F480880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 788 | 353 | 1576 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300049515|Ga0501292_048237|Ga0501292_048237_241_717 |
| Length | 158 |
| Sequence | MFSGHNKNPITSSSNVKEVEMAIRNASAVWNGNLKEGDGIMRLGSGAFEGAFTFASRFEEGEGTNPEELVGAAQAGCFSMYLASVLTNAGFPPVQVRTSAKVHLGEGPRITLIELDTEAEVPNVDEKTFQEKVDYSKENCPVSLALTGPELRVSARLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 214 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 300 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 301 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 303 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 307 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 308 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 309 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 315 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 316 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 317 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 318 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 319 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 320 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 321 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 322 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 323 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 324 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 325 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 326 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 327 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 328 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 329 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 330 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 331 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 332 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 333 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 334 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 335 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 336 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 337 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 338 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 339 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 340 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 341 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 342 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 343 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 344 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 345 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 346 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 347 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 348 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 349 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 350 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 351 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 352 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 353 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.67 |
| Metatranscriptomes | 0.38 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0.76 |
| Rhizoplane | 4.06 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501292_048237 | 3300049515 | Unclassified | 749 |
| 2 | JGI25406J46586_10015007 | 3300003203 | Bacteria | 3278 |
| 3 | JGI25406J46586_10017660 | 3300003203 | Bacteria | 2944 |
| 4 | JGI25406J46586_10032081 | 3300003203 | Bacteria | 1956 |
| 5 | JGI25406J46586_10065930 | 3300003203 | Bacteria | 1152 |
| 6 | JGI25406J46586_10098817 | 3300003203 | Bacteria | 872 |
| 7 | Ga0065704_10003919 | 3300005289 | Bacteria | 5237 |
| 8 | Ga0065704_10131556 | 3300005289 | Bacteria | 1623 |
| 9 | Ga0065712_10144598 | 3300005290 | Bacteria | 1419 |
| 10 | Ga0065712_10187289 | 3300005290 | Bacteria | 1163 |
| 11 | Ga0065712_10378705 | 3300005290 | Unclassified | 754 |
| 12 | Ga0065715_10057372 | 3300005293 | Bacteria | 928 |
| 13 | Ga0065715_10138730 | 3300005293 | Bacteria | 1876 |
| 14 | Ga0065707_10030111 | 3300005295 | Unclassified | 1383 |
| 15 | Ga0065707_10086277 | 3300005295 | Bacteria | 5554 |
| 16 | Ga0065707_10089040 | 3300005295 | Bacteria | 4483 |
| 17 | Ga0065707_10410709 | 3300005295 | Bacteria | 800 |
| 18 | Ga0070676_10034089 | 3300005328 | Bacteria | 2922 |
| 19 | Ga0070676_10267932 | 3300005328 | Bacteria | 1146 |
| 20 | Ga0070690_100196698 | 3300005330 | Unclassified | 1400 |
| 21 | Ga0070690_100664726 | 3300005330 | Bacteria | 797 |
| 22 | Ga0068869_100372955 | 3300005334 | Bacteria | 1168 |
| 23 | Ga0070666_10211856 | 3300005335 | Bacteria | 1365 |
| 24 | Ga0070680_100500215 | 3300005336 | Unclassified | 1040 |
| 25 | Ga0070682_100849695 | 3300005337 | Bacteria | 746 |
| 26 | Ga0068868_100106743 | 3300005338 | Bacteria | 2272 |
| 27 | Ga0068868_100154148 | 3300005338 | Bacteria | 1894 |
| 28 | Ga0068868_100479053 | 3300005338 | Bacteria | 1087 |
| 29 | Ga0070660_101242638 | 3300005339 | Bacteria | 632 |
| 30 | Ga0070689_100252378 | 3300005340 | Bacteria | 1456 |
| 31 | Ga0070689_100740811 | 3300005340 | Unclassified | 861 |
| 32 | Ga0070689_100830776 | 3300005340 | Bacteria | 814 |
| 33 | Ga0070689_102007194 | 3300005340 | Bacteria | 529 |
| 34 | Ga0070687_100402547 | 3300005343 | Bacteria | 898 |
| 35 | Ga0070687_101350361 | 3300005343 | Unclassified | 531 |
| 36 | Ga0070668_100000635 | 3300005347 | Bacteria | 23621 |
| 37 | Ga0070668_100124925 | 3300005347 | Bacteria | 2060 |
| 38 | Ga0070668_100828119 | 3300005347 | Bacteria | 824 |
| 39 | Ga0070668_101366014 | 3300005347 | Unclassified | 645 |
| 40 | Ga0070669_100026514 | 3300005353 | Bacteria | 4169 |
| 41 | Ga0070669_100294532 | 3300005353 | Unclassified | 1304 |
| 42 | Ga0070675_100107989 | 3300005354 | Bacteria | 2350 |
| 43 | Ga0070675_101237323 | 3300005354 | Bacteria | 687 |
| 44 | Ga0070671_100026407 | 3300005355 | Bacteria | 4772 |
| 45 | Ga0070671_100152838 | 3300005355 | Bacteria | 1949 |
| 46 | Ga0070671_100347509 | 3300005355 | Bacteria | 1266 |
| 47 | Ga0070671_100642231 | 3300005355 | Bacteria | 919 |
| 48 | Ga0070671_101715348 | 3300005355 | Unclassified | 557 |
| 49 | Ga0070674_100009328 | 3300005356 | Bacteria | 5874 |
| 50 | Ga0070674_100115551 | 3300005356 | Bacteria | 1978 |
| 51 | Ga0070674_100837843 | 3300005356 | Unclassified | 797 |
| 52 | Ga0070673_100166892 | 3300005364 | Unclassified | 1876 |
| 53 | Ga0070673_100797247 | 3300005364 | Bacteria | 872 |
| 54 | Ga0070673_100923831 | 3300005364 | Bacteria | 810 |
| 55 | Ga0070673_101549429 | 3300005364 | Unclassified | 625 |
| 56 | Ga0070688_101364514 | 3300005365 | Bacteria | 574 |
| 57 | Ga0070667_100078030 | 3300005367 | Bacteria | 2828 |
| 58 | Ga0070667_100192334 | 3300005367 | Bacteria | 1808 |
| 59 | Ga0070667_100236666 | 3300005367 | Unclassified | 1629 |
| 60 | Ga0070709_10024337 | 3300005434 | Bacteria | 3563 |
| 61 | Ga0070714_100337539 | 3300005435 | Bacteria | 1412 |
| 62 | Ga0070714_101950995 | 3300005435 | Bacteria | 573 |
| 63 | Ga0070714_102474877 | 3300005435 | Unclassified | 504 |
| 64 | Ga0070713_100861929 | 3300005436 | Bacteria | 870 |
| 65 | Ga0070713_102369173 | 3300005436 | Unclassified | 513 |
| 66 | Ga0070711_100022781 | 3300005439 | Bacteria | 4064 |
| 67 | Ga0070711_100029506 | 3300005439 | Bacteria | 3620 |
| 68 | Ga0070711_100192256 | 3300005439 | Unclassified | 1569 |
| 69 | Ga0070711_100644478 | 3300005439 | Bacteria | 887 |
| 70 | Ga0070705_100263616 | 3300005440 | Unclassified | 1217 |
| 71 | Ga0070705_100512563 | 3300005440 | Unclassified | 913 |
| 72 | Ga0070705_101194980 | 3300005440 | Unclassified | 626 |
| 73 | Ga0070700_100211174 | 3300005441 | Bacteria | 1369 |
| 74 | Ga0070694_100015098 | 3300005444 | Bacteria | 4843 |
| 75 | Ga0070694_100130332 | 3300005444 | Bacteria | 1816 |
| 76 | Ga0070694_100820537 | 3300005444 | Unclassified | 764 |
| 77 | Ga0070708_100116545 | 3300005445 | Bacteria | 2460 |
| 78 | Ga0070708_100295517 | 3300005445 | Unclassified | 1525 |
| 79 | Ga0070663_100120316 | 3300005455 | Bacteria | 1983 |
| 80 | Ga0070663_100854722 | 3300005455 | Bacteria | 783 |
| 81 | Ga0070678_100421787 | 3300005456 | Bacteria | 1163 |
| 82 | Ga0070678_100478952 | 3300005456 | Bacteria | 1095 |
| 83 | Ga0070662_100001968 | 3300005457 | Bacteria | 12618 |
| 84 | Ga0070662_100070412 | 3300005457 | Unclassified | 2577 |
| 85 | Ga0070662_100216166 | 3300005457 | Bacteria | 1527 |
| 86 | Ga0070662_101574691 | 3300005457 | Bacteria | 567 |
| 87 | Ga0068867_100043479 | 3300005459 | Bacteria | 3289 |
| 88 | Ga0070685_10158200 | 3300005466 | Bacteria | 1442 |
| 89 | Ga0070706_100016401 | 3300005467 | Bacteria | 6845 |
| 90 | Ga0070706_100090619 | 3300005467 | Bacteria | 2836 |
| 91 | Ga0070706_100209341 | 3300005467 | Bacteria | 1821 |
| 92 | Ga0070706_101027547 | 3300005467 | Bacteria | 760 |
| 93 | Ga0070706_101553148 | 3300005467 | Bacteria | 604 |
| 94 | Ga0070707_100117285 | 3300005468 | Unclassified | 2584 |
| 95 | Ga0070707_100137858 | 3300005468 | Bacteria | 2374 |
| 96 | Ga0070707_100315248 | 3300005468 | Bacteria | 1520 |
| 97 | Ga0070707_100406986 | 3300005468 | Bacteria | 1321 |
| 98 | Ga0070698_100026359 | 3300005471 | Bacteria | 6050 |
| 99 | Ga0070698_100102123 | 3300005471 | Bacteria | 2839 |
| 100 | Ga0070698_100199609 | 3300005471 | Bacteria | 1936 |
| 101 | Ga0070698_101485353 | 3300005471 | Bacteria | 629 |
| 102 | Ga0070698_101667220 | 3300005471 | Unclassified | 590 |
| 103 | Ga0070699_100026407 | 3300005518 | Bacteria | 5008 |
| 104 | Ga0070699_100032083 | 3300005518 | Bacteria | 4536 |
| 105 | Ga0070699_100669048 | 3300005518 | Bacteria | 948 |
| 106 | Ga0070699_100786518 | 3300005518 | Bacteria | 871 |
| 107 | Ga0070699_101503371 | 3300005518 | Unclassified | 617 |
| 108 | Ga0070684_100269935 | 3300005535 | Bacteria | 1557 |
| 109 | Ga0070684_101520490 | 3300005535 | Bacteria | 631 |
