F480955
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 790 | 306 | 1580 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_0472856|Ga0451853_0472856_161_1291 |
| Length | 376 |
| Sequence | VRSGKTPIGAAEGCGENPFGTSPRCSGASGTLQRTTMTKPPFLSSRRGAPALRRRCLAVLGLAVAMLGGGSAFAQTELKLGHVGEPGSLLAASTEEYAKRINARLAGKVKVVVYGSSQLGGDKEMLQKVKLGTLDMVLPSTVMSSEVDLFGIFEMPYLVKDREHMKRIEQAVFWPKLAPETEKKGLKVIAVWENGYRNITNNKRPIKTPDDLKGIKLRVPEGKWRVKMFQAYGANPSPMKFSELFTALQTGVMDGQENPLTQIYSAKLQEVQKYLSLSGHVYTPSYLIVGSRKWATLPADVRKVLEDTAKETQAFVYETAAHEETDLLGKLKQAGMQVNEVDKDAFFAASKPIYEEFSTEVAGAKALLDQAAALRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 306 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.13 |
| Rhizoplane | 2.03 |
| Rhizosphere | 97.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451853_0472856 | 3300041512 | Bacteria | 1557 |
| 2 | Ga0070658_10014541 | 3300005327 | Bacteria | 6317 |
| 3 | Ga0070658_10045275 | 3300005327 | Bacteria | 3558 |
| 4 | Ga0070658_10066518 | 3300005327 | Bacteria | 2944 |
| 5 | Ga0070658_10084139 | 3300005327 | Bacteria | 2616 |
| 6 | Ga0070658_10148900 | 3300005327 | Bacteria | 1959 |
| 7 | Ga0070658_10150053 | 3300005327 | Bacteria | 1951 |
| 8 | Ga0070658_10290901 | 3300005327 | Bacteria | 1392 |
| 9 | Ga0070658_10352531 | 3300005327 | Bacteria | 1260 |
| 10 | Ga0070676_10318666 | 3300005328 | Bacteria | 1059 |
| 11 | Ga0070683_100014342 | 3300005329 | Bacteria | 6931 |
| 12 | Ga0070683_100040826 | 3300005329 | Bacteria | 4266 |
| 13 | Ga0070683_100057081 | 3300005329 | Bacteria | 3626 |
| 14 | Ga0070683_100066241 | 3300005329 | Bacteria | 3364 |
| 15 | Ga0070670_100031458 | 3300005331 | Bacteria | 4570 |
| 16 | Ga0068869_100048924 | 3300005334 | Bacteria | 3059 |
| 17 | Ga0068869_100268493 | 3300005334 | Bacteria | 1368 |
| 18 | Ga0070666_10016572 | 3300005335 | Bacteria | 4715 |
| 19 | Ga0070666_10043621 | 3300005335 | Bacteria | 3003 |
| 20 | Ga0070680_100001220 | 3300005336 | Bacteria | 18520 |
| 21 | Ga0070680_100069611 | 3300005336 | Bacteria | 2889 |
| 22 | Ga0070680_100087094 | 3300005336 | Bacteria | 2582 |
| 23 | Ga0070680_100116886 | 3300005336 | Bacteria | 2224 |
| 24 | Ga0070680_100180216 | 3300005336 | Bacteria | 1779 |
| 25 | Ga0070682_100010676 | 3300005337 | Bacteria | 5220 |
| 26 | Ga0068868_100029461 | 3300005338 | Bacteria | 4204 |
| 27 | Ga0068868_100080936 | 3300005338 | Bacteria | 2603 |
| 28 | Ga0070660_100003047 | 3300005339 | Bacteria | 11529 |
| 29 | Ga0070660_100011210 | 3300005339 | Bacteria | 6362 |
| 30 | Ga0070660_100030341 | 3300005339 | Bacteria | 4056 |
| 31 | Ga0070660_100048387 | 3300005339 | Bacteria | 3266 |
| 32 | Ga0070689_100014168 | 3300005340 | Bacteria | 5787 |
| 33 | Ga0070661_100000659 | 3300005344 | Bacteria | 25350 |
| 34 | Ga0070661_100007548 | 3300005344 | Bacteria | 7503 |
| 35 | Ga0070661_100033091 | 3300005344 | Bacteria | 3744 |
| 36 | Ga0070661_100042473 | 3300005344 | Bacteria | 3318 |
| 37 | Ga0070661_100099671 | 3300005344 | Bacteria | 2159 |
| 38 | Ga0070661_100136587 | 3300005344 | Bacteria | 1845 |
| 39 | Ga0070661_100172373 | 3300005344 | Bacteria | 1643 |
| 40 | Ga0070692_10008294 | 3300005345 | Bacteria | 4630 |
| 41 | Ga0070692_10024640 | 3300005345 | Bacteria | 2959 |
| 42 | Ga0070692_10094067 | 3300005345 | Bacteria | 1633 |
| 43 | Ga0070669_100034654 | 3300005353 | Bacteria | 3655 |
| 44 | Ga0070669_100039097 | 3300005353 | Bacteria | 3446 |
| 45 | Ga0070669_100105699 | 3300005353 | Bacteria | 2130 |
| 46 | Ga0070675_100043993 | 3300005354 | Bacteria | 3652 |
| 47 | Ga0070675_100287990 | 3300005354 | Bacteria | 1445 |
| 48 | Ga0070671_100085165 | 3300005355 | Bacteria | 2644 |
| 49 | Ga0070671_100099897 | 3300005355 | Bacteria | 2434 |
| 50 | Ga0070671_100169857 | 3300005355 | Bacteria | 1844 |
| 51 | Ga0070671_100220556 | 3300005355 | Bacteria | 1609 |
| 52 | Ga0070673_100005875 | 3300005364 | Bacteria | 7915 |
| 53 | Ga0070673_100039404 | 3300005364 | Bacteria | 3616 |
| 54 | Ga0070673_100086495 | 3300005364 | Bacteria | 2554 |
| 55 | Ga0070673_100307100 | 3300005364 | Bacteria | 1398 |
| 56 | Ga0070659_100002518 | 3300005366 | Bacteria | 13010 |
| 57 | Ga0070659_100021894 | 3300005366 | Bacteria | 4875 |
| 58 | Ga0070659_100081540 | 3300005366 | Bacteria | 2584 |
| 59 | Ga0070659_100127068 | 3300005366 | Bacteria | 2069 |
| 60 | Ga0070659_100356057 | 3300005366 | Bacteria | 1229 |
| 61 | Ga0070667_100097949 | 3300005367 | Bacteria | 2530 |
| 62 | Ga0070667_100322768 | 3300005367 | Bacteria | 1393 |
| 63 | Ga0070709_10039869 | 3300005434 | Bacteria | 2884 |
| 64 | Ga0070709_10163923 | 3300005434 | Bacteria | 1548 |
| 65 | Ga0070709_10258352 | 3300005434 | Bacteria | 1257 |
| 66 | Ga0070714_100001230 | 3300005435 | Bacteria | 18485 |
| 67 | Ga0070714_100012985 | 3300005435 | Bacteria | 6662 |
| 68 | Ga0070714_100040709 | 3300005435 | Bacteria | 3917 |
| 69 | Ga0070714_100176106 | 3300005435 | Bacteria | 1944 |
| 70 | Ga0070714_100327199 | 3300005435 | Bacteria | 1434 |
| 71 | Ga0070714_100441690 | 3300005435 | Bacteria | 1235 |
| 72 | Ga0070713_100041327 | 3300005436 | Bacteria | 3756 |
| 73 | Ga0070713_100044368 | 3300005436 | Bacteria | 3639 |
| 74 | Ga0070713_100068647 | 3300005436 | Bacteria | 2987 |
| 75 | Ga0070710_10023720 | 3300005437 | Bacteria | 3228 |
| 76 | Ga0070701_10108773 | 3300005438 | Bacteria | 1546 |
| 77 | Ga0070711_100019511 | 3300005439 | Bacteria | 4350 |
| 78 | Ga0070711_100057157 | 3300005439 | Bacteria | 2700 |
| 79 | Ga0070694_100120685 | 3300005444 | Bacteria | 1880 |
| 80 | Ga0070708_100442065 | 3300005445 | Bacteria | 1227 |
| 81 | Ga0070663_100002206 | 3300005455 | Bacteria | 10895 |
| 82 | Ga0070663_100037714 | 3300005455 | Bacteria | 3367 |
| 83 | Ga0070663_100054756 | 3300005455 | Bacteria | 2852 |
| 84 | Ga0070663_100141109 | 3300005455 | Bacteria | 1840 |
| 85 | Ga0070663_100192566 | 3300005455 | Bacteria | 1587 |
| 86 | Ga0070663_100280446 | 3300005455 | Bacteria | 1328 |
| 87 | Ga0070678_100146298 | 3300005456 | Bacteria | 1897 |
| 88 | Ga0070662_100002542 | 3300005457 | Bacteria | 11237 |
| 89 | Ga0070662_100082196 | 3300005457 | Bacteria | 2402 |
| 90 | Ga0070681_10006079 | 3300005458 | Bacteria | 11708 |
| 91 | Ga0070681_10017264 | 3300005458 | Bacteria | 7212 |
| 92 | Ga0070681_10032524 | 3300005458 | Bacteria | 5235 |
| 93 | Ga0070681_10051174 | 3300005458 | Bacteria | 4120 |
| 94 | Ga0070681_10065111 | 3300005458 | Bacteria | 3614 |
| 95 | Ga0070681_10081150 | 3300005458 | Bacteria | 3199 |
| 96 | Ga0070681_10137047 | 3300005458 | Bacteria | 2378 |
| 97 | Ga0070681_10247713 | 3300005458 | Bacteria | 1695 |
| 98 | Ga0070681_10330544 | 3300005458 | Bacteria | 1434 |
| 99 | Ga0068867_100100841 | 3300005459 | Bacteria | 2205 |
| 100 | Ga0070685_10009162 | 3300005466 | Bacteria | 5109 |
| 101 | Ga0070707_100252846 | 3300005468 | Bacteria | 1715 |
| 102 | Ga0070699_100062841 | 3300005518 | Bacteria | 3219 |
| 103 | Ga0070699_100091987 | 3300005518 | Bacteria | 2653 |
| 104 | Ga0070699_100108419 | 3300005518 | Bacteria | 2437 |
| 105 | Ga0070679_100002223 | 3300005530 | Bacteria | 17526 |
| 106 | Ga0070679_100012385 | 3300005530 | Bacteria | 8149 |
| 107 | Ga0070679_100012464 | 3300005530 | Bacteria | 8126 |
| 108 | Ga0070679_100022596 | 3300005530 | Bacteria | 6148 |
| 109 | Ga0070679_100028486 | 3300005530 | Bacteria | 5507 |
| 110 | Ga0070679_100035984 | 3300005530 | Bacteria | 4913 |
| 111 | Ga0070679_100039760 | 3300005530 | Bacteria | 4675 |
| 112 | Ga0070679_100048642 | 3300005530 | Bacteria | 4224 |
| 113 | Ga0070679_100049521 | 3300005530 | Bacteria | 4184 |
| 114 | Ga0070679_100072269 | 3300005530 | Bacteria | 3442 |
| 115 | Ga0070679_100127957 | 3300005530 | Bacteria | 2521 |
| 116 | Ga0070679_100178799 | 3300005530 | Bacteria | 2094 |
| 117 | Ga0070684_100028079 | 3300005535 | Bacteria | 4756 |
| 118 | Ga0070684_100032759 | 3300005535 | Bacteria | 4433 |
| 119 | Ga0070684_100049016 | 3300005535 | Bacteria | 3665 |
| 120 | Ga0068853_100015209 | 3300005539 | Bacteria | 6325 |
| 121 | Ga0068853_100029855 | 3300005539 | Bacteria | 4599 |
| 122 | Ga0068853_100065040 | 3300005539 | Bacteria | 3164 |
| 123 | Ga0070672_100057825 | 3300005543 | Bacteria | 3045 |
| 124 | Ga0070672_100268665 | 3300005543 | Bacteria | 1439 |
| 125 | Ga0070686_100290249 | 3300005544 | Bacteria | 1210 |
| 126 | Ga0070695_100134142 | 3300005545 | Bacteria | 1709 |
| 127 | Ga0070696_100000647 | 3300005546 | Bacteria | 22250 |
| 128 | Ga0070665_100038962 | 3300005548 | Bacteria | 4779 |
| 129 | Ga0068855_100006103 | 3300005563 | Bacteria | 14694 |
| 130 | Ga0068855_100007555 | 3300005563 | Bacteria | 13153 |
| 131 | Ga0068855_100022104 | 3300005563 | Bacteria | 7624 |
| 132 | Ga0068855_100069451 | 3300005563 | Bacteria | 4100 |
| 133 | Ga0068855_100069463 | 3300005563 | Bacteria | 4099 |
| 134 | Ga0068855_100075173 | 3300005563 | Bacteria | 3923 |
| 135 | Ga0068855_100090119 | 3300005563 | Bacteria | 3540 |
| 136 | Ga0070664_100000157 | 3300005564 | Bacteria | 47128 |
| 137 | Ga0070664_100000662 | 3300005564 | Bacteria | 26301 |
| 138 | Ga0070664_100015295 | 3300005564 | Bacteria | 6273 |
| 139 | Ga0070664_100042978 | 3300005564 | Bacteria | 3812 |
| 140 | Ga0070664_100058072 | 3300005564 | Bacteria | 3291 |
| 141 | Ga0070664_100196445 | 3300005564 | Bacteria | 1798 |
| 142 | Ga0070664_100229350 | 3300005564 | Bacteria | 1664 |
| 143 | Ga0068857_100002118 | 3300005577 | Bacteria | 16141 |
| 144 | Ga0068857_100009373 | 3300005577 | Bacteria | 8498 |
| 145 | Ga0068857_100099262 | 3300005577 | Bacteria | 2612 |
| 146 | Ga0068857_100129709 | 3300005577 | Bacteria | 2273 |
