 3442
115 Ga0070679_100127957 3300005530 Bacteria 2521
116 Ga0070679_100178799 3300005530 Bacteria 2094
117 Ga0070684_100028079 3300005535 Bacteria 4756
118 Ga0070684_100032759 3300005535 Bacteria 4433
119 Ga0070684_100049016 3300005535 Bacteria 3665
120 Ga0068853_100015209 3300005539 Bacteria 6325
121 Ga0068853_100029855 3300005539 Bacteria 4599
122 Ga0068853_100065040 3300005539 Bacteria 3164
123 Ga0070672_100057825 3300005543 Bacteria 3045
124 Ga0070672_100268665 3300005543 Bacteria 1439
125 Ga0070686_100290249 3300005544 Bacteria 1210
126 Ga0070695_100134142 3300005545 Bacteria 1709
127 Ga0070696_100000647 3300005546 Bacteria 22250
128 Ga0070665_100038962 3300005548 Bacteria 4779
129 Ga0068855_100006103 3300005563 Bacteria 14694
130 Ga0068855_100007555 3300005563 Bacteria 13153
131 Ga0068855_100022104 3300005563 Bacteria 7624
132 Ga0068855_100069451 3300005563 Bacteria 4100
133 Ga0068855_100069463 3300005563 Bacteria 4099
134 Ga0068855_100075173 3300005563 Bacteria 3923
135 Ga0068855_100090119 3300005563 Bacteria 3540
136 Ga0070664_100000157 3300005564 Bacteria 47128
137 Ga0070664_100000662 3300005564 Bacteria 26301
138 Ga0070664_100015295 3300005564 Bacteria 6273
139 Ga0070664_100042978 3300005564 Bacteria 3812
140 Ga0070664_100058072 3300005564 Bacteria 3291
141 Ga0070664_100196445 3300005564 Bacteria 1798
142 Ga0070664_100229350 3300005564 Bacteria 1664
143 Ga0068857_100002118 3300005577 Bacteria 16141
144 Ga0068857_100009373 3300005577 Bacteria 8498
145 Ga0068857_100099262 3300005577 Bacteria 2612
146 Ga0068857_100129709 3300005577 Bacteria 2273
147 Ga0068857_100196197 3300005577 Bacteria 1839
148 Ga0068854_100005030 3300005578 Bacteria 8328
149 Ga0068854_100020694 3300005578 Bacteria 4457
150 Ga0068854_100031708 3300005578 Bacteria 3674
151 Ga0068854_100039623 3300005578 Bacteria 3321
152 Ga0068854_100080306 3300005578 Bacteria 2407
153 Ga0068854_100090917 3300005578 Bacteria 2271
154 Ga0068854_100157923 3300005578 Bacteria 1754
155 Ga0068854_100227271 3300005578 Bacteria 1479
156 Ga0068856_100003357 3300005614 Bacteria 16236
157 Ga0068856_100007224 3300005614 Bacteria 10835
158 Ga0068856_100056804 3300005614 Bacteria 3863
159 Ga0068856_100112135 3300005614 Bacteria 2725
160 Ga0068856_100197242 3300005614 Bacteria 2027
161 Ga0068856_100422660 3300005614 Bacteria 1353
162 Ga0070702_100008195 3300005615 Bacteria 5047
163 Ga0068852_100000826 3300005616 Bacteria 20462
164 Ga0068852_100001041 3300005616 Bacteria 18251
165 Ga0068852_100005593 3300005616 Bacteria 9009
166 Ga0068859_100135280 3300005617 Bacteria 2537
167 Ga0068859_100192282 3300005617 Bacteria 2125
168 Ga0068864_100000836 3300005618 Bacteria 25975
169 Ga0068864_100212286 3300005618 Bacteria 1783
170 Ga0068866_10003875 3300005718 Bacteria 6135
171 Ga0068861_100327556 3300005719 Bacteria 1336
172 Ga0068851_10008632 3300005834 Bacteria 4717
173 Ga0068851_10020864 3300005834 Bacteria 3176
174 Ga0068863_100060640 3300005841 Bacteria 3577
175 Ga0068863_100090905 3300005841 Bacteria 2894
176 Ga0068863_100398513 3300005841 Bacteria 1346
177 Ga0068858_100002758 3300005842 Bacteria 17655
178 Ga0068858_100084407 3300005842 Bacteria 2954
179 Ga0068860_100023120 3300005843 Bacteria 6010
180 Ga0068860_100156887 3300005843 Bacteria 2193
181 Ga0070717_10332334 3300006028 Bacteria 1356
182 Ga0070717_10333586 3300006028 Bacteria 1353
183 Ga0070715_10021078 3300006163 Bacteria 2522
184 Ga0070715_10061509 3300006163 Bacteria 1649
185 Ga0070712_100007146 3300006175 Bacteria 6962
186 Ga0070712_100234637 3300006175 Bacteria 1458
187 Ga0097621_100068335 3300006237 Bacteria 2930
188 Ga0097621_100220087 3300006237 Bacteria 1654
189 Ga0068871_100075121 3300006358 Bacteria 2789
190 Ga0068871_100181398 3300006358 Bacteria 1809
191 Ga0068871_100183372 3300006358 Bacteria 1800
192 Ga0068871_100460020 3300006358 Bacteria 1142
193 Ga0075428_100017431 3300006844 Bacteria 7937
194 Ga0075434_100062690 3300006871 Bacteria 3701
195 Ga0075434_100106255 3300006871 Bacteria 2817
196 Ga0068865_100085004 3300006881 Bacteria 2281
197 Ga0075436_100040552 3300006914 Bacteria 3213
198 Ga0075436_100093243 3300006914 Bacteria 2094
199 Ga0097620_100135272 3300006931 Bacteria 2537
200 Ga0097620_100192285 3300006931 Bacteria 2125
201 Ga0075435_100385480 3300007076 Bacteria 1204
202 Ga0099795_10054122 3300007788 Bacteria 1470
203 Ga0105240_10004865 3300009093 Bacteria 20216
204 Ga0105240_10006057 3300009093 Bacteria 17866
205 Ga0105240_10007716 3300009093 Bacteria 15569
206 Ga0105240_10007858 3300009093 Bacteria 15392
207 Ga0105240_10017051 3300009093 Bacteria 9808
208 Ga0105240_10018681 3300009093 Bacteria 9288
209 Ga0105240_10041376 3300009093 Bacteria 5882
210 Ga0105240_10104066 3300009093 Bacteria 3447
211 Ga0105240_10171461 3300009093 Bacteria 2570
212 Ga0105240_10458322 3300009093 Bacteria 1425
213 Ga0105245_10019049 3300009098 Bacteria 6007
214 Ga0105245_10023939 3300009098 Bacteria 5359
215 Ga0105245_10035739 3300009098 Bacteria 4410
216 Ga0105241_10008874 3300009174 Bacteria 7394
217 Ga0105242_10061250 3300009176 Bacteria 3095
218 Ga0105248_10001643 3300009177 Bacteria 24867
219 Ga0105237_10008781 3300009545 Bacteria 10901
220 Ga0105237_10094865 3300009545 Bacteria 2972
221 Ga0105237_10552263 3300009545 Bacteria 1158
222 Ga0105238_10000203 3300009551 Bacteria 65825
223 Ga0105238_10005300 3300009551 Bacteria 12739
224 Ga0105238_10015654 3300009551 Bacteria 7677
225 Ga0105238_10022170 3300009551 Bacteria 6477
226 Ga0105238_10025071 3300009551 Bacteria 6079
227 Ga0105238_10223875 3300009551 Bacteria 1858
228 Ga0105239_10093277 3300010375 Bacteria 3324
229 Ga0105239_10323087 3300010375 Bacteria 1740
230 Ga0105239_10748449 3300010375 Bacteria 1118
231 Ga0105246_10069127 3300011119 Bacteria 2479
232 Ga0157373_10001573 3300013100 Bacteria 17415
233 Ga0157373_10016974 3300013100 Bacteria 5303
234 Ga0157373_10032306 3300013100 Bacteria 3768
235 Ga0157373_10047841 3300013100 Bacteria 3050
236 Ga0157373_10068387 3300013100 Bacteria 2510
237 Ga0157373_10101786 3300013100 Bacteria 2021
238 Ga0157373_10107530 3300013100 Bacteria 1961
239 Ga0157373_10148394 3300013100 Bacteria 1650
240 Ga0157371_10002592 3300013102 Bacteria 17154
241 Ga0157371_10016262 3300013102 Bacteria 5557
242 Ga0157371_10127408 3300013102 Bacteria 1811
243 Ga0157370_10001120 3300013104 Bacteria 33464
244 Ga0157370_10002318 3300013104 Bacteria 23048
245 Ga0157370_10010117 3300013104 Bacteria 9961
246 Ga0157370_10015498 3300013104 Bacteria 7750
247 Ga0157370_10028168 3300013104 Bacteria 5530
248 Ga0157370_10053733 3300013104 Bacteria 3841
