F480899

General Info

Members Datasets Scaffolds Average Seq Length
789 260 1578 153

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10344273|Ga0114129_103442732
Length 183
Sequence MIYMVAGAAGVRVLRPADGYRARADFPLTPGDRMIRLLALAVFALVVAVPSGYGAPDIDRTAVDFKTPSEIKWVRNAAGTNESAVLFGDPSKPGPYVVRVKWFPGNMSRPHFHPNDRFFAVLSGTWWMGTGEVFDPERTVPAPAGSYVIHYGGKVHYDGAKNEETIIQVWGMGPATSTPAEKR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
202 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 0.51
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 16.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10344273 3300009147 Bacteria 1976
2 JGI24744J21845_10025995 3300002077 Bacteria 1138
3 JGI24742J22300_10043820 3300002244 Bacteria 801
4 JGI24751J29686_10057899 3300002459 Unclassified 798
5 JGI25406J46586_10223172 3300003203 Archaea 551
6 Ga0065715_10187987 3300005293 Bacteria 1433
7 Ga0065715_10532512 3300005293 Unclassified 726
8 Ga0065707_10001557 3300005295 Bacteria 6182
9 Ga0065707_10097100 3300005295 Bacteria 3199
10 Ga0065707_10188684 3300005295 Bacteria 1374
11 Ga0065707_10221916 3300005295 Bacteria 1221
12 Ga0065707_10244256 3300005295 Bacteria 1127
13 Ga0065707_10338356 3300005295 Bacteria 935
14 Ga0065707_10621832 3300005295 Unclassified 662
15 Ga0070676_10223933 3300005328 Bacteria 1244
16 Ga0070676_10621794 3300005328 Bacteria 781
17 Ga0070676_10733356 3300005328 Bacteria 724
18 Ga0070690_100117771 3300005330 Unclassified 1780
19 Ga0070690_100356006 3300005330 Bacteria 1064
20 Ga0070690_100489833 3300005330 Bacteria 918
21 Ga0070690_100941641 3300005330 Bacteria 678
22 Ga0070670_100071231 3300005331 Bacteria 2984
23 Ga0070670_100115889 3300005331 Bacteria 2310
24 Ga0070670_100758630 3300005331 Bacteria 875
25 Ga0070670_100871084 3300005331 Unclassified 815
26 Ga0070677_10034212 3300005333 Bacteria 1961
27 Ga0070677_10122571 3300005333 Unclassified 1176
28 Ga0068869_100011048 3300005334 Bacteria 5914
29 Ga0068869_100015229 3300005334 Bacteria 5154
30 Ga0068869_101364616 3300005334 Unclassified 627
31 Ga0070666_10044889 3300005335 Bacteria 2962
32 Ga0070666_10241263 3300005335 Bacteria 1278
33 Ga0070666_10671100 3300005335 Bacteria 759
34 Ga0070680_100129307 3300005336 Bacteria 2112
35 Ga0070680_100214682 3300005336 Bacteria 1623
36 Ga0068868_100209962 3300005338 Bacteria 1627
37 Ga0068868_100480974 3300005338 Bacteria 1085
38 Ga0070689_101440451 3300005340 Bacteria 623
39 Ga0070691_10295500 3300005341 Unclassified 883
40 Ga0070691_10297911 3300005341 Bacteria 880
41 Ga0070687_100187479 3300005343 Unclassified 1244
42 Ga0070687_100327210 3300005343 Bacteria 981
43 Ga0070687_100803373 3300005343 Bacteria 667
44 Ga0070692_10049809 3300005345 Bacteria 2174
45 Ga0070692_10190625 3300005345 Bacteria 1194
46 Ga0070668_100025330 3300005347 Bacteria 4497
47 Ga0070668_100075627 3300005347 Bacteria 2629
48 Ga0070668_101170408 3300005347 Bacteria 696
49 Ga0070668_101288790 3300005347 Bacteria 664
50 Ga0070669_100043999 3300005353 Bacteria 3253
51 Ga0070669_100064607 3300005353 Bacteria 2695
52 Ga0070669_100090938 3300005353 Bacteria 2288
53 Ga0070669_100174389 3300005353 Bacteria 1678
54 Ga0070669_100222315 3300005353 Bacteria 1493
55 Ga0070669_100358555 3300005353 Bacteria 1185
56 Ga0070669_100373057 3300005353 Bacteria 1162
57 Ga0070675_100001085 3300005354 Bacteria 19641
58 Ga0070675_100042543 3300005354 Bacteria 3711
59 Ga0070675_100620472 3300005354 Bacteria 981
60 Ga0070675_101019919 3300005354 Bacteria 760
61 Ga0070671_100055518 3300005355 Bacteria 3295
62 Ga0070671_100548624 3300005355 Bacteria 997
63 Ga0070674_100000588 3300005356 Bacteria 18404
64 Ga0070673_100039287 3300005364 Bacteria 3620
65 Ga0070673_100045823 3300005364 Bacteria 3393
66 Ga0070673_100072051 3300005364 Bacteria 2778
67 Ga0070673_100327437 3300005364 Bacteria 1355
68 Ga0070673_100709337 3300005364 Bacteria 924
69 Ga0070673_100979926 3300005364 Bacteria 786
70 Ga0070688_100023903 3300005365 Bacteria 3600
71 Ga0070688_100104873 3300005365 Bacteria 1870
72 Ga0070688_100405711 3300005365 Bacteria 1010
73 Ga0070688_100532454 3300005365 Unclassified 891
74 Ga0070659_100290303 3300005366 Unclassified 1362
75 Ga0070659_100349593 3300005366 Unclassified 1240
76 Ga0070659_100475659 3300005366 Bacteria 1062
77 Ga0070667_100424433 3300005367 Bacteria 1213
78 Ga0070667_101224998 3300005367 Unclassified 703
79 Ga0070667_101821199 3300005367 Bacteria 573
80 Ga0070667_102152331 3300005367 Unclassified 525
81 Ga0070709_10358916 3300005434 Unclassified 1079
82 Ga0070701_10413882 3300005438 Unclassified 857
83 Ga0070701_10560894 3300005438 Bacteria 751
84 Ga0070701_11201009 3300005438 Bacteria 538
85 Ga0070705_100116374 3300005440 Bacteria 1718
86 Ga0070705_100155689 3300005440 Unclassified 1521
87 Ga0070705_100497396 3300005440 Bacteria 925
88 Ga0070705_100732110 3300005440 Unclassified 780
89 Ga0070700_100042642 3300005441 Bacteria 2787
90 Ga0070700_100099524 3300005441 Bacteria 1913
91 Ga0070700_100438972 3300005441 Bacteria 990
92 Ga0070700_100625722 3300005441 Bacteria 847
93 Ga0070694_100106283 3300005444 Bacteria 1993
94 Ga0070708_100025171 3300005445 Bacteria 5085
95 Ga0070708_100040895 3300005445 Bacteria 4062
96 Ga0070708_100051381 3300005445 Bacteria 3652
97 Ga0070708_100070463 3300005445 Bacteria 3145
98 Ga0070708_100070975 3300005445 Bacteria 3134
99 Ga0070708_100081015 3300005445 Unclassified 2938
100 Ga0070708_100200219 3300005445 Bacteria 1869
101 Ga0070708_100293528 3300005445 Unclassified 1531
102 Ga0070708_100984039 3300005445 Unclassified 791
103 Ga0070678_100004453 3300005456 Bacteria 7949
104 Ga0070678_100075374 3300005456 Bacteria 2538
105 Ga0070678_100151844 3300005456 Bacteria 1866
106 Ga0070678_101307621 3300005456 Unclassified 675
107 Ga0070662_100024226 3300005457 Bacteria 4179
108 Ga0070662_100071909 3300005457 Bacteria 2552
109 Ga0070662_100223734 3300005457 Bacteria 1503
110 Ga0070662_100378741 3300005457 Bacteria 1164
111 Ga0070681_10009692 3300005458 Bacteria 9476
112 Ga0070681_10157350 3300005458 Bacteria 2196
113 Ga0070681_10158660 3300005458 Unclassified 2186
114 Ga0068867_100002633 3300005459 Bacteria 12659
115 Ga0068867_100063275 3300005459 Bacteria 2749
116 Ga0068867_100119661 3300005459 Bacteria 2033
117 Ga0068867_100624322 3300005459 Bacteria 943
118 Ga0068867_100686774 3300005459 Unclassified 902
119 Ga0070685_10710268 3300005466 Bacteria 734
120 Ga0070706_100022999 3300005467 Bacteria 5741
121 Ga0070706_100048473 3300005467 Bacteria 3920
122 Ga0070706_100225145 3300005467 Bacteria 1751
123 Ga0070706_100497830 3300005467 Bacteria 1134
124 Ga0070707_100022590 3300005468 Bacteria 5947
125 Ga0070707_100025451 3300005468 Bacteria 5614
126 Ga0070707_100025770 3300005468 Bacteria 5581
127 Ga0070707_100029187 3300005468 Bacteria 5251
128 Ga0070707_100096449 3300005468 Bacteria 2864
129 Ga0070707_100641788 3300005468 Bacteria 1024
130 Ga0070707_100647286 3300005468 Bacteria 1019
131 Ga0070707_101314162 3300005468 Bacteria 689
132 Ga0070707_101334892 3300005468 Unclassified 683
133 Ga0070698_100001397 3300005471 Bacteria 26725
134 Ga0070698_100189727 3300005471 Bacteria 1993
135 Ga0070698_100236627 3300005471 Bacteria 1759
136 Ga0070699_100010797 3300005518 Bacteria 7905
137 Ga0070699_100010971 3300005518 Bacteria 7835
138 Ga0070699_100029740 3300005518 Bacteria 4711
139 Ga0070699_100054808 3300005518 Bacteria 3452
140 Ga0070699_100096198 3300005518 Bacteria 2593
141 Ga0070699_100976390 3300005518 Unclassified 776