| 147 | Ga0068857_100196197 | 3300005577 | Bacteria | 1839 |
| 148 | Ga0068854_100005030 | 3300005578 | Bacteria | 8328 |
| 149 | Ga0068854_100020694 | 3300005578 | Bacteria | 4457 |
| 150 | Ga0068854_100031708 | 3300005578 | Bacteria | 3674 |
| 151 | Ga0068854_100039623 | 3300005578 | Bacteria | 3321 |
| 152 | Ga0068854_100080306 | 3300005578 | Bacteria | 2407 |
| 153 | Ga0068854_100090917 | 3300005578 | Bacteria | 2271 |
| 154 | Ga0068854_100157923 | 3300005578 | Bacteria | 1754 |
| 155 | Ga0068854_100227271 | 3300005578 | Bacteria | 1479 |
| 156 | Ga0068856_100003357 | 3300005614 | Bacteria | 16236 |
| 157 | Ga0068856_100007224 | 3300005614 | Bacteria | 10835 |
| 158 | Ga0068856_100056804 | 3300005614 | Bacteria | 3863 |
| 159 | Ga0068856_100112135 | 3300005614 | Bacteria | 2725 |
| 160 | Ga0068856_100197242 | 3300005614 | Bacteria | 2027 |
| 161 | Ga0068856_100422660 | 3300005614 | Bacteria | 1353 |
| 162 | Ga0070702_100008195 | 3300005615 | Bacteria | 5047 |
| 163 | Ga0068852_100000826 | 3300005616 | Bacteria | 20462 |
| 164 | Ga0068852_100001041 | 3300005616 | Bacteria | 18251 |
| 165 | Ga0068852_100005593 | 3300005616 | Bacteria | 9009 |
| 166 | Ga0068859_100135280 | 3300005617 | Bacteria | 2537 |
| 167 | Ga0068859_100192282 | 3300005617 | Bacteria | 2125 |
| 168 | Ga0068864_100000836 | 3300005618 | Bacteria | 25975 |
| 169 | Ga0068864_100212286 | 3300005618 | Bacteria | 1783 |
| 170 | Ga0068866_10003875 | 3300005718 | Bacteria | 6135 |
| 171 | Ga0068861_100327556 | 3300005719 | Bacteria | 1336 |
| 172 | Ga0068851_10008632 | 3300005834 | Bacteria | 4717 |
| 173 | Ga0068851_10020864 | 3300005834 | Bacteria | 3176 |
| 174 | Ga0068863_100060640 | 3300005841 | Bacteria | 3577 |
| 175 | Ga0068863_100090905 | 3300005841 | Bacteria | 2894 |
| 176 | Ga0068863_100398513 | 3300005841 | Bacteria | 1346 |
| 177 | Ga0068858_100002758 | 3300005842 | Bacteria | 17655 |
| 178 | Ga0068858_100084407 | 3300005842 | Bacteria | 2954 |
| 179 | Ga0068860_100023120 | 3300005843 | Bacteria | 6010 |
| 180 | Ga0068860_100156887 | 3300005843 | Bacteria | 2193 |
| 181 | Ga0070717_10332334 | 3300006028 | Bacteria | 1356 |
| 182 | Ga0070717_10333586 | 3300006028 | Bacteria | 1353 |
| 183 | Ga0070715_10021078 | 3300006163 | Bacteria | 2522 |
| 184 | Ga0070715_10061509 | 3300006163 | Bacteria | 1649 |
| 185 | Ga0070712_100007146 | 3300006175 | Bacteria | 6962 |
| 186 | Ga0070712_100234637 | 3300006175 | Bacteria | 1458 |
| 187 | Ga0097621_100068335 | 3300006237 | Bacteria | 2930 |
| 188 | Ga0097621_100220087 | 3300006237 | Bacteria | 1654 |
| 189 | Ga0068871_100075121 | 3300006358 | Bacteria | 2789 |
| 190 | Ga0068871_100181398 | 3300006358 | Bacteria | 1809 |
| 191 | Ga0068871_100183372 | 3300006358 | Bacteria | 1800 |
| 192 | Ga0068871_100460020 | 3300006358 | Bacteria | 1142 |
| 193 | Ga0075428_100017431 | 3300006844 | Bacteria | 7937 |
| 194 | Ga0075434_100062690 | 3300006871 | Bacteria | 3701 |
| 195 | Ga0075434_100106255 | 3300006871 | Bacteria | 2817 |
| 196 | Ga0068865_100085004 | 3300006881 | Bacteria | 2281 |
| 197 | Ga0075436_100040552 | 3300006914 | Bacteria | 3213 |
| 198 | Ga0075436_100093243 | 3300006914 | Bacteria | 2094 |
| 199 | Ga0097620_100135272 | 3300006931 | Bacteria | 2537 |
| 200 | Ga0097620_100192285 | 3300006931 | Bacteria | 2125 |
| 201 | Ga0075435_100385480 | 3300007076 | Bacteria | 1204 |
| 202 | Ga0099795_10054122 | 3300007788 | Bacteria | 1470 |
| 203 | Ga0105240_10004865 | 3300009093 | Bacteria | 20216 |
| 204 | Ga0105240_10006057 | 3300009093 | Bacteria | 17866 |
| 205 | Ga0105240_10007716 | 3300009093 | Bacteria | 15569 |
| 206 | Ga0105240_10007858 | 3300009093 | Bacteria | 15392 |
| 207 | Ga0105240_10017051 | 3300009093 | Bacteria | 9808 |
| 208 | Ga0105240_10018681 | 3300009093 | Bacteria | 9288 |
| 209 | Ga0105240_10041376 | 3300009093 | Bacteria | 5882 |
| 210 | Ga0105240_10104066 | 3300009093 | Bacteria | 3447 |
| 211 | Ga0105240_10171461 | 3300009093 | Bacteria | 2570 |
| 212 | Ga0105240_10458322 | 3300009093 | Bacteria | 1425 |
| 213 | Ga0105245_10019049 | 3300009098 | Bacteria | 6007 |
| 214 | Ga0105245_10023939 | 3300009098 | Bacteria | 5359 |
| 215 | Ga0105245_10035739 | 3300009098 | Bacteria | 4410 |
| 216 | Ga0105241_10008874 | 3300009174 | Bacteria | 7394 |
| 217 | Ga0105242_10061250 | 3300009176 | Bacteria | 3095 |
| 218 | Ga0105248_10001643 | 3300009177 | Bacteria | 24867 |
| 219 | Ga0105237_10008781 | 3300009545 | Bacteria | 10901 |
| 220 | Ga0105237_10094865 | 3300009545 | Bacteria | 2972 |
| 221 | Ga0105237_10552263 | 3300009545 | Bacteria | 1158 |
| 222 | Ga0105238_10000203 | 3300009551 | Bacteria | 65825 |
| 223 | Ga0105238_10005300 | 3300009551 | Bacteria | 12739 |
| 224 | Ga0105238_10015654 | 3300009551 | Bacteria | 7677 |
| 225 | Ga0105238_10022170 | 3300009551 | Bacteria | 6477 |
| 226 | Ga0105238_10025071 | 3300009551 | Bacteria | 6079 |
| 227 | Ga0105238_10223875 | 3300009551 | Bacteria | 1858 |
| 228 | Ga0105239_10093277 | 3300010375 | Bacteria | 3324 |
| 229 | Ga0105239_10323087 | 3300010375 | Bacteria | 1740 |
| 230 | Ga0105239_10748449 | 3300010375 | Bacteria | 1118 |
| 231 | Ga0105246_10069127 | 3300011119 | Bacteria | 2479 |
| 232 | Ga0157373_10001573 | 3300013100 | Bacteria | 17415 |
| 233 | Ga0157373_10016974 | 3300013100 | Bacteria | 5303 |
| 234 | Ga0157373_10032306 | 3300013100 | Bacteria | 3768 |
| 235 | Ga0157373_10047841 | 3300013100 | Bacteria | 3050 |
| 236 | Ga0157373_10068387 | 3300013100 | Bacteria | 2510 |
| 237 | Ga0157373_10101786 | 3300013100 | Bacteria | 2021 |
| 238 | Ga0157373_10107530 | 3300013100 | Bacteria | 1961 |
| 239 | Ga0157373_10148394 | 3300013100 | Bacteria | 1650 |
| 240 | Ga0157371_10002592 | 3300013102 | Bacteria | 17154 |
| 241 | Ga0157371_10016262 | 3300013102 | Bacteria | 5557 |
| 242 | Ga0157371_10127408 | 3300013102 | Bacteria | 1811 |
| 243 | Ga0157370_10001120 | 3300013104 | Bacteria | 33464 |
| 244 | Ga0157370_10002318 | 3300013104 | Bacteria | 23048 |
| 245 | Ga0157370_10010117 | 3300013104 | Bacteria | 9961 |
| 246 | Ga0157370_10015498 | 3300013104 | Bacteria | 7750 |
| 247 | Ga0157370_10028168 | 3300013104 | Bacteria | 5530 |
| 248 | Ga0157370_10053733 | 3300013104 | Bacteria | 3841 |
| 249 | Ga0157370_10073398 | 3300013104 | Bacteria | 3228 |
| 250 | Ga0157370_10078279 | 3300013104 | Bacteria | 3114 |
| 251 | Ga0157370_10087886 | 3300013104 | Bacteria | 2919 |
| 252 | Ga0157370_10090588 | 3300013104 | Bacteria | 2871 |
| 253 | Ga0157370_10224140 | 3300013104 | Bacteria | 1741 |
| 254 | Ga0157369_10004919 | 3300013105 | Bacteria | 15662 |
| 255 | Ga0157369_10008031 | 3300013105 | Bacteria | 12109 |
| 256 | Ga0157369_10018830 | 3300013105 | Bacteria | 7737 |
| 257 | Ga0157369_10054805 | 3300013105 | Bacteria | 4305 |
| 258 | Ga0157369_10137759 | 3300013105 | Bacteria | 2583 |
| 259 | Ga0157369_10232238 | 3300013105 | Bacteria | 1928 |
| 260 | Ga0157374_10003153 | 3300013296 | Bacteria | 13861 |
| 261 | Ga0157374_10125525 | 3300013296 | Bacteria | 2480 |
| 262 | Ga0157378_10066491 | 3300013297 | Bacteria | 3229 |
| 263 | Ga0157378_10120977 | 3300013297 | Bacteria | 2413 |
| 264 | Ga0157378_10403246 | 3300013297 | Bacteria | 1348 |
| 265 | Ga0163162_10024159 | 3300013306 | Bacteria | 5998 |
| 266 | Ga0163162_10041753 | 3300013306 | Bacteria | 4590 |
| 267 | Ga0163162_10047261 | 3300013306 | Bacteria | 4313 |
| 268 | Ga0163162_10065671 | 3300013306 | Bacteria | 3676 |
| 269 | Ga0163162_10072223 | 3300013306 | Bacteria | 3505 |
| 270 | Ga0157372_10001409 | 3300013307 | Bacteria | 25953 |
| 271 | Ga0157372_10004130 | 3300013307 | Bacteria | 15553 |
| 272 | Ga0157372_10007797 | 3300013307 | Bacteria | 11373 |
| 273 | Ga0157372_10009719 | 3300013307 | Bacteria | 10230 |
| 274 | Ga0157372_10019156 | 3300013307 | Bacteria | 7369 |
| 275 | Ga0157372_10132532 | 3300013307 | Bacteria | 2869 |
| 276 | Ga0157375_10032094 | 3300013308 | Bacteria | 4977 |
| 277 | Ga0157375_10130879 | 3300013308 | Bacteria | 2628 |
| 278 | Ga0163163_10031646 | 3300014325 | Bacteria | 5107 |
| 279 | Ga0157380_10442143 | 3300014326 | Bacteria | 1246 |
| 280 | Ga0157380_10482403 | 3300014326 | Bacteria | 1199 |
| 281 | Ga0157377_10175814 | 3300014745 | Bacteria | 1342 |
| 282 | Ga0157376_10006216 | 3300014969 | Bacteria | 8416 |
| 283 | Ga0157376_10207725 | 3300014969 | Bacteria | 1806 |
| 284 | Ga0182005_1031178 | 3300015265 | Bacteria | 1453 |
| 285 | Ga0163161_10022924 | 3300017792 | Bacteria | 4399 |
| 286 | Ga0163161_10157182 | 3300017792 | Bacteria | 1731 |
| 287 | Ga0207680_10121218 | 3300025903 | Bacteria | 1710 |
| 288 | Ga0207699_10141582 | 3300025906 | Bacteria | 1581 |
| 289 | Ga0207643_10059517 | 3300025908 | Bacteria | 2179 |
| 290 | Ga0207705_10008790 | 3300025909 | Bacteria | 7363 |
| 291 | Ga0207705_10020178 | 3300025909 | Bacteria | 4768 |
| 292 | Ga0207705_10026329 | 3300025909 | Bacteria | 4148 |
| 293 | Ga0207705_10094523 | 3300025909 | Bacteria | 2192 |
| 294 | Ga0207705_10202618 | 3300025909 | Bacteria | 1504 |
| 295 | Ga0207654_10013056 | 3300025911 | Bacteria | 4266 |
| 296 | Ga0207654_10054982 | 3300025911 | Bacteria | 2303 |
| 297 | Ga0207707_10016373 | 3300025912 | Bacteria | 6466 |
| 298 | Ga0207707_10034346 | 3300025912 | Bacteria | 4436 |
| 299 | Ga0207707_10035990 | 3300025912 | Bacteria | 4328 |
| 300 | Ga0207707_10108112 | 3300025912 | Bacteria | 2432 |
| 301 | Ga0207707_10172045 | 3300025912 | Bacteria | 1893 |
| 302 | Ga0207707_10323393 | 3300025912 | Bacteria | 1331 |
| 303 | Ga0207695_10016171 | 3300025913 | Bacteria | 8749 |