249 Ga0157370_10073398 3300013104 Bacteria 3228
250 Ga0157370_10078279 3300013104 Bacteria 3114
251 Ga0157370_10087886 3300013104 Bacteria 2919
252 Ga0157370_10090588 3300013104 Bacteria 2871
253 Ga0157370_10224140 3300013104 Bacteria 1741
254 Ga0157369_10004919 3300013105 Bacteria 15662
255 Ga0157369_10008031 3300013105 Bacteria 12109
256 Ga0157369_10018830 3300013105 Bacteria 7737
257 Ga0157369_10054805 3300013105 Bacteria 4305
258 Ga0157369_10137759 3300013105 Bacteria 2583
259 Ga0157369_10232238 3300013105 Bacteria 1928
260 Ga0157374_10003153 3300013296 Bacteria 13861
261 Ga0157374_10125525 3300013296 Bacteria 2480
262 Ga0157378_10066491 3300013297 Bacteria 3229
263 Ga0157378_10120977 3300013297 Bacteria 2413
264 Ga0157378_10403246 3300013297 Bacteria 1348
265 Ga0163162_10024159 3300013306 Bacteria 5998
266 Ga0163162_10041753 3300013306 Bacteria 4590
267 Ga0163162_10047261 3300013306 Bacteria 4313
268 Ga0163162_10065671 3300013306 Bacteria 3676
269 Ga0163162_10072223 3300013306 Bacteria 3505
270 Ga0157372_10001409 3300013307 Bacteria 25953
271 Ga0157372_10004130 3300013307 Bacteria 15553
272 Ga0157372_10007797 3300013307 Bacteria 11373
273 Ga0157372_10009719 3300013307 Bacteria 10230
274 Ga0157372_10019156 3300013307 Bacteria 7369
275 Ga0157372_10132532 3300013307 Bacteria 2869
276 Ga0157375_10032094 3300013308 Bacteria 4977
277 Ga0157375_10130879 3300013308 Bacteria 2628
278 Ga0163163_10031646 3300014325 Bacteria 5107
279 Ga0157380_10442143 3300014326 Bacteria 1246
280 Ga0157380_10482403 3300014326 Bacteria 1199
281 Ga0157377_10175814 3300014745 Bacteria 1342
282 Ga0157376_10006216 3300014969 Bacteria 8416
283 Ga0157376_10207725 3300014969 Bacteria 1806
284 Ga0182005_1031178 3300015265 Bacteria 1453
285 Ga0163161_10022924 3300017792 Bacteria 4399
286 Ga0163161_10157182 3300017792 Bacteria 1731
287 Ga0207680_10121218 3300025903 Bacteria 1710
288 Ga0207699_10141582 3300025906 Bacteria 1581
289 Ga0207643_10059517 3300025908 Bacteria 2179
290 Ga0207705_10008790 3300025909 Bacteria 7363
291 Ga0207705_10020178 3300025909 Bacteria 4768
292 Ga0207705_10026329 3300025909 Bacteria 4148
293 Ga0207705_10094523 3300025909 Bacteria 2192
294 Ga0207705_10202618 3300025909 Bacteria 1504
295 Ga0207654_10013056 3300025911 Bacteria 4266
296 Ga0207654_10054982 3300025911 Bacteria 2303
297 Ga0207707_10016373 3300025912 Bacteria 6466
298 Ga0207707_10034346 3300025912 Bacteria 4436
299 Ga0207707_10035990 3300025912 Bacteria 4328
300 Ga0207707_10108112 3300025912 Bacteria 2432
301 Ga0207707_10172045 3300025912 Bacteria 1893
302 Ga0207707_10323393 3300025912 Bacteria 1331
303 Ga0207695_10016171 3300025913 Bacteria 8749
304 Ga0207695_10043015 3300025913 Bacteria 4818
305 Ga0207695_10049717 3300025913 Bacteria 4416
306 Ga0207695_10051599 3300025913 Bacteria 4316
307 Ga0207695_10091139 3300025913 Bacteria 3063
308 Ga0207695_10150764 3300025913 Bacteria 2264
309 Ga0207695_10151078 3300025913 Bacteria 2262
310 Ga0207671_10169164 3300025914 Bacteria 1696
311 Ga0207671_10202165 3300025914 Bacteria 1552
312 Ga0207693_10201414 3300025915 Bacteria 1566
313 Ga0207660_10000918 3300025917 Bacteria 19431
314 Ga0207660_10022899 3300025917 Bacteria 4212
315 Ga0207660_10036379 3300025917 Bacteria 3422
316 Ga0207660_10095436 3300025917 Bacteria 2212
317 Ga0207660_10176045 3300025917 Bacteria 1659
318 Ga0207660_10404312 3300025917 Bacteria 1100
319 Ga0207662_10096609 3300025918 Bacteria 1825
320 Ga0207657_10000586 3300025919 Bacteria 38661
321 Ga0207657_10002457 3300025919 Bacteria 20027
322 Ga0207657_10009562 3300025919 Bacteria 9730
323 Ga0207657_10041288 3300025919 Bacteria 4080
324 Ga0207657_10058693 3300025919 Bacteria 3310
325 Ga0207657_10063624 3300025919 Bacteria 3153
326 Ga0207657_10091926 3300025919 Bacteria 2529
327 Ga0207649_10003878 3300025920 Bacteria 8155
328 Ga0207649_10015963 3300025920 Bacteria 4226
329 Ga0207649_10031357 3300025920 Bacteria 3158
330 Ga0207649_10032416 3300025920 Bacteria 3115
331 Ga0207649_10132484 3300025920 Bacteria 1695
332 Ga0207649_10166363 3300025920 Bacteria 1532
333 Ga0207652_10004936 3300025921 Bacteria 10797
334 Ga0207652_10022926 3300025921 Bacteria 5171
335 Ga0207652_10029509 3300025921 Bacteria 4587
336 Ga0207652_10035307 3300025921 Bacteria 4219
337 Ga0207652_10039342 3300025921 Bacteria 4013
338 Ga0207652_10094577 3300025921 Bacteria 2631
339 Ga0207652_10099129 3300025921 Bacteria 2570
340 Ga0207652_10155956 3300025921 Bacteria 2045
341 Ga0207652_10405137 3300025921 Bacteria 1231
342 Ga0207652_10484790 3300025921 Bacteria 1113
343 Ga0207646_10025356 3300025922 Bacteria 5424
344 Ga0207681_10115047 3300025923 Bacteria 1963
345 Ga0207694_10006781 3300025924 Bacteria 8697
346 Ga0207694_10010483 3300025924 Bacteria 6990
347 Ga0207694_10014521 3300025924 Bacteria 5938
348 Ga0207694_10029612 3300025924 Bacteria 4178
349 Ga0207694_10206536 3300025924 Bacteria 1599
350 Ga0207659_10071014 3300025926 Bacteria 2541
351 Ga0207687_10002728 3300025927 Bacteria 11957
352 Ga0207687_10028131 3300025927 Bacteria 3777
353 Ga0207687_10034278 3300025927 Bacteria 3447
354 Ga0207700_10017425 3300025928 Bacteria 4798
355 Ga0207700_10048370 3300025928 Bacteria 3157
356 Ga0207664_10008038 3300025929 Bacteria 7332
357 Ga0207664_10044232 3300025929 Bacteria 3486
358 Ga0207644_10002797 3300025931 Bacteria 11244
359 Ga0207644_10008406 3300025931 Bacteria 6756
360 Ga0207644_10177909 3300025931 Bacteria 1665
361 Ga0207644_10196837 3300025931 Bacteria 1587
362 Ga0207690_10013365 3300025932 Bacteria 4934
363 Ga0207690_10055002 3300025932 Bacteria 2679
364 Ga0207690_10328266 3300025932 Bacteria 1204
365 Ga0207706_10002770 3300025933 Bacteria 17037
366 Ga0207706_10021790 3300025933 Bacteria 5751
367 Ga0207686_10218872 3300025934 Bacteria 1373
368 Ga0207670_10014556 3300025936 Bacteria 4674
369 Ga0207669_10041984 3300025937 Bacteria 2666
370 Ga0207665_10019599 3300025939 Bacteria 4448
371 Ga0207665_10036446 3300025939 Bacteria 3271
372 Ga0207665_10076841 3300025939 Bacteria 2291
373 Ga0207691_10010545 3300025940 Bacteria 8868
374 Ga0207691_10067598 3300025940 Bacteria 3231
375 Ga0207691_10238336 3300025940 Bacteria 1573
376 Ga0207711_10000116 3300025941 Bacteria 83390
377 Ga0207711_10007075 3300025941 Bacteria 9402
378 Ga0207689_10038570 3300025942 Bacteria 3956
379 Ga0207661_10011082 3300025944 Bacteria 6516
380 Ga0207661_10014956 3300025944 Bacteria 5697
381 Ga0207661_10163354 3300025944 Bacteria 1933
382 Ga0207679_10003482 3300025945 Bacteria 9730
383 Ga0207679_10006427 3300025945 Bacteria 7423
384 Ga0207679_10012754 3300025945 Bacteria 5490
385 Ga0207679_10022679 3300025945 Bacteria 4279