| 110 | Ga0070697_100012363 | 3300005536 | Bacteria | 6687 |
| 111 | Ga0070697_100088580 | 3300005536 | Bacteria | 2556 |
| 112 | Ga0070697_100179450 | 3300005536 | Unclassified | 1795 |
| 113 | Ga0070697_100276316 | 3300005536 | Bacteria | 1440 |
| 114 | Ga0068853_100775896 | 3300005539 | Bacteria | 917 |
| 115 | Ga0070672_100023238 | 3300005543 | Bacteria | 4566 |
| 116 | Ga0070686_100125890 | 3300005544 | Bacteria | 1765 |
| 117 | Ga0070695_100007828 | 3300005545 | Bacteria | 6333 |
| 118 | Ga0070696_100106903 | 3300005546 | Unclassified | 2012 |
| 119 | Ga0070696_100303867 | 3300005546 | Bacteria | 1223 |
| 120 | Ga0070665_100065510 | 3300005548 | Bacteria | 3644 |
| 121 | Ga0070665_100089068 | 3300005548 | Bacteria | 3092 |
| 122 | Ga0070665_100105607 | 3300005548 | Bacteria | 2818 |
| 123 | Ga0070704_100155319 | 3300005549 | Bacteria | 1804 |
| 124 | Ga0070704_100530261 | 3300005549 | Bacteria | 1026 |
| 125 | Ga0070664_100054358 | 3300005564 | Bacteria | 3397 |
| 126 | Ga0070664_100062456 | 3300005564 | Bacteria | 3175 |
| 127 | Ga0070664_100719347 | 3300005564 | Bacteria | 931 |
| 128 | Ga0068856_100183688 | 3300005614 | Unclassified | 2105 |
| 129 | Ga0068856_102038171 | 3300005614 | Unclassified | 584 |
| 130 | Ga0068859_100108835 | 3300005617 | Bacteria | 2832 |
| 131 | Ga0068859_101817570 | 3300005617 | Bacteria | 673 |
| 132 | Ga0068864_100118087 | 3300005618 | Bacteria | 2368 |
| 133 | Ga0068864_100334759 | 3300005618 | Bacteria | 1425 |
| 134 | Ga0068864_100472524 | 3300005618 | Bacteria | 1202 |
| 135 | Ga0068861_100094103 | 3300005719 | Bacteria | 2370 |
| 136 | Ga0068861_100159188 | 3300005719 | Bacteria | 1861 |
| 137 | Ga0068861_100537854 | 3300005719 | Unclassified | 1062 |
| 138 | Ga0068861_101020016 | 3300005719 | Bacteria | 791 |
| 139 | Ga0068863_100236484 | 3300005841 | Bacteria | 1763 |
| 140 | Ga0068863_100697107 | 3300005841 | Bacteria | 1009 |
| 141 | Ga0068863_100776597 | 3300005841 | Bacteria | 955 |
| 142 | Ga0068858_100060776 | 3300005842 | Bacteria | 3492 |
| 143 | Ga0068860_100094551 | 3300005843 | Bacteria | 2849 |
| 144 | Ga0068860_100997198 | 3300005843 | Bacteria | 855 |
| 145 | Ga0068860_101514709 | 3300005843 | Bacteria | 692 |
| 146 | Ga0068862_100000326 | 3300005844 | Bacteria | 51888 |
| 147 | Ga0068862_100210541 | 3300005844 | Bacteria | 1756 |
| 148 | Ga0068862_100227790 | 3300005844 | Unclassified | 1690 |
| 149 | Ga0068862_100259155 | 3300005844 | Bacteria | 1587 |
| 150 | Ga0081455_10002550 | 3300005937 | Bacteria | 21626 |
| 151 | Ga0081455_10014139 | 3300005937 | Bacteria | 7845 |
| 152 | Ga0081538_10008916 | 3300005981 | Bacteria | 8432 |
| 153 | Ga0081538_10386386 | 3300005981 | Bacteria | 504 |
| 154 | Ga0081540_1038402 | 3300005983 | Bacteria | 2524 |
| 155 | Ga0081539_10000070 | 3300005985 | Bacteria | 235651 |
| 156 | Ga0081539_10001374 | 3300005985 | Bacteria | 42092 |
| 157 | Ga0081539_10001803 | 3300005985 | Bacteria | 33905 |
| 158 | Ga0081539_10001984 | 3300005985 | Bacteria | 31132 |
| 159 | Ga0081539_10002192 | 3300005985 | Bacteria | 28654 |
| 160 | Ga0081539_10004130 | 3300005985 | Bacteria | 16525 |
| 161 | Ga0081539_10006135 | 3300005985 | Bacteria | 11702 |
| 162 | Ga0081539_10010909 | 3300005985 | Bacteria | 7293 |
| 163 | Ga0081539_10017622 | 3300005985 | Bacteria | 5003 |
| 164 | Ga0081539_10038575 | 3300005985 | Bacteria | 2829 |
| 165 | Ga0070717_10039365 | 3300006028 | Bacteria | 3846 |
| 166 | Ga0070717_10573895 | 3300006028 | Bacteria | 1022 |
| 167 | Ga0070717_10665360 | 3300006028 | Unclassified | 945 |
| 168 | Ga0070717_11015346 | 3300006028 | Unclassified | 755 |
| 169 | Ga0070717_11797901 | 3300006028 | Unclassified | 554 |
| 170 | Ga0075365_10945216 | 3300006038 | Bacteria | 608 |
| 171 | Ga0070715_10197138 | 3300006163 | Unclassified | 1020 |
| 172 | Ga0070716_100735194 | 3300006173 | Unclassified | 757 |
| 173 | Ga0097621_100726805 | 3300006237 | Unclassified | 916 |
| 174 | Ga0097621_101533688 | 3300006237 | Bacteria | 633 |
| 175 | Ga0097621_101541192 | 3300006237 | Bacteria | 631 |
| 176 | Ga0068871_100147444 | 3300006358 | Bacteria | 2005 |
| 177 | Ga0068871_100724299 | 3300006358 | Unclassified | 913 |
| 178 | Ga0075428_100002481 | 3300006844 | Bacteria | 20023 |
| 179 | Ga0075428_100055496 | 3300006844 | Bacteria | 4340 |
| 180 | Ga0075428_100221481 | 3300006844 | Bacteria | 2043 |
| 181 | Ga0075428_100233620 | 3300006844 | Bacteria | 1984 |
| 182 | Ga0075428_100307448 | 3300006844 | Bacteria | 1704 |
| 183 | Ga0075428_100376923 | 3300006844 | Bacteria | 1521 |
| 184 | Ga0075428_100582366 | 3300006844 | Bacteria | 1196 |
| 185 | Ga0075428_100742101 | 3300006844 | Unclassified | 1045 |
| 186 | Ga0075428_100820714 | 3300006844 | Unclassified | 988 |
| 187 | Ga0075428_101236626 | 3300006844 | Bacteria | 786 |
| 188 | Ga0075430_100000325 | 3300006846 | Bacteria | 34035 |
| 189 | Ga0075430_100092069 | 3300006846 | Bacteria | 2535 |
| 190 | Ga0075430_100092139 | 3300006846 | Bacteria | 2534 |
| 191 | Ga0075430_100512655 | 3300006846 | Bacteria | 990 |
| 192 | Ga0075430_100571781 | 3300006846 | Bacteria | 932 |
| 193 | Ga0075430_100797833 | 3300006846 | Bacteria | 778 |
| 194 | Ga0075431_100042360 | 3300006847 | Bacteria | 4695 |
| 195 | Ga0075431_100088219 | 3300006847 | Bacteria | 3201 |
| 196 | Ga0075431_100182045 | 3300006847 | Bacteria | 2156 |
| 197 | Ga0075431_100278985 | 3300006847 | Bacteria | 1692 |
| 198 | Ga0075431_100380130 | 3300006847 | Bacteria | 1416 |
| 199 | Ga0075431_100438065 | 3300006847 | Bacteria | 1304 |
| 200 | Ga0075431_100731262 | 3300006847 | Bacteria | 966 |
| 201 | Ga0075431_101562213 | 3300006847 | Unclassified | 618 |
| 202 | Ga0075433_10044269 | 3300006852 | Bacteria | 3867 |
| 203 | Ga0075433_10231847 | 3300006852 | Bacteria | 1639 |
| 204 | Ga0075433_10241424 | 3300006852 | Bacteria | 1604 |
| 205 | Ga0075433_10561272 | 3300006852 | Bacteria | 1003 |
| 206 | Ga0075433_10623627 | 3300006852 | Unclassified | 946 |
| 207 | Ga0075433_10825130 | 3300006852 | Unclassified | 810 |
| 208 | Ga0075434_100077266 | 3300006871 | Bacteria | 3324 |
| 209 | Ga0075434_100088630 | 3300006871 | Bacteria | 3095 |
| 210 | Ga0075434_101849860 | 3300006871 | Unclassified | 610 |
| 211 | Ga0075429_100005683 | 3300006880 | Bacteria | 10753 |
| 212 | Ga0075429_100019907 | 3300006880 | Bacteria | 5819 |
| 213 | Ga0075429_100029431 | 3300006880 | Bacteria | 4770 |
| 214 | Ga0075429_100041146 | 3300006880 | Bacteria | 4025 |
| 215 | Ga0075429_100080567 | 3300006880 | Bacteria | 2838 |
| 216 | Ga0075429_100088060 | 3300006880 | Bacteria | 2706 |
| 217 | Ga0075429_100347812 | 3300006880 | Bacteria | 1298 |
| 218 | Ga0075429_100711361 | 3300006880 | Unclassified | 880 |
| 219 | Ga0075429_100884182 | 3300006880 | Unclassified | 782 |
| 220 | Ga0097620_100108836 | 3300006931 | Bacteria | 2832 |
| 221 | Ga0097620_101817365 | 3300006931 | Bacteria | 673 |
| 222 | Ga0075435_100085405 | 3300007076 | Bacteria | 2598 |
| 223 | Ga0075435_100455963 | 3300007076 | Bacteria | 1103 |
| 224 | Ga0075435_100508454 | 3300007076 | Bacteria | 1042 |
| 225 | Ga0099794_10199718 | 3300007265 | Unclassified | 1024 |
| 226 | Ga0105251_10459373 | 3300009011 | Bacteria | 591 |
| 227 | Ga0105250_10338000 | 3300009092 | Bacteria | 657 |
| 228 | Ga0105240_10257165 | 3300009093 | Bacteria | 2016 |
| 229 | Ga0111539_10068947 | 3300009094 | Bacteria | 4176 |
| 230 | Ga0111539_10079440 | 3300009094 | Bacteria | 3859 |
| 231 | Ga0111539_10303184 | 3300009094 | Bacteria | 1859 |
| 232 | Ga0111539_10422815 | 3300009094 | Bacteria | 1552 |
| 233 | Ga0111539_11548600 | 3300009094 | Bacteria | 769 |
| 234 | Ga0105245_10006025 | 3300009098 | Bacteria | 10656 |
| 235 | Ga0105245_10579264 | 3300009098 | Bacteria | 1147 |
| 236 | Ga0105247_10111109 | 3300009101 | Bacteria | 1764 |
| 237 | Ga0105247_10521825 | 3300009101 | Unclassified | 869 |
| 238 | Ga0105247_10529772 | 3300009101 | Bacteria | 863 |
| 239 | Ga0114129_10002746 | 3300009147 | Bacteria | 24536 |
| 240 | Ga0114129_10015317 | 3300009147 | Bacteria | 10911 |
| 241 | Ga0114129_10027565 | 3300009147 | Bacteria | 8043 |
| 242 | Ga0114129_10038320 | 3300009147 | Bacteria | 6763 |
| 243 | Ga0114129_10041383 | 3300009147 | Bacteria | 6493 |
| 244 | Ga0114129_10065860 | 3300009147 | Bacteria | 5055 |
| 245 | Ga0114129_10073788 | 3300009147 | Bacteria | 4753 |
| 246 | Ga0114129_10139135 | 3300009147 | Bacteria | 3329 |
| 247 | Ga0114129_10167688 | 3300009147 | Bacteria | 2995 |
| 248 | Ga0114129_10273361 | 3300009147 | Bacteria | 2260 |
| 249 | Ga0114129_10344558 | 3300009147 | Bacteria | 1975 |
| 250 | Ga0114129_10481490 | 3300009147 | Bacteria | 1624 |
| 251 | Ga0114129_10671319 | 3300009147 | Bacteria | 1335 |
| 252 | Ga0114129_10673008 | 3300009147 | Bacteria | 1333 |
| 253 | Ga0114129_10737156 | 3300009147 | Unclassified | 1263 |
| 254 | Ga0114129_10827133 | 3300009147 | Bacteria | 1179 |
| 255 | Ga0114129_11167582 | 3300009147 | Bacteria | 961 |
| 256 | Ga0114129_11196955 | 3300009147 | Bacteria | 946 |
| 257 | Ga0114129_11235924 | 3300009147 | Bacteria | 929 |
| 258 | Ga0114129_11240572 | 3300009147 | Bacteria | 927 |
| 259 | Ga0114129_11254140 | 3300009147 | Bacteria | 921 |
| 260 | Ga0114129_12107404 | 3300009147 | Bacteria | 680 |
| 261 | Ga0105243_10008709 | 3300009148 | Bacteria | 7780 |
| 262 | Ga0105243_10045280 | 3300009148 | Bacteria | 3456 |
| 263 | Ga0105243_10979320 | 3300009148 | Bacteria | 847 |
| 264 | Ga0105242_10064779 | 3300009176 | Unclassified | 3013 |
| 265 | Ga0105242_10747146 | 3300009176 | Bacteria | 963 |
| 266 | Ga0105242_11298699 | 3300009176 | Bacteria | 751 |
| 267 | Ga0105248_11221862 | 3300009177 | Bacteria | 850 |
| 268 | Ga0105248_11413082 | 3300009177 | Bacteria | 787 |
| 269 | Ga0105237_10534164 | 3300009545 | Bacteria | 1179 |
| 270 | Ga0105238_11346196 | 3300009551 | Bacteria | 740 |