142 Ga0070699_101745953 3300005518 Unclassified 570
143 Ga0070679_100014793 3300005530 Bacteria 7498
144 Ga0070697_100001716 3300005536 Bacteria 16733
145 Ga0070697_100045483 3300005536 Bacteria 3557
146 Ga0070697_100055523 3300005536 Bacteria 3220
147 Ga0070697_100572849 3300005536 Unclassified 991
148 Ga0070697_100995793 3300005536 Unclassified 745
149 Ga0070697_101806796 3300005536 Unclassified 547
150 Ga0068853_100752928 3300005539 Bacteria 931
151 Ga0070672_100004437 3300005543 Bacteria 9184
152 Ga0070672_100058238 3300005543 Bacteria 3035
153 Ga0070672_100149419 3300005543 Bacteria 1932
154 Ga0070672_100290394 3300005543 Bacteria 1384
155 Ga0070686_100208630 3300005544 Bacteria 1405
156 Ga0070686_100484842 3300005544 Bacteria 957
157 Ga0070686_101210712 3300005544 Bacteria 628
158 Ga0070695_100051974 3300005545 Bacteria 2631
159 Ga0070695_100090026 3300005545 Bacteria 2047
160 Ga0070696_100033959 3300005546 Bacteria 3508
161 Ga0070696_100084601 3300005546 Bacteria 2251
162 Ga0070696_100086728 3300005546 Bacteria 2223
163 Ga0070696_100302450 3300005546 Unclassified 1225
164 Ga0070696_100325560 3300005546 Bacteria 1184
165 Ga0070696_100455850 3300005546 Bacteria 1010
166 Ga0070696_100841509 3300005546 Unclassified 758
167 Ga0070693_100136833 3300005547 Unclassified 1537
168 Ga0070693_100408453 3300005547 Bacteria 943
169 Ga0070693_100717254 3300005547 Bacteria 734
170 Ga0070704_100025708 3300005549 Bacteria 3879
171 Ga0070704_100027559 3300005549 Bacteria 3770
172 Ga0070704_100137833 3300005549 Bacteria 1901
173 Ga0070704_100329781 3300005549 Unclassified 1281
174 Ga0070664_100523199 3300005564 Bacteria 1095
175 Ga0070664_100640819 3300005564 Bacteria 987
176 Ga0068857_100080545 3300005577 Bacteria 2908
177 Ga0068857_100182095 3300005577 Bacteria 1912
178 Ga0068857_101478299 3300005577 Unclassified 662
179 Ga0068856_101014594 3300005614 Unclassified 848
180 Ga0070702_100585307 3300005615 Bacteria 834
181 Ga0070702_100751750 3300005615 Unclassified 749
182 Ga0068852_100436488 3300005616 Bacteria 1294
183 Ga0068859_100288080 3300005617 Unclassified 1735
184 Ga0068859_100308727 3300005617 Bacteria 1675
185 Ga0068859_100386677 3300005617 Bacteria 1495
186 Ga0068859_100549397 3300005617 Bacteria 1249
187 Ga0068859_101022664 3300005617 Unclassified 908
188 Ga0068859_101840401 3300005617 Unclassified 668
189 Ga0068864_100014952 3300005618 Bacteria 6450
190 Ga0068864_100017199 3300005618 Bacteria 6030
191 Ga0068864_100132623 3300005618 Bacteria 2240
192 Ga0068864_100135404 3300005618 Bacteria 2218
193 Ga0068864_100220325 3300005618 Bacteria 1750
194 Ga0068866_10014193 3300005718 Bacteria 3512
195 Ga0068861_100040484 3300005719 Bacteria 3486
196 Ga0068861_100158161 3300005719 Bacteria 1866
197 Ga0068861_100260449 3300005719 Unclassified 1484
198 Ga0068861_100374523 3300005719 Bacteria 1256
199 Ga0068861_100382676 3300005719 Bacteria 1244
200 Ga0068861_100515514 3300005719 Bacteria 1083
201 Ga0068861_100898333 3300005719 Bacteria 839
202 Ga0068870_10034593 3300005840 Bacteria 2586
203 Ga0068870_10050359 3300005840 Bacteria 2201
204 Ga0068870_10223548 3300005840 Bacteria 1154
205 Ga0068870_10258864 3300005840 Bacteria 1082
206 Ga0068870_11212721 3300005840 Unclassified 547
207 Ga0068863_100594794 3300005841 Unclassified 1095
208 Ga0068863_100678663 3300005841 Bacteria 1023
209 Ga0068858_100163809 3300005842 Bacteria 2094
210 Ga0068860_100011426 3300005843 Bacteria 8748
211 Ga0068860_100240831 3300005843 Bacteria 1759
212 Ga0068860_100443619 3300005843 Bacteria 1290
213 Ga0068860_100571525 3300005843 Bacteria 1134
214 Ga0068860_100860614 3300005843 Bacteria 921
215 Ga0068860_102671645 3300005843 Unclassified 518
216 Ga0068862_100005002 3300005844 Bacteria 11157
217 Ga0068862_100028009 3300005844 Bacteria 4745
218 Ga0068862_100176728 3300005844 Bacteria 1914
219 Ga0068862_100194064 3300005844 Bacteria 1828
220 Ga0068862_100318983 3300005844 Bacteria 1434
221 Ga0068862_100817884 3300005844 Viruses 911
222 Ga0068862_101112158 3300005844 Bacteria 786
223 Ga0068862_102125906 3300005844 Bacteria 572
224 Ga0081455_10404684 3300005937 Unclassified 946
225 Ga0081539_10000180 3300005985 Bacteria 148269
226 Ga0075363_100000437 3300006048 Bacteria 13021
227 Ga0075363_100758825 3300006048 Bacteria 588
228 Ga0075432_10178253 3300006058 Bacteria 830
229 Ga0075432_10407537 3300006058 Bacteria 588
230 Ga0075362_10001310 3300006177 Bacteria 7893
231 Ga0075367_10022950 3300006178 Bacteria 3506
232 Ga0075369_10047831 3300006186 Bacteria 1845
233 Ga0097621_100783159 3300006237 Bacteria 883
234 Ga0075370_10708878 3300006353 Bacteria 612
235 Ga0068871_100308498 3300006358 Bacteria 1390
236 Ga0068871_100873050 3300006358 Bacteria 833
237 Ga0075428_100008076 3300006844 Bacteria 11686
238 Ga0075428_100141332 3300006844 Unclassified 2617
239 Ga0075428_100142242 3300006844 Bacteria 2608
240 Ga0075428_100753492 3300006844 Bacteria 1036
241 Ga0075428_101597988 3300006844 Bacteria 682
242 Ga0075430_100000497 3300006846 Bacteria 29597
243 Ga0075430_100045904 3300006846 Bacteria 3690
244 Ga0075430_100075140 3300006846 Bacteria 2833
245 Ga0075430_100168127 3300006846 Bacteria 1824
246 Ga0075430_100181073 3300006846 Unclassified 1753
247 Ga0075430_100387876 3300006846 Bacteria 1153
248 Ga0075430_100774935 3300006846 Archaea 790
249 Ga0075431_100000294 3300006847 Bacteria 39181
250 Ga0075431_100002661 3300006847 Bacteria 17294
251 Ga0075431_100021409 3300006847 Bacteria 6611
252 Ga0075431_100032705 3300006847 Bacteria 5360
253 Ga0075431_100046450 3300006847 Bacteria 4478
254 Ga0075431_100049713 3300006847 Bacteria 4323
255 Ga0075431_100637066 3300006847 Archaea 1047
256 Ga0075431_100659948 3300006847 Bacteria 1026
257 Ga0075431_101024686 3300006847 Bacteria 792
258 Ga0075431_101086606 3300006847 Unclassified 765
259 Ga0075433_10021333 3300006852 Bacteria 5431
260 Ga0075433_10034806 3300006852 Bacteria 4328
261 Ga0075433_10040041 3300006852 Bacteria 4054
262 Ga0075433_10078776 3300006852 Bacteria 2903
263 Ga0075433_10146439 3300006852 Bacteria 2100
264 Ga0075433_10150043 3300006852 Bacteria 2073
265 Ga0075433_11134029 3300006852 Unclassified 680
266 Ga0075433_11423411 3300006852 Bacteria 599
267 Ga0075434_100032929 3300006871 Bacteria 5112
268 Ga0075434_100035465 3300006871 Bacteria 4931
269 Ga0075434_100035934 3300006871 Bacteria 4899
270 Ga0075434_100060506 3300006871 Unclassified 3767
271 Ga0075434_100093875 3300006871 Bacteria 3004
272 Ga0075434_100103901 3300006871 Bacteria 2850
273 Ga0075434_100107716 3300006871 Bacteria 2797
274 Ga0075434_100158648 3300006871 Bacteria 2282
275 Ga0075434_100188802 3300006871 Bacteria 2081
276 Ga0075434_100224691 3300006871 Bacteria 1897
277 Ga0075434_100227769 3300006871 Unclassified 1883
278 Ga0075434_100505068 3300006871 Unclassified 1230
279 Ga0075434_101511028 3300006871 Unclassified 681
280 Ga0075429_100004499 3300006880 Bacteria 11993
281 Ga0075429_100024474 3300006880 Bacteria 5239
282 Ga0075429_100037328 3300006880 Bacteria 4229
283 Ga0075429_100048166 3300006880 Bacteria 3707
284 Ga0075429_100125901 3300006880 Bacteria 2241
285 Ga0075429_100232333 3300006880 Bacteria 1615
286 Ga0075429_100268493 3300006880 Bacteria 1494
287 Ga0075429_100291027 3300006880 Bacteria 1430
288 Ga0068865_100066535 3300006881 Bacteria 2543
289 Ga0068865_100275836 3300006881 Bacteria 1337
290 Ga0068865_100318113 3300006881 Bacteria 1251
291 Ga0068865_100702069 3300006881 Bacteria 864
292 Ga0075436_100048822 3300006914 Bacteria 2920