386 Ga0207679_10025964 3300025945 Bacteria 4034
387 Ga0207679_10042623 3300025945 Bacteria 3263
388 Ga0207679_10154420 3300025945 Bacteria 1872
389 Ga0207679_10253156 3300025945 Bacteria 1498
390 Ga0207679_10269379 3300025945 Bacteria 1456
391 Ga0207667_10000425 3300025949 Bacteria 56804
392 Ga0207667_10009574 3300025949 Bacteria 11400
393 Ga0207667_10015677 3300025949 Bacteria 8596
394 Ga0207667_10041828 3300025949 Bacteria 4873
395 Ga0207667_10065965 3300025949 Bacteria 3774
396 Ga0207667_10094825 3300025949 Bacteria 3081
397 Ga0207667_10107077 3300025949 Bacteria 2883
398 Ga0207667_10122191 3300025949 Bacteria 2683
399 Ga0207667_10261083 3300025949 Bacteria 1771
400 Ga0207667_10346379 3300025949 Bacteria 1515
401 Ga0207651_10015223 3300025960 Bacteria 4464
402 Ga0207651_10052444 3300025960 Bacteria 2781
403 Ga0207640_10070754 3300025981 Bacteria 2348
404 Ga0207658_10122137 3300025986 Bacteria 2078
405 Ga0207658_10174695 3300025986 Bacteria 1773
406 Ga0207658_10299886 3300025986 Bacteria 1384
407 Ga0207677_10000188 3300026023 Bacteria 49751
408 Ga0207703_10000806 3300026035 Bacteria 30873
409 Ga0207639_10048427 3300026041 Bacteria 3217
410 Ga0207639_10054697 3300026041 Bacteria 3052
411 Ga0207639_10087916 3300026041 Bacteria 2478
412 Ga0207639_10202390 3300026041 Bacteria 1704
413 Ga0207678_10005045 3300026067 Bacteria 11846
414 Ga0207678_10016867 3300026067 Bacteria 6413
415 Ga0207678_10080029 3300026067 Bacteria 2797
416 Ga0207678_10094111 3300026067 Bacteria 2560
417 Ga0207702_10002758 3300026078 Bacteria 16441
418 Ga0207702_10002944 3300026078 Bacteria 15907
419 Ga0207702_10024530 3300026078 Bacteria 5004
420 Ga0207702_10042863 3300026078 Bacteria 3798
421 Ga0207702_10052623 3300026078 Bacteria 3446
422 Ga0207702_10354713 3300026078 Bacteria 1404
423 Ga0207641_10027731 3300026088 Bacteria 4679
424 Ga0207641_10037558 3300026088 Bacteria 4045
425 Ga0207648_10042104 3300026089 Bacteria 4010
426 Ga0207648_10054451 3300026089 Bacteria 3494
427 Ga0207648_10068843 3300026089 Bacteria 3084
428 Ga0207676_10000230 3300026095 Bacteria 48620
429 Ga0207676_10122612 3300026095 Bacteria 2195
430 Ga0207674_10000301 3300026116 Bacteria 62588
431 Ga0207674_10000593 3300026116 Bacteria 47678
432 Ga0207674_10024546 3300026116 Bacteria 6439
433 Ga0207674_10142081 3300026116 Bacteria 2360
434 Ga0207675_100057058 3300026118 Bacteria 3643
435 Ga0207675_100090794 3300026118 Bacteria 2872
436 Ga0207683_10001896 3300026121 Bacteria 18497
437 Ga0207683_10089782 3300026121 Bacteria 2735
438 Ga0207683_10248322 3300026121 Bacteria 1624
439 Ga0207698_10001265 3300026142 Bacteria 14771
440 Ga0207698_10134925 3300026142 Bacteria 2116
441 Ga0207698_10171428 3300026142 Bacteria 1911
442 Ga0209995_1004512 3300027471 Bacteria 2226
443 Ga0209970_1000330 3300027614 Bacteria 7911
444 Ga0209983_1003253 3300027665 Bacteria 3486
445 Ga0209971_1002990 3300027682 Bacteria 4042
446 Ga0209971_1023720 3300027682 Bacteria 1464
447 Ga0209966_1001960 3300027695 Bacteria 3449
448 Ga0209974_10000515 3300027876 Bacteria 12912
449 Ga0209974_10028705 3300027876 Bacteria 1842
450 Ga0268266_10041432 3300028379 Bacteria 3929
451 Ga0268264_10025840 3300028381 Bacteria 4795
452 Ga0268264_10092651 3300028381 Bacteria 2608
453 Ga0268264_10131145 3300028381 Bacteria 2222
454 Ga0307408_100026386 3300031548 Bacteria 3990
455 Ga0307408_100060833 3300031548 Bacteria 2754
456 Ga0307408_100118759 3300031548 Bacteria 2045
457 Ga0307413_10110370 3300031824 Bacteria 1840
458 Ga0307413_10145003 3300031824 Bacteria 1647
459 Ga0307410_10026531 3300031852 Bacteria 3648
460 Ga0307410_10031925 3300031852 Bacteria 3384
461 Ga0307406_10029752 3300031901 Bacteria 3309
462 Ga0307406_10031045 3300031901 Bacteria 3250
463 Ga0307412_10039145 3300031911 Bacteria 3059
464 Ga0307409_100019041 3300031995 Bacteria 4636
465 Ga0307409_100042722 3300031995 Bacteria 3397
466 Ga0307416_100115009 3300032002 Bacteria 2381
467 Ga0307416_100390291 3300032002 Bacteria 1426
468 Ga0307416_100539113 3300032002 Bacteria 1238
469 Ga0307414_10050934 3300032004 Bacteria 2871
470 Ga0307414_10074883 3300032004 Bacteria 2455
471 Ga0307411_10017682 3300032005 Bacteria 4071
472 Ga0307411_10306632 3300032005 Bacteria 1276
473 Ga0307415_100103075 3300032126 Bacteria 2098
474 Ga0373934_0012408 3300035086 Bacteria 3217
475 Ga0373944_0003249 3300035089 Bacteria 4180
476 Ga0373936_0004509 3300035113 Bacteria 5272
477 Ga0373941_0003011 3300035115 Bacteria 3772
478 Ga0373945_0066334 3300035116 Bacteria 1357
479 Ga0373953_0006271 3300035117 Bacteria 3908
480 Ga0373954_0016093 3300035118 Bacteria 3346
481 Ga0373957_0067105 3300035120 Bacteria 1398
482 Ga0373943_0007550 3300035170 Bacteria 4883
483 Ga0373946_0002403 3300035171 Bacteria 6619
484 Ga0373946_0092826 3300035171 Bacteria 1340
485 Ga0373955_0036180 3300035172 Bacteria 2618
486 Ga0373924_0040791 3300035410 Bacteria 1901
487 Ga0373935_0004641 3300035692 Bacteria 8075
488 Ga0373935_0019629 3300035692 Bacteria 4122
489 Ga0373935_0089392 3300035692 Bacteria 2014
490 Ga0373935_0220427 3300035692 Bacteria 1317
491 Ga0373927_0006549 3300035695 Bacteria 7934
492 Ga0373927_0058721 3300035695 Bacteria 2488
493 Ga0373927_0157603 3300035695 Bacteria 1487
494 Ga0373933_0029862 3300035724 Bacteria 3154
495 Ga0373947_0023666 3300035725 Bacteria 3575
496 Ga0373947_0025712 3300035725 Bacteria 3433
497 Ga0373947_0209163 3300035725 Bacteria 1279
498 Ga0373937_0023672 3300036401 Bacteria 5535
499 Ga0373937_0122387 3300036401 Bacteria 2425
500 Ga0373937_0128829 3300036401 Bacteria 2362
501 Ga0373937_0180020 3300036401 Bacteria 1985
502 Ga0373925_0011332 3300037068 Bacteria 6471
503 Ga0373925_0013181 3300037068 Bacteria 5984
504 Ga0395899_0000216 3300037312 Bacteria 81683
505 Ga0395899_0003355 3300037312 Bacteria 12697
506 Ga0395899_0084595 3300037312 Bacteria 2306
507 Ga0395899_0135320 3300037312 Bacteria 1757
508 Ga0395900_0002787 3300037418 Bacteria 19106
509 Ga0395900_0003035 3300037418 Bacteria 18279
510 Ga0395900_0355701 3300037418 Bacteria 1437
511 Ga0395900_0462376 3300037418 Bacteria 1223
512 Ga0395898_0008265 3300037466 Bacteria 11006
513 Ga0395898_0040854 3300037466 Bacteria 4584
514 Ga0395898_0155032 3300037466 Bacteria 2191
515 Ga0395905_0054144 3300037471 Bacteria 3755
516 Ga0395905_0290944 3300037471 Bacteria 1520
517 Ga0395905_0292481 3300037471 Bacteria 1515
518 Ga0395901_0000420 3300038443 Bacteria 49952
519 Ga0395901_0011350 3300038443 Bacteria 9027
520 Ga0395901_0197827 3300038443 Bacteria 2107
521 Ga0395901_0282382 3300038443 Bacteria 1725
522 Ga0466966_0025687 3300044684 Bacteria 3847