| 271 | Ga0105249_10330915 | 3300009553 | Bacteria | 1537 |
| 272 | Ga0105249_10440753 | 3300009553 | Bacteria | 1340 |
| 273 | Ga0099796_10005699 | 3300010159 | Bacteria | 3125 |
| 274 | Ga0105239_10013380 | 3300010375 | Bacteria | 9116 |
| 275 | Ga0105239_10497135 | 3300010375 | Bacteria | 1386 |
| 276 | Ga0105239_11203217 | 3300010375 | Unclassified | 873 |
| 277 | Ga0105239_12018602 | 3300010375 | Bacteria | 670 |
| 278 | Ga0105239_13076402 | 3300010375 | Bacteria | 543 |
| 279 | Ga0105246_10397932 | 3300011119 | Unclassified | 1143 |
| 280 | Ga0105246_10783907 | 3300011119 | Unclassified | 844 |
| 281 | Ga0157373_10344236 | 3300013100 | Unclassified | 1063 |
| 282 | Ga0157373_11372578 | 3300013100 | Bacteria | 537 |
| 283 | Ga0157370_11375232 | 3300013104 | Bacteria | 635 |
| 284 | Ga0157374_10068668 | 3300013296 | Bacteria | 3335 |
| 285 | Ga0157374_10171919 | 3300013296 | Bacteria | 2114 |
| 286 | Ga0157374_10870170 | 3300013296 | Bacteria | 918 |
| 287 | Ga0157374_11599997 | 3300013296 | Unclassified | 676 |
| 288 | Ga0157374_11607043 | 3300013296 | Bacteria | 674 |
| 289 | Ga0157378_10093799 | 3300013297 | Bacteria | 2733 |
| 290 | Ga0157378_10147800 | 3300013297 | Bacteria | 2187 |
| 291 | Ga0157378_10433047 | 3300013297 | Bacteria | 1302 |
| 292 | Ga0157378_10772414 | 3300013297 | Unclassified | 985 |
| 293 | Ga0157378_11317448 | 3300013297 | Bacteria | 764 |
| 294 | Ga0163162_10006856 | 3300013306 | Bacteria | 11053 |
| 295 | Ga0163162_10424826 | 3300013306 | Bacteria | 1461 |
| 296 | Ga0163162_10529622 | 3300013306 | Unclassified | 1307 |
| 297 | Ga0163162_10999753 | 3300013306 | Bacteria | 946 |
| 298 | Ga0163162_11228859 | 3300013306 | Bacteria | 851 |
| 299 | Ga0157372_10620756 | 3300013307 | Bacteria | 1260 |
| 300 | Ga0157375_10810009 | 3300013308 | Bacteria | 1085 |
| 301 | Ga0157375_11631631 | 3300013308 | Bacteria | 763 |
| 302 | Ga0157375_11897310 | 3300013308 | Bacteria | 707 |
| 303 | Ga0163163_10076891 | 3300014325 | Bacteria | 3334 |
| 304 | Ga0163163_10378271 | 3300014325 | Bacteria | 1474 |
| 305 | Ga0163163_11273375 | 3300014325 | Unclassified | 798 |
| 306 | Ga0157380_10585019 | 3300014326 | Bacteria | 1101 |
| 307 | Ga0157380_10808242 | 3300014326 | Bacteria | 955 |
| 308 | Ga0157379_11935907 | 3300014968 | Bacteria | 581 |
| 309 | Ga0157376_10099294 | 3300014969 | Bacteria | 2540 |
| 310 | Ga0157376_10164248 | 3300014969 | Bacteria | 2016 |
| 311 | Ga0157376_10343037 | 3300014969 | Unclassified | 1427 |
| 312 | Ga0163161_10061942 | 3300017792 | Bacteria | 2725 |
| 313 | Ga0163161_10116001 | 3300017792 | Unclassified | 2007 |
| 314 | Ga0206354_10311746 | 3300020081 | Unclassified | 532 |
| 315 | Ga0206353_11917053 | 3300020082 | Unclassified | 523 |
| 316 | Ga0207673_1013051 | 3300025290 | Bacteria | 1086 |
| 317 | Ga0207697_10001869 | 3300025315 | Bacteria | 11247 |
| 318 | Ga0207697_10008030 | 3300025315 | Bacteria | 4659 |
| 319 | Ga0207696_1137314 | 3300025711 | Bacteria | 655 |
| 320 | Ga0207682_10027266 | 3300025893 | Bacteria | 2274 |
| 321 | Ga0207692_10167533 | 3300025898 | Bacteria | 1271 |
| 322 | Ga0207642_10053251 | 3300025899 | Unclassified | 1840 |
| 323 | Ga0207710_10328168 | 3300025900 | Bacteria | 777 |
| 324 | Ga0207688_10092447 | 3300025901 | Bacteria | 1738 |
| 325 | Ga0207688_10122259 | 3300025901 | Bacteria | 1520 |
| 326 | Ga0207680_10032343 | 3300025903 | Bacteria | 2973 |
| 327 | Ga0207680_10554880 | 3300025903 | Unclassified | 820 |
| 328 | Ga0207680_10602883 | 3300025903 | Bacteria | 786 |
| 329 | Ga0207699_10381665 | 3300025906 | Unclassified | 1000 |
| 330 | Ga0207645_10006819 | 3300025907 | Bacteria | 8152 |
| 331 | Ga0207645_10045453 | 3300025907 | Unclassified | 2806 |
| 332 | Ga0207645_10259481 | 3300025907 | Bacteria | 1151 |
| 333 | Ga0207684_10016870 | 3300025910 | Bacteria | 6271 |
| 334 | Ga0207684_10048066 | 3300025910 | Bacteria | 3619 |
| 335 | Ga0207684_10079574 | 3300025910 | Bacteria | 2788 |
| 336 | Ga0207671_10272049 | 3300025914 | Unclassified | 1335 |
| 337 | Ga0207693_10189244 | 3300025915 | Unclassified | 1620 |
| 338 | Ga0207663_10298123 | 3300025916 | Unclassified | 1203 |
| 339 | Ga0207663_10392842 | 3300025916 | Unclassified | 1059 |
| 340 | Ga0207646_10004642 | 3300025922 | Bacteria | 14827 |
| 341 | Ga0207646_10092942 | 3300025922 | Bacteria | 2701 |
| 342 | Ga0207646_10404182 | 3300025922 | Bacteria | 1233 |
| 343 | Ga0207646_10687256 | 3300025922 | Bacteria | 915 |
| 344 | Ga0207646_10853145 | 3300025922 | Unclassified | 809 |
| 345 | Ga0207681_10141492 | 3300025923 | Bacteria | 1792 |
| 346 | Ga0207650_10090220 | 3300025925 | Bacteria | 2340 |
| 347 | Ga0207659_10053425 | 3300025926 | Unclassified | 2881 |
| 348 | Ga0207659_10112658 | 3300025926 | Unclassified | 2071 |
| 349 | Ga0207659_10484549 | 3300025926 | Bacteria | 1045 |
| 350 | Ga0207700_10058362 | 3300025928 | Unclassified | 2914 |
| 351 | Ga0207700_10135687 | 3300025928 | Bacteria | 2015 |
| 352 | Ga0207700_11783418 | 3300025928 | Unclassified | 541 |
| 353 | Ga0207664_10587500 | 3300025929 | Bacteria | 1000 |
| 354 | Ga0207644_10024337 | 3300025931 | Bacteria | 4155 |
| 355 | Ga0207644_10024991 | 3300025931 | Bacteria | 4103 |
| 356 | Ga0207644_10071813 | 3300025931 | Bacteria | 2533 |
| 357 | Ga0207706_10017316 | 3300025933 | Bacteria | 6491 |
| 358 | Ga0207706_10080010 | 3300025933 | Bacteria | 2873 |
| 359 | Ga0207706_10237837 | 3300025933 | Bacteria | 1592 |
| 360 | Ga0207706_10646123 | 3300025933 | Bacteria | 906 |
| 361 | Ga0207686_10400846 | 3300025934 | Unclassified | 1045 |
| 362 | Ga0207709_10399795 | 3300025935 | Bacteria | 1050 |
| 363 | Ga0207670_10089769 | 3300025936 | Unclassified | 2169 |
| 364 | Ga0207670_10210832 | 3300025936 | Bacteria | 1481 |
| 365 | Ga0207670_10679003 | 3300025936 | Bacteria | 851 |
| 366 | Ga0207669_10007862 | 3300025937 | Bacteria | 4967 |
| 367 | Ga0207669_10102146 | 3300025937 | Bacteria | 1898 |
| 368 | Ga0207669_10295075 | 3300025937 | Unclassified | 1229 |
| 369 | Ga0207669_11375613 | 3300025937 | Bacteria | 601 |
| 370 | Ga0207665_10025683 | 3300025939 | Unclassified | 3887 |
| 371 | Ga0207665_11342159 | 3300025939 | Bacteria | 570 |
| 372 | Ga0207691_10007318 | 3300025940 | Bacteria | 10648 |
| 373 | Ga0207691_10044930 | 3300025940 | Bacteria | 4064 |
| 374 | Ga0207711_10328722 | 3300025941 | Bacteria | 1414 |
| 375 | Ga0207689_10351673 | 3300025942 | Bacteria | 1225 |
| 376 | Ga0207689_11184352 | 3300025942 | Bacteria | 643 |
| 377 | Ga0207661_11192156 | 3300025944 | Bacteria | 701 |
| 378 | Ga0207668_10001042 | 3300025972 | Bacteria | 16562 |
| 379 | Ga0207668_10037064 | 3300025972 | Bacteria | 3260 |
| 380 | Ga0207668_10116459 | 3300025972 | Unclassified | 2015 |
| 381 | Ga0207668_10191176 | 3300025972 | Bacteria | 1622 |
| 382 | Ga0207668_10713061 | 3300025972 | Bacteria | 882 |
| 383 | Ga0207640_10573279 | 3300025981 | Unclassified | 952 |
| 384 | Ga0207658_10055305 | 3300025986 | Bacteria | 2940 |
| 385 | Ga0207658_10439331 | 3300025986 | Unclassified | 1153 |
| 386 | Ga0207658_10900513 | 3300025986 | Bacteria | 805 |
| 387 | Ga0207677_10277911 | 3300026023 | Bacteria | 1373 |
| 388 | Ga0207677_10419749 | 3300026023 | Unclassified | 1139 |
| 389 | Ga0207677_10533351 | 3300026023 | Bacteria | 1020 |
| 390 | Ga0207703_10157651 | 3300026035 | Bacteria | 1985 |
| 391 | Ga0207703_10195240 | 3300026035 | Bacteria | 1795 |
| 392 | Ga0207639_10710806 | 3300026041 | Bacteria | 933 |
| 393 | Ga0207678_10171773 | 3300026067 | Bacteria | 1851 |
| 394 | Ga0207678_10693034 | 3300026067 | Bacteria | 896 |
| 395 | Ga0207708_10112652 | 3300026075 | Bacteria | 2113 |
| 396 | Ga0207708_10532121 | 3300026075 | Bacteria | 989 |
| 397 | Ga0207702_10447558 | 3300026078 | Bacteria | 1253 |
| 398 | Ga0207702_10555884 | 3300026078 | Unclassified | 1123 |
| 399 | Ga0207641_10387768 | 3300026088 | Bacteria | 1339 |
| 400 | Ga0207641_11312437 | 3300026088 | Bacteria | 724 |
| 401 | Ga0207648_10173497 | 3300026089 | Bacteria | 1906 |
| 402 | Ga0207648_10349355 | 3300026089 | Unclassified | 1333 |
| 403 | Ga0207676_10326886 | 3300026095 | Bacteria | 1410 |
| 404 | Ga0207676_10436038 | 3300026095 | Bacteria | 1232 |
| 405 | Ga0207676_10551882 | 3300026095 | Bacteria | 1101 |
| 406 | Ga0207676_10691959 | 3300026095 | Bacteria | 987 |
| 407 | Ga0207674_10900084 | 3300026116 | Bacteria | 853 |
| 408 | Ga0207674_10969451 | 3300026116 | Bacteria | 819 |
| 409 | Ga0207675_100001774 | 3300026118 | Bacteria | 21561 |
| 410 | Ga0207675_100182031 | 3300026118 | Bacteria | 2012 |
| 411 | Ga0207675_100196036 | 3300026118 | Bacteria | 1938 |
| 412 | Ga0207675_100522204 | 3300026118 | Bacteria | 1184 |
| 413 | Ga0207675_100546606 | 3300026118 | Unclassified | 1157 |
| 414 | Ga0207683_10008702 | 3300026121 | Bacteria | 8672 |
| 415 | Ga0207683_10145254 | 3300026121 | Bacteria | 2139 |
| 416 | Ga0207683_10204124 | 3300026121 | Unclassified | 1797 |
| 417 | Ga0207683_10236334 | 3300026121 | Bacteria | 1667 |
| 418 | Ga0207428_10008508 | 3300027907 | Bacteria | 9263 |
| 419 | Ga0268266_10086518 | 3300028379 | Bacteria | 2741 |
| 420 | Ga0268266_10095287 | 3300028379 | Bacteria | 2614 |
| 421 | Ga0268266_10333517 | 3300028379 | Bacteria | 1422 |
| 422 | Ga0268265_10000138 | 3300028380 | Bacteria | 92824 |
| 423 | Ga0268265_10047434 | 3300028380 | Unclassified | 3219 |
| 424 | Ga0268265_10231561 | 3300028380 | Bacteria | 1624 |
| 425 | Ga0268265_11407569 | 3300028380 | Bacteria | 699 |
| 426 | Ga0268264_10067687 | 3300028381 | Bacteria | 3015 |
| 427 | Ga0307517_10127523 | 3300028786 | Bacteria | 1849 |
| 428 | Ga0307515_10004739 | 3300028794 | Bacteria | 27867 |
| 429 | Ga0307515_10007075 | 3300028794 | Bacteria | 22286 |
| 430 | Ga0307515_10802512 | 3300028794 | Bacteria | 564 |
| 431 | Ga0307512_10002245 | 3300030522 | Bacteria | 25098 |
| 432 | Ga0307513_10002908 | 3300031456 | Bacteria | 23416 |