293 Ga0075436_100693548 3300006914 Bacteria 754
294 Ga0097620_100211892 3300006931 Bacteria 2024
295 Ga0097620_100288088 3300006931 Unclassified 1735
296 Ga0097620_100308727 3300006931 Bacteria 1675
297 Ga0097620_100386680 3300006931 Bacteria 1495
298 Ga0097620_100549408 3300006931 Bacteria 1249
299 Ga0097620_101022779 3300006931 Unclassified 908
300 Ga0097620_101840423 3300006931 Unclassified 668
301 Ga0075435_100002819 3300007076 Bacteria 11627
302 Ga0075435_100008935 3300007076 Bacteria 7223
303 Ga0075435_100059264 3300007076 Unclassified 3103
304 Ga0075435_100113314 3300007076 Bacteria 2257
305 Ga0075435_100159689 3300007076 Bacteria 1898
306 Ga0075435_100181325 3300007076 Bacteria 1779
307 Ga0075435_100839923 3300007076 Unclassified 800
308 Ga0099794_10037923 3300007265 Bacteria 2283
309 Ga0099794_10149401 3300007265 Bacteria 1186
310 Ga0105240_11247325 3300009093 Bacteria 786
311 Ga0111539_10000111 3300009094 Bacteria 89076
312 Ga0111539_10015730 3300009094 Bacteria 9400
313 Ga0111539_10065546 3300009094 Unclassified 4291
314 Ga0111539_10168263 3300009094 Bacteria 2562
315 Ga0111539_10186513 3300009094 Bacteria 2422
316 Ga0111539_10284405 3300009094 Bacteria 1925
317 Ga0111539_10656795 3300009094 Unclassified 1221
318 Ga0111539_10745366 3300009094 Bacteria 1140
319 Ga0111539_11464133 3300009094 Bacteria 792
320 Ga0105245_10066500 3300009098 Bacteria 3263
321 Ga0105245_10206637 3300009098 Bacteria 1888
322 Ga0105245_11826379 3300009098 Bacteria 661
323 Ga0105247_10119944 3300009101 Bacteria 1703
324 Ga0114129_10003348 3300009147 Bacteria 22517
325 Ga0114129_10004389 3300009147 Bacteria 19894
326 Ga0114129_10006262 3300009147 Bacteria 16873
327 Ga0114129_10048310 3300009147 Bacteria 5979
328 Ga0114129_10066533 3300009147 Bacteria 5028
329 Ga0114129_10079714 3300009147 Bacteria 4552
330 Ga0114129_10239720 3300009147 Bacteria 2438
331 Ga0114129_10272541 3300009147 Bacteria 2264
332 Ga0114129_10323351 3300009147 Bacteria 2050
333 Ga0114129_10336892 3300009147 Unclassified 2002
334 Ga0114129_10651384 3300009147 Bacteria 1359
335 Ga0114129_10864556 3300009147 Bacteria 1148
336 Ga0105243_10006918 3300009148 Bacteria 8740
337 Ga0105243_10014194 3300009148 Bacteria 6029
338 Ga0105243_10211695 3300009148 Bacteria 1707
339 Ga0105243_10220701 3300009148 Bacteria 1675
340 Ga0105243_10298520 3300009148 Bacteria 1459
341 Ga0105243_10389680 3300009148 Bacteria 1291
342 Ga0105243_10480848 3300009148 Bacteria 1172
343 Ga0105243_10597098 3300009148 Bacteria 1062
344 Ga0105243_10869058 3300009148 Viruses 894
345 Ga0105241_10196983 3300009174 Bacteria 1680
346 Ga0105241_10217253 3300009174 Bacteria 1605
347 Ga0105242_10039382 3300009176 Bacteria 3804
348 Ga0105242_11305340 3300009176 Unclassified 749
349 Ga0105248_10518538 3300009177 Bacteria 1344
350 Ga0105248_11348768 3300009177 Bacteria 807
351 Ga0105249_10016751 3300009553 Bacteria 6504
352 Ga0105249_10094822 3300009553 Bacteria 2797
353 Ga0105249_10211930 3300009553 Bacteria 1902
354 Ga0105249_10799532 3300009553 Unclassified 1007
355 Ga0105249_10996681 3300009553 Bacteria 906
356 Ga0105239_10648813 3300010375 Bacteria 1205
357 Ga0105239_13403409 3300010375 Unclassified 517
358 Ga0105246_10217969 3300011119 Bacteria 1494
359 Ga0105246_11005614 3300011119 Unclassified 755
360 Ga0105246_11359837 3300011119 Unclassified 661
361 Ga0157374_10131088 3300013296 Bacteria 2426
362 Ga0157374_10796300 3300013296 Bacteria 961
363 Ga0157374_11411814 3300013296 Unclassified 719
364 Ga0157374_11655316 3300013296 Bacteria 664
365 Ga0157378_10207637 3300013297 Bacteria 1856
366 Ga0157378_10384409 3300013297 Bacteria 1379
367 Ga0157378_10517731 3300013297 Bacteria 1194
368 Ga0163162_10008907 3300013306 Bacteria 9758
369 Ga0163162_10276215 3300013306 Bacteria 1812
370 Ga0163162_10432818 3300013306 Bacteria 1448
371 Ga0157375_10482116 3300013308 Bacteria 1405
372 Ga0157375_10901704 3300013308 Bacteria 1028
373 Ga0157375_11306078 3300013308 Bacteria 853
374 Ga0157375_11530764 3300013308 Bacteria 788
375 Ga0157375_11537316 3300013308 Unclassified 786
376 Ga0163163_11086317 3300014325 Bacteria 863
377 Ga0157380_10000634 3300014326 Bacteria 21652
378 Ga0157380_10087494 3300014326 Bacteria 2562
379 Ga0157380_10122923 3300014326 Bacteria 2201
380 Ga0157380_10217135 3300014326 Bacteria 1708
381 Ga0157380_10756891 3300014326 Unclassified 983
382 Ga0157377_10152260 3300014745 Bacteria 1431
383 Ga0157377_10307585 3300014745 Bacteria 1048
384 Ga0157377_10955826 3300014745 Unclassified 645
385 Ga0157379_11172775 3300014968 Bacteria 738
386 Ga0157379_11243639 3300014968 Unclassified 717
387 Ga0157376_10286632 3300014969 Bacteria 1553
388 Ga0157376_10580658 3300014969 Bacteria 1113
389 Ga0163161_10030103 3300017792 Bacteria 3861
390 Ga0207697_10023958 3300025315 Bacteria 2500
391 Ga0207656_10280720 3300025321 Bacteria 821
392 Ga0207653_10025451 3300025885 Unclassified 1893
393 Ga0207653_10058843 3300025885 Bacteria 1292
394 Ga0207653_10383973 3300025885 Bacteria 550
395 Ga0207682_10017308 3300025893 Bacteria 2815
396 Ga0207682_10283251 3300025893 Bacteria 775
397 Ga0207642_10064986 3300025899 Bacteria 1712
398 Ga0207688_10058383 3300025901 Bacteria 2171
399 Ga0207688_10098511 3300025901 Bacteria 1686
400 Ga0207688_10127700 3300025901 Bacteria 1488
401 Ga0207680_10069582 3300025903 Bacteria 2175
402 Ga0207680_10359410 3300025903 Bacteria 1024
403 Ga0207680_10652241 3300025903 Unclassified 754
404 Ga0207680_10977612 3300025903 Unclassified 606
405 Ga0207699_10050179 3300025906 Bacteria 2459
406 Ga0207645_10018134 3300025907 Bacteria 4638
407 Ga0207645_10038564 3300025907 Bacteria 3063
408 Ga0207645_10052615 3300025907 Bacteria 2602
409 Ga0207645_10180326 3300025907 Bacteria 1386
410 Ga0207643_10019529 3300025908 Bacteria 3714
411 Ga0207643_10034100 3300025908 Bacteria 2851
412 Ga0207643_10034643 3300025908 Bacteria 2830
413 Ga0207643_10055157 3300025908 Bacteria 2260
414 Ga0207643_10333862 3300025908 Bacteria 949
415 Ga0207684_10000464 3300025910 Bacteria 52531
416 Ga0207684_10015631 3300025910 Bacteria 6532
417 Ga0207684_10051267 3300025910 Bacteria 3501
418 Ga0207684_10066579 3300025910 Bacteria 3060
419 Ga0207684_10158793 3300025910 Bacteria 1946
420 Ga0207684_10214337 3300025910 Bacteria 1661
421 Ga0207684_10456347 3300025910 Bacteria 1097
422 Ga0207654_10276154 3300025911 Bacteria 1135
423 Ga0207654_10482222 3300025911 Bacteria 873
424 Ga0207707_10128372 3300025912 Bacteria 2217
425 Ga0207707_10648320 3300025912 Bacteria 890
426 Ga0207660_10153550 3300025917 Bacteria 1771
427 Ga0207660_10184750 3300025917 Bacteria 1621
428 Ga0207660_10285289 3300025917 Bacteria 1311
429 Ga0207662_10023520 3300025918 Unclassified 3541
430 Ga0207662_10055671 3300025918 Bacteria 2361
431 Ga0207662_10166389 3300025918 Bacteria 1412
432 Ga0207662_10338916 3300025918 Bacteria 1007
433 Ga0207662_10445970 3300025918 Bacteria 884
434 Ga0207657_11405723 3300025919 Bacteria 524
435 Ga0207652_10042491 3300025921 Bacteria 3870
436 Ga0207646_10001668 3300025922 Bacteria 27110
437 Ga0207646_10006866 3300025922 Bacteria 11692
438 Ga0207646_10024823 3300025922 Bacteria 5486
439 Ga0207646_10044420 3300025922 Bacteria 3988
440 Ga0207646_10051525 3300025922 Bacteria 3683
441 Ga0207646_10295199 3300025922 Unclassified 1464
442 Ga0207646_10379078 3300025922 Unclassified 1278
443 Ga0207646_11796756 3300025922 Unclassified 524
444 Ga0207681_10010452 3300025923 Bacteria 5680
445 Ga0207681_10021373 3300025923 Bacteria 4112
446 Ga0207681_10075613 3300025923 Bacteria 2362