523 Ga0466966_0045290 3300044684 Bacteria 2813
524 Ga0466961_0090581 3300044693 Bacteria 1931
525 Ga0466963_0051494 3300044694 Bacteria 2729
526 Ga0466963_0078451 3300044694 Bacteria 2233
527 Ga0466963_0164095 3300044694 Bacteria 1547
528 Ga0466957_0002655 3300044842 Bacteria 9651
529 Ga0466957_0006402 3300044842 Bacteria 6649
530 Ga0466959_0078420 3300045049 Bacteria 2382
531 Ga0466959_0165712 3300045049 Bacteria 1552
532 Ga0466958_0038992 3300045836 Bacteria 2852
533 Ga0466967_0504161 3300045976 Bacteria 1188
534 Ga0495627_006947 3300046453 Bacteria 4393
535 Ga0495603_0057426 3300046455 Bacteria 2303
536 Ga0495629_0018061 3300046459 Bacteria 5055
537 Ga0495629_0215474 3300046459 Bacteria 1325
538 Ga0495638_0004189 3300046460 Bacteria 10991
539 Ga0495651_0108694 3300046462 Bacteria 2054
540 Ga0495653_0067370 3300046463 Bacteria 2689
541 Ga0495580_0000377 3300046472 Bacteria 36420
542 Ga0495582_0028692 3300046473 Bacteria 3054
543 Ga0495582_0031290 3300046473 Bacteria 2924
544 Ga0495605_0047257 3300046474 Bacteria 2111
545 Ga0495639_0027422 3300046475 Bacteria 2521
546 Ga0495584_0013636 3300046491 Bacteria 4146
547 Ga0495584_0038891 3300046491 Bacteria 2404
548 Ga0495585_0000070 3300046492 Bacteria 106156
549 Ga0495585_0002310 3300046492 Bacteria 13734
550 Ga0495585_0033853 3300046492 Bacteria 2890
551 Ga0495585_0036365 3300046492 Bacteria 2778
552 Ga0495594_0002927 3300046499 Bacteria 8866
553 Ga0495594_0017420 3300046499 Bacteria 3796
554 Ga0495594_0065466 3300046499 Bacteria 2016
555 Ga0495596_0000031 3300046500 Bacteria 102612
556 Ga0495607_0076382 3300046501 Bacteria 1853
557 Ga0495607_0091400 3300046501 Bacteria 1648
558 Ga0495583_0008132 3300046506 Bacteria 6460
559 Ga0495606_0051516 3300046507 Bacteria 2684
560 Ga0495616_0011422 3300046513 Bacteria 5088
561 Ga0495628_0239631 3300046516 Bacteria 1357
562 Ga0495630_0217709 3300046517 Bacteria 1458
563 Ga0495644_0005511 3300046523 Bacteria 4942
564 Ga0495648_0126222 3300046524 Bacteria 1367
565 Ga0495663_0034771 3300046525 Bacteria 1511
566 Ga0495642_0008031 3300046528 Bacteria 4037
567 Ga0495665_0010534 3300046531 Bacteria 5003
568 Ga0495665_0014273 3300046531 Bacteria 4285
569 Ga0495665_0038594 3300046531 Bacteria 2546
570 Ga0495586_0002833 3300046535 Bacteria 9368
571 Ga0495587_0052392 3300046536 Bacteria 2408
572 Ga0495621_0010545 3300046539 Bacteria 2831
573 Ga0495597_0010825 3300046542 Bacteria 4443
574 Ga0495645_0006342 3300046543 Bacteria 8207
575 Ga0495633_0020320 3300046558 Bacteria 3341
576 Ga0495656_0089881 3300046615 Bacteria 1402
577 Ga0495668_0003146 3300046616 Bacteria 12732
578 Ga0495611_0002422 3300046648 Bacteria 8546
579 Ga0495625_0023691 3300046660 Bacteria 4685
580 Ga0495661_0030849 3300046665 Bacteria 3409
581 Ga0495588_0024059 3300046674 Bacteria 3022
582 Ga0495588_0072628 3300046674 Bacteria 1790
583 Ga0495657_0114117 3300046675 Bacteria 1708
584 Ga0495623_0077429 3300046679 Bacteria 2062
585 Ga0495647_0001972 3300046681 Bacteria 6406
586 Ga0495658_0003752 3300046683 Bacteria 7517
587 Ga0495658_0005362 3300046683 Bacteria 6307
588 Ga0495658_0020500 3300046683 Bacteria 3469
589 Ga0495669_0017559 3300046684 Bacteria 3071
590 Ga0495670_0016846 3300046691 Bacteria 3593
591 Ga0495589_0030198 3300046794 Bacteria 2730
592 Ga0495589_0112070 3300046794 Bacteria 1316
593 Ga0495636_0019167 3300047318 Bacteria 2748
594 Ga0495674_0188934 3300047319 Bacteria 1713
595 Ga0495676_0014845 3300047321 Bacteria 6955
596 Ga0495683_0011188 3300047323 Bacteria 4729
597 Ga0495675_0037056 3300047444 Bacteria 3107
598 Ga0495675_0067705 3300047444 Bacteria 2256
599 Ga0495677_0002049 3300047445 Bacteria 8038
600 Ga0495677_0011499 3300047445 Bacteria 3237
601 Ga0495685_038561 3300047447 Bacteria 1637
602 Ga0495681_0036781 3300047470 Bacteria 2418
603 Ga0495681_0038572 3300047470 Bacteria 2340
604 Ga0495684_0159510 3300047471 Bacteria 1683
605 Ga0495593_0014866 3300047673 Bacteria 4421
606 Ga0495602_0069453 3300048088 Bacteria 3020
607 Ga0495615_0012899 3300048090 Bacteria 1734
608 Ga0495626_0000792 3300048091 Bacteria 28683
609 Ga0495626_0009038 3300048091 Bacteria 5404
610 Ga0496100_0101584 3300048903 Bacteria 1983
611 Ga0496104_0009253 3300048907 Bacteria 8761
612 Ga0496104_0119357 3300048907 Bacteria 2532
613 Ga0496105_0085483 3300048908 Bacteria 2606
614 Ga0496106_0008585 3300048909 Bacteria 7558
615 Ga0496107_0059033 3300048910 Bacteria 2775
616 Ga0496108_0052651 3300048911 Bacteria 3412
617 Ga0496109_0136508 3300048912 Bacteria 2292
618 Ga0496109_0164565 3300048912 Bacteria 2079
619 Ga0496112_0000303 3300048915 Bacteria 31772
620 Ga0496112_0043423 3300048915 Bacteria 4401
621 Ga0496113_0107622 3300048916 Bacteria 2167
622 Ga0496113_0144366 3300048916 Bacteria 1874
623 Ga0496114_0112677 3300048917 Bacteria 2332
624 Ga0496115_0007489 3300048918 Bacteria 8035
625 Ga0496115_0108328 3300048918 Bacteria 2281
626 Ga0495682_0009527 3300049460 Bacteria 3789
627 Ga0501291_010739 3300049514 Bacteria 1308
628 Ga0501031_0041109 3300049568 Bacteria 3019
629 Ga0501031_0069075 3300049568 Bacteria 2301
630 Ga0501031_0087132 3300049568 Bacteria 2036
631 Ga0501032_0022206 3300049569 Bacteria 4402
632 Ga0501033_0010042 3300049570 Bacteria 7268
633 Ga0501033_0102677 3300049570 Bacteria 2085
634 Ga0501034_0005289 3300049571 Bacteria 14159
635 Ga0501034_0005371 3300049571 Bacteria 14024
636 Ga0501034_0028499 3300049571 Bacteria 5683
637 Ga0501034_0066728 3300049571 Bacteria 3611
638 Ga0501034_0077625 3300049571 Bacteria 3327
639 Ga0501034_0121504 3300049571 Bacteria 2598
640 Ga0501034_0431229 3300049571 Bacteria 1238
641 Ga0501036_0003666 3300049572 Bacteria 12287
642 Ga0501036_0009460 3300049572 Bacteria 8017
643 Ga0501036_0014214 3300049572 Bacteria 6623
644 Ga0501036_0027364 3300049572 Bacteria 4818
645 Ga0501036_0031801 3300049572 Bacteria 4458
646 Ga0501036_0032087 3300049572 Bacteria 4437
647 Ga0501036_0050927 3300049572 Bacteria 3506
648 Ga0501037_0015609 3300049573 Bacteria 5589
649 Ga0501037_0080388 3300049573 Bacteria 2365
650 Ga0501037_0117402 3300049573 Bacteria 1914
651 Ga0501037_0136355 3300049573 Bacteria 1758
652 Ga0501037_0209933 3300049573 Unclassified 1373
653 Ga0501038_0001109 3300049574 Bacteria 24402
654 Ga0501038_0003531 3300049574 Bacteria 14553
655 Ga0501038_0014002 3300049574 Bacteria 7310
656 Ga0501038_0053866 3300049574 Bacteria 3461
657 Ga0501038_0076264 3300049574 Bacteria 2832
658 Ga0501038_0224301 3300049574 Bacteria 1498
659 Ga0501039_0015991 3300049575 Bacteria 5745
660 Ga0501039_0020033 3300049575 Bacteria 5127
661 Ga0501039_0022710 3300049575 Bacteria 4814