| 433 | Ga0307408_100365566 | 3300031548 | Bacteria | 1229 |
| 434 | Ga0307508_10005441 | 3300031616 | Bacteria | 12103 |
| 435 | Ga0307508_10060277 | 3300031616 | Bacteria | 3356 |
| 436 | Ga0307508_10114605 | 3300031616 | Bacteria | 2296 |
| 437 | Ga0307508_10146523 | 3300031616 | Bacteria | 1965 |
| 438 | Ga0316578_10473298 | 3300031728 | Unclassified | 739 |
| 439 | Ga0307516_10000528 | 3300031730 | Bacteria | 51172 |
| 440 | Ga0307516_10076953 | 3300031730 | Bacteria | 3186 |
| 441 | Ga0307516_10115978 | 3300031730 | Bacteria | 2474 |
| 442 | Ga0307516_10127005 | 3300031730 | Bacteria | 2334 |
| 443 | Ga0307516_10213579 | 3300031730 | Bacteria | 1642 |
| 444 | Ga0307405_10005279 | 3300031731 | Bacteria | 6212 |
| 445 | Ga0307405_10237887 | 3300031731 | Unclassified | 1347 |
| 446 | Ga0307413_10060027 | 3300031824 | Bacteria | 2339 |
| 447 | Ga0307413_10118800 | 3300031824 | Bacteria | 1786 |
| 448 | Ga0307413_10700439 | 3300031824 | Bacteria | 841 |
| 449 | Ga0307413_11659278 | 3300031824 | Bacteria | 569 |
| 450 | Ga0307410_10156195 | 3300031852 | Bacteria | 1704 |
| 451 | Ga0307410_10186027 | 3300031852 | Bacteria | 1576 |
| 452 | Ga0307410_10386022 | 3300031852 | Bacteria | 1128 |
| 453 | Ga0307410_10423445 | 3300031852 | Bacteria | 1080 |
| 454 | Ga0307410_10755759 | 3300031852 | Bacteria | 824 |
| 455 | Ga0307406_10005652 | 3300031901 | Bacteria | 6837 |
| 456 | Ga0307406_10006884 | 3300031901 | Bacteria | 6296 |
| 457 | Ga0307406_10932489 | 3300031901 | Bacteria | 741 |
| 458 | Ga0307406_10958409 | 3300031901 | Bacteria | 732 |
| 459 | Ga0307407_10023579 | 3300031903 | Bacteria | 3213 |
| 460 | Ga0307407_10188817 | 3300031903 | Bacteria | 1372 |
| 461 | Ga0307407_10194712 | 3300031903 | Bacteria | 1354 |
| 462 | Ga0307407_10238526 | 3300031903 | Bacteria | 1239 |
| 463 | Ga0307412_10059594 | 3300031911 | Bacteria | 2559 |
| 464 | Ga0307412_10796735 | 3300031911 | Bacteria | 820 |
| 465 | Ga0307412_10880524 | 3300031911 | Bacteria | 783 |
| 466 | Ga0307409_100015616 | 3300031995 | Bacteria | 4990 |
| 467 | Ga0307409_100195813 | 3300031995 | Bacteria | 1803 |
| 468 | Ga0307409_100202313 | 3300031995 | Bacteria | 1778 |
| 469 | Ga0307409_100360272 | 3300031995 | Bacteria | 1375 |
| 470 | Ga0307409_101507754 | 3300031995 | Bacteria | 700 |
| 471 | Ga0307409_102245235 | 3300031995 | Bacteria | 575 |
| 472 | Ga0307416_100003064 | 3300032002 | Bacteria | 9768 |
| 473 | Ga0307416_100112914 | 3300032002 | Bacteria | 2399 |
| 474 | Ga0307416_100115944 | 3300032002 | Bacteria | 2373 |
| 475 | Ga0307416_100137557 | 3300032002 | Bacteria | 2213 |
| 476 | Ga0307416_100781008 | 3300032002 | Bacteria | 1050 |
| 477 | Ga0307416_101384949 | 3300032002 | Bacteria | 809 |
| 478 | Ga0307414_10085593 | 3300032004 | Bacteria | 2323 |
| 479 | Ga0307414_10447562 | 3300032004 | Bacteria | 1132 |
| 480 | Ga0307411_10291946 | 3300032005 | Bacteria | 1303 |
| 481 | Ga0307411_10328803 | 3300032005 | Bacteria | 1238 |
| 482 | Ga0307411_11127489 | 3300032005 | Bacteria | 708 |
| 483 | Ga0307415_100000009 | 3300032126 | Bacteria | 90122 |
| 484 | Ga0307415_100026967 | 3300032126 | Bacteria | 3632 |
| 485 | Ga0307415_100063058 | 3300032126 | Bacteria | 2574 |
| 486 | Ga0307415_100182134 | 3300032126 | Bacteria | 1649 |
| 487 | Ga0307415_100331579 | 3300032126 | Bacteria | 1273 |
| 488 | Ga0307415_100369931 | 3300032126 | Bacteria | 1213 |
| 489 | Ga0307415_100395534 | 3300032126 | Bacteria | 1178 |
| 490 | Ga0307415_100947675 | 3300032126 | Bacteria | 796 |
| 491 | Ga0307415_101076631 | 3300032126 | Bacteria | 751 |
| 492 | Ga0307415_101416489 | 3300032126 | Unclassified | 662 |
| 493 | Ga0307507_10312587 | 3300033179 | Bacteria | 953 |
| 494 | Ga0307510_10413871 | 3300033180 | Bacteria | 791 |
| 495 | Ga0316592_1160856 | 3300033524 | Unclassified | 532 |
| 496 | Ga0373938_0025835 | 3300034957 | Bacteria | 1225 |
| 497 | Ga0373928_0087956 | 3300035084 | Bacteria | 793 |
| 498 | Ga0373940_0003039 | 3300035088 | Bacteria | 3364 |
| 499 | Ga0373951_0000134 | 3300035091 | Bacteria | 28118 |
| 500 | Ga0373932_0014431 | 3300035112 | Bacteria | 1986 |
| 501 | Ga0373941_0355056 | 3300035115 | Unclassified | 597 |
| 502 | Ga0373941_0507976 | 3300035115 | Bacteria | 513 |
| 503 | Ga0373945_0025421 | 3300035116 | Bacteria | 2057 |
| 504 | Ga0373945_0244856 | 3300035116 | Bacteria | 756 |
| 505 | Ga0373957_0100775 | 3300035120 | Bacteria | 1156 |
| 506 | Ga0373943_0266668 | 3300035170 | Unclassified | 965 |
| 507 | Ga0373946_0193978 | 3300035171 | Bacteria | 970 |
| 508 | Ga0373942_0001030 | 3300035207 | Bacteria | 7573 |
| 509 | Ga0373962_0002273 | 3300035242 | Bacteria | 4588 |
| 510 | Ga0373924_0142514 | 3300035410 | Bacteria | 1046 |
| 511 | Ga0373931_0119349 | 3300035691 | Unclassified | 1506 |
| 512 | Ga0373931_0305682 | 3300035691 | Bacteria | 983 |
| 513 | Ga0373935_0007029 | 3300035692 | Bacteria | 6719 |
| 514 | Ga0373935_0068307 | 3300035692 | Bacteria | 2287 |
| 515 | Ga0373935_0234771 | 3300035692 | Bacteria | 1278 |
| 516 | Ga0373935_0450549 | 3300035692 | Unclassified | 930 |
| 517 | Ga0373935_0503620 | 3300035692 | Bacteria | 879 |
| 518 | Ga0373927_0399762 | 3300035695 | Unclassified | 906 |
| 519 | Ga0373927_1089844 | 3300035695 | Bacteria | 527 |
| 520 | Ga0373947_0096275 | 3300035725 | Bacteria | 1853 |
| 521 | Ga0373947_0103015 | 3300035725 | Bacteria | 1796 |
| 522 | Ga0373937_0048253 | 3300036401 | Bacteria | 3897 |
| 523 | Ga0373937_0114090 | 3300036401 | Bacteria | 2515 |
| 524 | Ga0373937_0923116 | 3300036401 | Unclassified | 822 |
| 525 | Ga0316582_0008790 | 3300036647 | Bacteria | 5445 |
| 526 | Ga0395899_0064801 | 3300037312 | Bacteria | 2686 |
| 527 | Ga0395900_0137234 | 3300037418 | Bacteria | 2506 |
| 528 | Ga0395900_0356829 | 3300037418 | Bacteria | 1434 |
| 529 | Ga0395900_0375212 | 3300037418 | Bacteria | 1391 |
| 530 | Ga0395900_0591377 | 3300037418 | Bacteria | 1051 |
| 531 | Ga0395898_0036138 | 3300037466 | Bacteria | 4907 |
| 532 | Ga0395898_0049949 | 3300037466 | Bacteria | 4096 |
| 533 | Ga0395898_1778338 | 3300037466 | Bacteria | 538 |
| 534 | Ga0316581_0118649 | 3300037588 | Unclassified | 815 |
| 535 | Ga0436364_1383891 | 3300037853 | Bacteria | 842 |
| 536 | Ga0395901_0305353 | 3300038443 | Bacteria | 1649 |
| 537 | Ga0451793_1633125 | 3300041452 | Bacteria | 1019 |
| 538 | Ga0451802_1771638 | 3300041460 | Bacteria | 948 |
| 539 | Ga0451804_0377329 | 3300041463 | Bacteria | 562 |
| 540 | Ga0451833_0074111 | 3300041491 | Bacteria | 1207 |
| 541 | Ga0451841_1387006 | 3300041498 | Bacteria | 572 |
| 542 | Ga0451853_1233207 | 3300041512 | Unclassified | 755 |
| 543 | Ga0451853_3441805 | 3300041512 | Bacteria | 3168 |
| 544 | Ga0439463_045945 | 3300042016 | Bacteria | 1112 |
| 545 | Ga0439459_0035868 | 3300042438 | Bacteria | 1032 |
| 546 | Ga0466963_0445644 | 3300044694 | Bacteria | 913 |
| 547 | Ga0466963_0795704 | 3300044694 | Bacteria | 667 |
| 548 | Ga0466968_0067229 | 3300044735 | Bacteria | 1554 |
| 549 | Ga0466960_0731854 | 3300044901 | Bacteria | 595 |
| 550 | Ga0466967_0154970 | 3300045976 | Bacteria | 2145 |
| 551 | Ga0466967_2311311 | 3300045976 | Bacteria | 533 |
| 552 | Ga0495603_0292970 | 3300046455 | Bacteria | 935 |
| 553 | Ga0495629_0550211 | 3300046459 | Bacteria | 775 |
| 554 | Ga0495651_0106096 | 3300046462 | Bacteria | 2083 |
| 555 | Ga0495653_0188118 | 3300046463 | Bacteria | 1411 |
| 556 | Ga0495664_0239086 | 3300046477 | Bacteria | 1099 |
| 557 | Ga0495606_0001573 | 3300046507 | Bacteria | 29909 |
| 558 | Ga0495630_0214769 | 3300046517 | Bacteria | 1468 |
| 559 | Ga0495630_0256370 | 3300046517 | Bacteria | 1336 |
| 560 | Ga0495630_1346219 | 3300046517 | Unclassified | 538 |
| 561 | Ga0495632_0034183 | 3300046519 | Bacteria | 2604 |
| 562 | Ga0495632_0044122 | 3300046519 | Bacteria | 2226 |
| 563 | Ga0495652_0046702 | 3300046529 | Bacteria | 3716 |
| 564 | Ga0495640_0790254 | 3300046533 | Bacteria | 566 |
| 565 | Ga0495667_0391448 | 3300046559 | Bacteria | 876 |
| 566 | Ga0495668_0000668 | 3300046616 | Bacteria | 41278 |
| 567 | Ga0495634_0380083 | 3300046642 | Bacteria | 842 |
| 568 | Ga0495625_0004244 | 3300046660 | Bacteria | 13649 |
| 569 | Ga0495625_0120926 | 3300046660 | Bacteria | 1782 |
| 570 | Ga0495625_0369701 | 3300046660 | Bacteria | 902 |
| 571 | Ga0495635_0273673 | 3300046663 | Bacteria | 1135 |
| 572 | Ga0495657_0502354 | 3300046675 | Bacteria | 707 |
| 573 | Ga0495599_0367453 | 3300046678 | Bacteria | 861 |
| 574 | Ga0495669_0063375 | 3300046684 | Unclassified | 1677 |
| 575 | Ga0495669_0232573 | 3300046684 | Bacteria | 884 |
| 576 | Ga0495669_0373383 | 3300046684 | Bacteria | 690 |
| 577 | Ga0495613_0483300 | 3300046689 | Bacteria | 836 |
| 578 | Ga0495624_0168220 | 3300046690 | Bacteria | 1338 |
| 579 | Ga0495672_0115586 | 3300047320 | Bacteria | 1434 |
| 580 | Ga0495683_0163957 | 3300047323 | Bacteria | 1026 |
| 581 | Ga0495675_0082267 | 3300047444 | Bacteria | 2027 |
| 582 | Ga0495684_0026233 | 3300047471 | Bacteria | 4477 |
| 583 | Ga0495626_0000282 | 3300048091 | Bacteria | 55428 |
| 584 | Ga0496100_0006316 | 3300048903 | Bacteria | 6456 |
| 585 | Ga0496101_1446446 | 3300048904 | Bacteria | 536 |
| 586 | Ga0496102_0034791 | 3300048905 | Bacteria | 4533 |
| 587 | Ga0496102_0861799 | 3300048905 | Bacteria | 828 |
| 588 | Ga0496102_1256001 | 3300048905 | Bacteria | 660 |
| 589 | Ga0496103_0169487 | 3300048906 | Unclassified | 1402 |
| 590 | Ga0496103_0611563 | 3300048906 | Unclassified | 694 |
| 591 | Ga0496104_0208342 | 3300048907 | Unclassified | 1867 |
| 592 | Ga0496104_0638423 | 3300048907 | Bacteria | 974 |
| 593 | Ga0496106_0059977 | 3300048909 | Unclassified | 2883 |
| 594 | Ga0496106_0495313 | 3300048909 | Unclassified | 982 |
| 595 | Ga0496106_0502663 | 3300048909 | Bacteria | 974 |
| 596 | Ga0496107_0082591 | 3300048910 | Unclassified | 2343 |