447 Ga0207681_10189490 3300025923 Bacteria 1572
448 Ga0207681_10383256 3300025923 Bacteria 1132
449 Ga0207681_11167362 3300025923 Unclassified 647
450 Ga0207681_11485398 3300025923 Bacteria 568
451 Ga0207650_10043323 3300025925 Bacteria 3303
452 Ga0207650_10081740 3300025925 Bacteria 2451
453 Ga0207650_11657080 3300025925 Unclassified 542
454 Ga0207659_10024355 3300025926 Bacteria 4054
455 Ga0207659_10081353 3300025926 Unclassified 2395
456 Ga0207659_10246283 3300025926 Unclassified 1448
457 Ga0207659_10286991 3300025926 Bacteria 1347
458 Ga0207659_10976290 3300025926 Unclassified 729
459 Ga0207687_10034529 3300025927 Bacteria 3434
460 Ga0207687_10490701 3300025927 Bacteria 1024
461 Ga0207687_10944634 3300025927 Bacteria 739
462 Ga0207644_10064529 3300025931 Bacteria 2661
463 Ga0207644_10465085 3300025931 Bacteria 1040
464 Ga0207690_10267165 3300025932 Bacteria 1327
465 Ga0207690_10572948 3300025932 Bacteria 919
466 Ga0207690_10939532 3300025932 Unclassified 718
467 Ga0207706_10014951 3300025933 Bacteria 7027
468 Ga0207706_10037158 3300025933 Bacteria 4325
469 Ga0207706_10186851 3300025933 Bacteria 1819
470 Ga0207706_10468759 3300025933 Bacteria 1088
471 Ga0207706_10947963 3300025933 Bacteria 725
472 Ga0207686_10446875 3300025934 Bacteria 994
473 Ga0207709_10003471 3300025935 Bacteria 9348
474 Ga0207709_10060822 3300025935 Bacteria 2357
475 Ga0207709_10112102 3300025935 Bacteria 1826
476 Ga0207709_10345396 3300025935 Bacteria 1121
477 Ga0207670_10599790 3300025936 Bacteria 904
478 Ga0207670_11667664 3300025936 Unclassified 542
479 Ga0207669_10000465 3300025937 Bacteria 17694
480 Ga0207669_10063157 3300025937 Bacteria 2284
481 Ga0207669_10223474 3300025937 Bacteria 1384
482 Ga0207669_10226016 3300025937 Bacteria 1377
483 Ga0207669_10895787 3300025937 Bacteria 741
484 Ga0207704_10000545 3300025938 Bacteria 16783
485 Ga0207704_10039943 3300025938 Bacteria 2738
486 Ga0207704_10071003 3300025938 Bacteria 2208
487 Ga0207704_10130977 3300025938 Bacteria 1737
488 Ga0207704_11224151 3300025938 Unclassified 641
489 Ga0207665_10576485 3300025939 Bacteria 877
490 Ga0207691_10009134 3300025940 Bacteria 9513
491 Ga0207691_10013963 3300025940 Bacteria 7663
492 Ga0207691_10135211 3300025940 Bacteria 2175
493 Ga0207691_10198485 3300025940 Bacteria 1747
494 Ga0207691_10424525 3300025940 Unclassified 1133
495 Ga0207689_10017712 3300025942 Bacteria 6020
496 Ga0207689_10087011 3300025942 Bacteria 2567
497 Ga0207689_10297694 3300025942 Bacteria 1337
498 Ga0207689_10636169 3300025942 Unclassified 898
499 Ga0207689_10946127 3300025942 Unclassified 727
500 Ga0207689_10955168 3300025942 Bacteria 723
501 Ga0207679_10365417 3300025945 Bacteria 1261
502 Ga0207679_10495995 3300025945 Bacteria 1089
503 Ga0207667_11773547 3300025949 Unclassified 582
504 Ga0207651_10001874 3300025960 Bacteria 9841
505 Ga0207651_10250001 3300025960 Bacteria 1450
506 Ga0207651_10300053 3300025960 Bacteria 1335
507 Ga0207651_11227337 3300025960 Bacteria 673
508 Ga0207712_10001551 3300025961 Bacteria 15493
509 Ga0207712_10020267 3300025961 Bacteria 4354
510 Ga0207712_10163353 3300025961 Bacteria 1733
511 Ga0207712_10507901 3300025961 Unclassified 1031
512 Ga0207712_11264178 3300025961 Bacteria 659
513 Ga0207668_10016426 3300025972 Bacteria 4620
514 Ga0207668_10022543 3300025972 Bacteria 4034
515 Ga0207668_10023173 3300025972 Bacteria 3985
516 Ga0207668_10443877 3300025972 Bacteria 1106
517 Ga0207668_10528720 3300025972 Unclassified 1019
518 Ga0207668_11506564 3300025972 Bacteria 607
519 Ga0207640_11503882 3300025981 Bacteria 605
520 Ga0207658_10155595 3300025986 Bacteria 1868
521 Ga0207658_10308671 3300025986 Bacteria 1366
522 Ga0207677_10069311 3300026023 Bacteria 2480
523 Ga0207677_10221812 3300026023 Bacteria 1517
524 Ga0207703_10252751 3300026035 Bacteria 1589
525 Ga0207703_10396229 3300026035 Unclassified 1280
526 Ga0207708_10001449 3300026075 Bacteria 17783
527 Ga0207708_10009813 3300026075 Bacteria 7104
528 Ga0207708_10270909 3300026075 Bacteria 1373
529 Ga0207708_10824330 3300026075 Bacteria 800
530 Ga0207708_10896464 3300026075 Bacteria 767
531 Ga0207708_11445153 3300026075 Unclassified 604
532 Ga0207641_10214737 3300026088 Bacteria 1781
533 Ga0207641_10316388 3300026088 Bacteria 1479
534 Ga0207641_10377669 3300026088 Bacteria 1356
535 Ga0207641_10398729 3300026088 Bacteria 1321
536 Ga0207641_11404349 3300026088 Unclassified 699
537 Ga0207648_10000297 3300026089 Bacteria 54091
538 Ga0207648_10020005 3300026089 Bacteria 6038
539 Ga0207648_10030508 3300026089 Bacteria 4774
540 Ga0207648_10079338 3300026089 Bacteria 2863
541 Ga0207648_10079795 3300026089 Bacteria 2854
542 Ga0207648_10847463 3300026089 Unclassified 852
543 Ga0207676_10152589 3300026095 Bacteria 1991
544 Ga0207676_10317606 3300026095 Unclassified 1428
545 Ga0207676_10446935 3300026095 Bacteria 1218
546 Ga0207674_10098814 3300026116 Bacteria 2902
547 Ga0207674_10212021 3300026116 Bacteria 1886
548 Ga0207675_100033928 3300026118 Bacteria 4756
549 Ga0207675_100034957 3300026118 Bacteria 4686
550 Ga0207675_100270152 3300026118 Bacteria 1650
551 Ga0207675_100700795 3300026118 Bacteria 1021
552 Ga0207675_101935899 3300026118 Unclassified 608
553 Ga0207683_10010991 3300026121 Bacteria 7719
554 Ga0207683_10069340 3300026121 Bacteria 3114
555 Ga0207683_10124254 3300026121 Bacteria 2318
556 Ga0207683_10229121 3300026121 Bacteria 1694
557 Ga0207683_10567513 3300026121 Bacteria 1050
558 Ga0207683_11172576 3300026121 Unclassified 712
559 Ga0209588_1073010 3300027671 Bacteria 1108
560 Ga0207428_10000069 3300027907 Bacteria 149507
561 Ga0207428_10001771 3300027907 Bacteria 22132
562 Ga0207428_10013402 3300027907 Bacteria 7163
563 Ga0207428_10047291 3300027907 Bacteria 3455
564 Ga0207428_10450836 3300027907 Bacteria 938
565 Ga0207428_10457664 3300027907 Bacteria 930
566 Ga0268266_11624613 3300028379 Unclassified 622
567 Ga0268265_10001755 3300028380 Bacteria 17430
568 Ga0268265_10035788 3300028380 Bacteria 3631
569 Ga0268265_10045390 3300028380 Bacteria 3279
570 Ga0268265_10143523 3300028380 Bacteria 2002
571 Ga0268265_10350985 3300028380 Bacteria 1347
572 Ga0268265_10611966 3300028380 Bacteria 1042
573 Ga0268265_11398626 3300028380 Bacteria 702
574 Ga0268264_10076860 3300028381 Bacteria 2842
575 Ga0268264_10096690 3300028381 Bacteria 2558
576 Ga0268264_10389244 3300028381 Bacteria 1337
577 Ga0268264_10726573 3300028381 Bacteria 988
578 Ga0268264_10742800 3300028381 Bacteria 977
579 Ga0268264_11247341 3300028381 Unclassified 753
580 Ga0265318_10002178 3300028577 Bacteria 10607
581 Ga0265330_10030821 3300031235 Unclassified 2406
582 Ga0265332_10003617 3300031238 Bacteria 7406
583 Ga0265328_10393644 3300031239 Bacteria 543
584 Ga0265320_10016075 3300031240 Bacteria 4205
585 Ga0265331_10036116 3300031250 Bacteria 2428
586 Ga0265313_10168110 3300031595 Bacteria 928
587 Ga0265314_10017118 3300031711 Bacteria 5698
588 Ga0265342_10129291 3300031712 Bacteria 1416
589 Ga0373930_0015314 3300034816 Bacteria 1438
590 Ga0373948_0001061 3300034817 Bacteria 3709
591 Ga0373948_0008101 3300034817 Unclassified 1783
592 Ga0373948_0062094 3300034817 Bacteria 822
593 Ga0373950_0029386 3300034818 Bacteria 1011
594 Ga0373958_0003372 3300034819 Bacteria 2297
595 Ga0373928_0023247 3300035084 Bacteria 1321
596 Ga0373929_0008937 3300035085 Bacteria 1851
597 Ga0373929_0062786 3300035085 Bacteria 873
598 Ga0373929_0185484 3300035085 Bacteria 576
599 Ga0373940_0010213 3300035088 Bacteria 2202
600 Ga0373940_0047654 3300035088 Bacteria 1196