662 Ga0501039_0059797 3300049575 Bacteria 2951
663 Ga0501039_0218934 3300049575 Bacteria 1497
664 Ga0501040_0001909 3300049576 Bacteria 13402
665 Ga0501041_0007568 3300049577 Bacteria 6378
666 Ga0501041_0010527 3300049577 Bacteria 5452
667 Ga0501042_0000383 3300049578 Bacteria 22452
668 Ga0501042_0237166 3300049578 Bacteria 1316
669 Ga0501043_0000027 3300049579 Bacteria 144685
670 Ga0501043_0002821 3300049579 Bacteria 14532
671 Ga0501043_0004264 3300049579 Bacteria 11645
672 Ga0501043_0052312 3300049579 Bacteria 3208
673 Ga0501043_0136476 3300049579 Bacteria 1921
674 Ga0501046_0000034 3300049580 Bacteria 173742
675 Ga0501046_0001197 3300049580 Bacteria 25219
676 Ga0501046_0002832 3300049580 Bacteria 16136
677 Ga0501046_0015650 3300049580 Bacteria 6369
678 Ga0501046_0029937 3300049580 Bacteria 4423
679 Ga0501046_0046996 3300049580 Bacteria 3424
680 Ga0501046_0049945 3300049580 Bacteria 3306
681 Ga0501047_0000042 3300049581 Bacteria 176603
682 Ga0501047_0001297 3300049581 Bacteria 24634
683 Ga0501047_0001508 3300049581 Bacteria 22710
684 Ga0501047_0003796 3300049581 Bacteria 14208
685 Ga0501047_0032228 3300049581 Bacteria 5058
686 Ga0501047_0038275 3300049581 Bacteria 4640
687 Ga0501047_0139176 3300049581 Bacteria 2306
688 Ga0501047_0161965 3300049581 Bacteria 2109
689 Ga0501047_0254501 3300049581 Bacteria 1604
690 Ga0501048_0000019 3300049582 Bacteria 71064
691 Ga0501048_0000151 3300049582 Bacteria 42561
692 Ga0501048_0010770 3300049582 Bacteria 6818
693 Ga0501048_0058178 3300049582 Bacteria 2740
694 Ga0501048_0064163 3300049582 Bacteria 2598
695 Ga0501067_0017968 3300049583 Bacteria 3916
696 Ga0501067_0030791 3300049583 Bacteria 2977
697 Ga0501067_0054640 3300049583 Bacteria 2212
698 Ga0501068_0005410 3300049584 Bacteria 6985
699 Ga0501068_0010972 3300049584 Bacteria 5100
700 Ga0501068_0020932 3300049584 Bacteria 3817
701 Ga0501069_0028398 3300049585 Bacteria 3067
702 Ga0501069_0087357 3300049585 Bacteria 1761
703 Ga0501069_0108210 3300049585 Unclassified 1581
704 Ga0501070_0006477 3300049586 Bacteria 9967
705 Ga0501070_0007769 3300049586 Bacteria 9092
706 Ga0501070_0014067 3300049586 Bacteria 6737
707 Ga0501070_0041930 3300049586 Bacteria 3811
708 Ga0501070_0043411 3300049586 Bacteria 3741
709 Ga0501070_0044878 3300049586 Bacteria 3676
710 Ga0501070_0119877 3300049586 Bacteria 2174
711 Ga0501071_0032712 3300049587 Bacteria 3694
712 Ga0501071_0059340 3300049587 Bacteria 2768
713 Ga0501071_0108130 3300049587 Bacteria 2054
714 Ga0501072_0002470 3300049588 Bacteria 13847
715 Ga0501072_0026350 3300049588 Bacteria 4533
716 Ga0501072_0032599 3300049588 Bacteria 4080
717 Ga0501072_0160691 3300049588 Bacteria 1792
718 Ga0501072_0185864 3300049588 Unclassified 1658
719 Ga0501072_0243389 3300049588 Bacteria 1433
720 Ga0501073_0001397 3300049589 Bacteria 17807
721 Ga0501073_0009222 3300049589 Bacteria 7275
722 Ga0501073_0013135 3300049589 Bacteria 6037
723 Ga0501073_0048934 3300049589 Bacteria 2965
724 Ga0501073_0076220 3300049589 Bacteria 2333
725 Ga0501073_0121918 3300049589 Bacteria 1807
726 Ga0501073_0179998 3300049589 Bacteria 1463
727 Ga0501074_0001516 3300049590 Bacteria 15686
728 Ga0501074_0018041 3300049590 Bacteria 5126
729 Ga0501074_0019723 3300049590 Bacteria 4896
730 Ga0501074_0033428 3300049590 Bacteria 3726
731 Ga0501074_0058715 3300049590 Bacteria 2771
732 Ga0501074_0238304 3300049590 Bacteria 1294
733 Ga0501075_0000525 3300049591 Bacteria 23161
734 Ga0501076_0013583 3300049592 Bacteria 6108
735 Ga0501076_0085370 3300049592 Bacteria 2537
736 Ga0501077_0006058 3300049593 Bacteria 7381
737 Ga0501079_0000625 3300049741 Bacteria 23469
738 Ga0501079_0002303 3300049741 Bacteria 13814
739 Ga0501079_0037452 3300049741 Bacteria 3738
740 Ga0501080_0000130 3300049742 Bacteria 53465
741 Ga0501080_0003305 3300049742 Bacteria 14252
742 Ga0501080_0004495 3300049742 Bacteria 12429
743 Ga0501080_0013629 3300049742 Bacteria 7486
744 Ga0501080_0048054 3300049742 Bacteria 3972
745 Ga0501080_0051065 3300049742 Bacteria 3846
746 Ga0501080_0052289 3300049742 Bacteria 3802
747 Ga0501080_0056885 3300049742 Bacteria 3641
748 Ga0501080_0079937 3300049742 Bacteria 3039
749 Ga0501081_0000055 3300049743 Bacteria 43227
750 Ga0501081_0001663 3300049743 Bacteria 13751
751 Ga0501083_0002779 3300049744 Bacteria 12096
752 Ga0501083_0003894 3300049744 Bacteria 10486
753 Ga0501083_0017232 3300049744 Bacteria 5036
754 Ga0501083_0039248 3300049744 Bacteria 3216
755 Ga0501083_0056255 3300049744 Bacteria 2636
756 Ga0501083_0069452 3300049744 Bacteria 2344
757 Ga0501083_0135529 3300049744 Bacteria 1613
758 Ga0501035_0018873 3300049822 Bacteria 6354
759 Ga0501035_0037832 3300049822 Bacteria 4367
760 Ga0501035_0042121 3300049822 Bacteria 4119
761 Ga0501035_0044729 3300049822 Bacteria 3985
762 Ga0501035_0166755 3300049822 Bacteria 1904
763 Ga0501035_0315224 3300049822 Bacteria 1315
764 Ga0501044_0000636 3300049823 Bacteria 42394
765 Ga0501044_0006986 3300049823 Bacteria 12419
766 Ga0501044_0029378 3300049823 Bacteria 5797
767 Ga0501044_0095165 3300049823 Bacteria 3002
768 Ga0501044_0134975 3300049823 Bacteria 2459
769 Ga0501044_0155313 3300049823 Bacteria 2268
770 Ga0501044_0204794 3300049823 Bacteria 1930
771 Ga0501044_0226753 3300049823 Bacteria 1818
772 Ga0501045_0000901 3300049824 Bacteria 19335
773 Ga0501045_0006559 3300049824 Bacteria 8067
774 Ga0501045_0041865 3300049824 Bacteria 3333
775 nmdc:mga0n895_114609_c1 3300050512 Bacteria 2713
776 nmdc:mga0n895_199802_c1 3300050512 Bacteria 2030
777 nmdc:mga0rr50_464137_c1 3300050513 Bacteria 1074
778 nmdc:mga08x19_90949_c1 3300050514 Bacteria 2014
779 nmdc:mga0a205_103402_c1 3300050515 Bacteria 2747
780 Ga0495601_0120341 3300053077 Bacteria 1705
781 Ga0495619_0012269 3300053085 Bacteria 5391
782 Ga0495619_0231197 3300053085 Bacteria 1281
783 Ga0501084_0021611 3300054114 Bacteria 5365
784 Ga0501084_0040400 3300054114 Bacteria 3902
785 Ga0501082_0084604 3300060353 Bacteria 2735
786 Ga0501082_0166194 3300060353 Bacteria 1917
787 Ga0501082_0179078 3300060353 Bacteria 1843
788 Ga0466962_0027029 3300061719 Bacteria 2755
789 Ga0530510_0001004 3300061734 Bacteria 18744
790 2842334280 2842333319 Bacteria 8899485
791 Ga0451853_0472856
792 Ga0070658_10014541
793 Ga0070658_10045275
794 Ga0070658_10066518
795 Ga0070658_10084139
796 Ga0070658_10148900
797 Ga0070658_10150053
798 Ga0070658_10290901
799 Ga0070658_10352531
800 Ga0070676_10318666
801 Ga0070683_100014342
802 Ga0070683_100040826
803 Ga0070683_100057081
804 Ga0070683_100066241
805 Ga0070670_100031458
806 Ga0068869_100048924
807 Ga0068869_100268493
808 Ga0070666_10016572