| 304 | Ga0207695_10043015 | 3300025913 | Bacteria | 4818 |
| 305 | Ga0207695_10049717 | 3300025913 | Bacteria | 4416 |
| 306 | Ga0207695_10051599 | 3300025913 | Bacteria | 4316 |
| 307 | Ga0207695_10091139 | 3300025913 | Bacteria | 3063 |
| 308 | Ga0207695_10150764 | 3300025913 | Bacteria | 2264 |
| 309 | Ga0207695_10151078 | 3300025913 | Bacteria | 2262 |
| 310 | Ga0207671_10169164 | 3300025914 | Bacteria | 1696 |
| 311 | Ga0207671_10202165 | 3300025914 | Bacteria | 1552 |
| 312 | Ga0207693_10201414 | 3300025915 | Bacteria | 1566 |
| 313 | Ga0207660_10000918 | 3300025917 | Bacteria | 19431 |
| 314 | Ga0207660_10022899 | 3300025917 | Bacteria | 4212 |
| 315 | Ga0207660_10036379 | 3300025917 | Bacteria | 3422 |
| 316 | Ga0207660_10095436 | 3300025917 | Bacteria | 2212 |
| 317 | Ga0207660_10176045 | 3300025917 | Bacteria | 1659 |
| 318 | Ga0207660_10404312 | 3300025917 | Bacteria | 1100 |
| 319 | Ga0207662_10096609 | 3300025918 | Bacteria | 1825 |
| 320 | Ga0207657_10000586 | 3300025919 | Bacteria | 38661 |
| 321 | Ga0207657_10002457 | 3300025919 | Bacteria | 20027 |
| 322 | Ga0207657_10009562 | 3300025919 | Bacteria | 9730 |
| 323 | Ga0207657_10041288 | 3300025919 | Bacteria | 4080 |
| 324 | Ga0207657_10058693 | 3300025919 | Bacteria | 3310 |
| 325 | Ga0207657_10063624 | 3300025919 | Bacteria | 3153 |
| 326 | Ga0207657_10091926 | 3300025919 | Bacteria | 2529 |
| 327 | Ga0207649_10003878 | 3300025920 | Bacteria | 8155 |
| 328 | Ga0207649_10015963 | 3300025920 | Bacteria | 4226 |
| 329 | Ga0207649_10031357 | 3300025920 | Bacteria | 3158 |
| 330 | Ga0207649_10032416 | 3300025920 | Bacteria | 3115 |
| 331 | Ga0207649_10132484 | 3300025920 | Bacteria | 1695 |
| 332 | Ga0207649_10166363 | 3300025920 | Bacteria | 1532 |
| 333 | Ga0207652_10004936 | 3300025921 | Bacteria | 10797 |
| 334 | Ga0207652_10022926 | 3300025921 | Bacteria | 5171 |
| 335 | Ga0207652_10029509 | 3300025921 | Bacteria | 4587 |
| 336 | Ga0207652_10035307 | 3300025921 | Bacteria | 4219 |
| 337 | Ga0207652_10039342 | 3300025921 | Bacteria | 4013 |
| 338 | Ga0207652_10094577 | 3300025921 | Bacteria | 2631 |
| 339 | Ga0207652_10099129 | 3300025921 | Bacteria | 2570 |
| 340 | Ga0207652_10155956 | 3300025921 | Bacteria | 2045 |
| 341 | Ga0207652_10405137 | 3300025921 | Bacteria | 1231 |
| 342 | Ga0207652_10484790 | 3300025921 | Bacteria | 1113 |
| 343 | Ga0207646_10025356 | 3300025922 | Bacteria | 5424 |
| 344 | Ga0207681_10115047 | 3300025923 | Bacteria | 1963 |
| 345 | Ga0207694_10006781 | 3300025924 | Bacteria | 8697 |
| 346 | Ga0207694_10010483 | 3300025924 | Bacteria | 6990 |
| 347 | Ga0207694_10014521 | 3300025924 | Bacteria | 5938 |
| 348 | Ga0207694_10029612 | 3300025924 | Bacteria | 4178 |
| 349 | Ga0207694_10206536 | 3300025924 | Bacteria | 1599 |
| 350 | Ga0207659_10071014 | 3300025926 | Bacteria | 2541 |
| 351 | Ga0207687_10002728 | 3300025927 | Bacteria | 11957 |
| 352 | Ga0207687_10028131 | 3300025927 | Bacteria | 3777 |
| 353 | Ga0207687_10034278 | 3300025927 | Bacteria | 3447 |
| 354 | Ga0207700_10017425 | 3300025928 | Bacteria | 4798 |
| 355 | Ga0207700_10048370 | 3300025928 | Bacteria | 3157 |
| 356 | Ga0207664_10008038 | 3300025929 | Bacteria | 7332 |
| 357 | Ga0207664_10044232 | 3300025929 | Bacteria | 3486 |
| 358 | Ga0207644_10002797 | 3300025931 | Bacteria | 11244 |
| 359 | Ga0207644_10008406 | 3300025931 | Bacteria | 6756 |
| 360 | Ga0207644_10177909 | 3300025931 | Bacteria | 1665 |
| 361 | Ga0207644_10196837 | 3300025931 | Bacteria | 1587 |
| 362 | Ga0207690_10013365 | 3300025932 | Bacteria | 4934 |
| 363 | Ga0207690_10055002 | 3300025932 | Bacteria | 2679 |
| 364 | Ga0207690_10328266 | 3300025932 | Bacteria | 1204 |
| 365 | Ga0207706_10002770 | 3300025933 | Bacteria | 17037 |
| 366 | Ga0207706_10021790 | 3300025933 | Bacteria | 5751 |
| 367 | Ga0207686_10218872 | 3300025934 | Bacteria | 1373 |
| 368 | Ga0207670_10014556 | 3300025936 | Bacteria | 4674 |
| 369 | Ga0207669_10041984 | 3300025937 | Bacteria | 2666 |
| 370 | Ga0207665_10019599 | 3300025939 | Bacteria | 4448 |
| 371 | Ga0207665_10036446 | 3300025939 | Bacteria | 3271 |
| 372 | Ga0207665_10076841 | 3300025939 | Bacteria | 2291 |
| 373 | Ga0207691_10010545 | 3300025940 | Bacteria | 8868 |
| 374 | Ga0207691_10067598 | 3300025940 | Bacteria | 3231 |
| 375 | Ga0207691_10238336 | 3300025940 | Bacteria | 1573 |
| 376 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 377 | Ga0207711_10007075 | 3300025941 | Bacteria | 9402 |
| 378 | Ga0207689_10038570 | 3300025942 | Bacteria | 3956 |
| 379 | Ga0207661_10011082 | 3300025944 | Bacteria | 6516 |
| 380 | Ga0207661_10014956 | 3300025944 | Bacteria | 5697 |
| 381 | Ga0207661_10163354 | 3300025944 | Bacteria | 1933 |
| 382 | Ga0207679_10003482 | 3300025945 | Bacteria | 9730 |
| 383 | Ga0207679_10006427 | 3300025945 | Bacteria | 7423 |
| 384 | Ga0207679_10012754 | 3300025945 | Bacteria | 5490 |
| 385 | Ga0207679_10022679 | 3300025945 | Bacteria | 4279 |
| 386 | Ga0207679_10025964 | 3300025945 | Bacteria | 4034 |
| 387 | Ga0207679_10042623 | 3300025945 | Bacteria | 3263 |
| 388 | Ga0207679_10154420 | 3300025945 | Bacteria | 1872 |
| 389 | Ga0207679_10253156 | 3300025945 | Bacteria | 1498 |
| 390 | Ga0207679_10269379 | 3300025945 | Bacteria | 1456 |
| 391 | Ga0207667_10000425 | 3300025949 | Bacteria | 56804 |
| 392 | Ga0207667_10009574 | 3300025949 | Bacteria | 11400 |
| 393 | Ga0207667_10015677 | 3300025949 | Bacteria | 8596 |
| 394 | Ga0207667_10041828 | 3300025949 | Bacteria | 4873 |
| 395 | Ga0207667_10065965 | 3300025949 | Bacteria | 3774 |
| 396 | Ga0207667_10094825 | 3300025949 | Bacteria | 3081 |
| 397 | Ga0207667_10107077 | 3300025949 | Bacteria | 2883 |
| 398 | Ga0207667_10122191 | 3300025949 | Bacteria | 2683 |
| 399 | Ga0207667_10261083 | 3300025949 | Bacteria | 1771 |
| 400 | Ga0207667_10346379 | 3300025949 | Bacteria | 1515 |
| 401 | Ga0207651_10015223 | 3300025960 | Bacteria | 4464 |
| 402 | Ga0207651_10052444 | 3300025960 | Bacteria | 2781 |
| 403 | Ga0207640_10070754 | 3300025981 | Bacteria | 2348 |
| 404 | Ga0207658_10122137 | 3300025986 | Bacteria | 2078 |
| 405 | Ga0207658_10174695 | 3300025986 | Bacteria | 1773 |
| 406 | Ga0207658_10299886 | 3300025986 | Bacteria | 1384 |
| 407 | Ga0207677_10000188 | 3300026023 | Bacteria | 49751 |
| 408 | Ga0207703_10000806 | 3300026035 | Bacteria | 30873 |
| 409 | Ga0207639_10048427 | 3300026041 | Bacteria | 3217 |
| 410 | Ga0207639_10054697 | 3300026041 | Bacteria | 3052 |
| 411 | Ga0207639_10087916 | 3300026041 | Bacteria | 2478 |
| 412 | Ga0207639_10202390 | 3300026041 | Bacteria | 1704 |
| 413 | Ga0207678_10005045 | 3300026067 | Bacteria | 11846 |
| 414 | Ga0207678_10016867 | 3300026067 | Bacteria | 6413 |
| 415 | Ga0207678_10080029 | 3300026067 | Bacteria | 2797 |
| 416 | Ga0207678_10094111 | 3300026067 | Bacteria | 2560 |
| 417 | Ga0207702_10002758 | 3300026078 | Bacteria | 16441 |
| 418 | Ga0207702_10002944 | 3300026078 | Bacteria | 15907 |
| 419 | Ga0207702_10024530 | 3300026078 | Bacteria | 5004 |
| 420 | Ga0207702_10042863 | 3300026078 | Bacteria | 3798 |
| 421 | Ga0207702_10052623 | 3300026078 | Bacteria | 3446 |
| 422 | Ga0207702_10354713 | 3300026078 | Bacteria | 1404 |
| 423 | Ga0207641_10027731 | 3300026088 | Bacteria | 4679 |
| 424 | Ga0207641_10037558 | 3300026088 | Bacteria | 4045 |
| 425 | Ga0207648_10042104 | 3300026089 | Bacteria | 4010 |
| 426 | Ga0207648_10054451 | 3300026089 | Bacteria | 3494 |
| 427 | Ga0207648_10068843 | 3300026089 | Bacteria | 3084 |
| 428 | Ga0207676_10000230 | 3300026095 | Bacteria | 48620 |
| 429 | Ga0207676_10122612 | 3300026095 | Bacteria | 2195 |
| 430 | Ga0207674_10000301 | 3300026116 | Bacteria | 62588 |
| 431 | Ga0207674_10000593 | 3300026116 | Bacteria | 47678 |
| 432 | Ga0207674_10024546 | 3300026116 | Bacteria | 6439 |
| 433 | Ga0207674_10142081 | 3300026116 | Bacteria | 2360 |
| 434 | Ga0207675_100057058 | 3300026118 | Bacteria | 3643 |
| 435 | Ga0207675_100090794 | 3300026118 | Bacteria | 2872 |
| 436 | Ga0207683_10001896 | 3300026121 | Bacteria | 18497 |
| 437 | Ga0207683_10089782 | 3300026121 | Bacteria | 2735 |
| 438 | Ga0207683_10248322 | 3300026121 | Bacteria | 1624 |
| 439 | Ga0207698_10001265 | 3300026142 | Bacteria | 14771 |
| 440 | Ga0207698_10134925 | 3300026142 | Bacteria | 2116 |
| 441 | Ga0207698_10171428 | 3300026142 | Bacteria | 1911 |
| 442 | Ga0209995_1004512 | 3300027471 | Bacteria | 2226 |
| 443 | Ga0209970_1000330 | 3300027614 | Bacteria | 7911 |
| 444 | Ga0209983_1003253 | 3300027665 | Bacteria | 3486 |
| 445 | Ga0209971_1002990 | 3300027682 | Bacteria | 4042 |
| 446 | Ga0209971_1023720 | 3300027682 | Bacteria | 1464 |
| 447 | Ga0209966_1001960 | 3300027695 | Bacteria | 3449 |
| 448 | Ga0209974_10000515 | 3300027876 | Bacteria | 12912 |
| 449 | Ga0209974_10028705 | 3300027876 | Bacteria | 1842 |
| 450 | Ga0268266_10041432 | 3300028379 | Bacteria | 3929 |
| 451 | Ga0268264_10025840 | 3300028381 | Bacteria | 4795 |
| 452 | Ga0268264_10092651 | 3300028381 | Bacteria | 2608 |
| 453 | Ga0268264_10131145 | 3300028381 | Bacteria | 2222 |
| 454 | Ga0307408_100026386 | 3300031548 | Bacteria | 3990 |
| 455 | Ga0307408_100060833 | 3300031548 | Bacteria | 2754 |
| 456 | Ga0307408_100118759 | 3300031548 | Bacteria | 2045 |
| 457 | Ga0307413_10110370 | 3300031824 | Bacteria | 1840 |
| 458 | Ga0307413_10145003 | 3300031824 | Bacteria | 1647 |
| 459 | Ga0307410_10026531 | 3300031852 | Bacteria | 3648 |
| 460 | Ga0307410_10031925 | 3300031852 | Bacteria | 3384 |
| 461 | Ga0307406_10029752 | 3300031901 | Bacteria | 3309 |
| 462 | Ga0307406_10031045 | 3300031901 | Bacteria | 3250 |