601 Ga0373940_0069511 3300035088 Unclassified 1022
602 Ga0373949_0007465 3300035090 Bacteria 2393
603 Ga0373949_0052492 3300035090 Bacteria 1030
604 Ga0373951_0001250 3300035091 Bacteria 6721
605 Ga0373951_0103813 3300035091 Bacteria 758
606 Ga0373952_0012381 3300035092 Bacteria 1677
607 Ga0373932_0001204 3300035112 Bacteria 7370
608 Ga0373932_0027649 3300035112 Bacteria 1554
609 Ga0373932_0036010 3300035112 Unclassified 1403
610 Ga0373932_0278156 3300035112 Bacteria 618
611 Ga0373939_0002228 3300035114 Bacteria 4593
612 Ga0373939_0003829 3300035114 Bacteria 3546
613 Ga0373939_0036686 3300035114 Unclassified 1452
614 Ga0373941_0035156 3300035115 Bacteria 1516
615 Ga0373945_0095740 3300035116 Bacteria 1156
616 Ga0373960_0004395 3300035121 Bacteria 3227
617 Ga0373960_0122833 3300035121 Unclassified 863
618 Ga0373960_0165207 3300035121 Bacteria 764
619 Ga0373960_0171611 3300035121 Bacteria 752
620 Ga0373946_0378020 3300035171 Bacteria 712
621 Ga0373942_0014439 3300035207 Bacteria 1912
622 Ga0373942_0036424 3300035207 Bacteria 1325
623 Ga0373961_0106399 3300035241 Unclassified 914
624 Ga0373961_0141851 3300035241 Bacteria 812
625 Ga0373962_0003993 3300035242 Bacteria 3551
626 Ga0373962_0024680 3300035242 Bacteria 1610
627 Ga0373962_0240083 3300035242 Unclassified 626
628 Ga0373931_0001213 3300035691 Bacteria 11020
629 Ga0373931_0005406 3300035691 Bacteria 5903
630 Ga0373931_0012331 3300035691 Bacteria 4140
631 Ga0373931_0143656 3300035691 Bacteria 1385
632 Ga0373931_0700116 3300035691 Bacteria 669
633 Ga0373927_0959146 3300035695 Bacteria 564
634 Ga0373947_0683065 3300035725 Bacteria 700
635 Ga0373925_0086456 3300037068 Bacteria 2392
636 Ga0395900_0975736 3300037418 Bacteria 768
637 Ga0395905_0137249 3300037471 Bacteria 2301
638 Ga0395901_0109384 3300038443 Bacteria 2902
639 Ga0242420_126378 3300038996 Unclassified 561
640 Ga0436360_0235166 3300039438 Bacteria 958
641 Ga0439453_0028926 3300041408 Bacteria 1040
642 Ga0439441_028110 3300042001 Bacteria 1076
643 Ga0439459_0058069 3300042438 Bacteria 867
644 Ga0451577_0002450 3300042876 Bacteria 22102
645 Ga0451577_0139645 3300042876 Unclassified 2177
646 Ga0451577_1382244 3300042876 Bacteria 625
647 Ga0439440_0020359 3300042993 Bacteria 1487
648 Ga0453683_0845749 3300044673 Unclassified 603
649 Ga0453683_0907686 3300044673 Unclassified 582
650 Ga0453684_0042007 3300044712 Bacteria 6171
651 Ga0451576_0023485 3300045051 Bacteria 6676
652 Ga0451576_0058914 3300045051 Bacteria 4011
653 Ga0451576_0481681 3300045051 Unclassified 1303
654 Ga0451576_0680858 3300045051 Unclassified 1080
655 Ga0451576_0782832 3300045051 Bacteria 1002
656 Ga0451576_1024434 3300045051 Bacteria 865
657 Ga0495603_0008486 3300046455 Bacteria 6208
658 Ga0495590_0370978 3300046457 Unclassified 546
659 Ga0495584_0071096 3300046491 Bacteria 1749
660 Ga0495584_0207019 3300046491 Bacteria 997
661 Ga0495620_0237036 3300046515 Bacteria 697
662 Ga0495663_0021788 3300046525 Bacteria 1848
663 Ga0495642_0038698 3300046528 Bacteria 1933
664 Ga0495642_0040711 3300046528 Bacteria 1888
665 Ga0495598_0006550 3300046537 Bacteria 2635
666 Ga0495621_0050134 3300046539 Bacteria 1491
667 Ga0495633_0329076 3300046558 Bacteria 693
668 Ga0495656_0027075 3300046615 Bacteria 2288
669 Ga0495656_0145876 3300046615 Bacteria 1139
670 Ga0495659_0145457 3300046664 Bacteria 949
671 Ga0495669_0024090 3300046684 Bacteria 2652
672 Ga0495670_0457498 3300046691 Bacteria 692
673 Ga0495636_0181942 3300047318 Bacteria 954
674 Ga0495636_0184072 3300047318 Bacteria 949
675 Ga0496102_0025061 3300048905 Bacteria 5306
676 Ga0496103_0009532 3300048906 Bacteria 5748
677 Ga0496108_0411570 3300048911 Bacteria 1181
678 Ga0496115_0966236 3300048918 Bacteria 653
679 Ga0501036_0107302 3300049572 Bacteria 2361
680 Ga0501039_0051104 3300049575 Bacteria 3199
681 Ga0501040_0162668 3300049576 Bacteria 1578
682 Ga0501041_0094641 3300049577 Bacteria 1845
683 Ga0501042_0170456 3300049578 Bacteria 1570
684 Ga0501046_0024732 3300049580 Bacteria 4922
685 Ga0501048_0169713 3300049582 Bacteria 1545
686 Ga0501068_0282851 3300049584 Bacteria 1060
687 Ga0501071_0021634 3300049587 Bacteria 4481
688 Ga0501072_0003523 3300049588 Bacteria 11791
689 Ga0501072_0151989 3300049588 Bacteria 1846
690 Ga0501073_1008597 3300049589 Bacteria 573
691 Ga0501074_0082064 3300049590 Bacteria 2312
692 Ga0501075_0233152 3300049591 Bacteria 1403
693 Ga0501077_0152862 3300049593 Bacteria 1464
694 Ga0501079_0010755 3300049741 Bacteria 6968
695 Ga0501080_0524386 3300049742 Bacteria 1057
696 Ga0501080_1562496 3300049742 Bacteria 559
697 Ga0501083_0032943 3300049744 Bacteria 3550
698 Ga0501083_0107050 3300049744 Bacteria 1840
699 Ga0501083_0118159 3300049744 Bacteria 1739
700 Ga0501083_0400229 3300049744 Bacteria 893
701 Ga0501035_0211515 3300049822 Unclassified 1659
702 Ga0501045_0012643 3300049824 Bacteria 5943
703 nmdc:mga03683_6575_c1 3300050489 Bacteria 3989
704 nmdc:mga00v17_16351_c1 3300050491 Bacteria 4182
705 nmdc:mga0k408_12737_c1 3300050493 Bacteria 4600
706 nmdc:mga06z11_14571_c2 3300050494 Bacteria 2134
707 nmdc:mga07m45_644173_c1 3300050496 Bacteria 611
708 nmdc:mga05p37_1147425_c1 3300050507 Unclassified 809
709 nmdc:mga05p37_1160054_c1 3300050507 Bacteria 803
710 nmdc:mga05p37_204918_c1 3300050507 Bacteria 2387
711 nmdc:mga05p37_205643_c1 3300050507 Bacteria 2381
712 nmdc:mga05p37_27381_c1 3300050507 Bacteria 6940
713 nmdc:mga05p37_2936_c1 3300050507 Bacteria 19785
714 nmdc:mga05p37_3021_c1 3300050507 Bacteria 19531
715 nmdc:mga05p37_306211_c1 3300050507 Bacteria 1885
716 nmdc:mga05p37_517_c1 3300050507 Bacteria 42690
717 nmdc:mga05p37_99320_c1 3300050507 Bacteria 3585
718 nmdc:mga09592_113502_c1 3300050508 Bacteria 2325
719 nmdc:mga09592_23130_c1 3300050508 Bacteria 5130
720 nmdc:mga09592_26354_c1 3300050508 Bacteria 4815
721 nmdc:mga09592_27030_c1 3300050508 Unclassified 4758
722 nmdc:mga09592_270493_c1 3300050508 Bacteria 1474
723 nmdc:mga09592_293024_c1 3300050508 Bacteria 1411
724 nmdc:mga09592_457215_c1 3300050508 Bacteria 1101
725 nmdc:mga09592_57928_c1 3300050508 Bacteria 3276
726 nmdc:mga09592_61367_c1 3300050508 Bacteria 3180
727 nmdc:mga09592_712329_c1 3300050508 Bacteria 854
728 nmdc:mga09592_98268_c1 3300050508 Bacteria 2506
729 nmdc:mga0qj67_166793_c1 3300050509 Unclassified 1788
730 nmdc:mga0qj67_24048_c1 3300050509 Bacteria 4694
731 nmdc:mga0qj67_253398_c1 3300050509 Bacteria 1428
732 nmdc:mga0qj67_288620_c1 3300050509 Bacteria 1330
733 nmdc:mga0qj67_31121_c1 3300050509 Bacteria 4156
734 nmdc:mga0qj67_372676_c1 3300050509 Bacteria 1153
735 nmdc:mga0qj67_85893_c1 3300050509 Unclassified 2524
736 nmdc:mga06r32_1026872_c1 3300050510 Bacteria 776
737 nmdc:mga06r32_111773_c1 3300050510 Unclassified 2689
738 nmdc:mga06r32_1532458_c1 3300050510 Bacteria 606
739 nmdc:mga06r32_24562_c1 3300050510 Bacteria 5597
740 nmdc:mga06r32_2497_c1 3300050510 Bacteria 16458
741 nmdc:mga06r32_255376_c1 3300050510 Bacteria 1740
742 nmdc:mga06r32_3402_c1 3300050510 Bacteria 14233
743 nmdc:mga06r32_446500_c1 3300050510 Bacteria 1273
744 nmdc:mga06r32_48669_c1 3300050510 Bacteria 4053
745 nmdc:mga06r32_820852_c1 3300050510 Bacteria 889
746 nmdc:mga08y16_103704_c1 3300050511 Bacteria 2961
747 nmdc:mga08y16_121865_c1 3300050511 Bacteria 2714
748 nmdc:mga08y16_1257_c1 3300050511 Bacteria 25160
749 nmdc:mga08y16_3030_c1 3300050511 Bacteria 17353
750 nmdc:mga08y16_52549_c1 3300050511 Unclassified 4263
751 nmdc:mga08y16_733942_c1 3300050511 Bacteria 985