809 Ga0070666_10043621
810 Ga0070680_100001220
811 Ga0070680_100069611
812 Ga0070680_100087094
813 Ga0070680_100116886
814 Ga0070680_100180216
815 Ga0070682_100010676
816 Ga0068868_100029461
817 Ga0068868_100080936
818 Ga0070660_100003047
819 Ga0070660_100011210
820 Ga0070660_100030341
821 Ga0070660_100048387
822 Ga0070689_100014168
823 Ga0070661_100000659
824 Ga0070661_100007548
825 Ga0070661_100033091
826 Ga0070661_100042473
827 Ga0070661_100099671
828 Ga0070661_100136587
829 Ga0070661_100172373
830 Ga0070692_10008294
831 Ga0070692_10024640
832 Ga0070692_10094067
833 Ga0070669_100034654
834 Ga0070669_100039097
835 Ga0070669_100105699
836 Ga0070675_100043993
837 Ga0070675_100287990
838 Ga0070671_100085165
839 Ga0070671_100099897
840 Ga0070671_100169857
841 Ga0070671_100220556
842 Ga0070673_100005875
843 Ga0070673_100039404
844 Ga0070673_100086495
845 Ga0070673_100307100
846 Ga0070659_100002518
847 Ga0070659_100021894
848 Ga0070659_100081540
849 Ga0070659_100127068
850 Ga0070659_100356057
851 Ga0070667_100097949
852 Ga0070667_100322768
853 Ga0070709_10039869
854 Ga0070709_10163923
855 Ga0070709_10258352
856 Ga0070714_100001230
857 Ga0070714_100012985
858 Ga0070714_100040709
859 Ga0070714_100176106
860 Ga0070714_100327199
861 Ga0070714_100441690
862 Ga0070713_100041327
863 Ga0070713_100044368
864 Ga0070713_100068647
865 Ga0070710_10023720
866 Ga0070701_10108773
867 Ga0070711_100019511
868 Ga0070711_100057157
869 Ga0070694_100120685
870 Ga0070708_100442065
871 Ga0070663_100002206
872 Ga0070663_100037714
873 Ga0070663_100054756
874 Ga0070663_100141109
875 Ga0070663_100192566
876 Ga0070663_100280446
877 Ga0070678_100146298
878 Ga0070662_100002542
879 Ga0070662_100082196
880 Ga0070681_10006079
881 Ga0070681_10017264
882 Ga0070681_10032524
883 Ga0070681_10051174
884 Ga0070681_10065111
885 Ga0070681_10081150
886 Ga0070681_10137047
887 Ga0070681_10247713
888 Ga0070681_10330544
889 Ga0068867_100100841
890 Ga0070685_10009162
891 Ga0070707_100252846
892 Ga0070699_100062841
893 Ga0070699_100091987
894 Ga0070699_100108419
895 Ga0070679_100002223
896 Ga0070679_100012385
897 Ga0070679_100012464
898 Ga0070679_100022596
899 Ga0070679_100028486
900 Ga0070679_100035984
901 Ga0070679_100039760
902 Ga0070679_100048642
903 Ga0070679_100049521
904 Ga0070679_100072269
905 Ga0070679_100127957
906 Ga0070679_100178799
907 Ga0070684_100028079
908 Ga0070684_100032759
909 Ga0070684_100049016
910 Ga0068853_100015209
911 Ga0068853_100029855
912 Ga0068853_100065040
913 Ga0070672_100057825
914 Ga0070672_100268665
915 Ga0070686_100290249
916 Ga0070695_100134142
917 Ga0070696_100000647
918 Ga0070665_100038962
919 Ga0068855_100006103
920 Ga0068855_100007555
921 Ga0068855_100022104
922 Ga0068855_100069451
923 Ga0068855_100069463
924 Ga0068855_100075173
925 Ga0068855_100090119
926 Ga0070664_100000157
927 Ga0070664_100000662
928 Ga0070664_100015295
929 Ga0070664_100042978
930 Ga0070664_100058072
931 Ga0070664_100196445
932 Ga0070664_100229350
933 Ga0068857_100002118
934 Ga0068857_100009373
935 Ga0068857_100099262
936 Ga0068857_100129709
937 Ga0068857_100196197
938 Ga0068854_100005030
939 Ga0068854_100020694
940 Ga0068854_100031708
941 Ga0068854_100039623
942 Ga0068854_100080306
943 Ga0068854_100090917
944 Ga0068854_100157923
945 Ga0068854_100227271
946 Ga0068856_100003357
947 Ga0068856_100007224
948 Ga0068856_100056804
949 Ga0068856_100112135
950 Ga0068856_100197242
951 Ga0068856_100422660
952 Ga0070702_100008195
953 Ga0068852_100000826
954 Ga0068852_100001041
955 Ga0068852_100005593
956 Ga0068859_100135280
957 Ga0068859_100192282
958 Ga0068864_100000836
959 Ga0068864_100212286
960 Ga0068866_10003875
961 Ga0068861_100327556
962 Ga0068851_10008632
963 Ga0068851_10020864
964 Ga0068863_100060640
965 Ga0068863_100090905
966 Ga0068863_100398513
967 Ga0068858_100002758
968 Ga0068858_100084407
969 Ga0068860_100023120
970 Ga0068860_100156887
971 Ga0070717_10332334
972 Ga0070717_10333586
973 Ga0070715_10021078
974 Ga0070715_10061509
975 Ga0070712_100007146
976 Ga0070712_100234637
977 Ga0097621_100068335
978 Ga0097621_100220087
979 Ga0068871_100075121
980 Ga0068871_100181398
981 Ga0068871_100183372
982 Ga0068871_100460020
983 Ga0075428_100017431
984 Ga0075434_100062690
985 Ga0075434_100106255
986 Ga0068865_100085004
987 Ga0075436_100040552
988 Ga0075436_100093243
989 Ga0097620_100135272
990 Ga0097620_100192285
991 Ga0075435_100385480
992 Ga0099795_10054122
993 Ga0105240_10004865
994 Ga0105240_10006057
995 Ga0105240_10007716
996 Ga0105240_10007858
997 Ga0105240_10017051
998 Ga0105240_10018681
999 Ga0105240_10041376
1000 Ga0105240_10104066
1001 Ga0105240_10171461
1002 Ga0105240_10458322
1003 Ga0105245_10019049
1004 Ga0105245_10023939
1005 Ga0105245_10035739
1006 Ga0105241_10008874
1007 Ga0105242_10061250
1008 Ga0105248_10001643
1009 Ga0105237_10008781
1010 Ga0105237_10094865
1011 Ga0105237_10552263
1012 Ga0105238_10000203
1013 Ga0105238_10005300
1014 Ga0105238_10015654
1015 Ga0105238_10022170
1016 Ga0105238_10025071
1017 Ga0105238_10223875
1018 Ga0105239_10093277
1019 Ga0105239_10323087
1020 Ga0105239_10748449
1021 Ga0105246_10069127
1022 Ga0157373_10001573
1023 Ga0157373_10016974
1024 Ga0157373_10032306
1025 Ga0157373_10047841
1026 Ga0157373_10068387
1027 Ga0157373_10101786
1028 Ga0157373_10107530
1029 Ga0157373_10148394
1030 Ga0157371_10002592
1031 Ga0157371_10016262
1032 Ga0157371_10127408
1033 Ga0157370_10001120
1034 Ga0157370_10002318
1035 Ga0157370_10010117
1036 Ga0157370_10015498
1037 Ga0157370_10028168
1038 Ga0157370_10053733
1039 Ga0157370_10073398
1040 Ga0157370_10078279
1041 Ga0157370_10087886
1042 Ga0157370_10090588
1043 Ga0157370_10224140
1044 Ga0157369_10004919
1045 Ga0157369_10008031
1046 Ga0157369_10018830
1047 Ga0157369_10054805
1048 Ga0157369_10137759
1049 Ga0157369_10232238
1050 Ga0157374_10003153
1051 Ga0157374_10125525
1052 Ga0157378_10066491
1053 Ga0157378_10120977
1054 Ga0157378_10403246
1055 Ga0163162_10024159
1056 Ga0163162_10041753
1057 Ga0163162_10047261
1058 Ga0163162_10065671
1059 Ga0163162_10072223
1060 Ga0157372_10001409
1061 Ga0157372_10004130
1062 Ga0157372_10007797
1063 Ga0157372_10009719
1064 Ga0157372_10019156
1065 Ga0157372_10132532
1066 Ga0157375_10032094
1067 Ga0157375_10130879
1068 Ga0163163_10031646
1069 Ga0157380_10442143
1070 Ga0157380_10482403
1071 Ga0157377_10175814
1072 Ga0157376_10006216
1073 Ga0157376_10207725
1074 Ga0182005_1031178
1075 Ga0163161_10022924
1076 Ga0163161_10157182
1077 Ga0207680_10121218
1078 Ga0207699_10141582
1079 Ga0207643_10059517
1080 Ga0207705_10008790
1081 Ga0207705_10020178
1082 Ga0207705_10026329
1083 Ga0207705_10094523