| 463 | Ga0307412_10039145 | 3300031911 | Bacteria | 3059 |
| 464 | Ga0307409_100019041 | 3300031995 | Bacteria | 4636 |
| 465 | Ga0307409_100042722 | 3300031995 | Bacteria | 3397 |
| 466 | Ga0307416_100115009 | 3300032002 | Bacteria | 2381 |
| 467 | Ga0307416_100390291 | 3300032002 | Bacteria | 1426 |
| 468 | Ga0307416_100539113 | 3300032002 | Bacteria | 1238 |
| 469 | Ga0307414_10050934 | 3300032004 | Bacteria | 2871 |
| 470 | Ga0307414_10074883 | 3300032004 | Bacteria | 2455 |
| 471 | Ga0307411_10017682 | 3300032005 | Bacteria | 4071 |
| 472 | Ga0307411_10306632 | 3300032005 | Bacteria | 1276 |
| 473 | Ga0307415_100103075 | 3300032126 | Bacteria | 2098 |
| 474 | Ga0373934_0012408 | 3300035086 | Bacteria | 3217 |
| 475 | Ga0373944_0003249 | 3300035089 | Bacteria | 4180 |
| 476 | Ga0373936_0004509 | 3300035113 | Bacteria | 5272 |
| 477 | Ga0373941_0003011 | 3300035115 | Bacteria | 3772 |
| 478 | Ga0373945_0066334 | 3300035116 | Bacteria | 1357 |
| 479 | Ga0373953_0006271 | 3300035117 | Bacteria | 3908 |
| 480 | Ga0373954_0016093 | 3300035118 | Bacteria | 3346 |
| 481 | Ga0373957_0067105 | 3300035120 | Bacteria | 1398 |
| 482 | Ga0373943_0007550 | 3300035170 | Bacteria | 4883 |
| 483 | Ga0373946_0002403 | 3300035171 | Bacteria | 6619 |
| 484 | Ga0373946_0092826 | 3300035171 | Bacteria | 1340 |
| 485 | Ga0373955_0036180 | 3300035172 | Bacteria | 2618 |
| 486 | Ga0373924_0040791 | 3300035410 | Bacteria | 1901 |
| 487 | Ga0373935_0004641 | 3300035692 | Bacteria | 8075 |
| 488 | Ga0373935_0019629 | 3300035692 | Bacteria | 4122 |
| 489 | Ga0373935_0089392 | 3300035692 | Bacteria | 2014 |
| 490 | Ga0373935_0220427 | 3300035692 | Bacteria | 1317 |
| 491 | Ga0373927_0006549 | 3300035695 | Bacteria | 7934 |
| 492 | Ga0373927_0058721 | 3300035695 | Bacteria | 2488 |
| 493 | Ga0373927_0157603 | 3300035695 | Bacteria | 1487 |
| 494 | Ga0373933_0029862 | 3300035724 | Bacteria | 3154 |
| 495 | Ga0373947_0023666 | 3300035725 | Bacteria | 3575 |
| 496 | Ga0373947_0025712 | 3300035725 | Bacteria | 3433 |
| 497 | Ga0373947_0209163 | 3300035725 | Bacteria | 1279 |
| 498 | Ga0373937_0023672 | 3300036401 | Bacteria | 5535 |
| 499 | Ga0373937_0122387 | 3300036401 | Bacteria | 2425 |
| 500 | Ga0373937_0128829 | 3300036401 | Bacteria | 2362 |
| 501 | Ga0373937_0180020 | 3300036401 | Bacteria | 1985 |
| 502 | Ga0373925_0011332 | 3300037068 | Bacteria | 6471 |
| 503 | Ga0373925_0013181 | 3300037068 | Bacteria | 5984 |
| 504 | Ga0395899_0000216 | 3300037312 | Bacteria | 81683 |
| 505 | Ga0395899_0003355 | 3300037312 | Bacteria | 12697 |
| 506 | Ga0395899_0084595 | 3300037312 | Bacteria | 2306 |
| 507 | Ga0395899_0135320 | 3300037312 | Bacteria | 1757 |
| 508 | Ga0395900_0002787 | 3300037418 | Bacteria | 19106 |
| 509 | Ga0395900_0003035 | 3300037418 | Bacteria | 18279 |
| 510 | Ga0395900_0355701 | 3300037418 | Bacteria | 1437 |
| 511 | Ga0395900_0462376 | 3300037418 | Bacteria | 1223 |
| 512 | Ga0395898_0008265 | 3300037466 | Bacteria | 11006 |
| 513 | Ga0395898_0040854 | 3300037466 | Bacteria | 4584 |
| 514 | Ga0395898_0155032 | 3300037466 | Bacteria | 2191 |
| 515 | Ga0395905_0054144 | 3300037471 | Bacteria | 3755 |
| 516 | Ga0395905_0290944 | 3300037471 | Bacteria | 1520 |
| 517 | Ga0395905_0292481 | 3300037471 | Bacteria | 1515 |
| 518 | Ga0395901_0000420 | 3300038443 | Bacteria | 49952 |
| 519 | Ga0395901_0011350 | 3300038443 | Bacteria | 9027 |
| 520 | Ga0395901_0197827 | 3300038443 | Bacteria | 2107 |
| 521 | Ga0395901_0282382 | 3300038443 | Bacteria | 1725 |
| 522 | Ga0466966_0025687 | 3300044684 | Bacteria | 3847 |
| 523 | Ga0466966_0045290 | 3300044684 | Bacteria | 2813 |
| 524 | Ga0466961_0090581 | 3300044693 | Bacteria | 1931 |
| 525 | Ga0466963_0051494 | 3300044694 | Bacteria | 2729 |
| 526 | Ga0466963_0078451 | 3300044694 | Bacteria | 2233 |
| 527 | Ga0466963_0164095 | 3300044694 | Bacteria | 1547 |
| 528 | Ga0466957_0002655 | 3300044842 | Bacteria | 9651 |
| 529 | Ga0466957_0006402 | 3300044842 | Bacteria | 6649 |
| 530 | Ga0466959_0078420 | 3300045049 | Bacteria | 2382 |
| 531 | Ga0466959_0165712 | 3300045049 | Bacteria | 1552 |
| 532 | Ga0466958_0038992 | 3300045836 | Bacteria | 2852 |
| 533 | Ga0466967_0504161 | 3300045976 | Bacteria | 1188 |
| 534 | Ga0495627_006947 | 3300046453 | Bacteria | 4393 |
| 535 | Ga0495603_0057426 | 3300046455 | Bacteria | 2303 |
| 536 | Ga0495629_0018061 | 3300046459 | Bacteria | 5055 |
| 537 | Ga0495629_0215474 | 3300046459 | Bacteria | 1325 |
| 538 | Ga0495638_0004189 | 3300046460 | Bacteria | 10991 |
| 539 | Ga0495651_0108694 | 3300046462 | Bacteria | 2054 |
| 540 | Ga0495653_0067370 | 3300046463 | Bacteria | 2689 |
| 541 | Ga0495580_0000377 | 3300046472 | Bacteria | 36420 |
| 542 | Ga0495582_0028692 | 3300046473 | Bacteria | 3054 |
| 543 | Ga0495582_0031290 | 3300046473 | Bacteria | 2924 |
| 544 | Ga0495605_0047257 | 3300046474 | Bacteria | 2111 |
| 545 | Ga0495639_0027422 | 3300046475 | Bacteria | 2521 |
| 546 | Ga0495584_0013636 | 3300046491 | Bacteria | 4146 |
| 547 | Ga0495584_0038891 | 3300046491 | Bacteria | 2404 |
| 548 | Ga0495585_0000070 | 3300046492 | Bacteria | 106156 |
| 549 | Ga0495585_0002310 | 3300046492 | Bacteria | 13734 |
| 550 | Ga0495585_0033853 | 3300046492 | Bacteria | 2890 |
| 551 | Ga0495585_0036365 | 3300046492 | Bacteria | 2778 |
| 552 | Ga0495594_0002927 | 3300046499 | Bacteria | 8866 |
| 553 | Ga0495594_0017420 | 3300046499 | Bacteria | 3796 |
| 554 | Ga0495594_0065466 | 3300046499 | Bacteria | 2016 |
| 555 | Ga0495596_0000031 | 3300046500 | Bacteria | 102612 |
| 556 | Ga0495607_0076382 | 3300046501 | Bacteria | 1853 |
| 557 | Ga0495607_0091400 | 3300046501 | Bacteria | 1648 |
| 558 | Ga0495583_0008132 | 3300046506 | Bacteria | 6460 |
| 559 | Ga0495606_0051516 | 3300046507 | Bacteria | 2684 |
| 560 | Ga0495616_0011422 | 3300046513 | Bacteria | 5088 |
| 561 | Ga0495628_0239631 | 3300046516 | Bacteria | 1357 |
| 562 | Ga0495630_0217709 | 3300046517 | Bacteria | 1458 |
| 563 | Ga0495644_0005511 | 3300046523 | Bacteria | 4942 |
| 564 | Ga0495648_0126222 | 3300046524 | Bacteria | 1367 |
| 565 | Ga0495663_0034771 | 3300046525 | Bacteria | 1511 |
| 566 | Ga0495642_0008031 | 3300046528 | Bacteria | 4037 |
| 567 | Ga0495665_0010534 | 3300046531 | Bacteria | 5003 |
| 568 | Ga0495665_0014273 | 3300046531 | Bacteria | 4285 |
| 569 | Ga0495665_0038594 | 3300046531 | Bacteria | 2546 |
| 570 | Ga0495586_0002833 | 3300046535 | Bacteria | 9368 |
| 571 | Ga0495587_0052392 | 3300046536 | Bacteria | 2408 |
| 572 | Ga0495621_0010545 | 3300046539 | Bacteria | 2831 |
| 573 | Ga0495597_0010825 | 3300046542 | Bacteria | 4443 |
| 574 | Ga0495645_0006342 | 3300046543 | Bacteria | 8207 |
| 575 | Ga0495633_0020320 | 3300046558 | Bacteria | 3341 |
| 576 | Ga0495656_0089881 | 3300046615 | Bacteria | 1402 |
| 577 | Ga0495668_0003146 | 3300046616 | Bacteria | 12732 |
| 578 | Ga0495611_0002422 | 3300046648 | Bacteria | 8546 |
| 579 | Ga0495625_0023691 | 3300046660 | Bacteria | 4685 |
| 580 | Ga0495661_0030849 | 3300046665 | Bacteria | 3409 |
| 581 | Ga0495588_0024059 | 3300046674 | Bacteria | 3022 |
| 582 | Ga0495588_0072628 | 3300046674 | Bacteria | 1790 |
| 583 | Ga0495657_0114117 | 3300046675 | Bacteria | 1708 |
| 584 | Ga0495623_0077429 | 3300046679 | Bacteria | 2062 |
| 585 | Ga0495647_0001972 | 3300046681 | Bacteria | 6406 |
| 586 | Ga0495658_0003752 | 3300046683 | Bacteria | 7517 |
| 587 | Ga0495658_0005362 | 3300046683 | Bacteria | 6307 |
| 588 | Ga0495658_0020500 | 3300046683 | Bacteria | 3469 |
| 589 | Ga0495669_0017559 | 3300046684 | Bacteria | 3071 |
| 590 | Ga0495670_0016846 | 3300046691 | Bacteria | 3593 |
| 591 | Ga0495589_0030198 | 3300046794 | Bacteria | 2730 |
| 592 | Ga0495589_0112070 | 3300046794 | Bacteria | 1316 |
| 593 | Ga0495636_0019167 | 3300047318 | Bacteria | 2748 |
| 594 | Ga0495674_0188934 | 3300047319 | Bacteria | 1713 |
| 595 | Ga0495676_0014845 | 3300047321 | Bacteria | 6955 |
| 596 | Ga0495683_0011188 | 3300047323 | Bacteria | 4729 |
| 597 | Ga0495675_0037056 | 3300047444 | Bacteria | 3107 |
| 598 | Ga0495675_0067705 | 3300047444 | Bacteria | 2256 |
| 599 | Ga0495677_0002049 | 3300047445 | Bacteria | 8038 |
| 600 | Ga0495677_0011499 | 3300047445 | Bacteria | 3237 |
| 601 | Ga0495685_038561 | 3300047447 | Bacteria | 1637 |
| 602 | Ga0495681_0036781 | 3300047470 | Bacteria | 2418 |
| 603 | Ga0495681_0038572 | 3300047470 | Bacteria | 2340 |
| 604 | Ga0495684_0159510 | 3300047471 | Bacteria | 1683 |
| 605 | Ga0495593_0014866 | 3300047673 | Bacteria | 4421 |
| 606 | Ga0495602_0069453 | 3300048088 | Bacteria | 3020 |
| 607 | Ga0495615_0012899 | 3300048090 | Bacteria | 1734 |
| 608 | Ga0495626_0000792 | 3300048091 | Bacteria | 28683 |
| 609 | Ga0495626_0009038 | 3300048091 | Bacteria | 5404 |
| 610 | Ga0496100_0101584 | 3300048903 | Bacteria | 1983 |
| 611 | Ga0496104_0009253 | 3300048907 | Bacteria | 8761 |
| 612 | Ga0496104_0119357 | 3300048907 | Bacteria | 2532 |
| 613 | Ga0496105_0085483 | 3300048908 | Bacteria | 2606 |
| 614 | Ga0496106_0008585 | 3300048909 | Bacteria | 7558 |
| 615 | Ga0496107_0059033 | 3300048910 | Bacteria | 2775 |
| 616 | Ga0496108_0052651 | 3300048911 | Bacteria | 3412 |
| 617 | Ga0496109_0136508 | 3300048912 | Bacteria | 2292 |
| 618 | Ga0496109_0164565 | 3300048912 | Bacteria | 2079 |
| 619 | Ga0496112_0000303 | 3300048915 | Bacteria | 31772 |
| 620 | Ga0496112_0043423 | 3300048915 | Bacteria | 4401 |
| 621 | Ga0496113_0107622 | 3300048916 | Bacteria | 2167 |
| 622 | Ga0496113_0144366 | 3300048916 | Bacteria | 1874 |
| 623 | Ga0496114_0112677 | 3300048917 | Bacteria | 2332 |