752 nmdc:mga08y16_7719_c1 3300050511 Bacteria 11266
753 nmdc:mga08y16_892337_c1 3300050511 Bacteria 876
754 nmdc:mga08y16_97301_c1 3300050511 Bacteria 3065
755 nmdc:mga0n895_15178_c1 3300050512 Bacteria 7018
756 nmdc:mga0n895_153429_c1 3300050512 Bacteria 2334
757 nmdc:mga0n895_181151_c1 3300050512 Bacteria 2138
758 nmdc:mga0n895_2132482_c1 3300050512 Unclassified 517
759 nmdc:mga0n895_214431_c1 3300050512 Bacteria 1955
760 nmdc:mga0n895_32540_c1 3300050512 Bacteria 5006
761 nmdc:mga0n895_351856_c1 3300050512 Unclassified 1492
762 nmdc:mga0n895_37329_c1 3300050512 Bacteria 4700
763 nmdc:mga0n895_79963_c1 3300050512 Bacteria 3256
764 nmdc:mga0rr50_10880_c1 3300050513 Bacteria 5800
765 nmdc:mga0rr50_12722_c1 3300050513 Bacteria 5452
766 nmdc:mga0rr50_1302261_c1 3300050513 Unclassified 616
767 nmdc:mga0rr50_170713_c1 3300050513 Bacteria 1772
768 nmdc:mga0rr50_252590_c1 3300050513 Bacteria 1465
769 nmdc:mga0rr50_295312_c1 3300050513 Unclassified 1355
770 nmdc:mga0rr50_58174_c1 3300050513 Bacteria 2896
771 nmdc:mga0rr50_64660_c1 3300050513 Bacteria 2768
772 nmdc:mga0rr50_81693_c2 3300050513 Bacteria 1258
773 nmdc:mga08x19_105731_c1 3300050514 Bacteria 1872
774 nmdc:mga08x19_55045_c1 3300050514 Bacteria 2562
775 nmdc:mga0a205_134231_c1 3300050515 Unclassified 2376
776 nmdc:mga0a205_13506_c1 3300050515 Bacteria 7606
777 nmdc:mga0a205_183671_c1 3300050515 Unclassified 1985
778 nmdc:mga0a205_183960_c1 3300050515 Bacteria 1983
779 nmdc:mga0a205_246642_c1 3300050515 Bacteria 1666
780 nmdc:mga0a205_336665_c1 3300050515 Unclassified 1378
781 nmdc:mga0a205_345779_c1 3300050515 Bacteria 1355
782 nmdc:mga0a205_40536_c1 3300050515 Bacteria 4483
783 nmdc:mga0a205_592824_c1 3300050515 Bacteria 962
784 nmdc:mga0a205_59587_c1 3300050515 Bacteria 3687
785 nmdc:mga0a205_770274_c1 3300050515 Bacteria 810
786 Ga0501084_0024752 3300054114 Bacteria 5009
787 Ga0501082_0000016 3300060353 Bacteria 115081
788 Ga0501082_0011884 3300060353 Bacteria 7483
789 Ga0501082_1980196 3300060353 Bacteria 508
790 Ga0114129_10344273
791 JGI24744J21845_10025995
792 JGI24742J22300_10043820
793 JGI24751J29686_10057899
794 JGI25406J46586_10223172
795 Ga0065715_10187987
796 Ga0065715_10532512
797 Ga0065707_10001557
798 Ga0065707_10097100
799 Ga0065707_10188684
800 Ga0065707_10221916
801 Ga0065707_10244256
802 Ga0065707_10338356
803 Ga0065707_10621832
804 Ga0070676_10223933
805 Ga0070676_10621794
806 Ga0070676_10733356
807 Ga0070690_100117771
808 Ga0070690_100356006
809 Ga0070690_100489833
810 Ga0070690_100941641
811 Ga0070670_100071231
812 Ga0070670_100115889
813 Ga0070670_100758630
814 Ga0070670_100871084
815 Ga0070677_10034212
816 Ga0070677_10122571
817 Ga0068869_100011048
818 Ga0068869_100015229
819 Ga0068869_101364616
820 Ga0070666_10044889
821 Ga0070666_10241263
822 Ga0070666_10671100
823 Ga0070680_100129307
824 Ga0070680_100214682
825 Ga0068868_100209962
826 Ga0068868_100480974
827 Ga0070689_101440451
828 Ga0070691_10295500
829 Ga0070691_10297911
830 Ga0070687_100187479
831 Ga0070687_100327210
832 Ga0070687_100803373
833 Ga0070692_10049809
834 Ga0070692_10190625
835 Ga0070668_100025330
836 Ga0070668_100075627
837 Ga0070668_101170408
838 Ga0070668_101288790
839 Ga0070669_100043999
840 Ga0070669_100064607
841 Ga0070669_100090938
842 Ga0070669_100174389
843 Ga0070669_100222315
844 Ga0070669_100358555
845 Ga0070669_100373057
846 Ga0070675_100001085
847 Ga0070675_100042543
848 Ga0070675_100620472
849 Ga0070675_101019919
850 Ga0070671_100055518
851 Ga0070671_100548624
852 Ga0070674_100000588
853 Ga0070673_100039287
854 Ga0070673_100045823
855 Ga0070673_100072051
856 Ga0070673_100327437
857 Ga0070673_100709337
858 Ga0070673_100979926
859 Ga0070688_100023903
860 Ga0070688_100104873
861 Ga0070688_100405711
862 Ga0070688_100532454
863 Ga0070659_100290303
864 Ga0070659_100349593
865 Ga0070659_100475659
866 Ga0070667_100424433
867 Ga0070667_101224998
868 Ga0070667_101821199
869 Ga0070667_102152331
870 Ga0070709_10358916
871 Ga0070701_10413882
872 Ga0070701_10560894
873 Ga0070701_11201009
874 Ga0070705_100116374
875 Ga0070705_100155689
876 Ga0070705_100497396
877 Ga0070705_100732110
878 Ga0070700_100042642
879 Ga0070700_100099524
880 Ga0070700_100438972
881 Ga0070700_100625722
882 Ga0070694_100106283
883 Ga0070708_100025171
884 Ga0070708_100040895
885 Ga0070708_100051381
886 Ga0070708_100070463
887 Ga0070708_100070975
888 Ga0070708_100081015
889 Ga0070708_100200219
890 Ga0070708_100293528
891 Ga0070708_100984039
892 Ga0070678_100004453
893 Ga0070678_100075374
894 Ga0070678_100151844
895 Ga0070678_101307621
896 Ga0070662_100024226
897 Ga0070662_100071909
898 Ga0070662_100223734
899 Ga0070662_100378741
900 Ga0070681_10009692
901 Ga0070681_10157350
902 Ga0070681_10158660
903 Ga0068867_100002633
904 Ga0068867_100063275
905 Ga0068867_100119661
906 Ga0068867_100624322
907 Ga0068867_100686774
908 Ga0070685_10710268
909 Ga0070706_100022999
910 Ga0070706_100048473
911 Ga0070706_100225145
912 Ga0070706_100497830
913 Ga0070707_100022590
914 Ga0070707_100025451
915 Ga0070707_100025770
916 Ga0070707_100029187
917 Ga0070707_100096449
918 Ga0070707_100641788
919 Ga0070707_100647286
920 Ga0070707_101314162
921 Ga0070707_101334892
922 Ga0070698_100001397
923 Ga0070698_100189727
924 Ga0070698_100236627
925 Ga0070699_100010797
926 Ga0070699_100010971
927 Ga0070699_100029740
928 Ga0070699_100054808
929 Ga0070699_100096198
930 Ga0070699_100976390
931 Ga0070699_101745953
932 Ga0070679_100014793
933 Ga0070697_100001716
934 Ga0070697_100045483
935 Ga0070697_100055523
936 Ga0070697_100572849
937 Ga0070697_100995793
938 Ga0070697_101806796
939 Ga0068853_100752928
940 Ga0070672_100004437
941 Ga0070672_100058238
942 Ga0070672_100149419
943 Ga0070672_100290394
944 Ga0070686_100208630
945 Ga0070686_100484842
946 Ga0070686_101210712
947 Ga0070695_100051974
948 Ga0070695_100090026
949 Ga0070696_100033959
950 Ga0070696_100084601
951 Ga0070696_100086728
952 Ga0070696_100302450
953 Ga0070696_100325560
954 Ga0070696_100455850
955 Ga0070696_100841509
956 Ga0070693_100136833
957 Ga0070693_100408453
958 Ga0070693_100717254
959 Ga0070704_100025708
960 Ga0070704_100027559
961 Ga0070704_100137833
962 Ga0070704_100329781
963 Ga0070664_100523199
964 Ga0070664_100640819
965 Ga0068857_100080545
966 Ga0068857_100182095
967 Ga0068857_101478299
968 Ga0068856_101014594
969 Ga0070702_100585307
970 Ga0070702_100751750
971 Ga0068852_100436488
972 Ga0068859_100288080
973 Ga0068859_100308727
974 Ga0068859_100386677
975 Ga0068859_100549397
976 Ga0068859_101022664
977 Ga0068859_101840401
978 Ga0068864_100014952
979 Ga0068864_100017199
980 Ga0068864_100132623
981 Ga0068864_100135404
982 Ga0068864_100220325
983 Ga0068866_10014193
984 Ga0068861_100040484
985 Ga0068861_100158161
986 Ga0068861_100260449
987 Ga0068861_100374523
988 Ga0068861_100382676
989 Ga0068861_100515514
990 Ga0068861_100898333
991 Ga0068870_10034593
992 Ga0068870_10050359
993 Ga0068870_10223548
994 Ga0068870_10258864
995 Ga0068870_11212721
996 Ga0068863_100594794
997 Ga0068863_100678663
998 Ga0068858_100163809
999 Ga0068860_100011426
1000 Ga0068860_100240831
1001 Ga0068860_100443619
1002 Ga0068860_100571525
1003 Ga0068860_100860614
1004 Ga0068860_102671645
1005 Ga0068862_100005002
1006 Ga0068862_100028009
1007 Ga0068862_100176728
1008 Ga0068862_100194064
1009 Ga0068862_100318983
1010 Ga0068862_100817884
1011 Ga0068862_101112158
1012 Ga0068862_102125906
1013 Ga0081455_10404684
1014 Ga0081539_10000180
1015 Ga0075363_100000437
1016 Ga0075363_100758825
1017 Ga0075432_10178253