1084 Ga0207705_10202618
1085 Ga0207654_10013056
1086 Ga0207654_10054982
1087 Ga0207707_10016373
1088 Ga0207707_10034346
1089 Ga0207707_10035990
1090 Ga0207707_10108112
1091 Ga0207707_10172045
1092 Ga0207707_10323393
1093 Ga0207695_10016171
1094 Ga0207695_10043015
1095 Ga0207695_10049717
1096 Ga0207695_10051599
1097 Ga0207695_10091139
1098 Ga0207695_10150764
1099 Ga0207695_10151078
1100 Ga0207671_10169164
1101 Ga0207671_10202165
1102 Ga0207693_10201414
1103 Ga0207660_10000918
1104 Ga0207660_10022899
1105 Ga0207660_10036379
1106 Ga0207660_10095436
1107 Ga0207660_10176045
1108 Ga0207660_10404312
1109 Ga0207662_10096609
1110 Ga0207657_10000586
1111 Ga0207657_10002457
1112 Ga0207657_10009562
1113 Ga0207657_10041288
1114 Ga0207657_10058693
1115 Ga0207657_10063624
1116 Ga0207657_10091926
1117 Ga0207649_10003878
1118 Ga0207649_10015963
1119 Ga0207649_10031357
1120 Ga0207649_10032416
1121 Ga0207649_10132484
1122 Ga0207649_10166363
1123 Ga0207652_10004936
1124 Ga0207652_10022926
1125 Ga0207652_10029509
1126 Ga0207652_10035307
1127 Ga0207652_10039342
1128 Ga0207652_10094577
1129 Ga0207652_10099129
1130 Ga0207652_10155956
1131 Ga0207652_10405137
1132 Ga0207652_10484790
1133 Ga0207646_10025356
1134 Ga0207681_10115047
1135 Ga0207694_10006781
1136 Ga0207694_10010483
1137 Ga0207694_10014521
1138 Ga0207694_10029612
1139 Ga0207694_10206536
1140 Ga0207659_10071014
1141 Ga0207687_10002728
1142 Ga0207687_10028131
1143 Ga0207687_10034278
1144 Ga0207700_10017425
1145 Ga0207700_10048370
1146 Ga0207664_10008038
1147 Ga0207664_10044232
1148 Ga0207644_10002797
1149 Ga0207644_10008406
1150 Ga0207644_10177909
1151 Ga0207644_10196837
1152 Ga0207690_10013365
1153 Ga0207690_10055002
1154 Ga0207690_10328266
1155 Ga0207706_10002770
1156 Ga0207706_10021790
1157 Ga0207686_10218872
1158 Ga0207670_10014556
1159 Ga0207669_10041984
1160 Ga0207665_10019599
1161 Ga0207665_10036446
1162 Ga0207665_10076841
1163 Ga0207691_10010545
1164 Ga0207691_10067598
1165 Ga0207691_10238336
1166 Ga0207711_10000116
1167 Ga0207711_10007075
1168 Ga0207689_10038570
1169 Ga0207661_10011082
1170 Ga0207661_10014956
1171 Ga0207661_10163354
1172 Ga0207679_10003482
1173 Ga0207679_10006427
1174 Ga0207679_10012754
1175 Ga0207679_10022679
1176 Ga0207679_10025964
1177 Ga0207679_10042623
1178 Ga0207679_10154420
1179 Ga0207679_10253156
1180 Ga0207679_10269379
1181 Ga0207667_10000425
1182 Ga0207667_10009574
1183 Ga0207667_10015677
1184 Ga0207667_10041828
1185 Ga0207667_10065965
1186 Ga0207667_10094825
1187 Ga0207667_10107077
1188 Ga0207667_10122191
1189 Ga0207667_10261083
1190 Ga0207667_10346379
1191 Ga0207651_10015223
1192 Ga0207651_10052444
1193 Ga0207640_10070754
1194 Ga0207658_10122137
1195 Ga0207658_10174695
1196 Ga0207658_10299886
1197 Ga0207677_10000188
1198 Ga0207703_10000806
1199 Ga0207639_10048427
1200 Ga0207639_10054697
1201 Ga0207639_10087916
1202 Ga0207639_10202390
1203 Ga0207678_10005045
1204 Ga0207678_10016867
1205 Ga0207678_10080029
1206 Ga0207678_10094111
1207 Ga0207702_10002758
1208 Ga0207702_10002944
1209 Ga0207702_10024530
1210 Ga0207702_10042863
1211 Ga0207702_10052623
1212 Ga0207702_10354713
1213 Ga0207641_10027731
1214 Ga0207641_10037558
1215 Ga0207648_10042104
1216 Ga0207648_10054451
1217 Ga0207648_10068843
1218 Ga0207676_10000230
1219 Ga0207676_10122612
1220 Ga0207674_10000301
1221 Ga0207674_10000593
1222 Ga0207674_10024546
1223 Ga0207674_10142081
1224 Ga0207675_100057058
1225 Ga0207675_100090794
1226 Ga0207683_10001896
1227 Ga0207683_10089782
1228 Ga0207683_10248322
1229 Ga0207698_10001265
1230 Ga0207698_10134925
1231 Ga0207698_10171428
1232 Ga0209995_1004512
1233 Ga0209970_1000330
1234 Ga0209983_1003253
1235 Ga0209971_1002990
1236 Ga0209971_1023720
1237 Ga0209966_1001960
1238 Ga0209974_10000515
1239 Ga0209974_10028705
1240 Ga0268266_10041432
1241 Ga0268264_10025840
1242 Ga0268264_10092651
1243 Ga0268264_10131145
1244 Ga0307408_100026386
1245 Ga0307408_100060833
1246 Ga0307408_100118759
1247 Ga0307413_10110370
1248 Ga0307413_10145003
1249 Ga0307410_10026531
1250 Ga0307410_10031925
1251 Ga0307406_10029752
1252 Ga0307406_10031045
1253 Ga0307412_10039145
1254 Ga0307409_100019041
1255 Ga0307409_100042722
1256 Ga0307416_100115009
1257 Ga0307416_100390291
1258 Ga0307416_100539113
1259 Ga0307414_10050934
1260 Ga0307414_10074883
1261 Ga0307411_10017682
1262 Ga0307411_10306632
1263 Ga0307415_100103075
1264 Ga0373934_0012408
1265 Ga0373944_0003249
1266 Ga0373936_0004509
1267 Ga0373941_0003011
1268 Ga0373945_0066334
1269 Ga0373953_0006271
1270 Ga0373954_0016093
1271 Ga0373957_0067105
1272 Ga0373943_0007550
1273 Ga0373946_0002403
1274 Ga0373946_0092826
1275 Ga0373955_0036180
1276 Ga0373924_0040791
1277 Ga0373935_0004641
1278 Ga0373935_0019629
1279 Ga0373935_0089392
1280 Ga0373935_0220427
1281 Ga0373927_0006549
1282 Ga0373927_0058721
1283 Ga0373927_0157603
1284 Ga0373933_0029862
1285 Ga0373947_0023666
1286 Ga0373947_0025712
1287 Ga0373947_0209163
1288 Ga0373937_0023672
1289 Ga0373937_0122387
1290 Ga0373937_0128829
1291 Ga0373937_0180020
1292 Ga0373925_0011332
1293 Ga0373925_0013181
1294 Ga0395899_0000216
1295 Ga0395899_0003355
1296 Ga0395899_0084595
1297 Ga0395899_0135320
1298 Ga0395900_0002787
1299 Ga0395900_0003035
1300 Ga0395900_0355701
1301 Ga0395900_0462376
1302 Ga0395898_0008265
1303 Ga0395898_0040854
1304 Ga0395898_0155032
1305 Ga0395905_0054144
1306 Ga0395905_0290944
1307 Ga0395905_0292481
1308 Ga0395901_0000420
1309 Ga0395901_0011350
1310 Ga0395901_0197827
1311 Ga0395901_0282382
1312 Ga0466966_0025687
1313 Ga0466966_0045290
1314 Ga0466961_0090581
1315 Ga0466963_0051494
1316 Ga0466963_0078451
1317 Ga0466963_0164095
1318 Ga0466957_0002655
1319 Ga0466957_0006402
1320 Ga0466959_0078420
1321 Ga0466959_0165712
1322 Ga0466958_0038992
1323 Ga0466967_0504161
1324 Ga0495627_006947
1325 Ga0495603_0057426
1326 Ga0495629_0018061
1327 Ga0495629_0215474
1328 Ga0495638_0004189
1329 Ga0495651_0108694
1330 Ga0495653_0067370
1331 Ga0495580_0000377
1332 Ga0495582_0028692
1333 Ga0495582_0031290
1334 Ga0495605_0047257
1335 Ga0495639_0027422
1336 Ga0495584_0013636
1337 Ga0495584_0038891
1338 Ga0495585_0000070
1339 Ga0495585_0002310
1340 Ga0495585_0033853
1341 Ga0495585_0036365
1342 Ga0495594_0002927
1343 Ga0495594_0017420
1344 Ga0495594_0065466
1345 Ga0495596_0000031
1346 Ga0495607_0076382
1347 Ga0495607_0091400
1348 Ga0495583_0008132
1349 Ga0495606_0051516
1350 Ga0495616_0011422
1351 Ga0495628_0239631
1352 Ga0495630_0217709
1353 Ga0495644_0005511
1354 Ga0495648_0126222
1355 Ga0495663_0034771
1356 Ga0495642_0008031
1357 Ga0495665_0010534
1358 Ga0495665_0014273
1359 Ga0495665_0038594
1360 Ga0495586_0002833