| 624 | Ga0496115_0007489 | 3300048918 | Bacteria | 8035 |
| 625 | Ga0496115_0108328 | 3300048918 | Bacteria | 2281 |
| 626 | Ga0495682_0009527 | 3300049460 | Bacteria | 3789 |
| 627 | Ga0501291_010739 | 3300049514 | Bacteria | 1308 |
| 628 | Ga0501031_0041109 | 3300049568 | Bacteria | 3019 |
| 629 | Ga0501031_0069075 | 3300049568 | Bacteria | 2301 |
| 630 | Ga0501031_0087132 | 3300049568 | Bacteria | 2036 |
| 631 | Ga0501032_0022206 | 3300049569 | Bacteria | 4402 |
| 632 | Ga0501033_0010042 | 3300049570 | Bacteria | 7268 |
| 633 | Ga0501033_0102677 | 3300049570 | Bacteria | 2085 |
| 634 | Ga0501034_0005289 | 3300049571 | Bacteria | 14159 |
| 635 | Ga0501034_0005371 | 3300049571 | Bacteria | 14024 |
| 636 | Ga0501034_0028499 | 3300049571 | Bacteria | 5683 |
| 637 | Ga0501034_0066728 | 3300049571 | Bacteria | 3611 |
| 638 | Ga0501034_0077625 | 3300049571 | Bacteria | 3327 |
| 639 | Ga0501034_0121504 | 3300049571 | Bacteria | 2598 |
| 640 | Ga0501034_0431229 | 3300049571 | Bacteria | 1238 |
| 641 | Ga0501036_0003666 | 3300049572 | Bacteria | 12287 |
| 642 | Ga0501036_0009460 | 3300049572 | Bacteria | 8017 |
| 643 | Ga0501036_0014214 | 3300049572 | Bacteria | 6623 |
| 644 | Ga0501036_0027364 | 3300049572 | Bacteria | 4818 |
| 645 | Ga0501036_0031801 | 3300049572 | Bacteria | 4458 |
| 646 | Ga0501036_0032087 | 3300049572 | Bacteria | 4437 |
| 647 | Ga0501036_0050927 | 3300049572 | Bacteria | 3506 |
| 648 | Ga0501037_0015609 | 3300049573 | Bacteria | 5589 |
| 649 | Ga0501037_0080388 | 3300049573 | Bacteria | 2365 |
| 650 | Ga0501037_0117402 | 3300049573 | Bacteria | 1914 |
| 651 | Ga0501037_0136355 | 3300049573 | Bacteria | 1758 |
| 652 | Ga0501037_0209933 | 3300049573 | Unclassified | 1373 |
| 653 | Ga0501038_0001109 | 3300049574 | Bacteria | 24402 |
| 654 | Ga0501038_0003531 | 3300049574 | Bacteria | 14553 |
| 655 | Ga0501038_0014002 | 3300049574 | Bacteria | 7310 |
| 656 | Ga0501038_0053866 | 3300049574 | Bacteria | 3461 |
| 657 | Ga0501038_0076264 | 3300049574 | Bacteria | 2832 |
| 658 | Ga0501038_0224301 | 3300049574 | Bacteria | 1498 |
| 659 | Ga0501039_0015991 | 3300049575 | Bacteria | 5745 |
| 660 | Ga0501039_0020033 | 3300049575 | Bacteria | 5127 |
| 661 | Ga0501039_0022710 | 3300049575 | Bacteria | 4814 |
| 662 | Ga0501039_0059797 | 3300049575 | Bacteria | 2951 |
| 663 | Ga0501039_0218934 | 3300049575 | Bacteria | 1497 |
| 664 | Ga0501040_0001909 | 3300049576 | Bacteria | 13402 |
| 665 | Ga0501041_0007568 | 3300049577 | Bacteria | 6378 |
| 666 | Ga0501041_0010527 | 3300049577 | Bacteria | 5452 |
| 667 | Ga0501042_0000383 | 3300049578 | Bacteria | 22452 |
| 668 | Ga0501042_0237166 | 3300049578 | Bacteria | 1316 |
| 669 | Ga0501043_0000027 | 3300049579 | Bacteria | 144685 |
| 670 | Ga0501043_0002821 | 3300049579 | Bacteria | 14532 |
| 671 | Ga0501043_0004264 | 3300049579 | Bacteria | 11645 |
| 672 | Ga0501043_0052312 | 3300049579 | Bacteria | 3208 |
| 673 | Ga0501043_0136476 | 3300049579 | Bacteria | 1921 |
| 674 | Ga0501046_0000034 | 3300049580 | Bacteria | 173742 |
| 675 | Ga0501046_0001197 | 3300049580 | Bacteria | 25219 |
| 676 | Ga0501046_0002832 | 3300049580 | Bacteria | 16136 |
| 677 | Ga0501046_0015650 | 3300049580 | Bacteria | 6369 |
| 678 | Ga0501046_0029937 | 3300049580 | Bacteria | 4423 |
| 679 | Ga0501046_0046996 | 3300049580 | Bacteria | 3424 |
| 680 | Ga0501046_0049945 | 3300049580 | Bacteria | 3306 |
| 681 | Ga0501047_0000042 | 3300049581 | Bacteria | 176603 |
| 682 | Ga0501047_0001297 | 3300049581 | Bacteria | 24634 |
| 683 | Ga0501047_0001508 | 3300049581 | Bacteria | 22710 |
| 684 | Ga0501047_0003796 | 3300049581 | Bacteria | 14208 |
| 685 | Ga0501047_0032228 | 3300049581 | Bacteria | 5058 |
| 686 | Ga0501047_0038275 | 3300049581 | Bacteria | 4640 |
| 687 | Ga0501047_0139176 | 3300049581 | Bacteria | 2306 |
| 688 | Ga0501047_0161965 | 3300049581 | Bacteria | 2109 |
| 689 | Ga0501047_0254501 | 3300049581 | Bacteria | 1604 |
| 690 | Ga0501048_0000019 | 3300049582 | Bacteria | 71064 |
| 691 | Ga0501048_0000151 | 3300049582 | Bacteria | 42561 |
| 692 | Ga0501048_0010770 | 3300049582 | Bacteria | 6818 |
| 693 | Ga0501048_0058178 | 3300049582 | Bacteria | 2740 |
| 694 | Ga0501048_0064163 | 3300049582 | Bacteria | 2598 |
| 695 | Ga0501067_0017968 | 3300049583 | Bacteria | 3916 |
| 696 | Ga0501067_0030791 | 3300049583 | Bacteria | 2977 |
| 697 | Ga0501067_0054640 | 3300049583 | Bacteria | 2212 |
| 698 | Ga0501068_0005410 | 3300049584 | Bacteria | 6985 |
| 699 | Ga0501068_0010972 | 3300049584 | Bacteria | 5100 |
| 700 | Ga0501068_0020932 | 3300049584 | Bacteria | 3817 |
| 701 | Ga0501069_0028398 | 3300049585 | Bacteria | 3067 |
| 702 | Ga0501069_0087357 | 3300049585 | Bacteria | 1761 |
| 703 | Ga0501069_0108210 | 3300049585 | Unclassified | 1581 |
| 704 | Ga0501070_0006477 | 3300049586 | Bacteria | 9967 |
| 705 | Ga0501070_0007769 | 3300049586 | Bacteria | 9092 |
| 706 | Ga0501070_0014067 | 3300049586 | Bacteria | 6737 |
| 707 | Ga0501070_0041930 | 3300049586 | Bacteria | 3811 |
| 708 | Ga0501070_0043411 | 3300049586 | Bacteria | 3741 |
| 709 | Ga0501070_0044878 | 3300049586 | Bacteria | 3676 |
| 710 | Ga0501070_0119877 | 3300049586 | Bacteria | 2174 |
| 711 | Ga0501071_0032712 | 3300049587 | Bacteria | 3694 |
| 712 | Ga0501071_0059340 | 3300049587 | Bacteria | 2768 |
| 713 | Ga0501071_0108130 | 3300049587 | Bacteria | 2054 |
| 714 | Ga0501072_0002470 | 3300049588 | Bacteria | 13847 |
| 715 | Ga0501072_0026350 | 3300049588 | Bacteria | 4533 |
| 716 | Ga0501072_0032599 | 3300049588 | Bacteria | 4080 |
| 717 | Ga0501072_0160691 | 3300049588 | Bacteria | 1792 |
| 718 | Ga0501072_0185864 | 3300049588 | Unclassified | 1658 |
| 719 | Ga0501072_0243389 | 3300049588 | Bacteria | 1433 |
| 720 | Ga0501073_0001397 | 3300049589 | Bacteria | 17807 |
| 721 | Ga0501073_0009222 | 3300049589 | Bacteria | 7275 |
| 722 | Ga0501073_0013135 | 3300049589 | Bacteria | 6037 |
| 723 | Ga0501073_0048934 | 3300049589 | Bacteria | 2965 |
| 724 | Ga0501073_0076220 | 3300049589 | Bacteria | 2333 |
| 725 | Ga0501073_0121918 | 3300049589 | Bacteria | 1807 |
| 726 | Ga0501073_0179998 | 3300049589 | Bacteria | 1463 |
| 727 | Ga0501074_0001516 | 3300049590 | Bacteria | 15686 |
| 728 | Ga0501074_0018041 | 3300049590 | Bacteria | 5126 |
| 729 | Ga0501074_0019723 | 3300049590 | Bacteria | 4896 |
| 730 | Ga0501074_0033428 | 3300049590 | Bacteria | 3726 |
| 731 | Ga0501074_0058715 | 3300049590 | Bacteria | 2771 |
| 732 | Ga0501074_0238304 | 3300049590 | Bacteria | 1294 |
| 733 | Ga0501075_0000525 | 3300049591 | Bacteria | 23161 |
| 734 | Ga0501076_0013583 | 3300049592 | Bacteria | 6108 |
| 735 | Ga0501076_0085370 | 3300049592 | Bacteria | 2537 |
| 736 | Ga0501077_0006058 | 3300049593 | Bacteria | 7381 |
| 737 | Ga0501079_0000625 | 3300049741 | Bacteria | 23469 |
| 738 | Ga0501079_0002303 | 3300049741 | Bacteria | 13814 |
| 739 | Ga0501079_0037452 | 3300049741 | Bacteria | 3738 |
| 740 | Ga0501080_0000130 | 3300049742 | Bacteria | 53465 |
| 741 | Ga0501080_0003305 | 3300049742 | Bacteria | 14252 |
| 742 | Ga0501080_0004495 | 3300049742 | Bacteria | 12429 |
| 743 | Ga0501080_0013629 | 3300049742 | Bacteria | 7486 |
| 744 | Ga0501080_0048054 | 3300049742 | Bacteria | 3972 |
| 745 | Ga0501080_0051065 | 3300049742 | Bacteria | 3846 |
| 746 | Ga0501080_0052289 | 3300049742 | Bacteria | 3802 |
| 747 | Ga0501080_0056885 | 3300049742 | Bacteria | 3641 |
| 748 | Ga0501080_0079937 | 3300049742 | Bacteria | 3039 |
| 749 | Ga0501081_0000055 | 3300049743 | Bacteria | 43227 |
| 750 | Ga0501081_0001663 | 3300049743 | Bacteria | 13751 |
| 751 | Ga0501083_0002779 | 3300049744 | Bacteria | 12096 |
| 752 | Ga0501083_0003894 | 3300049744 | Bacteria | 10486 |
| 753 | Ga0501083_0017232 | 3300049744 | Bacteria | 5036 |
| 754 | Ga0501083_0039248 | 3300049744 | Bacteria | 3216 |
| 755 | Ga0501083_0056255 | 3300049744 | Bacteria | 2636 |
| 756 | Ga0501083_0069452 | 3300049744 | Bacteria | 2344 |
| 757 | Ga0501083_0135529 | 3300049744 | Bacteria | 1613 |
| 758 | Ga0501035_0018873 | 3300049822 | Bacteria | 6354 |
| 759 | Ga0501035_0037832 | 3300049822 | Bacteria | 4367 |
| 760 | Ga0501035_0042121 | 3300049822 | Bacteria | 4119 |
| 761 | Ga0501035_0044729 | 3300049822 | Bacteria | 3985 |
| 762 | Ga0501035_0166755 | 3300049822 | Bacteria | 1904 |
| 763 | Ga0501035_0315224 | 3300049822 | Bacteria | 1315 |
| 764 | Ga0501044_0000636 | 3300049823 | Bacteria | 42394 |
| 765 | Ga0501044_0006986 | 3300049823 | Bacteria | 12419 |
| 766 | Ga0501044_0029378 | 3300049823 | Bacteria | 5797 |
| 767 | Ga0501044_0095165 | 3300049823 | Bacteria | 3002 |
| 768 | Ga0501044_0134975 | 3300049823 | Bacteria | 2459 |
| 769 | Ga0501044_0155313 | 3300049823 | Bacteria | 2268 |
| 770 | Ga0501044_0204794 | 3300049823 | Bacteria | 1930 |
| 771 | Ga0501044_0226753 | 3300049823 | Bacteria | 1818 |
| 772 | Ga0501045_0000901 | 3300049824 | Bacteria | 19335 |
| 773 | Ga0501045_0006559 | 3300049824 | Bacteria | 8067 |
| 774 | Ga0501045_0041865 | 3300049824 | Bacteria | 3333 |
| 775 | nmdc:mga0n895_114609_c1 | 3300050512 | Bacteria | 2713 |
| 776 | nmdc:mga0n895_199802_c1 | 3300050512 | Bacteria | 2030 |
| 777 | nmdc:mga0rr50_464137_c1 | 3300050513 | Bacteria | 1074 |
| 778 | nmdc:mga08x19_90949_c1 | 3300050514 | Bacteria | 2014 |
| 779 | nmdc:mga0a205_103402_c1 | 3300050515 | Bacteria | 2747 |
| 780 | Ga0495601_0120341 | 3300053077 | Bacteria | 1705 |
| 781 | Ga0495619_0012269 | 3300053085 | Bacteria | 5391 |
| 782 | Ga0495619_0231197 | 3300053085 | Bacteria | 1281 |
| 783 | Ga0501084_0021611 | 3300054114 | Bacteria | 5365 |