1018 Ga0075432_10407537
1019 Ga0075362_10001310
1020 Ga0075367_10022950
1021 Ga0075369_10047831
1022 Ga0097621_100783159
1023 Ga0075370_10708878
1024 Ga0068871_100308498
1025 Ga0068871_100873050
1026 Ga0075428_100008076
1027 Ga0075428_100141332
1028 Ga0075428_100142242
1029 Ga0075428_100753492
1030 Ga0075428_101597988
1031 Ga0075430_100000497
1032 Ga0075430_100045904
1033 Ga0075430_100075140
1034 Ga0075430_100168127
1035 Ga0075430_100181073
1036 Ga0075430_100387876
1037 Ga0075430_100774935
1038 Ga0075431_100000294
1039 Ga0075431_100002661
1040 Ga0075431_100021409
1041 Ga0075431_100032705
1042 Ga0075431_100046450
1043 Ga0075431_100049713
1044 Ga0075431_100637066
1045 Ga0075431_100659948
1046 Ga0075431_101024686
1047 Ga0075431_101086606
1048 Ga0075433_10021333
1049 Ga0075433_10034806
1050 Ga0075433_10040041
1051 Ga0075433_10078776
1052 Ga0075433_10146439
1053 Ga0075433_10150043
1054 Ga0075433_11134029
1055 Ga0075433_11423411
1056 Ga0075434_100032929
1057 Ga0075434_100035465
1058 Ga0075434_100035934
1059 Ga0075434_100060506
1060 Ga0075434_100093875
1061 Ga0075434_100103901
1062 Ga0075434_100107716
1063 Ga0075434_100158648
1064 Ga0075434_100188802
1065 Ga0075434_100224691
1066 Ga0075434_100227769
1067 Ga0075434_100505068
1068 Ga0075434_101511028
1069 Ga0075429_100004499
1070 Ga0075429_100024474
1071 Ga0075429_100037328
1072 Ga0075429_100048166
1073 Ga0075429_100125901
1074 Ga0075429_100232333
1075 Ga0075429_100268493
1076 Ga0075429_100291027
1077 Ga0068865_100066535
1078 Ga0068865_100275836
1079 Ga0068865_100318113
1080 Ga0068865_100702069
1081 Ga0075436_100048822
1082 Ga0075436_100693548
1083 Ga0097620_100211892
1084 Ga0097620_100288088
1085 Ga0097620_100308727
1086 Ga0097620_100386680
1087 Ga0097620_100549408
1088 Ga0097620_101022779
1089 Ga0097620_101840423
1090 Ga0075435_100002819
1091 Ga0075435_100008935
1092 Ga0075435_100059264
1093 Ga0075435_100113314
1094 Ga0075435_100159689
1095 Ga0075435_100181325
1096 Ga0075435_100839923
1097 Ga0099794_10037923
1098 Ga0099794_10149401
1099 Ga0105240_11247325
1100 Ga0111539_10000111
1101 Ga0111539_10015730
1102 Ga0111539_10065546
1103 Ga0111539_10168263
1104 Ga0111539_10186513
1105 Ga0111539_10284405
1106 Ga0111539_10656795
1107 Ga0111539_10745366
1108 Ga0111539_11464133
1109 Ga0105245_10066500
1110 Ga0105245_10206637
1111 Ga0105245_11826379
1112 Ga0105247_10119944
1113 Ga0114129_10003348
1114 Ga0114129_10004389
1115 Ga0114129_10006262
1116 Ga0114129_10048310
1117 Ga0114129_10066533
1118 Ga0114129_10079714
1119 Ga0114129_10239720
1120 Ga0114129_10272541
1121 Ga0114129_10323351
1122 Ga0114129_10336892
1123 Ga0114129_10651384
1124 Ga0114129_10864556
1125 Ga0105243_10006918
1126 Ga0105243_10014194
1127 Ga0105243_10211695
1128 Ga0105243_10220701
1129 Ga0105243_10298520
1130 Ga0105243_10389680
1131 Ga0105243_10480848
1132 Ga0105243_10597098
1133 Ga0105243_10869058
1134 Ga0105241_10196983
1135 Ga0105241_10217253
1136 Ga0105242_10039382
1137 Ga0105242_11305340
1138 Ga0105248_10518538
1139 Ga0105248_11348768
1140 Ga0105249_10016751
1141 Ga0105249_10094822
1142 Ga0105249_10211930
1143 Ga0105249_10799532
1144 Ga0105249_10996681
1145 Ga0105239_10648813
1146 Ga0105239_13403409
1147 Ga0105246_10217969
1148 Ga0105246_11005614
1149 Ga0105246_11359837
1150 Ga0157374_10131088
1151 Ga0157374_10796300
1152 Ga0157374_11411814
1153 Ga0157374_11655316
1154 Ga0157378_10207637
1155 Ga0157378_10384409
1156 Ga0157378_10517731
1157 Ga0163162_10008907
1158 Ga0163162_10276215
1159 Ga0163162_10432818
1160 Ga0157375_10482116
1161 Ga0157375_10901704
1162 Ga0157375_11306078
1163 Ga0157375_11530764
1164 Ga0157375_11537316
1165 Ga0163163_11086317
1166 Ga0157380_10000634
1167 Ga0157380_10087494
1168 Ga0157380_10122923
1169 Ga0157380_10217135
1170 Ga0157380_10756891
1171 Ga0157377_10152260
1172 Ga0157377_10307585
1173 Ga0157377_10955826
1174 Ga0157379_11172775
1175 Ga0157379_11243639
1176 Ga0157376_10286632
1177 Ga0157376_10580658
1178 Ga0163161_10030103
1179 Ga0207697_10023958
1180 Ga0207656_10280720
1181 Ga0207653_10025451
1182 Ga0207653_10058843
1183 Ga0207653_10383973
1184 Ga0207682_10017308
1185 Ga0207682_10283251
1186 Ga0207642_10064986
1187 Ga0207688_10058383
1188 Ga0207688_10098511
1189 Ga0207688_10127700
1190 Ga0207680_10069582
1191 Ga0207680_10359410
1192 Ga0207680_10652241
1193 Ga0207680_10977612
1194 Ga0207699_10050179
1195 Ga0207645_10018134
1196 Ga0207645_10038564
1197 Ga0207645_10052615
1198 Ga0207645_10180326
1199 Ga0207643_10019529
1200 Ga0207643_10034100
1201 Ga0207643_10034643
1202 Ga0207643_10055157
1203 Ga0207643_10333862
1204 Ga0207684_10000464
1205 Ga0207684_10015631
1206 Ga0207684_10051267
1207 Ga0207684_10066579
1208 Ga0207684_10158793
1209 Ga0207684_10214337
1210 Ga0207684_10456347
1211 Ga0207654_10276154
1212 Ga0207654_10482222
1213 Ga0207707_10128372
1214 Ga0207707_10648320
1215 Ga0207660_10153550
1216 Ga0207660_10184750
1217 Ga0207660_10285289
1218 Ga0207662_10023520
1219 Ga0207662_10055671
1220 Ga0207662_10166389
1221 Ga0207662_10338916
1222 Ga0207662_10445970
1223 Ga0207657_11405723
1224 Ga0207652_10042491
1225 Ga0207646_10001668
1226 Ga0207646_10006866
1227 Ga0207646_10024823
1228 Ga0207646_10044420
1229 Ga0207646_10051525
1230 Ga0207646_10295199
1231 Ga0207646_10379078
1232 Ga0207646_11796756
1233 Ga0207681_10010452
1234 Ga0207681_10021373
1235 Ga0207681_10075613
1236 Ga0207681_10189490
1237 Ga0207681_10383256
1238 Ga0207681_11167362
1239 Ga0207681_11485398
1240 Ga0207650_10043323
1241 Ga0207650_10081740
1242 Ga0207650_11657080
1243 Ga0207659_10024355
1244 Ga0207659_10081353
1245 Ga0207659_10246283
1246 Ga0207659_10286991
1247 Ga0207659_10976290
1248 Ga0207687_10034529
1249 Ga0207687_10490701
1250 Ga0207687_10944634
1251 Ga0207644_10064529
1252 Ga0207644_10465085
1253 Ga0207690_10267165
1254 Ga0207690_10572948
1255 Ga0207690_10939532
1256 Ga0207706_10014951
1257 Ga0207706_10037158
1258 Ga0207706_10186851
1259 Ga0207706_10468759
1260 Ga0207706_10947963
1261 Ga0207686_10446875
1262 Ga0207709_10003471
1263 Ga0207709_10060822
1264 Ga0207709_10112102
1265 Ga0207709_10345396
1266 Ga0207670_10599790
1267 Ga0207670_11667664
1268 Ga0207669_10000465
1269 Ga0207669_10063157
1270 Ga0207669_10223474
1271 Ga0207669_10226016
1272 Ga0207669_10895787
1273 Ga0207704_10000545
1274 Ga0207704_10039943
1275 Ga0207704_10071003
1276 Ga0207704_10130977
1277 Ga0207704_11224151
1278 Ga0207665_10576485
1279 Ga0207691_10009134
1280 Ga0207691_10013963
1281 Ga0207691_10135211
1282 Ga0207691_10198485
1283 Ga0207691_10424525
1284 Ga0207689_10017712
1285 Ga0207689_10087011
1286 Ga0207689_10297694
1287 Ga0207689_10636169
1288 Ga0207689_10946127
1289 Ga0207689_10955168
1290 Ga0207679_10365417
1291 Ga0207679_10495995
1292 Ga0207667_11773547
1293 Ga0207651_10001874
1294 Ga0207651_10250001
1295 Ga0207651_10300053
1296 Ga0207651_11227337
1297 Ga0207712_10001551
1298 Ga0207712_10020267
1299 Ga0207712_10163353
1300 Ga0207712_10507901
1301 Ga0207712_11264178
1302 Ga0207668_10016426
1303 Ga0207668_10022543
1304 Ga0207668_10023173
1305 Ga0207668_10443877
1306 Ga0207668_10528720
1307 Ga0207668_11506564
1308 Ga0207640_11503882
1309 Ga0207658_10155595
1310 Ga0207658_10308671
1311 Ga0207677_10069311
1312 Ga0207677_10221812
1313 Ga0207703_10252751
1314 Ga0207703_10396229
1315 Ga0207708_10001449
1316 Ga0207708_10009813
1317 Ga0207708_10270909
1318 Ga0207708_10824330
1319 Ga0207708_10896464
1320 Ga0207708_11445153
1321 Ga0207641_10214737
1322 Ga0207641_10316388
1323 Ga0207641_10377669
1324 Ga0207641_10398729
1325 Ga0207641_11404349