| 597 | Ga0496107_0209819 | 3300048910 | Unclassified | 1448 |
| 598 | Ga0496107_0452108 | 3300048910 | Unclassified | 954 |
| 599 | Ga0496108_0000247 | 3300048911 | Bacteria | 48233 |
| 600 | Ga0496108_0172262 | 3300048911 | Unclassified | 1873 |
| 601 | Ga0496109_0000040 | 3300048912 | Bacteria | 145496 |
| 602 | Ga0496109_0207460 | 3300048912 | Unclassified | 1843 |
| 603 | Ga0496110_1213631 | 3300048913 | Unclassified | 663 |
| 604 | Ga0496112_0021085 | 3300048915 | Bacteria | 6190 |
| 605 | Ga0496112_0116312 | 3300048915 | Bacteria | 2645 |
| 606 | Ga0496112_0121762 | 3300048915 | Bacteria | 2579 |
| 607 | Ga0496112_0710727 | 3300048915 | Unclassified | 933 |
| 608 | Ga0496112_1398161 | 3300048915 | Unclassified | 614 |
| 609 | Ga0496113_0321701 | 3300048916 | Unclassified | 1240 |
| 610 | Ga0496114_1140820 | 3300048917 | Bacteria | 665 |
| 611 | Ga0496115_0020650 | 3300048918 | Bacteria | 5081 |
| 612 | Ga0496115_0438291 | 3300048918 | Unclassified | 1057 |
| 613 | Ga0496119_0456829 | 3300048922 | Bacteria | 601 |
| 614 | Ga0496126_0069897 | 3300048929 | Bacteria | 3130 |
| 615 | Ga0501031_0005760 | 3300049568 | Bacteria | 8073 |
| 616 | Ga0501032_0064110 | 3300049569 | Bacteria | 2460 |
| 617 | Ga0501032_0595214 | 3300049569 | Bacteria | 704 |
| 618 | Ga0501033_0015722 | 3300049570 | Bacteria | 5738 |
| 619 | Ga0501036_0000376 | 3300049572 | Bacteria | 31534 |
| 620 | Ga0501037_1050545 | 3300049573 | Bacteria | 529 |
| 621 | Ga0501038_0000696 | 3300049574 | Bacteria | 29904 |
| 622 | Ga0501038_0638230 | 3300049574 | Bacteria | 803 |
| 623 | Ga0501039_0000734 | 3300049575 | Bacteria | 23642 |
| 624 | Ga0501039_0041300 | 3300049575 | Bacteria | 3562 |
| 625 | Ga0501039_0452166 | 3300049575 | Bacteria | 1009 |
| 626 | Ga0501039_1129625 | 3300049575 | Bacteria | 607 |
| 627 | Ga0501040_0002456 | 3300049576 | Bacteria | 11932 |
| 628 | Ga0501040_0088609 | 3300049576 | Bacteria | 2149 |
| 629 | Ga0501040_0382075 | 3300049576 | Bacteria | 1010 |
| 630 | Ga0501040_0637072 | 3300049576 | Bacteria | 770 |
| 631 | Ga0501041_0000196 | 3300049577 | Bacteria | 27844 |
| 632 | Ga0501041_1110030 | 3300049577 | Bacteria | 510 |
| 633 | Ga0501042_0000854 | 3300049578 | Bacteria | 16986 |
| 634 | Ga0501042_0199377 | 3300049578 | Bacteria | 1443 |
| 635 | Ga0501042_0244965 | 3300049578 | Bacteria | 1293 |
| 636 | Ga0501042_0592949 | 3300049578 | Bacteria | 806 |
| 637 | Ga0501042_0605464 | 3300049578 | Bacteria | 797 |
| 638 | Ga0501043_0005448 | 3300049579 | Bacteria | 10286 |
| 639 | Ga0501043_0862055 | 3300049579 | Bacteria | 652 |
| 640 | Ga0501046_0001223 | 3300049580 | Bacteria | 24877 |
| 641 | Ga0501046_0073171 | 3300049580 | Bacteria | 2660 |
| 642 | Ga0501047_0125479 | 3300049581 | Bacteria | 2447 |
| 643 | Ga0501047_1334544 | 3300049581 | Bacteria | 532 |
| 644 | Ga0501048_0001630 | 3300049582 | Bacteria | 17080 |
| 645 | Ga0501068_0005176 | 3300049584 | Bacteria | 7115 |
| 646 | Ga0501068_0470754 | 3300049584 | Bacteria | 814 |
| 647 | Ga0501070_0159492 | 3300049586 | Unclassified | 1860 |
| 648 | Ga0501070_0587328 | 3300049586 | Bacteria | 889 |
| 649 | Ga0501071_0001306 | 3300049587 | Bacteria | 14206 |
| 650 | Ga0501071_0162807 | 3300049587 | Bacteria | 1668 |
| 651 | Ga0501072_0011907 | 3300049588 | Bacteria | 6643 |
| 652 | Ga0501072_0016960 | 3300049588 | Bacteria | 5596 |
| 653 | Ga0501072_1047805 | 3300049588 | Bacteria | 635 |
| 654 | Ga0501074_0028137 | 3300049590 | Bacteria | 4073 |
| 655 | Ga0501075_0021301 | 3300049591 | Bacteria | 4724 |
| 656 | Ga0501075_0087770 | 3300049591 | Bacteria | 2357 |
| 657 | Ga0501075_0344507 | 3300049591 | Bacteria | 1136 |
| 658 | Ga0501075_0351804 | 3300049591 | Bacteria | 1123 |
| 659 | Ga0501075_1006316 | 3300049591 | Bacteria | 633 |
| 660 | Ga0501076_0006204 | 3300049592 | Bacteria | 8651 |
| 661 | Ga0501076_0054541 | 3300049592 | Bacteria | 3168 |
| 662 | Ga0501076_0979189 | 3300049592 | Bacteria | 697 |
| 663 | Ga0501077_0026053 | 3300049593 | Bacteria | 3710 |
| 664 | Ga0501077_1027650 | 3300049593 | Bacteria | 530 |
| 665 | Ga0501079_0005835 | 3300049741 | Bacteria | 9207 |
| 666 | Ga0501080_0002956 | 3300049742 | Bacteria | 14941 |
| 667 | Ga0501081_0005772 | 3300049743 | Bacteria | 8014 |
| 668 | Ga0501081_0029860 | 3300049743 | Bacteria | 3686 |
| 669 | Ga0501081_0216852 | 3300049743 | Bacteria | 1391 |
| 670 | Ga0501083_0043108 | 3300049744 | Bacteria | 3057 |
| 671 | Ga0501035_0007957 | 3300049822 | Bacteria | 9891 |
| 672 | Ga0501035_0435950 | 3300049822 | Bacteria | 1086 |
| 673 | Ga0501044_0062803 | 3300049823 | Bacteria | 3796 |
| 674 | Ga0501044_0068715 | 3300049823 | Bacteria | 3609 |
| 675 | Ga0501045_0020270 | 3300049824 | Bacteria | 4748 |
| 676 | Ga0501045_0021597 | 3300049824 | Bacteria | 4606 |
| 677 | nmdc:mga05p37_1017172_c1 | 3300050507 | Bacteria | 878 |
| 678 | nmdc:mga05p37_1033795_c1 | 3300050507 | Bacteria | 869 |
| 679 | nmdc:mga05p37_11061_c1 | 3300050507 | Bacteria | 10722 |
| 680 | nmdc:mga05p37_1637217_c1 | 3300050507 | Bacteria | 632 |
| 681 | nmdc:mga05p37_16753_c1 | 3300050507 | Bacteria | 8834 |
| 682 | nmdc:mga05p37_175888_c1 | 3300050507 | Bacteria | 2608 |
| 683 | nmdc:mga05p37_215197_c1 | 3300050507 | Bacteria | 2321 |
| 684 | nmdc:mga05p37_216593_c1 | 3300050507 | Bacteria | 2313 |
| 685 | nmdc:mga05p37_2273_c1 | 3300050507 | Bacteria | 22397 |
| 686 | nmdc:mga05p37_351219_c1 | 3300050507 | Bacteria | 1736 |
| 687 | nmdc:mga05p37_354305_c1 | 3300050507 | Unclassified | 1727 |
| 688 | nmdc:mga05p37_390070_c1 | 3300050507 | Bacteria | 1629 |
| 689 | nmdc:mga05p37_400314_c1 | 3300050507 | Bacteria | 1603 |
| 690 | nmdc:mga05p37_63507_c1 | 3300050507 | Bacteria | 4544 |
| 691 | nmdc:mga05p37_660391_c1 | 3300050507 | Bacteria | 1169 |
| 692 | nmdc:mga05p37_67721_c1 | 3300050507 | Bacteria | 4392 |
| 693 | nmdc:mga05p37_69274_c1 | 3300050507 | Unclassified | 4339 |
| 694 | nmdc:mga09592_123920_c1 | 3300050508 | Bacteria | 2221 |
| 695 | nmdc:mga09592_1373845_c1 | 3300050508 | Unclassified | 578 |
| 696 | nmdc:mga09592_194_c1 | 3300050508 | Bacteria | 43708 |
| 697 | nmdc:mga09592_219646_c1 | 3300050508 | Unclassified | 1647 |
| 698 | nmdc:mga09592_554503_c1 | 3300050508 | Bacteria | 987 |
| 699 | nmdc:mga09592_63909_c1 | 3300050508 | Bacteria | 3116 |
| 700 | nmdc:mga09592_81120_c1 | 3300050508 | Bacteria | 2764 |
| 701 | nmdc:mga0qj67_104446_c1 | 3300050509 | Bacteria | 2285 |
| 702 | nmdc:mga0qj67_1184589_c1 | 3300050509 | Bacteria | 595 |
| 703 | nmdc:mga0qj67_21563_c1 | 3300050509 | Unclassified | 4942 |
| 704 | nmdc:mga0qj67_877_c1 | 3300050509 | Bacteria | 20625 |
| 705 | nmdc:mga06r32_1335420_c1 | 3300050510 | Bacteria | 660 |
| 706 | nmdc:mga06r32_1381081_c1 | 3300050510 | Unclassified | 646 |
| 707 | nmdc:mga06r32_217922_c2 | 3300050510 | Bacteria | 1447 |
| 708 | nmdc:mga06r32_265703_c1 | 3300050510 | Bacteria | 1703 |
| 709 | nmdc:mga06r32_428231_c1 | 3300050510 | Bacteria | 1304 |
| 710 | nmdc:mga06r32_497210_c1 | 3300050510 | Bacteria | 1197 |
| 711 | nmdc:mga06r32_534241_c1 | 3300050510 | Bacteria | 1148 |
| 712 | nmdc:mga06r32_736427_c1 | 3300050510 | Bacteria | 950 |
| 713 | nmdc:mga06r32_830538_c1 | 3300050510 | Bacteria | 883 |
| 714 | nmdc:mga06r32_83277_c1 | 3300050510 | Bacteria | 3117 |
| 715 | nmdc:mga06r32_919249_c1 | 3300050510 | Unclassified | 831 |
| 716 | nmdc:mga08y16_1291915_c1 | 3300050511 | Bacteria | 697 |
| 717 | nmdc:mga08y16_1494729_c1 | 3300050511 | Bacteria | 636 |
| 718 | nmdc:mga08y16_32240_c1 | 3300050511 | Bacteria | 5510 |
| 719 | nmdc:mga08y16_600046_c1 | 3300050511 | Bacteria | 1110 |
| 720 | nmdc:mga0n895_1244610_c1 | 3300050512 | Unclassified | 717 |
| 721 | nmdc:mga0rr50_126760_c1 | 3300050513 | Bacteria | 2039 |
| 722 | nmdc:mga0rr50_1364470_c1 | 3300050513 | Bacteria | 600 |
| 723 | nmdc:mga0rr50_442756_c1 | 3300050513 | Bacteria | 1101 |
| 724 | nmdc:mga0a205_1197703_c1 | 3300050515 | Unclassified | 607 |
| 725 | nmdc:mga0a205_250821_c1 | 3300050515 | Bacteria | 1649 |
| 726 | nmdc:mga0a205_31629_c1 | 3300050515 | Bacteria | 5072 |
| 727 | Ga0495619_0157046 | 3300053085 | Bacteria | 1570 |
| 728 | Ga0500644_0117806 | 3300053088 | Bacteria | 1031 |
| 729 | Ga0500583_0135872 | 3300053092 | Bacteria | 1221 |
| 730 | Ga0500651_0050721 | 3300053093 | Bacteria | 2603 |
| 731 | Ga0500641_0005174 | 3300053096 | Bacteria | 4622 |
| 732 | Ga0500660_098312 | 3300053100 | Bacteria | 1285 |
| 733 | Ga0500555_004378 | 3300053103 | Bacteria | 4014 |
| 734 | Ga0500556_0132369 | 3300053104 | Unclassified | 978 |
| 735 | Ga0500562_086245 | 3300053108 | Bacteria | 851 |
| 736 | Ga0500562_136680 | 3300053108 | Unclassified | 668 |
| 737 | Ga0500569_020587 | 3300053109 | Bacteria | 1733 |
| 738 | Ga0500594_0095449 | 3300053118 | Bacteria | 908 |
| 739 | Ga0500652_015178 | 3300053131 | Bacteria | 2774 |
| 740 | Ga0500600_0217209 | 3300053149 | Bacteria | 885 |
| 741 | Ga0500627_0291028 | 3300053158 | Unclassified | 715 |
| 742 | Ga0500633_0023451 | 3300053160 | Bacteria | 1905 |
| 743 | Ga0501084_0004927 | 3300054114 | Bacteria | 10908 |
| 744 | Ga0501084_0049963 | 3300054114 | Bacteria | 3501 |
| 745 | Ga0501082_0002856 | 3300060353 | Bacteria | 15053 |
| 746 | Ga0501082_1018873 | 3300060353 | Unclassified | 724 |
| 747 | Ga0530510_0006318 | 3300061734 | Bacteria | 8241 |
| 748 | Ga0530510_0027646 | 3300061734 | Bacteria | 4065 |
| 749 | Ga0530510_0129188 | 3300061734 | Bacteria | 1858 |
| 750 | 2501943695 | 2501939600 | Bacteria | 6907073 |
| 751 | 2623585701 | 2622736626 | Bacteria | 7181580 |
| 752 | 2676482933 | 2675903059 | Bacteria | 8644972 |
| 753 | 2753269673 | 2751185782 | Bacteria | 11227053 |
| 754 | 2772642894 | 2772190715 | Bacteria | 6959372 |
| 755 | 2831938832 | 2831935698 | Bacteria | 5963223 |
| 756 | 2832006870 | 2832004796 | Bacteria | 6538017 |
| 757 | 2855674171 | 2855670206 | Bacteria | 7120389 |