| 784 | Ga0501084_0040400 | 3300054114 | Bacteria | 3902 |
| 785 | Ga0501082_0084604 | 3300060353 | Bacteria | 2735 |
| 786 | Ga0501082_0166194 | 3300060353 | Bacteria | 1917 |
| 787 | Ga0501082_0179078 | 3300060353 | Bacteria | 1843 |
| 788 | Ga0466962_0027029 | 3300061719 | Bacteria | 2755 |
| 789 | Ga0530510_0001004 | 3300061734 | Bacteria | 18744 |
| 790 | 2842334280 | 2842333319 | Bacteria | 8899485 |
| 791 | Ga0451853_0472856 | |||
| 792 | Ga0070658_10014541 | |||
| 793 | Ga0070658_10045275 | |||
| 794 | Ga0070658_10066518 | |||
| 795 | Ga0070658_10084139 | |||
| 796 | Ga0070658_10148900 | |||
| 797 | Ga0070658_10150053 | |||
| 798 | Ga0070658_10290901 | |||
| 799 | Ga0070658_10352531 | |||
| 800 | Ga0070676_10318666 | |||
| 801 | Ga0070683_100014342 | |||
| 802 | Ga0070683_100040826 | |||
| 803 | Ga0070683_100057081 | |||
| 804 | Ga0070683_100066241 | |||
| 805 | Ga0070670_100031458 | |||
| 806 | Ga0068869_100048924 | |||
| 807 | Ga0068869_100268493 | |||
| 808 | Ga0070666_10016572 | |||
| 809 | Ga0070666_10043621 | |||
| 810 | Ga0070680_100001220 | |||
| 811 | Ga0070680_100069611 | |||
| 812 | Ga0070680_100087094 | |||
| 813 | Ga0070680_100116886 | |||
| 814 | Ga0070680_100180216 | |||
| 815 | Ga0070682_100010676 | |||
| 816 | Ga0068868_100029461 | |||
| 817 | Ga0068868_100080936 | |||
| 818 | Ga0070660_100003047 | |||
| 819 | Ga0070660_100011210 | |||
| 820 | Ga0070660_100030341 | |||
| 821 | Ga0070660_100048387 | |||
| 822 | Ga0070689_100014168 | |||
| 823 | Ga0070661_100000659 | |||
| 824 | Ga0070661_100007548 | |||
| 825 | Ga0070661_100033091 | |||
| 826 | Ga0070661_100042473 | |||
| 827 | Ga0070661_100099671 | |||
| 828 | Ga0070661_100136587 | |||
| 829 | Ga0070661_100172373 | |||
| 830 | Ga0070692_10008294 | |||
| 831 | Ga0070692_10024640 | |||
| 832 | Ga0070692_10094067 | |||
| 833 | Ga0070669_100034654 | |||
| 834 | Ga0070669_100039097 | |||
| 835 | Ga0070669_100105699 | |||
| 836 | Ga0070675_100043993 | |||
| 837 | Ga0070675_100287990 | |||
| 838 | Ga0070671_100085165 | |||
| 839 | Ga0070671_100099897 | |||
| 840 | Ga0070671_100169857 | |||
| 841 | Ga0070671_100220556 | |||
| 842 | Ga0070673_100005875 | |||
| 843 | Ga0070673_100039404 | |||
| 844 | Ga0070673_100086495 | |||
| 845 | Ga0070673_100307100 | |||
| 846 | Ga0070659_100002518 | |||
| 847 | Ga0070659_100021894 | |||
| 848 | Ga0070659_100081540 | |||
| 849 | Ga0070659_100127068 | |||
| 850 | Ga0070659_100356057 | |||
| 851 | Ga0070667_100097949 | |||
| 852 | Ga0070667_100322768 | |||
| 853 | Ga0070709_10039869 | |||
| 854 | Ga0070709_10163923 | |||
| 855 | Ga0070709_10258352 | |||
| 856 | Ga0070714_100001230 | |||
| 857 | Ga0070714_100012985 | |||
| 858 | Ga0070714_100040709 | |||
| 859 | Ga0070714_100176106 | |||
| 860 | Ga0070714_100327199 | |||
| 861 | Ga0070714_100441690 | |||
| 862 | Ga0070713_100041327 | |||
| 863 | Ga0070713_100044368 | |||
| 864 | Ga0070713_100068647 | |||
| 865 | Ga0070710_10023720 | |||
| 866 | Ga0070701_10108773 | |||
| 867 | Ga0070711_100019511 | |||
| 868 | Ga0070711_100057157 | |||
| 869 | Ga0070694_100120685 | |||
| 870 | Ga0070708_100442065 | |||
| 871 | Ga0070663_100002206 | |||
| 872 | Ga0070663_100037714 | |||
| 873 | Ga0070663_100054756 | |||
| 874 | Ga0070663_100141109 | |||
| 875 | Ga0070663_100192566 | |||
| 876 | Ga0070663_100280446 | |||
| 877 | Ga0070678_100146298 | |||
| 878 | Ga0070662_100002542 | |||
| 879 | Ga0070662_100082196 | |||
| 880 | Ga0070681_10006079 | |||
| 881 | Ga0070681_10017264 | |||
| 882 | Ga0070681_10032524 | |||
| 883 | Ga0070681_10051174 | |||
| 884 | Ga0070681_10065111 | |||
| 885 | Ga0070681_10081150 | |||
| 886 | Ga0070681_10137047 | |||
| 887 | Ga0070681_10247713 | |||
| 888 | Ga0070681_10330544 | |||
| 889 | Ga0068867_100100841 | |||
| 890 | Ga0070685_10009162 | |||
| 891 | Ga0070707_100252846 | |||
| 892 | Ga0070699_100062841 | |||
| 893 | Ga0070699_100091987 | |||
| 894 | Ga0070699_100108419 | |||
| 895 | Ga0070679_100002223 | |||
| 896 | Ga0070679_100012385 | |||
| 897 | Ga0070679_100012464 | |||
| 898 | Ga0070679_100022596 | |||
| 899 | Ga0070679_100028486 | |||
| 900 | Ga0070679_100035984 | |||
| 901 | Ga0070679_100039760 | |||
| 902 | Ga0070679_100048642 | |||
| 903 | Ga0070679_100049521 | |||
| 904 | Ga0070679_100072269 | |||
| 905 | Ga0070679_100127957 | |||
| 906 | Ga0070679_100178799 | |||
| 907 | Ga0070684_100028079 | |||
| 908 | Ga0070684_100032759 | |||
| 909 | Ga0070684_100049016 | |||
| 910 | Ga0068853_100015209 | |||
| 911 | Ga0068853_100029855 | |||
| 912 | Ga0068853_100065040 | |||
| 913 | Ga0070672_100057825 | |||
| 914 | Ga0070672_100268665 | |||
| 915 | Ga0070686_100290249 | |||
| 916 | Ga0070695_100134142 | |||
| 917 | Ga0070696_100000647 | |||
| 918 | Ga0070665_100038962 | |||
| 919 | Ga0068855_100006103 | |||
| 920 | Ga0068855_100007555 | |||
| 921 | Ga0068855_100022104 | |||
| 922 | Ga0068855_100069451 | |||
| 923 | Ga0068855_100069463 | |||
| 924 | Ga0068855_100075173 | |||
| 925 | Ga0068855_100090119 | |||
| 926 | Ga0070664_100000157 | |||
| 927 | Ga0070664_100000662 | |||
| 928 | Ga0070664_100015295 | |||
| 929 | Ga0070664_100042978 | |||
| 930 | Ga0070664_100058072 | |||
| 931 | Ga0070664_100196445 | |||
| 932 | Ga0070664_100229350 | |||
| 933 | Ga0068857_100002118 | |||
| 934 | Ga0068857_100009373 | |||
| 935 | Ga0068857_100099262 | |||
| 936 | Ga0068857_100129709 | |||
| 937 | Ga0068857_100196197 | |||
| 938 | Ga0068854_100005030 | |||
| 939 | Ga0068854_100020694 | |||
| 940 | Ga0068854_100031708 | |||
| 941 | Ga0068854_100039623 | |||
| 942 | Ga0068854_100080306 | |||
| 943 | Ga0068854_100090917 | |||
| 944 | Ga0068854_100157923 | |||
| 945 | Ga0068854_100227271 | |||
| 946 | Ga0068856_100003357 | |||
| 947 | Ga0068856_100007224 | |||
| 948 | Ga0068856_100056804 | |||
| 949 | Ga0068856_100112135 | |||
| 950 | Ga0068856_100197242 | |||
| 951 | Ga0068856_100422660 | |||
| 952 | Ga0070702_100008195 | |||
| 953 | Ga0068852_100000826 | |||
| 954 | Ga0068852_100001041 | |||
| 955 | Ga0068852_100005593 | |||
| 956 | Ga0068859_100135280 | |||
| 957 | Ga0068859_100192282 | |||
| 958 | Ga0068864_100000836 | |||
| 959 | Ga0068864_100212286 | |||
| 960 | Ga0068866_10003875 | |||
| 961 | Ga0068861_100327556 | |||
| 962 | Ga0068851_10008632 | |||
| 963 | Ga0068851_10020864 | |||
| 964 | Ga0068863_100060640 | |||
| 965 | Ga0068863_100090905 | |||
| 966 | Ga0068863_100398513 | |||
| 967 | Ga0068858_100002758 | |||
| 968 | Ga0068858_100084407 | |||
| 969 | Ga0068860_100023120 | |||
| 970 | Ga0068860_100156887 | |||
| 971 | Ga0070717_10332334 | |||
| 972 | Ga0070717_10333586 | |||
| 973 | Ga0070715_10021078 | |||
| 974 | Ga0070715_10061509 | |||
| 975 | Ga0070712_100007146 | |||
| 976 | Ga0070712_100234637 | |||
| 977 | Ga0097621_100068335 | |||
| 978 | Ga0097621_100220087 | |||
| 979 | Ga0068871_100075121 | |||
| 980 | Ga0068871_100181398 | |||
| 981 | Ga0068871_100183372 | |||
| 982 | Ga0068871_100460020 | |||
| 983 | Ga0075428_100017431 | |||
| 984 | Ga0075434_100062690 | |||
| 985 | Ga0075434_100106255 | |||
| 986 | Ga0068865_100085004 | |||
| 987 | Ga0075436_100040552 | |||
| 988 | Ga0075436_100093243 | |||
| 989 | Ga0097620_100135272 | |||
| 990 | Ga0097620_100192285 | |||
| 991 | Ga0075435_100385480 | |||
| 992 | Ga0099795_10054122 | |||
| 993 | Ga0105240_10004865 | |||
| 994 | Ga0105240_10006057 | |||
| 995 | Ga0105240_10007716 | |||
| 996 | Ga0105240_10007858 | |||
| 997 | Ga0105240_10017051 | |||
| 998 | Ga0105240_10018681 | |||
| 999 | Ga0105240_10041376 | |||
| 1000 | Ga0105240_10104066 | |||
| 1001 | Ga0105240_10171461 | |||
| 1002 | Ga0105240_10458322 | |||
| 1003 | Ga0105245_10019049 | |||
| 1004 | Ga0105245_10023939 | |||
| 1005 | Ga0105245_10035739 | |||
| 1006 | Ga0105241_10008874 | |||
| 1007 | Ga0105242_10061250 | |||
| 1008 | Ga0105248_10001643 | |||
| 1009 | Ga0105237_10008781 | |||
| 1010 | Ga0105237_10094865 | |||
| 1011 | Ga0105237_10552263 | |||
| 1012 | Ga0105238_10000203 | |||
| 1013 | Ga0105238_10005300 | |||
| 1014 | Ga0105238_10015654 | |||
| 1015 | Ga0105238_10022170 | |||
| 1016 | Ga0105238_10025071 | |||
| 1017 | Ga0105238_10223875 | |||
| 1018 | Ga0105239_10093277 | |||
| 1019 | Ga0105239_10323087 | |||
| 1020 | Ga0105239_10748449 | |||
| 1021 | Ga0105246_10069127 | |||
| 1022 | Ga0157373_10001573 | |||
| 1023 | Ga0157373_10016974 | |||
| 1024 | Ga0157373_10032306 | |||
| 1025 | Ga0157373_10047841 | |||
| 1026 | Ga0157373_10068387 | |||
| 1027 | Ga0157373_10101786 | |||
| 1028 | Ga0157373_10107530 | |||
| 1029 | Ga0157373_10148394 | |||
| 1030 | Ga0157371_10002592 | |||
| 1031 | Ga0157371_10016262 | |||
| 1032 | Ga0157371_10127408 | |||
| 1033 | Ga0157370_10001120 | |||
| 1034 | Ga0157370_10002318 | |||
| 1035 | Ga0157370_10010117 | |||
| 1036 | Ga0157370_10015498 | |||
| 1037 | Ga0157370_10028168 | |||
| 1038 | Ga0157370_10053733 | |||
| 1039 | Ga0157370_10073398 | |||
| 1040 | Ga0157370_10078279 | |||
| 1041 | Ga0157370_10087886 | |||
| 1042 | Ga0157370_10090588 | |||
| 1043 | Ga0157370_10224140 | |||
| 1044 | Ga0157369_10004919 | |||
| 1045 | Ga0157369_10008031 | |||
| 1046 | Ga0157369_10018830 | |||
| 1047 | Ga0157369_10054805 | |||
| 1048 | Ga0157369_10137759 | |||
| 1049 | Ga0157369_10232238 | |||
| 1050 | Ga0157374_10003153 | |||
| 1051 | Ga0157374_10125525 | |||
| 1052 | Ga0157378_10066491 | |||
| 1053 | Ga0157378_10120977 | |||
| 1054 | Ga0157378_10403246 | |||
| 1055 | Ga0163162_10024159 | |||
| 1056 | Ga0163162_10041753 | |||
| 1057 | Ga0163162_10047261 | |||
| 1058 | Ga0163162_10065671 | |||
| 1059 | Ga0163162_10072223 | |||