1326 Ga0207648_10000297
1327 Ga0207648_10020005
1328 Ga0207648_10030508
1329 Ga0207648_10079338
1330 Ga0207648_10079795
1331 Ga0207648_10847463
1332 Ga0207676_10152589
1333 Ga0207676_10317606
1334 Ga0207676_10446935
1335 Ga0207674_10098814
1336 Ga0207674_10212021
1337 Ga0207675_100033928
1338 Ga0207675_100034957
1339 Ga0207675_100270152
1340 Ga0207675_100700795
1341 Ga0207675_101935899
1342 Ga0207683_10010991
1343 Ga0207683_10069340
1344 Ga0207683_10124254
1345 Ga0207683_10229121
1346 Ga0207683_10567513
1347 Ga0207683_11172576
1348 Ga0209588_1073010
1349 Ga0207428_10000069
1350 Ga0207428_10001771
1351 Ga0207428_10013402
1352 Ga0207428_10047291
1353 Ga0207428_10450836
1354 Ga0207428_10457664
1355 Ga0268266_11624613
1356 Ga0268265_10001755
1357 Ga0268265_10035788
1358 Ga0268265_10045390
1359 Ga0268265_10143523
1360 Ga0268265_10350985
1361 Ga0268265_10611966
1362 Ga0268265_11398626
1363 Ga0268264_10076860
1364 Ga0268264_10096690
1365 Ga0268264_10389244
1366 Ga0268264_10726573
1367 Ga0268264_10742800
1368 Ga0268264_11247341
1369 Ga0265318_10002178
1370 Ga0265330_10030821
1371 Ga0265332_10003617
1372 Ga0265328_10393644
1373 Ga0265320_10016075
1374 Ga0265331_10036116
1375 Ga0265313_10168110
1376 Ga0265314_10017118
1377 Ga0265342_10129291
1378 Ga0373930_0015314
1379 Ga0373948_0001061
1380 Ga0373948_0008101
1381 Ga0373948_0062094
1382 Ga0373950_0029386
1383 Ga0373958_0003372
1384 Ga0373928_0023247
1385 Ga0373929_0008937
1386 Ga0373929_0062786
1387 Ga0373929_0185484
1388 Ga0373940_0010213
1389 Ga0373940_0047654
1390 Ga0373940_0069511
1391 Ga0373949_0007465
1392 Ga0373949_0052492
1393 Ga0373951_0001250
1394 Ga0373951_0103813
1395 Ga0373952_0012381
1396 Ga0373932_0001204
1397 Ga0373932_0027649
1398 Ga0373932_0036010
1399 Ga0373932_0278156
1400 Ga0373939_0002228
1401 Ga0373939_0003829
1402 Ga0373939_0036686
1403 Ga0373941_0035156
1404 Ga0373945_0095740
1405 Ga0373960_0004395
1406 Ga0373960_0122833
1407 Ga0373960_0165207
1408 Ga0373960_0171611
1409 Ga0373946_0378020
1410 Ga0373942_0014439
1411 Ga0373942_0036424
1412 Ga0373961_0106399
1413 Ga0373961_0141851
1414 Ga0373962_0003993
1415 Ga0373962_0024680
1416 Ga0373962_0240083
1417 Ga0373931_0001213
1418 Ga0373931_0005406
1419 Ga0373931_0012331
1420 Ga0373931_0143656
1421 Ga0373931_0700116
1422 Ga0373927_0959146
1423 Ga0373947_0683065
1424 Ga0373925_0086456
1425 Ga0395900_0975736
1426 Ga0395905_0137249
1427 Ga0395901_0109384
1428 Ga0242420_126378
1429 Ga0436360_0235166
1430 Ga0439453_0028926
1431 Ga0439441_028110
1432 Ga0439459_0058069
1433 Ga0451577_0002450
1434 Ga0451577_0139645
1435 Ga0451577_1382244
1436 Ga0439440_0020359
1437 Ga0453683_0845749
1438 Ga0453683_0907686
1439 Ga0453684_0042007
1440 Ga0451576_0023485
1441 Ga0451576_0058914
1442 Ga0451576_0481681
1443 Ga0451576_0680858
1444 Ga0451576_0782832
1445 Ga0451576_1024434
1446 Ga0495603_0008486
1447 Ga0495590_0370978
1448 Ga0495584_0071096
1449 Ga0495584_0207019
1450 Ga0495620_0237036
1451 Ga0495663_0021788
1452 Ga0495642_0038698
1453 Ga0495642_0040711
1454 Ga0495598_0006550
1455 Ga0495621_0050134
1456 Ga0495633_0329076
1457 Ga0495656_0027075
1458 Ga0495656_0145876
1459 Ga0495659_0145457
1460 Ga0495669_0024090
1461 Ga0495670_0457498
1462 Ga0495636_0181942
1463 Ga0495636_0184072
1464 Ga0496102_0025061
1465 Ga0496103_0009532
1466 Ga0496108_0411570
1467 Ga0496115_0966236
1468 Ga0501036_0107302
1469 Ga0501039_0051104
1470 Ga0501040_0162668
1471 Ga0501041_0094641
1472 Ga0501042_0170456
1473 Ga0501046_0024732
1474 Ga0501048_0169713
1475 Ga0501068_0282851
1476 Ga0501071_0021634
1477 Ga0501072_0003523
1478 Ga0501072_0151989
1479 Ga0501073_1008597
1480 Ga0501074_0082064
1481 Ga0501075_0233152
1482 Ga0501077_0152862
1483 Ga0501079_0010755
1484 Ga0501080_0524386
1485 Ga0501080_1562496
1486 Ga0501083_0032943
1487 Ga0501083_0107050
1488 Ga0501083_0118159
1489 Ga0501083_0400229
1490 Ga0501035_0211515
1491 Ga0501045_0012643
1492 nmdc:mga03683_6575_c1
1493 nmdc:mga00v17_16351_c1
1494 nmdc:mga0k408_12737_c1
1495 nmdc:mga06z11_14571_c2
1496 nmdc:mga07m45_644173_c1
1497 nmdc:mga05p37_1147425_c1
1498 nmdc:mga05p37_1160054_c1
1499 nmdc:mga05p37_204918_c1
1500 nmdc:mga05p37_205643_c1
1501 nmdc:mga05p37_27381_c1
1502 nmdc:mga05p37_2936_c1
1503 nmdc:mga05p37_3021_c1
1504 nmdc:mga05p37_306211_c1
1505 nmdc:mga05p37_517_c1
1506 nmdc:mga05p37_99320_c1
1507 nmdc:mga09592_113502_c1
1508 nmdc:mga09592_23130_c1
1509 nmdc:mga09592_26354_c1
1510 nmdc:mga09592_27030_c1
1511 nmdc:mga09592_270493_c1
1512 nmdc:mga09592_293024_c1
1513 nmdc:mga09592_457215_c1
1514 nmdc:mga09592_57928_c1
1515 nmdc:mga09592_61367_c1
1516 nmdc:mga09592_712329_c1
1517 nmdc:mga09592_98268_c1
1518 nmdc:mga0qj67_166793_c1
1519 nmdc:mga0qj67_24048_c1
1520 nmdc:mga0qj67_253398_c1
1521 nmdc:mga0qj67_288620_c1
1522 nmdc:mga0qj67_31121_c1
1523 nmdc:mga0qj67_372676_c1
1524 nmdc:mga0qj67_85893_c1
1525 nmdc:mga06r32_1026872_c1
1526 nmdc:mga06r32_111773_c1
1527 nmdc:mga06r32_1532458_c1
1528 nmdc:mga06r32_24562_c1
1529 nmdc:mga06r32_2497_c1
1530 nmdc:mga06r32_255376_c1
1531 nmdc:mga06r32_3402_c1
1532 nmdc:mga06r32_446500_c1
1533 nmdc:mga06r32_48669_c1
1534 nmdc:mga06r32_820852_c1
1535 nmdc:mga08y16_103704_c1
1536 nmdc:mga08y16_121865_c1
1537 nmdc:mga08y16_1257_c1
1538 nmdc:mga08y16_3030_c1
1539 nmdc:mga08y16_52549_c1
1540 nmdc:mga08y16_733942_c1
1541 nmdc:mga08y16_7719_c1
1542 nmdc:mga08y16_892337_c1
1543 nmdc:mga08y16_97301_c1
1544 nmdc:mga0n895_15178_c1
1545 nmdc:mga0n895_153429_c1
1546 nmdc:mga0n895_181151_c1
1547 nmdc:mga0n895_2132482_c1
1548 nmdc:mga0n895_214431_c1
1549 nmdc:mga0n895_32540_c1
1550 nmdc:mga0n895_351856_c1
1551 nmdc:mga0n895_37329_c1
1552 nmdc:mga0n895_79963_c1
1553 nmdc:mga0rr50_10880_c1
1554 nmdc:mga0rr50_12722_c1
1555 nmdc:mga0rr50_1302261_c1
1556 nmdc:mga0rr50_170713_c1
1557 nmdc:mga0rr50_252590_c1
1558 nmdc:mga0rr50_295312_c1
1559 nmdc:mga0rr50_58174_c1
1560 nmdc:mga0rr50_64660_c1
1561 nmdc:mga0rr50_81693_c2
1562 nmdc:mga08x19_105731_c1
1563 nmdc:mga08x19_55045_c1
1564 nmdc:mga0a205_134231_c1
1565 nmdc:mga0a205_13506_c1
1566 nmdc:mga0a205_183671_c1
1567 nmdc:mga0a205_183960_c1
1568 nmdc:mga0a205_246642_c1
1569 nmdc:mga0a205_336665_c1
1570 nmdc:mga0a205_345779_c1
1571 nmdc:mga0a205_40536_c1
1572 nmdc:mga0a205_592824_c1
1573 nmdc:mga0a205_59587_c1
1574 nmdc:mga0a205_770274_c1
1575 Ga0501084_0024752
1576 Ga0501082_0000016
1577 Ga0501082_0011884
1578 Ga0501082_1980196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8811 65 141
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8806 65 141
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8752 61 138
6m9s-assembly1.cif.gz_A crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8728 61 138
6m9s-assembly1.cif.gz_B crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8726 61 138
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8689 62 139 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8642 51 140 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8514 33 141 2.60.120.10
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8494 47 140 2.60.120.10
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8438 33 143 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8IJW0-F1-model_v4 ChrR-like cupin domain-containing protein 0.9992 56 147
AF-A0A524IWX1-F1-model_v4 Cupin domain-containing protein 0.9639 51 145
AF-A0A7I7Q2Z2-F1-model_v4 Uncharacterized protein 0.958 53 151
AF-A0A2V7E2M1-F1-model_v4 Cupin 0.9498 48 151
AF-A0A2V6T7T4-F1-model_v4 ChrR-like cupin domain-containing protein 0.9491 20 147

Map