| 758 | 2855679828 | 2855676851 | Bacteria | 7063653 |
| 759 | 2855689844 | 2855683550 | Bacteria | 7134265 |
| 760 | 2856859592 | 2856858025 | Bacteria | 7255264 |
| 761 | 2857290824 | 2857288857 | Bacteria | 7189066 |
| 762 | 2858853802 | 2858848962 | Bacteria | 6963058 |
| 763 | 2858869746 | 2858868258 | Bacteria | 7683772 |
| 764 | 2858885175 | 2858882152 | Bacteria | 7230291 |
| 765 | 2858893222 | 2858888857 | Bacteria | 7060307 |
| 766 | 2858901906 | 2858895516 | Bacteria | 7378898 |
| 767 | 2858904978 | 2858902515 | Bacteria | 7086037 |
| 768 | 2867307946 | 2867302475 | Bacteria | 7087181 |
| 769 | 2867318663 | 2867312974 | Bacteria | 7058875 |
| 770 | 2867324023 | 2867319477 | Bacteria | 7069771 |
| 771 | 2869053274 | 2869048445 | Bacteria | 6875584 |
| 772 | 2869064161 | 2869061728 | Bacteria | 7112407 |
| 773 | 2869071238 | 2869068681 | Bacteria | 7205615 |
| 774 | 2880494537 | 2880489317 | Bacteria | 7096270 |
| 775 | 2880497770 | 2880495981 | Bacteria | 7340502 |
| 776 | 2887486405 | 2887478801 | Bacteria | 8972725 |
| 777 | 2902588459 | 2902582711 | Bacteria | 6187705 |
| 778 | 2929226344 | 2929219909 | Bacteria | 6984360 |
| 779 | 2929233041 | 2929226422 | Bacteria | 7248583 |
| 780 | 2996222880 | 2996221748 | Bacteria | 6799777 |
| 781 | 649816300 | 649633069 | Bacteria | 6962533 |
| 782 | 8001782606 | 8001781756 | Bacteria | 9586736 |
| 783 | 8003834354 | 8003830390 | Bacteria | 6541657 |
| 784 | 8003876491 | 8003870546 | Bacteria | 7396674 |
| 785 | 8054709645 | 8054704163 | Bacteria | 7247792 |
| 786 | 8054729567 | 8054727385 | Bacteria | 7558670 |
| 787 | 8054740411 | 8054734606 | Bacteria | 6947278 |
| 788 | 8055413249 | 8055412473 | Bacteria | 6257500 |
| 789 | Ga0501292_048237 | |||
| 790 | JGI25406J46586_10015007 | |||
| 791 | JGI25406J46586_10017660 | |||
| 792 | JGI25406J46586_10032081 | |||
| 793 | JGI25406J46586_10065930 | |||
| 794 | JGI25406J46586_10098817 | |||
| 795 | Ga0065704_10003919 | |||
| 796 | Ga0065704_10131556 | |||
| 797 | Ga0065712_10144598 | |||
| 798 | Ga0065712_10187289 | |||
| 799 | Ga0065712_10378705 | |||
| 800 | Ga0065715_10057372 | |||
| 801 | Ga0065715_10138730 | |||
| 802 | Ga0065707_10030111 | |||
| 803 | Ga0065707_10086277 | |||
| 804 | Ga0065707_10089040 | |||
| 805 | Ga0065707_10410709 | |||
| 806 | Ga0070676_10034089 | |||
| 807 | Ga0070676_10267932 | |||
| 808 | Ga0070690_100196698 | |||
| 809 | Ga0070690_100664726 | |||
| 810 | Ga0068869_100372955 | |||
| 811 | Ga0070666_10211856 | |||
| 812 | Ga0070680_100500215 | |||
| 813 | Ga0070682_100849695 | |||
| 814 | Ga0068868_100106743 | |||
| 815 | Ga0068868_100154148 | |||
| 816 | Ga0068868_100479053 | |||
| 817 | Ga0070660_101242638 | |||
| 818 | Ga0070689_100252378 | |||
| 819 | Ga0070689_100740811 | |||
| 820 | Ga0070689_100830776 | |||
| 821 | Ga0070689_102007194 | |||
| 822 | Ga0070687_100402547 | |||
| 823 | Ga0070687_101350361 | |||
| 824 | Ga0070668_100000635 | |||
| 825 | Ga0070668_100124925 | |||
| 826 | Ga0070668_100828119 | |||
| 827 | Ga0070668_101366014 | |||
| 828 | Ga0070669_100026514 | |||
| 829 | Ga0070669_100294532 | |||
| 830 | Ga0070675_100107989 | |||
| 831 | Ga0070675_101237323 | |||
| 832 | Ga0070671_100026407 | |||
| 833 | Ga0070671_100152838 | |||
| 834 | Ga0070671_100347509 | |||
| 835 | Ga0070671_100642231 | |||
| 836 | Ga0070671_101715348 | |||
| 837 | Ga0070674_100009328 | |||
| 838 | Ga0070674_100115551 | |||
| 839 | Ga0070674_100837843 | |||
| 840 | Ga0070673_100166892 | |||
| 841 | Ga0070673_100797247 | |||
| 842 | Ga0070673_100923831 | |||
| 843 | Ga0070673_101549429 | |||
| 844 | Ga0070688_101364514 | |||
| 845 | Ga0070667_100078030 | |||
| 846 | Ga0070667_100192334 | |||
| 847 | Ga0070667_100236666 | |||
| 848 | Ga0070709_10024337 | |||
| 849 | Ga0070714_100337539 | |||
| 850 | Ga0070714_101950995 | |||
| 851 | Ga0070714_102474877 | |||
| 852 | Ga0070713_100861929 | |||
| 853 | Ga0070713_102369173 | |||
| 854 | Ga0070711_100022781 | |||
| 855 | Ga0070711_100029506 | |||
| 856 | Ga0070711_100192256 | |||
| 857 | Ga0070711_100644478 | |||
| 858 | Ga0070705_100263616 | |||
| 859 | Ga0070705_100512563 | |||
| 860 | Ga0070705_101194980 | |||
| 861 | Ga0070700_100211174 | |||
| 862 | Ga0070694_100015098 | |||
| 863 | Ga0070694_100130332 | |||
| 864 | Ga0070694_100820537 | |||
| 865 | Ga0070708_100116545 | |||
| 866 | Ga0070708_100295517 | |||
| 867 | Ga0070663_100120316 | |||
| 868 | Ga0070663_100854722 | |||
| 869 | Ga0070678_100421787 | |||
| 870 | Ga0070678_100478952 | |||
| 871 | Ga0070662_100001968 | |||
| 872 | Ga0070662_100070412 | |||
| 873 | Ga0070662_100216166 | |||
| 874 | Ga0070662_101574691 | |||
| 875 | Ga0068867_100043479 | |||
| 876 | Ga0070685_10158200 | |||
| 877 | Ga0070706_100016401 | |||
| 878 | Ga0070706_100090619 | |||
| 879 | Ga0070706_100209341 | |||
| 880 | Ga0070706_101027547 | |||
| 881 | Ga0070706_101553148 | |||
| 882 | Ga0070707_100117285 | |||
| 883 | Ga0070707_100137858 | |||
| 884 | Ga0070707_100315248 | |||
| 885 | Ga0070707_100406986 | |||
| 886 | Ga0070698_100026359 | |||
| 887 | Ga0070698_100102123 | |||
| 888 | Ga0070698_100199609 | |||
| 889 | Ga0070698_101485353 | |||
| 890 | Ga0070698_101667220 | |||
| 891 | Ga0070699_100026407 | |||
| 892 | Ga0070699_100032083 | |||
| 893 | Ga0070699_100669048 | |||
| 894 | Ga0070699_100786518 | |||
| 895 | Ga0070699_101503371 | |||
| 896 | Ga0070684_100269935 | |||
| 897 | Ga0070684_101520490 | |||
| 898 | Ga0070697_100012363 | |||
| 899 | Ga0070697_100088580 | |||
| 900 | Ga0070697_100179450 | |||
| 901 | Ga0070697_100276316 | |||
| 902 | Ga0068853_100775896 | |||
| 903 | Ga0070672_100023238 | |||
| 904 | Ga0070686_100125890 | |||
| 905 | Ga0070695_100007828 | |||
| 906 | Ga0070696_100106903 | |||
| 907 | Ga0070696_100303867 | |||
| 908 | Ga0070665_100065510 | |||
| 909 | Ga0070665_100089068 | |||
| 910 | Ga0070665_100105607 | |||
| 911 | Ga0070704_100155319 | |||
| 912 | Ga0070704_100530261 | |||
| 913 | Ga0070664_100054358 | |||
| 914 | Ga0070664_100062456 | |||
| 915 | Ga0070664_100719347 | |||
| 916 | Ga0068856_100183688 | |||
| 917 | Ga0068856_102038171 | |||
| 918 | Ga0068859_100108835 | |||
| 919 | Ga0068859_101817570 | |||
| 920 | Ga0068864_100118087 | |||
| 921 | Ga0068864_100334759 | |||
| 922 | Ga0068864_100472524 | |||
| 923 | Ga0068861_100094103 | |||
| 924 | Ga0068861_100159188 | |||
| 925 | Ga0068861_100537854 | |||
| 926 | Ga0068861_101020016 | |||
| 927 | Ga0068863_100236484 | |||
| 928 | Ga0068863_100697107 | |||
| 929 | Ga0068863_100776597 | |||
| 930 | Ga0068858_100060776 | |||
| 931 | Ga0068860_100094551 | |||
| 932 | Ga0068860_100997198 | |||
| 933 | Ga0068860_101514709 | |||
| 934 | Ga0068862_100000326 | |||
| 935 | Ga0068862_100210541 | |||
| 936 | Ga0068862_100227790 | |||
| 937 | Ga0068862_100259155 | |||
| 938 | Ga0081455_10002550 | |||
| 939 | Ga0081455_10014139 | |||
| 940 | Ga0081538_10008916 | |||
| 941 | Ga0081538_10386386 | |||
| 942 | Ga0081540_1038402 | |||
| 943 | Ga0081539_10000070 | |||
| 944 | Ga0081539_10001374 | |||
| 945 | Ga0081539_10001803 | |||
| 946 | Ga0081539_10001984 | |||
| 947 | Ga0081539_10002192 | |||
| 948 | Ga0081539_10004130 | |||
| 949 | Ga0081539_10006135 | |||
| 950 | Ga0081539_10010909 | |||
| 951 | Ga0081539_10017622 | |||
| 952 | Ga0081539_10038575 | |||
| 953 | Ga0070717_10039365 | |||
| 954 | Ga0070717_10573895 | |||
| 955 | Ga0070717_10665360 | |||
| 956 | Ga0070717_11015346 | |||
| 957 | Ga0070717_11797901 | |||
| 958 | Ga0075365_10945216 | |||
| 959 | Ga0070715_10197138 | |||
| 960 | Ga0070716_100735194 | |||
| 961 | Ga0097621_100726805 | |||
| 962 | Ga0097621_101533688 | |||
| 963 | Ga0097621_101541192 | |||
| 964 | Ga0068871_100147444 | |||
| 965 | Ga0068871_100724299 | |||
| 966 | Ga0075428_100002481 | |||
| 967 | Ga0075428_100055496 | |||
| 968 | Ga0075428_100221481 | |||
| 969 | Ga0075428_100233620 | |||
| 970 | Ga0075428_100307448 | |||
| 971 | Ga0075428_100376923 | |||
| 972 | Ga0075428_100582366 | |||
| 973 | Ga0075428_100742101 | |||
| 974 | Ga0075428_100820714 | |||
| 975 | Ga0075428_101236626 | |||
| 976 | Ga0075430_100000325 | |||
| 977 | Ga0075430_100092069 | |||
| 978 | Ga0075430_100092139 | |||
| 979 | Ga0075430_100512655 | |||
| 980 | Ga0075430_100571781 | |||
| 981 | Ga0075430_100797833 | |||
| 982 | Ga0075431_100042360 | |||
| 983 | Ga0075431_100088219 | |||
| 984 | Ga0075431_100182045 | |||
| 985 | Ga0075431_100278985 | |||
| 986 | Ga0075431_100380130 | |||
| 987 | Ga0075431_100438065 | |||
| 988 | Ga0075431_100731262 | |||
| 989 | Ga0075431_101562213 | |||
| 990 | Ga0075433_10044269 | |||
| 991 | Ga0075433_10231847 | |||
| 992 | Ga0075433_10241424 | |||
| 993 | Ga0075433_10561272 | |||
| 994 | Ga0075433_10623627 | |||
| 995 | Ga0075433_10825130 | |||
| 996 | Ga0075434_100077266 | |||
| 997 | Ga0075434_100088630 | |||
| 998 | Ga0075434_101849860 | |||
| 999 | Ga0075429_100005683 | |||
| 1000 | Ga0075429_100019907 | |||
| 1001 | Ga0075429_100029431 | |||
| 1002 | Ga0075429_100041146 | |||
| 1003 | Ga0075429_100080567 | |||
| 1004 | Ga0075429_100088060 | |||
| 1005 | Ga0075429_100347812 | |||
| 1006 | Ga0075429_100711361 | |||
| 1007 | Ga0075429_100884182 | |||
| 1008 | Ga0097620_100108836 | |||
| 1009 | Ga0097620_101817365 | |||
| 1010 | Ga0075435_100085405 | |||
| 1011 | Ga0075435_100455963 | |||
| 1012 | Ga0075435_100508454 | |||
| 1013 | Ga0099794_10199718 | |||
| 1014 | Ga0105251_10459373 | |||
| 1015 | Ga0105250_10338000 | |||
| 1016 | Ga0105240_10257165 | |||
| 1017 | Ga0111539_10068947 | |||
| 1018 | Ga0111539_10079440 | |||
| 1019 | Ga0111539_10303184 | |||
| 1020 | Ga0111539_10422815 | |||
| 1021 | Ga0111539_11548600 | |||
| 1022 | Ga0105245_10006025 | |||
| 1023 | Ga0105245_10579264 | |||
| 1024 | Ga0105247_10111109 | |||
| 1025 | Ga0105247_10521825 | |||
| 1026 | Ga0105247_10529772 | |||
| 1027 | Ga0114129_10002746 | |||
| 1028 | Ga0114129_10015317 | |||