| 1060 | Ga0157372_10001409 | |||
| 1061 | Ga0157372_10004130 | |||
| 1062 | Ga0157372_10007797 | |||
| 1063 | Ga0157372_10009719 | |||
| 1064 | Ga0157372_10019156 | |||
| 1065 | Ga0157372_10132532 | |||
| 1066 | Ga0157375_10032094 | |||
| 1067 | Ga0157375_10130879 | |||
| 1068 | Ga0163163_10031646 | |||
| 1069 | Ga0157380_10442143 | |||
| 1070 | Ga0157380_10482403 | |||
| 1071 | Ga0157377_10175814 | |||
| 1072 | Ga0157376_10006216 | |||
| 1073 | Ga0157376_10207725 | |||
| 1074 | Ga0182005_1031178 | |||
| 1075 | Ga0163161_10022924 | |||
| 1076 | Ga0163161_10157182 | |||
| 1077 | Ga0207680_10121218 | |||
| 1078 | Ga0207699_10141582 | |||
| 1079 | Ga0207643_10059517 | |||
| 1080 | Ga0207705_10008790 | |||
| 1081 | Ga0207705_10020178 | |||
| 1082 | Ga0207705_10026329 | |||
| 1083 | Ga0207705_10094523 | |||
| 1084 | Ga0207705_10202618 | |||
| 1085 | Ga0207654_10013056 | |||
| 1086 | Ga0207654_10054982 | |||
| 1087 | Ga0207707_10016373 | |||
| 1088 | Ga0207707_10034346 | |||
| 1089 | Ga0207707_10035990 | |||
| 1090 | Ga0207707_10108112 | |||
| 1091 | Ga0207707_10172045 | |||
| 1092 | Ga0207707_10323393 | |||
| 1093 | Ga0207695_10016171 | |||
| 1094 | Ga0207695_10043015 | |||
| 1095 | Ga0207695_10049717 | |||
| 1096 | Ga0207695_10051599 | |||
| 1097 | Ga0207695_10091139 | |||
| 1098 | Ga0207695_10150764 | |||
| 1099 | Ga0207695_10151078 | |||
| 1100 | Ga0207671_10169164 | |||
| 1101 | Ga0207671_10202165 | |||
| 1102 | Ga0207693_10201414 | |||
| 1103 | Ga0207660_10000918 | |||
| 1104 | Ga0207660_10022899 | |||
| 1105 | Ga0207660_10036379 | |||
| 1106 | Ga0207660_10095436 | |||
| 1107 | Ga0207660_10176045 | |||
| 1108 | Ga0207660_10404312 | |||
| 1109 | Ga0207662_10096609 | |||
| 1110 | Ga0207657_10000586 | |||
| 1111 | Ga0207657_10002457 | |||
| 1112 | Ga0207657_10009562 | |||
| 1113 | Ga0207657_10041288 | |||
| 1114 | Ga0207657_10058693 | |||
| 1115 | Ga0207657_10063624 | |||
| 1116 | Ga0207657_10091926 | |||
| 1117 | Ga0207649_10003878 | |||
| 1118 | Ga0207649_10015963 | |||
| 1119 | Ga0207649_10031357 | |||
| 1120 | Ga0207649_10032416 | |||
| 1121 | Ga0207649_10132484 | |||
| 1122 | Ga0207649_10166363 | |||
| 1123 | Ga0207652_10004936 | |||
| 1124 | Ga0207652_10022926 | |||
| 1125 | Ga0207652_10029509 | |||
| 1126 | Ga0207652_10035307 | |||
| 1127 | Ga0207652_10039342 | |||
| 1128 | Ga0207652_10094577 | |||
| 1129 | Ga0207652_10099129 | |||
| 1130 | Ga0207652_10155956 | |||
| 1131 | Ga0207652_10405137 | |||
| 1132 | Ga0207652_10484790 | |||
| 1133 | Ga0207646_10025356 | |||
| 1134 | Ga0207681_10115047 | |||
| 1135 | Ga0207694_10006781 | |||
| 1136 | Ga0207694_10010483 | |||
| 1137 | Ga0207694_10014521 | |||
| 1138 | Ga0207694_10029612 | |||
| 1139 | Ga0207694_10206536 | |||
| 1140 | Ga0207659_10071014 | |||
| 1141 | Ga0207687_10002728 | |||
| 1142 | Ga0207687_10028131 | |||
| 1143 | Ga0207687_10034278 | |||
| 1144 | Ga0207700_10017425 | |||
| 1145 | Ga0207700_10048370 | |||
| 1146 | Ga0207664_10008038 | |||
| 1147 | Ga0207664_10044232 | |||
| 1148 | Ga0207644_10002797 | |||
| 1149 | Ga0207644_10008406 | |||
| 1150 | Ga0207644_10177909 | |||
| 1151 | Ga0207644_10196837 | |||
| 1152 | Ga0207690_10013365 | |||
| 1153 | Ga0207690_10055002 | |||
| 1154 | Ga0207690_10328266 | |||
| 1155 | Ga0207706_10002770 | |||
| 1156 | Ga0207706_10021790 | |||
| 1157 | Ga0207686_10218872 | |||
| 1158 | Ga0207670_10014556 | |||
| 1159 | Ga0207669_10041984 | |||
| 1160 | Ga0207665_10019599 | |||
| 1161 | Ga0207665_10036446 | |||
| 1162 | Ga0207665_10076841 | |||
| 1163 | Ga0207691_10010545 | |||
| 1164 | Ga0207691_10067598 | |||
| 1165 | Ga0207691_10238336 | |||
| 1166 | Ga0207711_10000116 | |||
| 1167 | Ga0207711_10007075 | |||
| 1168 | Ga0207689_10038570 | |||
| 1169 | Ga0207661_10011082 | |||
| 1170 | Ga0207661_10014956 | |||
| 1171 | Ga0207661_10163354 | |||
| 1172 | Ga0207679_10003482 | |||
| 1173 | Ga0207679_10006427 | |||
| 1174 | Ga0207679_10012754 | |||
| 1175 | Ga0207679_10022679 | |||
| 1176 | Ga0207679_10025964 | |||
| 1177 | Ga0207679_10042623 | |||
| 1178 | Ga0207679_10154420 | |||
| 1179 | Ga0207679_10253156 | |||
| 1180 | Ga0207679_10269379 | |||
| 1181 | Ga0207667_10000425 | |||
| 1182 | Ga0207667_10009574 | |||
| 1183 | Ga0207667_10015677 | |||
| 1184 | Ga0207667_10041828 | |||
| 1185 | Ga0207667_10065965 | |||
| 1186 | Ga0207667_10094825 | |||
| 1187 | Ga0207667_10107077 | |||
| 1188 | Ga0207667_10122191 | |||
| 1189 | Ga0207667_10261083 | |||
| 1190 | Ga0207667_10346379 | |||
| 1191 | Ga0207651_10015223 | |||
| 1192 | Ga0207651_10052444 | |||
| 1193 | Ga0207640_10070754 | |||
| 1194 | Ga0207658_10122137 | |||
| 1195 | Ga0207658_10174695 | |||
| 1196 | Ga0207658_10299886 | |||
| 1197 | Ga0207677_10000188 | |||
| 1198 | Ga0207703_10000806 | |||
| 1199 | Ga0207639_10048427 | |||
| 1200 | Ga0207639_10054697 | |||
| 1201 | Ga0207639_10087916 | |||
| 1202 | Ga0207639_10202390 | |||
| 1203 | Ga0207678_10005045 | |||
| 1204 | Ga0207678_10016867 | |||
| 1205 | Ga0207678_10080029 | |||
| 1206 | Ga0207678_10094111 | |||
| 1207 | Ga0207702_10002758 | |||
| 1208 | Ga0207702_10002944 | |||
| 1209 | Ga0207702_10024530 | |||
| 1210 | Ga0207702_10042863 | |||
| 1211 | Ga0207702_10052623 | |||
| 1212 | Ga0207702_10354713 | |||
| 1213 | Ga0207641_10027731 | |||
| 1214 | Ga0207641_10037558 | |||
| 1215 | Ga0207648_10042104 | |||
| 1216 | Ga0207648_10054451 | |||
| 1217 | Ga0207648_10068843 | |||
| 1218 | Ga0207676_10000230 | |||
| 1219 | Ga0207676_10122612 | |||
| 1220 | Ga0207674_10000301 | |||
| 1221 | Ga0207674_10000593 | |||
| 1222 | Ga0207674_10024546 | |||
| 1223 | Ga0207674_10142081 | |||
| 1224 | Ga0207675_100057058 | |||
| 1225 | Ga0207675_100090794 | |||
| 1226 | Ga0207683_10001896 | |||
| 1227 | Ga0207683_10089782 | |||
| 1228 | Ga0207683_10248322 | |||
| 1229 | Ga0207698_10001265 | |||
| 1230 | Ga0207698_10134925 | |||
| 1231 | Ga0207698_10171428 | |||
| 1232 | Ga0209995_1004512 | |||
| 1233 | Ga0209970_1000330 | |||
| 1234 | Ga0209983_1003253 | |||
| 1235 | Ga0209971_1002990 | |||
| 1236 | Ga0209971_1023720 | |||
| 1237 | Ga0209966_1001960 | |||
| 1238 | Ga0209974_10000515 | |||
| 1239 | Ga0209974_10028705 | |||
| 1240 | Ga0268266_10041432 | |||
| 1241 | Ga0268264_10025840 | |||
| 1242 | Ga0268264_10092651 | |||
| 1243 | Ga0268264_10131145 | |||
| 1244 | Ga0307408_100026386 | |||
| 1245 | Ga0307408_100060833 | |||
| 1246 | Ga0307408_100118759 | |||
| 1247 | Ga0307413_10110370 | |||
| 1248 | Ga0307413_10145003 | |||
| 1249 | Ga0307410_10026531 | |||
| 1250 | Ga0307410_10031925 | |||
| 1251 | Ga0307406_10029752 | |||
| 1252 | Ga0307406_10031045 | |||
| 1253 | Ga0307412_10039145 | |||
| 1254 | Ga0307409_100019041 | |||
| 1255 | Ga0307409_100042722 | |||
| 1256 | Ga0307416_100115009 | |||
| 1257 | Ga0307416_100390291 | |||
| 1258 | Ga0307416_100539113 | |||
| 1259 | Ga0307414_10050934 | |||
| 1260 | Ga0307414_10074883 | |||
| 1261 | Ga0307411_10017682 | |||
| 1262 | Ga0307411_10306632 | |||
| 1263 | Ga0307415_100103075 | |||
| 1264 | Ga0373934_0012408 | |||
| 1265 | Ga0373944_0003249 | |||
| 1266 | Ga0373936_0004509 | |||
| 1267 | Ga0373941_0003011 | |||
| 1268 | Ga0373945_0066334 | |||
| 1269 | Ga0373953_0006271 | |||
| 1270 | Ga0373954_0016093 | |||
| 1271 | Ga0373957_0067105 | |||
| 1272 | Ga0373943_0007550 | |||
| 1273 | Ga0373946_0002403 | |||
| 1274 | Ga0373946_0092826 | |||
| 1275 | Ga0373955_0036180 | |||
| 1276 | Ga0373924_0040791 | |||
| 1277 | Ga0373935_0004641 | |||
| 1278 | Ga0373935_0019629 | |||
| 1279 | Ga0373935_0089392 | |||
| 1280 | Ga0373935_0220427 | |||
| 1281 | Ga0373927_0006549 | |||
| 1282 | Ga0373927_0058721 | |||
| 1283 | Ga0373927_0157603 | |||
| 1284 | Ga0373933_0029862 | |||
| 1285 | Ga0373947_0023666 | |||
| 1286 | Ga0373947_0025712 | |||
| 1287 | Ga0373947_0209163 | |||
| 1288 | Ga0373937_0023672 | |||
| 1289 | Ga0373937_0122387 | |||
| 1290 | Ga0373937_0128829 | |||
| 1291 | Ga0373937_0180020 | |||
| 1292 | Ga0373925_0011332 | |||
| 1293 | Ga0373925_0013181 | |||
| 1294 | Ga0395899_0000216 | |||
| 1295 | Ga0395899_0003355 | |||
| 1296 | Ga0395899_0084595 | |||
| 1297 | Ga0395899_0135320 | |||
| 1298 | Ga0395900_0002787 | |||
| 1299 | Ga0395900_0003035 | |||
| 1300 | Ga0395900_0355701 | |||
| 1301 | Ga0395900_0462376 | |||
| 1302 | Ga0395898_0008265 | |||
| 1303 | Ga0395898_0040854 | |||
| 1304 | Ga0395898_0155032 | |||
| 1305 | Ga0395905_0054144 | |||
| 1306 | Ga0395905_0290944 | |||
| 1307 | Ga0395905_0292481 | |||
| 1308 | Ga0395901_0000420 | |||
| 1309 | Ga0395901_0011350 | |||
| 1310 | Ga0395901_0197827 | |||
| 1311 | Ga0395901_0282382 | |||
| 1312 | Ga0466966_0025687 | |||
| 1313 | Ga0466966_0045290 | |||
| 1314 | Ga0466961_0090581 | |||
| 1315 | Ga0466963_0051494 | |||
| 1316 | Ga0466963_0078451 | |||
| 1317 | Ga0466963_0164095 | |||
| 1318 | Ga0466957_0002655 | |||
| 1319 | Ga0466957_0006402 | |||
| 1320 | Ga0466959_0078420 | |||
| 1321 | Ga0466959_0165712 | |||
| 1322 | Ga0466958_0038992 | |||
| 1323 | Ga0466967_0504161 | |||
| 1324 | Ga0495627_006947 | |||
| 1325 | Ga0495603_0057426 | |||
| 1326 | Ga0495629_0018061 | |||
| 1327 | Ga0495629_0215474 | |||
| 1328 | Ga0495638_0004189 | |||
| 1329 | Ga0495651_0108694 | |||
| 1330 | Ga0495653_0067370 | |||
| 1331 | Ga0495580_0000377 | |||
| 1332 | Ga0495582_0028692 | |||
| 1333 | Ga0495582_0031290 | |||
| 1334 | Ga0495605_0047257 | |||
| 1335 | Ga0495639_0027422 | |||
| 1336 | Ga0495584_0013636 | |||
| 1337 | Ga0495584_0038891 | |||
| 1338 | Ga0495585_0000070 | |||
| 1339 | Ga0495585_0002310 | |||
| 1340 | Ga0495585_0033853 | |||
| 1341 | Ga0495585_0036365 | |||
| 1342 | Ga0495594_0002927 | |||