1361 Ga0495587_0052392
1362 Ga0495621_0010545
1363 Ga0495597_0010825
1364 Ga0495645_0006342
1365 Ga0495633_0020320
1366 Ga0495656_0089881
1367 Ga0495668_0003146
1368 Ga0495611_0002422
1369 Ga0495625_0023691
1370 Ga0495661_0030849
1371 Ga0495588_0024059
1372 Ga0495588_0072628
1373 Ga0495657_0114117
1374 Ga0495623_0077429
1375 Ga0495647_0001972
1376 Ga0495658_0003752
1377 Ga0495658_0005362
1378 Ga0495658_0020500
1379 Ga0495669_0017559
1380 Ga0495670_0016846
1381 Ga0495589_0030198
1382 Ga0495589_0112070
1383 Ga0495636_0019167
1384 Ga0495674_0188934
1385 Ga0495676_0014845
1386 Ga0495683_0011188
1387 Ga0495675_0037056
1388 Ga0495675_0067705
1389 Ga0495677_0002049
1390 Ga0495677_0011499
1391 Ga0495685_038561
1392 Ga0495681_0036781
1393 Ga0495681_0038572
1394 Ga0495684_0159510
1395 Ga0495593_0014866
1396 Ga0495602_0069453
1397 Ga0495615_0012899
1398 Ga0495626_0000792
1399 Ga0495626_0009038
1400 Ga0496100_0101584
1401 Ga0496104_0009253
1402 Ga0496104_0119357
1403 Ga0496105_0085483
1404 Ga0496106_0008585
1405 Ga0496107_0059033
1406 Ga0496108_0052651
1407 Ga0496109_0136508
1408 Ga0496109_0164565
1409 Ga0496112_0000303
1410 Ga0496112_0043423
1411 Ga0496113_0107622
1412 Ga0496113_0144366
1413 Ga0496114_0112677
1414 Ga0496115_0007489
1415 Ga0496115_0108328
1416 Ga0495682_0009527
1417 Ga0501291_010739
1418 Ga0501031_0041109
1419 Ga0501031_0069075
1420 Ga0501031_0087132
1421 Ga0501032_0022206
1422 Ga0501033_0010042
1423 Ga0501033_0102677
1424 Ga0501034_0005289
1425 Ga0501034_0005371
1426 Ga0501034_0028499
1427 Ga0501034_0066728
1428 Ga0501034_0077625
1429 Ga0501034_0121504
1430 Ga0501034_0431229
1431 Ga0501036_0003666
1432 Ga0501036_0009460
1433 Ga0501036_0014214
1434 Ga0501036_0027364
1435 Ga0501036_0031801
1436 Ga0501036_0032087
1437 Ga0501036_0050927
1438 Ga0501037_0015609
1439 Ga0501037_0080388
1440 Ga0501037_0117402
1441 Ga0501037_0136355
1442 Ga0501037_0209933
1443 Ga0501038_0001109
1444 Ga0501038_0003531
1445 Ga0501038_0014002
1446 Ga0501038_0053866
1447 Ga0501038_0076264
1448 Ga0501038_0224301
1449 Ga0501039_0015991
1450 Ga0501039_0020033
1451 Ga0501039_0022710
1452 Ga0501039_0059797
1453 Ga0501039_0218934
1454 Ga0501040_0001909
1455 Ga0501041_0007568
1456 Ga0501041_0010527
1457 Ga0501042_0000383
1458 Ga0501042_0237166
1459 Ga0501043_0000027
1460 Ga0501043_0002821
1461 Ga0501043_0004264
1462 Ga0501043_0052312
1463 Ga0501043_0136476
1464 Ga0501046_0000034
1465 Ga0501046_0001197
1466 Ga0501046_0002832
1467 Ga0501046_0015650
1468 Ga0501046_0029937
1469 Ga0501046_0046996
1470 Ga0501046_0049945
1471 Ga0501047_0000042
1472 Ga0501047_0001297
1473 Ga0501047_0001508
1474 Ga0501047_0003796
1475 Ga0501047_0032228
1476 Ga0501047_0038275
1477 Ga0501047_0139176
1478 Ga0501047_0161965
1479 Ga0501047_0254501
1480 Ga0501048_0000019
1481 Ga0501048_0000151
1482 Ga0501048_0010770
1483 Ga0501048_0058178
1484 Ga0501048_0064163
1485 Ga0501067_0017968
1486 Ga0501067_0030791
1487 Ga0501067_0054640
1488 Ga0501068_0005410
1489 Ga0501068_0010972
1490 Ga0501068_0020932
1491 Ga0501069_0028398
1492 Ga0501069_0087357
1493 Ga0501069_0108210
1494 Ga0501070_0006477
1495 Ga0501070_0007769
1496 Ga0501070_0014067
1497 Ga0501070_0041930
1498 Ga0501070_0043411
1499 Ga0501070_0044878
1500 Ga0501070_0119877
1501 Ga0501071_0032712
1502 Ga0501071_0059340
1503 Ga0501071_0108130
1504 Ga0501072_0002470
1505 Ga0501072_0026350
1506 Ga0501072_0032599
1507 Ga0501072_0160691
1508 Ga0501072_0185864
1509 Ga0501072_0243389
1510 Ga0501073_0001397
1511 Ga0501073_0009222
1512 Ga0501073_0013135
1513 Ga0501073_0048934
1514 Ga0501073_0076220
1515 Ga0501073_0121918
1516 Ga0501073_0179998
1517 Ga0501074_0001516
1518 Ga0501074_0018041
1519 Ga0501074_0019723
1520 Ga0501074_0033428
1521 Ga0501074_0058715
1522 Ga0501074_0238304
1523 Ga0501075_0000525
1524 Ga0501076_0013583
1525 Ga0501076_0085370
1526 Ga0501077_0006058
1527 Ga0501079_0000625
1528 Ga0501079_0002303
1529 Ga0501079_0037452
1530 Ga0501080_0000130
1531 Ga0501080_0003305
1532 Ga0501080_0004495
1533 Ga0501080_0013629
1534 Ga0501080_0048054
1535 Ga0501080_0051065
1536 Ga0501080_0052289
1537 Ga0501080_0056885
1538 Ga0501080_0079937
1539 Ga0501081_0000055
1540 Ga0501081_0001663
1541 Ga0501083_0002779
1542 Ga0501083_0003894
1543 Ga0501083_0017232
1544 Ga0501083_0039248
1545 Ga0501083_0056255
1546 Ga0501083_0069452
1547 Ga0501083_0135529
1548 Ga0501035_0018873
1549 Ga0501035_0037832
1550 Ga0501035_0042121
1551 Ga0501035_0044729
1552 Ga0501035_0166755
1553 Ga0501035_0315224
1554 Ga0501044_0000636
1555 Ga0501044_0006986
1556 Ga0501044_0029378
1557 Ga0501044_0095165
1558 Ga0501044_0134975
1559 Ga0501044_0155313
1560 Ga0501044_0204794
1561 Ga0501044_0226753
1562 Ga0501045_0000901
1563 Ga0501045_0006559
1564 Ga0501045_0041865
1565 nmdc:mga0n895_114609_c1
1566 nmdc:mga0n895_199802_c1
1567 nmdc:mga0rr50_464137_c1
1568 nmdc:mga08x19_90949_c1
1569 nmdc:mga0a205_103402_c1
1570 Ga0495601_0120341
1571 Ga0495619_0012269
1572 Ga0495619_0231197
1573 Ga0501084_0021611
1574 Ga0501084_0040400
1575 Ga0501082_0084604
1576 Ga0501082_0166194
1577 Ga0501082_0179078
1578 Ga0466962_0027029
1579 Ga0530510_0001004
1580 2842334280

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

80

360

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xeq-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid 0.9569 37 336
4ovq-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d-glucuronate 0.9546 37 333
7bcr-assembly1.cif.gz_A crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate 0.9538 35 334
4o7m-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate 0.9526 34 312
4oan-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) 0.9509 34 331
ID Description Score Start End Superfamily
af_P37676_23_328_3.40.190.170 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.965 33 334 3.40.190.170
af_P37676_23_328_3.40.190.170 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9497 33 334 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9477 37 335 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9434 36 316 3.40.190.170
4nhbB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9427 36 336 3.40.190.170
ID Description Score Start End GO Terms
AF-A8LNG5-F1-model_v4 TRAP transporter-DctP subunit 0.9866 31 336 GO:0030288
GO:0055085
AF-A0A3N5GUF3-F1-model_v4 TRAP transporter substrate-binding protein 0.9856 28 336 GO:0030288
GO:0055085
AF-A6D538-F1-model_v4 deleted 0.9828 28 336
AF-A0A7X4DI76-F1-model_v4 TRAP transporter substrate-binding protein 0.967 28 334 GO:0030288
GO:0055085
AF-A0A349HRU3-F1-model_v4 C4-dicarboxylate ABC transporter 0.9645 92 335 GO:0030288
GO:0055085

Map