| 1029 | Ga0114129_10027565 | |||
| 1030 | Ga0114129_10038320 | |||
| 1031 | Ga0114129_10041383 | |||
| 1032 | Ga0114129_10065860 | |||
| 1033 | Ga0114129_10073788 | |||
| 1034 | Ga0114129_10139135 | |||
| 1035 | Ga0114129_10167688 | |||
| 1036 | Ga0114129_10273361 | |||
| 1037 | Ga0114129_10344558 | |||
| 1038 | Ga0114129_10481490 | |||
| 1039 | Ga0114129_10671319 | |||
| 1040 | Ga0114129_10673008 | |||
| 1041 | Ga0114129_10737156 | |||
| 1042 | Ga0114129_10827133 | |||
| 1043 | Ga0114129_11167582 | |||
| 1044 | Ga0114129_11196955 | |||
| 1045 | Ga0114129_11235924 | |||
| 1046 | Ga0114129_11240572 | |||
| 1047 | Ga0114129_11254140 | |||
| 1048 | Ga0114129_12107404 | |||
| 1049 | Ga0105243_10008709 | |||
| 1050 | Ga0105243_10045280 | |||
| 1051 | Ga0105243_10979320 | |||
| 1052 | Ga0105242_10064779 | |||
| 1053 | Ga0105242_10747146 | |||
| 1054 | Ga0105242_11298699 | |||
| 1055 | Ga0105248_11221862 | |||
| 1056 | Ga0105248_11413082 | |||
| 1057 | Ga0105237_10534164 | |||
| 1058 | Ga0105238_11346196 | |||
| 1059 | Ga0105249_10330915 | |||
| 1060 | Ga0105249_10440753 | |||
| 1061 | Ga0099796_10005699 | |||
| 1062 | Ga0105239_10013380 | |||
| 1063 | Ga0105239_10497135 | |||
| 1064 | Ga0105239_11203217 | |||
| 1065 | Ga0105239_12018602 | |||
| 1066 | Ga0105239_13076402 | |||
| 1067 | Ga0105246_10397932 | |||
| 1068 | Ga0105246_10783907 | |||
| 1069 | Ga0157373_10344236 | |||
| 1070 | Ga0157373_11372578 | |||
| 1071 | Ga0157370_11375232 | |||
| 1072 | Ga0157374_10068668 | |||
| 1073 | Ga0157374_10171919 | |||
| 1074 | Ga0157374_10870170 | |||
| 1075 | Ga0157374_11599997 | |||
| 1076 | Ga0157374_11607043 | |||
| 1077 | Ga0157378_10093799 | |||
| 1078 | Ga0157378_10147800 | |||
| 1079 | Ga0157378_10433047 | |||
| 1080 | Ga0157378_10772414 | |||
| 1081 | Ga0157378_11317448 | |||
| 1082 | Ga0163162_10006856 | |||
| 1083 | Ga0163162_10424826 | |||
| 1084 | Ga0163162_10529622 | |||
| 1085 | Ga0163162_10999753 | |||
| 1086 | Ga0163162_11228859 | |||
| 1087 | Ga0157372_10620756 | |||
| 1088 | Ga0157375_10810009 | |||
| 1089 | Ga0157375_11631631 | |||
| 1090 | Ga0157375_11897310 | |||
| 1091 | Ga0163163_10076891 | |||
| 1092 | Ga0163163_10378271 | |||
| 1093 | Ga0163163_11273375 | |||
| 1094 | Ga0157380_10585019 | |||
| 1095 | Ga0157380_10808242 | |||
| 1096 | Ga0157379_11935907 | |||
| 1097 | Ga0157376_10099294 | |||
| 1098 | Ga0157376_10164248 | |||
| 1099 | Ga0157376_10343037 | |||
| 1100 | Ga0163161_10061942 | |||
| 1101 | Ga0163161_10116001 | |||
| 1102 | Ga0206354_10311746 | |||
| 1103 | Ga0206353_11917053 | |||
| 1104 | Ga0207673_1013051 | |||
| 1105 | Ga0207697_10001869 | |||
| 1106 | Ga0207697_10008030 | |||
| 1107 | Ga0207696_1137314 | |||
| 1108 | Ga0207682_10027266 | |||
| 1109 | Ga0207692_10167533 | |||
| 1110 | Ga0207642_10053251 | |||
| 1111 | Ga0207710_10328168 | |||
| 1112 | Ga0207688_10092447 | |||
| 1113 | Ga0207688_10122259 | |||
| 1114 | Ga0207680_10032343 | |||
| 1115 | Ga0207680_10554880 | |||
| 1116 | Ga0207680_10602883 | |||
| 1117 | Ga0207699_10381665 | |||
| 1118 | Ga0207645_10006819 | |||
| 1119 | Ga0207645_10045453 | |||
| 1120 | Ga0207645_10259481 | |||
| 1121 | Ga0207684_10016870 | |||
| 1122 | Ga0207684_10048066 | |||
| 1123 | Ga0207684_10079574 | |||
| 1124 | Ga0207671_10272049 | |||
| 1125 | Ga0207693_10189244 | |||
| 1126 | Ga0207663_10298123 | |||
| 1127 | Ga0207663_10392842 | |||
| 1128 | Ga0207646_10004642 | |||
| 1129 | Ga0207646_10092942 | |||
| 1130 | Ga0207646_10404182 | |||
| 1131 | Ga0207646_10687256 | |||
| 1132 | Ga0207646_10853145 | |||
| 1133 | Ga0207681_10141492 | |||
| 1134 | Ga0207650_10090220 | |||
| 1135 | Ga0207659_10053425 | |||
| 1136 | Ga0207659_10112658 | |||
| 1137 | Ga0207659_10484549 | |||
| 1138 | Ga0207700_10058362 | |||
| 1139 | Ga0207700_10135687 | |||
| 1140 | Ga0207700_11783418 | |||
| 1141 | Ga0207664_10587500 | |||
| 1142 | Ga0207644_10024337 | |||
| 1143 | Ga0207644_10024991 | |||
| 1144 | Ga0207644_10071813 | |||
| 1145 | Ga0207706_10017316 | |||
| 1146 | Ga0207706_10080010 | |||
| 1147 | Ga0207706_10237837 | |||
| 1148 | Ga0207706_10646123 | |||
| 1149 | Ga0207686_10400846 | |||
| 1150 | Ga0207709_10399795 | |||
| 1151 | Ga0207670_10089769 | |||
| 1152 | Ga0207670_10210832 | |||
| 1153 | Ga0207670_10679003 | |||
| 1154 | Ga0207669_10007862 | |||
| 1155 | Ga0207669_10102146 | |||
| 1156 | Ga0207669_10295075 | |||
| 1157 | Ga0207669_11375613 | |||
| 1158 | Ga0207665_10025683 | |||
| 1159 | Ga0207665_11342159 | |||
| 1160 | Ga0207691_10007318 | |||
| 1161 | Ga0207691_10044930 | |||
| 1162 | Ga0207711_10328722 | |||
| 1163 | Ga0207689_10351673 | |||
| 1164 | Ga0207689_11184352 | |||
| 1165 | Ga0207661_11192156 | |||
| 1166 | Ga0207668_10001042 | |||
| 1167 | Ga0207668_10037064 | |||
| 1168 | Ga0207668_10116459 | |||
| 1169 | Ga0207668_10191176 | |||
| 1170 | Ga0207668_10713061 | |||
| 1171 | Ga0207640_10573279 | |||
| 1172 | Ga0207658_10055305 | |||
| 1173 | Ga0207658_10439331 | |||
| 1174 | Ga0207658_10900513 | |||
| 1175 | Ga0207677_10277911 | |||
| 1176 | Ga0207677_10419749 | |||
| 1177 | Ga0207677_10533351 | |||
| 1178 | Ga0207703_10157651 | |||
| 1179 | Ga0207703_10195240 | |||
| 1180 | Ga0207639_10710806 | |||
| 1181 | Ga0207678_10171773 | |||
| 1182 | Ga0207678_10693034 | |||
| 1183 | Ga0207708_10112652 | |||
| 1184 | Ga0207708_10532121 | |||
| 1185 | Ga0207702_10447558 | |||
| 1186 | Ga0207702_10555884 | |||
| 1187 | Ga0207641_10387768 | |||
| 1188 | Ga0207641_11312437 | |||
| 1189 | Ga0207648_10173497 | |||
| 1190 | Ga0207648_10349355 | |||
| 1191 | Ga0207676_10326886 | |||
| 1192 | Ga0207676_10436038 | |||
| 1193 | Ga0207676_10551882 | |||
| 1194 | Ga0207676_10691959 | |||
| 1195 | Ga0207674_10900084 | |||
| 1196 | Ga0207674_10969451 | |||
| 1197 | Ga0207675_100001774 | |||
| 1198 | Ga0207675_100182031 | |||
| 1199 | Ga0207675_100196036 | |||
| 1200 | Ga0207675_100522204 | |||
| 1201 | Ga0207675_100546606 | |||
| 1202 | Ga0207683_10008702 | |||
| 1203 | Ga0207683_10145254 | |||
| 1204 | Ga0207683_10204124 | |||
| 1205 | Ga0207683_10236334 | |||
| 1206 | Ga0207428_10008508 | |||
| 1207 | Ga0268266_10086518 | |||
| 1208 | Ga0268266_10095287 | |||
| 1209 | Ga0268266_10333517 | |||
| 1210 | Ga0268265_10000138 | |||
| 1211 | Ga0268265_10047434 | |||
| 1212 | Ga0268265_10231561 | |||
| 1213 | Ga0268265_11407569 | |||
| 1214 | Ga0268264_10067687 | |||
| 1215 | Ga0307517_10127523 | |||
| 1216 | Ga0307515_10004739 | |||
| 1217 | Ga0307515_10007075 | |||
| 1218 | Ga0307515_10802512 | |||
| 1219 | Ga0307512_10002245 | |||
| 1220 | Ga0307513_10002908 | |||
| 1221 | Ga0307408_100365566 | |||
| 1222 | Ga0307508_10005441 | |||
| 1223 | Ga0307508_10060277 | |||
| 1224 | Ga0307508_10114605 | |||
| 1225 | Ga0307508_10146523 | |||
| 1226 | Ga0316578_10473298 | |||
| 1227 | Ga0307516_10000528 | |||
| 1228 | Ga0307516_10076953 | |||
| 1229 | Ga0307516_10115978 | |||
| 1230 | Ga0307516_10127005 | |||
| 1231 | Ga0307516_10213579 | |||
| 1232 | Ga0307405_10005279 | |||
| 1233 | Ga0307405_10237887 | |||
| 1234 | Ga0307413_10060027 | |||
| 1235 | Ga0307413_10118800 | |||
| 1236 | Ga0307413_10700439 | |||
| 1237 | Ga0307413_11659278 | |||
| 1238 | Ga0307410_10156195 | |||
| 1239 | Ga0307410_10186027 | |||
| 1240 | Ga0307410_10386022 | |||
| 1241 | Ga0307410_10423445 | |||
| 1242 | Ga0307410_10755759 | |||
| 1243 | Ga0307406_10005652 | |||
| 1244 | Ga0307406_10006884 | |||
| 1245 | Ga0307406_10932489 | |||
| 1246 | Ga0307406_10958409 | |||
| 1247 | Ga0307407_10023579 | |||
| 1248 | Ga0307407_10188817 | |||
| 1249 | Ga0307407_10194712 | |||
| 1250 | Ga0307407_10238526 | |||
| 1251 | Ga0307412_10059594 | |||
| 1252 | Ga0307412_10796735 | |||
| 1253 | Ga0307412_10880524 | |||
| 1254 | Ga0307409_100015616 | |||
| 1255 | Ga0307409_100195813 | |||
| 1256 | Ga0307409_100202313 | |||
| 1257 | Ga0307409_100360272 | |||
| 1258 | Ga0307409_101507754 | |||
| 1259 | Ga0307409_102245235 | |||
| 1260 | Ga0307416_100003064 | |||
| 1261 | Ga0307416_100112914 | |||
| 1262 | Ga0307416_100115944 | |||
| 1263 | Ga0307416_100137557 | |||
| 1264 | Ga0307416_100781008 | |||
| 1265 | Ga0307416_101384949 | |||
| 1266 | Ga0307414_10085593 | |||
| 1267 | Ga0307414_10447562 | |||
| 1268 | Ga0307411_10291946 | |||
| 1269 | Ga0307411_10328803 | |||
| 1270 | Ga0307411_11127489 | |||
| 1271 | Ga0307415_100000009 | |||
| 1272 | Ga0307415_100026967 | |||
| 1273 | Ga0307415_100063058 | |||
| 1274 | Ga0307415_100182134 | |||
| 1275 | Ga0307415_100331579 | |||
| 1276 | Ga0307415_100369931 | |||
| 1277 | Ga0307415_100395534 | |||
| 1278 | Ga0307415_100947675 | |||
| 1279 | Ga0307415_101076631 | |||
| 1280 | Ga0307415_101416489 | |||
| 1281 | Ga0307507_10312587 | |||
| 1282 | Ga0307510_10413871 | |||
| 1283 | Ga0316592_1160856 | |||
| 1284 | Ga0373938_0025835 | |||
| 1285 | Ga0373928_0087956 | |||
| 1286 | Ga0373940_0003039 | |||
| 1287 | Ga0373951_0000134 | |||
| 1288 | Ga0373932_0014431 | |||
| 1289 | Ga0373941_0355056 | |||
| 1290 | Ga0373941_0507976 | |||
| 1291 | Ga0373945_0025421 | |||
| 1292 | Ga0373945_0244856 | |||
| 1293 | Ga0373957_0100775 | |||
| 1294 | Ga0373943_0266668 | |||
| 1295 | Ga0373946_0193978 | |||
| 1296 | Ga0373942_0001030 | |||
| 1297 | Ga0373962_0002273 | |||
| 1298 | Ga0373924_0142514 | |||
| 1299 | Ga0373931_0119349 | |||
| 1300 | Ga0373931_0305682 | |||
| 1301 | Ga0373935_0007029 | |||
| 1302 | Ga0373935_0068307 | |||
| 1303 | Ga0373935_0234771 | |||
| 1304 | Ga0373935_0450549 | |||
| 1305 | Ga0373935_0503620 | |||
| 1306 | Ga0373927_0399762 | |||
| 1307 | Ga0373927_1089844 | |||
| 1308 | Ga0373947_0096275 | |||
| 1309 | Ga0373947_0103015 | |||
| 1310 | Ga0373937_0048253 | |||
| 1311 | Ga0373937_0114090 | |||
| 1312 | Ga0373937_0923116 | |||
| 1313 | Ga0316582_0008790 | |||
| 1314 | Ga0395899_0064801 | |||
| 1315 | Ga0395900_0137234 | |||
| 1316 | Ga0395900_0356829 | |||
| 1317 | Ga0395900_0375212 | |||
| 1318 | Ga0395900_0591377 | |||