| 1343 | Ga0495594_0017420 | |||
| 1344 | Ga0495594_0065466 | |||
| 1345 | Ga0495596_0000031 | |||
| 1346 | Ga0495607_0076382 | |||
| 1347 | Ga0495607_0091400 | |||
| 1348 | Ga0495583_0008132 | |||
| 1349 | Ga0495606_0051516 | |||
| 1350 | Ga0495616_0011422 | |||
| 1351 | Ga0495628_0239631 | |||
| 1352 | Ga0495630_0217709 | |||
| 1353 | Ga0495644_0005511 | |||
| 1354 | Ga0495648_0126222 | |||
| 1355 | Ga0495663_0034771 | |||
| 1356 | Ga0495642_0008031 | |||
| 1357 | Ga0495665_0010534 | |||
| 1358 | Ga0495665_0014273 | |||
| 1359 | Ga0495665_0038594 | |||
| 1360 | Ga0495586_0002833 | |||
| 1361 | Ga0495587_0052392 | |||
| 1362 | Ga0495621_0010545 | |||
| 1363 | Ga0495597_0010825 | |||
| 1364 | Ga0495645_0006342 | |||
| 1365 | Ga0495633_0020320 | |||
| 1366 | Ga0495656_0089881 | |||
| 1367 | Ga0495668_0003146 | |||
| 1368 | Ga0495611_0002422 | |||
| 1369 | Ga0495625_0023691 | |||
| 1370 | Ga0495661_0030849 | |||
| 1371 | Ga0495588_0024059 | |||
| 1372 | Ga0495588_0072628 | |||
| 1373 | Ga0495657_0114117 | |||
| 1374 | Ga0495623_0077429 | |||
| 1375 | Ga0495647_0001972 | |||
| 1376 | Ga0495658_0003752 | |||
| 1377 | Ga0495658_0005362 | |||
| 1378 | Ga0495658_0020500 | |||
| 1379 | Ga0495669_0017559 | |||
| 1380 | Ga0495670_0016846 | |||
| 1381 | Ga0495589_0030198 | |||
| 1382 | Ga0495589_0112070 | |||
| 1383 | Ga0495636_0019167 | |||
| 1384 | Ga0495674_0188934 | |||
| 1385 | Ga0495676_0014845 | |||
| 1386 | Ga0495683_0011188 | |||
| 1387 | Ga0495675_0037056 | |||
| 1388 | Ga0495675_0067705 | |||
| 1389 | Ga0495677_0002049 | |||
| 1390 | Ga0495677_0011499 | |||
| 1391 | Ga0495685_038561 | |||
| 1392 | Ga0495681_0036781 | |||
| 1393 | Ga0495681_0038572 | |||
| 1394 | Ga0495684_0159510 | |||
| 1395 | Ga0495593_0014866 | |||
| 1396 | Ga0495602_0069453 | |||
| 1397 | Ga0495615_0012899 | |||
| 1398 | Ga0495626_0000792 | |||
| 1399 | Ga0495626_0009038 | |||
| 1400 | Ga0496100_0101584 | |||
| 1401 | Ga0496104_0009253 | |||
| 1402 | Ga0496104_0119357 | |||
| 1403 | Ga0496105_0085483 | |||
| 1404 | Ga0496106_0008585 | |||
| 1405 | Ga0496107_0059033 | |||
| 1406 | Ga0496108_0052651 | |||
| 1407 | Ga0496109_0136508 | |||
| 1408 | Ga0496109_0164565 | |||
| 1409 | Ga0496112_0000303 | |||
| 1410 | Ga0496112_0043423 | |||
| 1411 | Ga0496113_0107622 | |||
| 1412 | Ga0496113_0144366 | |||
| 1413 | Ga0496114_0112677 | |||
| 1414 | Ga0496115_0007489 | |||
| 1415 | Ga0496115_0108328 | |||
| 1416 | Ga0495682_0009527 | |||
| 1417 | Ga0501291_010739 | |||
| 1418 | Ga0501031_0041109 | |||
| 1419 | Ga0501031_0069075 | |||
| 1420 | Ga0501031_0087132 | |||
| 1421 | Ga0501032_0022206 | |||
| 1422 | Ga0501033_0010042 | |||
| 1423 | Ga0501033_0102677 | |||
| 1424 | Ga0501034_0005289 | |||
| 1425 | Ga0501034_0005371 | |||
| 1426 | Ga0501034_0028499 | |||
| 1427 | Ga0501034_0066728 | |||
| 1428 | Ga0501034_0077625 | |||
| 1429 | Ga0501034_0121504 | |||
| 1430 | Ga0501034_0431229 | |||
| 1431 | Ga0501036_0003666 | |||
| 1432 | Ga0501036_0009460 | |||
| 1433 | Ga0501036_0014214 | |||
| 1434 | Ga0501036_0027364 | |||
| 1435 | Ga0501036_0031801 | |||
| 1436 | Ga0501036_0032087 | |||
| 1437 | Ga0501036_0050927 | |||
| 1438 | Ga0501037_0015609 | |||
| 1439 | Ga0501037_0080388 | |||
| 1440 | Ga0501037_0117402 | |||
| 1441 | Ga0501037_0136355 | |||
| 1442 | Ga0501037_0209933 | |||
| 1443 | Ga0501038_0001109 | |||
| 1444 | Ga0501038_0003531 | |||
| 1445 | Ga0501038_0014002 | |||
| 1446 | Ga0501038_0053866 | |||
| 1447 | Ga0501038_0076264 | |||
| 1448 | Ga0501038_0224301 | |||
| 1449 | Ga0501039_0015991 | |||
| 1450 | Ga0501039_0020033 | |||
| 1451 | Ga0501039_0022710 | |||
| 1452 | Ga0501039_0059797 | |||
| 1453 | Ga0501039_0218934 | |||
| 1454 | Ga0501040_0001909 | |||
| 1455 | Ga0501041_0007568 | |||
| 1456 | Ga0501041_0010527 | |||
| 1457 | Ga0501042_0000383 | |||
| 1458 | Ga0501042_0237166 | |||
| 1459 | Ga0501043_0000027 | |||
| 1460 | Ga0501043_0002821 | |||
| 1461 | Ga0501043_0004264 | |||
| 1462 | Ga0501043_0052312 | |||
| 1463 | Ga0501043_0136476 | |||
| 1464 | Ga0501046_0000034 | |||
| 1465 | Ga0501046_0001197 | |||
| 1466 | Ga0501046_0002832 | |||
| 1467 | Ga0501046_0015650 | |||
| 1468 | Ga0501046_0029937 | |||
| 1469 | Ga0501046_0046996 | |||
| 1470 | Ga0501046_0049945 | |||
| 1471 | Ga0501047_0000042 | |||
| 1472 | Ga0501047_0001297 | |||
| 1473 | Ga0501047_0001508 | |||
| 1474 | Ga0501047_0003796 | |||
| 1475 | Ga0501047_0032228 | |||
| 1476 | Ga0501047_0038275 | |||
| 1477 | Ga0501047_0139176 | |||
| 1478 | Ga0501047_0161965 | |||
| 1479 | Ga0501047_0254501 | |||
| 1480 | Ga0501048_0000019 | |||
| 1481 | Ga0501048_0000151 | |||
| 1482 | Ga0501048_0010770 | |||
| 1483 | Ga0501048_0058178 | |||
| 1484 | Ga0501048_0064163 | |||
| 1485 | Ga0501067_0017968 | |||
| 1486 | Ga0501067_0030791 | |||
| 1487 | Ga0501067_0054640 | |||
| 1488 | Ga0501068_0005410 | |||
| 1489 | Ga0501068_0010972 | |||
| 1490 | Ga0501068_0020932 | |||
| 1491 | Ga0501069_0028398 | |||
| 1492 | Ga0501069_0087357 | |||
| 1493 | Ga0501069_0108210 | |||
| 1494 | Ga0501070_0006477 | |||
| 1495 | Ga0501070_0007769 | |||
| 1496 | Ga0501070_0014067 | |||
| 1497 | Ga0501070_0041930 | |||
| 1498 | Ga0501070_0043411 | |||
| 1499 | Ga0501070_0044878 | |||
| 1500 | Ga0501070_0119877 | |||
| 1501 | Ga0501071_0032712 | |||
| 1502 | Ga0501071_0059340 | |||
| 1503 | Ga0501071_0108130 | |||
| 1504 | Ga0501072_0002470 | |||
| 1505 | Ga0501072_0026350 | |||
| 1506 | Ga0501072_0032599 | |||
| 1507 | Ga0501072_0160691 | |||
| 1508 | Ga0501072_0185864 | |||
| 1509 | Ga0501072_0243389 | |||
| 1510 | Ga0501073_0001397 | |||
| 1511 | Ga0501073_0009222 | |||
| 1512 | Ga0501073_0013135 | |||
| 1513 | Ga0501073_0048934 | |||
| 1514 | Ga0501073_0076220 | |||
| 1515 | Ga0501073_0121918 | |||
| 1516 | Ga0501073_0179998 | |||
| 1517 | Ga0501074_0001516 | |||
| 1518 | Ga0501074_0018041 | |||
| 1519 | Ga0501074_0019723 | |||
| 1520 | Ga0501074_0033428 | |||
| 1521 | Ga0501074_0058715 | |||
| 1522 | Ga0501074_0238304 | |||
| 1523 | Ga0501075_0000525 | |||
| 1524 | Ga0501076_0013583 | |||
| 1525 | Ga0501076_0085370 | |||
| 1526 | Ga0501077_0006058 | |||
| 1527 | Ga0501079_0000625 | |||
| 1528 | Ga0501079_0002303 | |||
| 1529 | Ga0501079_0037452 | |||
| 1530 | Ga0501080_0000130 | |||
| 1531 | Ga0501080_0003305 | |||
| 1532 | Ga0501080_0004495 | |||
| 1533 | Ga0501080_0013629 | |||
| 1534 | Ga0501080_0048054 | |||
| 1535 | Ga0501080_0051065 | |||
| 1536 | Ga0501080_0052289 | |||
| 1537 | Ga0501080_0056885 | |||
| 1538 | Ga0501080_0079937 | |||
| 1539 | Ga0501081_0000055 | |||
| 1540 | Ga0501081_0001663 | |||
| 1541 | Ga0501083_0002779 | |||
| 1542 | Ga0501083_0003894 | |||
| 1543 | Ga0501083_0017232 | |||
| 1544 | Ga0501083_0039248 | |||
| 1545 | Ga0501083_0056255 | |||
| 1546 | Ga0501083_0069452 | |||
| 1547 | Ga0501083_0135529 | |||
| 1548 | Ga0501035_0018873 | |||
| 1549 | Ga0501035_0037832 | |||
| 1550 | Ga0501035_0042121 | |||
| 1551 | Ga0501035_0044729 | |||
| 1552 | Ga0501035_0166755 | |||
| 1553 | Ga0501035_0315224 | |||
| 1554 | Ga0501044_0000636 | |||
| 1555 | Ga0501044_0006986 | |||
| 1556 | Ga0501044_0029378 | |||
| 1557 | Ga0501044_0095165 | |||
| 1558 | Ga0501044_0134975 | |||
| 1559 | Ga0501044_0155313 | |||
| 1560 | Ga0501044_0204794 | |||
| 1561 | Ga0501044_0226753 | |||
| 1562 | Ga0501045_0000901 | |||
| 1563 | Ga0501045_0006559 | |||
| 1564 | Ga0501045_0041865 | |||
| 1565 | nmdc:mga0n895_114609_c1 | |||
| 1566 | nmdc:mga0n895_199802_c1 | |||
| 1567 | nmdc:mga0rr50_464137_c1 | |||
| 1568 | nmdc:mga08x19_90949_c1 | |||
| 1569 | nmdc:mga0a205_103402_c1 | |||
| 1570 | Ga0495601_0120341 | |||
| 1571 | Ga0495619_0012269 | |||
| 1572 | Ga0495619_0231197 | |||
| 1573 | Ga0501084_0021611 | |||
| 1574 | Ga0501084_0040400 | |||
| 1575 | Ga0501082_0084604 | |||
| 1576 | Ga0501082_0166194 | |||
| 1577 | Ga0501082_0179078 | |||
| 1578 | Ga0466962_0027029 | |||
| 1579 | Ga0530510_0001004 | |||
| 1580 | 2842334280 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xeq-assembly4.cif.gz_D | crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid | 0.9569 | 37 | 336 |
| 4ovq-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d-glucuronate | 0.9546 | 37 | 333 |
| 7bcr-assembly1.cif.gz_A | crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate | 0.9538 | 35 | 334 |
| 4o7m-assembly3.cif.gz_C | crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate | 0.9526 | 34 | 312 |
| 4oan-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) | 0.9509 | 34 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37676_23_328_3.40.190.170 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.965 | 33 | 334 | 3.40.190.170 |
| af_P37676_23_328_3.40.190.170 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9497 | 33 | 334 | 3.40.190.170 |
| 4xeqD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9477 | 37 | 335 | 3.40.190.170 |
| 4nf0G00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9434 | 36 | 316 | 3.40.190.170 |
| 4nhbB00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9427 | 36 | 336 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A8LNG5-F1-model_v4 | TRAP transporter-DctP subunit | 0.9866 | 31 | 336 |
GO:0030288
GO:0055085 |
| AF-A0A3N5GUF3-F1-model_v4 | TRAP transporter substrate-binding protein | 0.9856 | 28 | 336 |
GO:0030288
GO:0055085 |
| AF-A6D538-F1-model_v4 | deleted | 0.9828 | 28 | 336 |
|
| AF-A0A7X4DI76-F1-model_v4 | TRAP transporter substrate-binding protein | 0.967 | 28 | 334 |
GO:0030288
GO:0055085 |
| AF-A0A349HRU3-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9645 | 92 | 335 |
GO:0030288
GO:0055085 |