| 1319 | Ga0395898_0036138 | |||
| 1320 | Ga0395898_0049949 | |||
| 1321 | Ga0395898_1778338 | |||
| 1322 | Ga0316581_0118649 | |||
| 1323 | Ga0436364_1383891 | |||
| 1324 | Ga0395901_0305353 | |||
| 1325 | Ga0451793_1633125 | |||
| 1326 | Ga0451802_1771638 | |||
| 1327 | Ga0451804_0377329 | |||
| 1328 | Ga0451833_0074111 | |||
| 1329 | Ga0451841_1387006 | |||
| 1330 | Ga0451853_1233207 | |||
| 1331 | Ga0451853_3441805 | |||
| 1332 | Ga0439463_045945 | |||
| 1333 | Ga0439459_0035868 | |||
| 1334 | Ga0466963_0445644 | |||
| 1335 | Ga0466963_0795704 | |||
| 1336 | Ga0466968_0067229 | |||
| 1337 | Ga0466960_0731854 | |||
| 1338 | Ga0466967_0154970 | |||
| 1339 | Ga0466967_2311311 | |||
| 1340 | Ga0495603_0292970 | |||
| 1341 | Ga0495629_0550211 | |||
| 1342 | Ga0495651_0106096 | |||
| 1343 | Ga0495653_0188118 | |||
| 1344 | Ga0495664_0239086 | |||
| 1345 | Ga0495606_0001573 | |||
| 1346 | Ga0495630_0214769 | |||
| 1347 | Ga0495630_0256370 | |||
| 1348 | Ga0495630_1346219 | |||
| 1349 | Ga0495632_0034183 | |||
| 1350 | Ga0495632_0044122 | |||
| 1351 | Ga0495652_0046702 | |||
| 1352 | Ga0495640_0790254 | |||
| 1353 | Ga0495667_0391448 | |||
| 1354 | Ga0495668_0000668 | |||
| 1355 | Ga0495634_0380083 | |||
| 1356 | Ga0495625_0004244 | |||
| 1357 | Ga0495625_0120926 | |||
| 1358 | Ga0495625_0369701 | |||
| 1359 | Ga0495635_0273673 | |||
| 1360 | Ga0495657_0502354 | |||
| 1361 | Ga0495599_0367453 | |||
| 1362 | Ga0495669_0063375 | |||
| 1363 | Ga0495669_0232573 | |||
| 1364 | Ga0495669_0373383 | |||
| 1365 | Ga0495613_0483300 | |||
| 1366 | Ga0495624_0168220 | |||
| 1367 | Ga0495672_0115586 | |||
| 1368 | Ga0495683_0163957 | |||
| 1369 | Ga0495675_0082267 | |||
| 1370 | Ga0495684_0026233 | |||
| 1371 | Ga0495626_0000282 | |||
| 1372 | Ga0496100_0006316 | |||
| 1373 | Ga0496101_1446446 | |||
| 1374 | Ga0496102_0034791 | |||
| 1375 | Ga0496102_0861799 | |||
| 1376 | Ga0496102_1256001 | |||
| 1377 | Ga0496103_0169487 | |||
| 1378 | Ga0496103_0611563 | |||
| 1379 | Ga0496104_0208342 | |||
| 1380 | Ga0496104_0638423 | |||
| 1381 | Ga0496106_0059977 | |||
| 1382 | Ga0496106_0495313 | |||
| 1383 | Ga0496106_0502663 | |||
| 1384 | Ga0496107_0082591 | |||
| 1385 | Ga0496107_0209819 | |||
| 1386 | Ga0496107_0452108 | |||
| 1387 | Ga0496108_0000247 | |||
| 1388 | Ga0496108_0172262 | |||
| 1389 | Ga0496109_0000040 | |||
| 1390 | Ga0496109_0207460 | |||
| 1391 | Ga0496110_1213631 | |||
| 1392 | Ga0496112_0021085 | |||
| 1393 | Ga0496112_0116312 | |||
| 1394 | Ga0496112_0121762 | |||
| 1395 | Ga0496112_0710727 | |||
| 1396 | Ga0496112_1398161 | |||
| 1397 | Ga0496113_0321701 | |||
| 1398 | Ga0496114_1140820 | |||
| 1399 | Ga0496115_0020650 | |||
| 1400 | Ga0496115_0438291 | |||
| 1401 | Ga0496119_0456829 | |||
| 1402 | Ga0496126_0069897 | |||
| 1403 | Ga0501031_0005760 | |||
| 1404 | Ga0501032_0064110 | |||
| 1405 | Ga0501032_0595214 | |||
| 1406 | Ga0501033_0015722 | |||
| 1407 | Ga0501036_0000376 | |||
| 1408 | Ga0501037_1050545 | |||
| 1409 | Ga0501038_0000696 | |||
| 1410 | Ga0501038_0638230 | |||
| 1411 | Ga0501039_0000734 | |||
| 1412 | Ga0501039_0041300 | |||
| 1413 | Ga0501039_0452166 | |||
| 1414 | Ga0501039_1129625 | |||
| 1415 | Ga0501040_0002456 | |||
| 1416 | Ga0501040_0088609 | |||
| 1417 | Ga0501040_0382075 | |||
| 1418 | Ga0501040_0637072 | |||
| 1419 | Ga0501041_0000196 | |||
| 1420 | Ga0501041_1110030 | |||
| 1421 | Ga0501042_0000854 | |||
| 1422 | Ga0501042_0199377 | |||
| 1423 | Ga0501042_0244965 | |||
| 1424 | Ga0501042_0592949 | |||
| 1425 | Ga0501042_0605464 | |||
| 1426 | Ga0501043_0005448 | |||
| 1427 | Ga0501043_0862055 | |||
| 1428 | Ga0501046_0001223 | |||
| 1429 | Ga0501046_0073171 | |||
| 1430 | Ga0501047_0125479 | |||
| 1431 | Ga0501047_1334544 | |||
| 1432 | Ga0501048_0001630 | |||
| 1433 | Ga0501068_0005176 | |||
| 1434 | Ga0501068_0470754 | |||
| 1435 | Ga0501070_0159492 | |||
| 1436 | Ga0501070_0587328 | |||
| 1437 | Ga0501071_0001306 | |||
| 1438 | Ga0501071_0162807 | |||
| 1439 | Ga0501072_0011907 | |||
| 1440 | Ga0501072_0016960 | |||
| 1441 | Ga0501072_1047805 | |||
| 1442 | Ga0501074_0028137 | |||
| 1443 | Ga0501075_0021301 | |||
| 1444 | Ga0501075_0087770 | |||
| 1445 | Ga0501075_0344507 | |||
| 1446 | Ga0501075_0351804 | |||
| 1447 | Ga0501075_1006316 | |||
| 1448 | Ga0501076_0006204 | |||
| 1449 | Ga0501076_0054541 | |||
| 1450 | Ga0501076_0979189 | |||
| 1451 | Ga0501077_0026053 | |||
| 1452 | Ga0501077_1027650 | |||
| 1453 | Ga0501079_0005835 | |||
| 1454 | Ga0501080_0002956 | |||
| 1455 | Ga0501081_0005772 | |||
| 1456 | Ga0501081_0029860 | |||
| 1457 | Ga0501081_0216852 | |||
| 1458 | Ga0501083_0043108 | |||
| 1459 | Ga0501035_0007957 | |||
| 1460 | Ga0501035_0435950 | |||
| 1461 | Ga0501044_0062803 | |||
| 1462 | Ga0501044_0068715 | |||
| 1463 | Ga0501045_0020270 | |||
| 1464 | Ga0501045_0021597 | |||
| 1465 | nmdc:mga05p37_1017172_c1 | |||
| 1466 | nmdc:mga05p37_1033795_c1 | |||
| 1467 | nmdc:mga05p37_11061_c1 | |||
| 1468 | nmdc:mga05p37_1637217_c1 | |||
| 1469 | nmdc:mga05p37_16753_c1 | |||
| 1470 | nmdc:mga05p37_175888_c1 | |||
| 1471 | nmdc:mga05p37_215197_c1 | |||
| 1472 | nmdc:mga05p37_216593_c1 | |||
| 1473 | nmdc:mga05p37_2273_c1 | |||
| 1474 | nmdc:mga05p37_351219_c1 | |||
| 1475 | nmdc:mga05p37_354305_c1 | |||
| 1476 | nmdc:mga05p37_390070_c1 | |||
| 1477 | nmdc:mga05p37_400314_c1 | |||
| 1478 | nmdc:mga05p37_63507_c1 | |||
| 1479 | nmdc:mga05p37_660391_c1 | |||
| 1480 | nmdc:mga05p37_67721_c1 | |||
| 1481 | nmdc:mga05p37_69274_c1 | |||
| 1482 | nmdc:mga09592_123920_c1 | |||
| 1483 | nmdc:mga09592_1373845_c1 | |||
| 1484 | nmdc:mga09592_194_c1 | |||
| 1485 | nmdc:mga09592_219646_c1 | |||
| 1486 | nmdc:mga09592_554503_c1 | |||
| 1487 | nmdc:mga09592_63909_c1 | |||
| 1488 | nmdc:mga09592_81120_c1 | |||
| 1489 | nmdc:mga0qj67_104446_c1 | |||
| 1490 | nmdc:mga0qj67_1184589_c1 | |||
| 1491 | nmdc:mga0qj67_21563_c1 | |||
| 1492 | nmdc:mga0qj67_877_c1 | |||
| 1493 | nmdc:mga06r32_1335420_c1 | |||
| 1494 | nmdc:mga06r32_1381081_c1 | |||
| 1495 | nmdc:mga06r32_217922_c2 | |||
| 1496 | nmdc:mga06r32_265703_c1 | |||
| 1497 | nmdc:mga06r32_428231_c1 | |||
| 1498 | nmdc:mga06r32_497210_c1 | |||
| 1499 | nmdc:mga06r32_534241_c1 | |||
| 1500 | nmdc:mga06r32_736427_c1 | |||
| 1501 | nmdc:mga06r32_830538_c1 | |||
| 1502 | nmdc:mga06r32_83277_c1 | |||
| 1503 | nmdc:mga06r32_919249_c1 | |||
| 1504 | nmdc:mga08y16_1291915_c1 | |||
| 1505 | nmdc:mga08y16_1494729_c1 | |||
| 1506 | nmdc:mga08y16_32240_c1 | |||
| 1507 | nmdc:mga08y16_600046_c1 | |||
| 1508 | nmdc:mga0n895_1244610_c1 | |||
| 1509 | nmdc:mga0rr50_126760_c1 | |||
| 1510 | nmdc:mga0rr50_1364470_c1 | |||
| 1511 | nmdc:mga0rr50_442756_c1 | |||
| 1512 | nmdc:mga0a205_1197703_c1 | |||
| 1513 | nmdc:mga0a205_250821_c1 | |||
| 1514 | nmdc:mga0a205_31629_c1 | |||
| 1515 | Ga0495619_0157046 | |||
| 1516 | Ga0500644_0117806 | |||
| 1517 | Ga0500583_0135872 | |||
| 1518 | Ga0500651_0050721 | |||
| 1519 | Ga0500641_0005174 | |||
| 1520 | Ga0500660_098312 | |||
| 1521 | Ga0500555_004378 | |||
| 1522 | Ga0500556_0132369 | |||
| 1523 | Ga0500562_086245 | |||
| 1524 | Ga0500562_136680 | |||
| 1525 | Ga0500569_020587 | |||
| 1526 | Ga0500594_0095449 | |||
| 1527 | Ga0500652_015178 | |||
| 1528 | Ga0500600_0217209 | |||
| 1529 | Ga0500627_0291028 | |||
| 1530 | Ga0500633_0023451 | |||
| 1531 | Ga0501084_0004927 | |||
| 1532 | Ga0501084_0049963 | |||
| 1533 | Ga0501082_0002856 | |||
| 1534 | Ga0501082_1018873 | |||
| 1535 | Ga0530510_0006318 | |||
| 1536 | Ga0530510_0027646 | |||
| 1537 | Ga0530510_0129188 | |||
| 1538 | 2501943695 | |||
| 1539 | 2623585701 | |||
| 1540 | 2676482933 | |||
| 1541 | 2753269673 | |||
| 1542 | 2772642894 | |||
| 1543 | 2831938832 | |||
| 1544 | 2832006870 | |||
| 1545 | 2855674171 | |||
| 1546 | 2855679828 | |||
| 1547 | 2855689844 | |||
| 1548 | 2856859592 | |||
| 1549 | 2857290824 | |||
| 1550 | 2858853802 | |||
| 1551 | 2858869746 | |||
| 1552 | 2858885175 | |||
| 1553 | 2858893222 | |||
| 1554 | 2858901906 | |||
| 1555 | 2858904978 | |||
| 1556 | 2867307946 | |||
| 1557 | 2867318663 | |||
| 1558 | 2867324023 | |||
| 1559 | 2869053274 | |||
| 1560 | 2869064161 | |||
| 1561 | 2869071238 | |||
| 1562 | 2880494537 | |||
| 1563 | 2880497770 | |||
| 1564 | 2887486405 | |||
| 1565 | 2902588459 | |||
| 1566 | 2929226344 | |||
| 1567 | 2929233041 | |||
| 1568 | 2996222880 | |||
| 1569 | 649816300 | |||
| 1570 | 8001782606 | |||
| 1571 | 8003834354 | |||
| 1572 | 8003876491 | |||
| 1573 | 8054709645 | |||
| 1574 | 8054729567 | |||
| 1575 | 8054740411 | |||
| 1576 | 8055413249 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9158 | 2 | 127 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9154 | 10 | 128 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9091 | 1 | 128 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9023 | 1 | 128 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.8968 | 1 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55E30_8_160_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9331 | 32 | 126 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.919 | 35 | 127 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9089 | 1 | 128 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9022 | 1 | 128 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8894 | 2 | 127 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258Y8I4-F1-model_v4 | OsmC family peroxiredoxin | 0.9796 | 41 | 128 |
GO:0004601
GO:0006979 |
| AF-A0A2W5FXT9-F1-model_v4 | OsmC family peroxiredoxin | 0.9787 | 33 | 128 |
GO:0004601
GO:0006979 |
| AF-A0A7J4VA71-F1-model_v4 | OsmC family peroxiredoxin | 0.9779 | 22 | 128 |
GO:0004601
GO:0006979 |
| AF-A0A534ZDK2-F1-model_v4 | OsmC family peroxiredoxin | 0.9779 | 36 | 127 |
GO:0004601
GO:0006979 |
| AF-A0A257KYW8-F1-model_v4 | OsmC family peroxiredoxin | 0.9779 | 33 | 127 |
GO:0004601
GO:0006979 |