F480880

General Info

Members Datasets Scaffolds Average Seq Length
788 353 1576 141

Family's Representative Sequence

Representative Sequence 3300049515|Ga0501292_048237|Ga0501292_048237_241_717
Length 158
Sequence MFSGHNKNPITSSSNVKEVEMAIRNASAVWNGNLKEGDGIMRLGSGAFEGAFTFASRFEEGEGTNPEELVGAAQAGCFSMYLASVLTNAGFPPVQVRTSAKVHLGEGPRITLIELDTEAEVPNVDEKTFQEKVDYSKENCPVSLALTGPELRVSARLV

Samples

Sample ID Description Type Environment
1 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
303 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
307 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 2501939600 Micromonospora sp. L5 Isolate Unclassified
316 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
317 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
318 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
319 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
320 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
321 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
322 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
323 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
324 2855683550 Micromonospora sp. RP3T Isolate Unclassified
325 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
326 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
327 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
328 2858868258 Micromonospora sp. MH33 Isolate Unclassified
329 2858882152 Micromonospora noduli MED15 Isolate Nodule
330 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
331 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
332 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
333 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
334 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
335 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
336 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
337 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
338 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
339 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
340 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
341 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
342 2902582711 Micromonospora sp. AP08 Isolate Unclassified
343 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
344 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
345 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
346 649633069 Micromonospora sp. L5 Isolate Unclassified
347 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
348 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
349 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
350 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
351 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
352 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
353 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.38
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0.76
Rhizoplane 4.06
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501292_048237 3300049515 Unclassified 749
2 JGI25406J46586_10015007 3300003203 Bacteria 3278
3 JGI25406J46586_10017660 3300003203 Bacteria 2944
4 JGI25406J46586_10032081 3300003203 Bacteria 1956
5 JGI25406J46586_10065930 3300003203 Bacteria 1152
6 JGI25406J46586_10098817 3300003203 Bacteria 872
7 Ga0065704_10003919 3300005289 Bacteria 5237
8 Ga0065704_10131556 3300005289 Bacteria 1623
9 Ga0065712_10144598 3300005290 Bacteria 1419
10 Ga0065712_10187289 3300005290 Bacteria 1163
11 Ga0065712_10378705 3300005290 Unclassified 754
12 Ga0065715_10057372 3300005293 Bacteria 928
13 Ga0065715_10138730 3300005293 Bacteria 1876
14 Ga0065707_10030111 3300005295 Unclassified 1383
15 Ga0065707_10086277 3300005295 Bacteria 5554
16 Ga0065707_10089040 3300005295 Bacteria 4483
17 Ga0065707_10410709 3300005295 Bacteria 800
18 Ga0070676_10034089 3300005328 Bacteria 2922
19 Ga0070676_10267932 3300005328 Bacteria 1146
20 Ga0070690_100196698 3300005330 Unclassified 1400
21 Ga0070690_100664726 3300005330 Bacteria 797
22 Ga0068869_100372955 3300005334 Bacteria 1168
23 Ga0070666_10211856 3300005335 Bacteria 1365
24 Ga0070680_100500215 3300005336 Unclassified 1040
25 Ga0070682_100849695 3300005337 Bacteria 746
26 Ga0068868_100106743 3300005338 Bacteria 2272
27 Ga0068868_100154148 3300005338 Bacteria 1894
28 Ga0068868_100479053 3300005338 Bacteria 1087
29 Ga0070660_101242638 3300005339 Bacteria 632
30 Ga0070689_100252378 3300005340 Bacteria 1456
31 Ga0070689_100740811 3300005340 Unclassified 861
32 Ga0070689_100830776 3300005340 Bacteria 814
33 Ga0070689_102007194 3300005340 Bacteria 529
34 Ga0070687_100402547 3300005343 Bacteria 898
35 Ga0070687_101350361 3300005343 Unclassified 531
36 Ga0070668_100000635 3300005347 Bacteria 23621
37 Ga0070668_100124925 3300005347 Bacteria 2060
38 Ga0070668_100828119 3300005347 Bacteria 824
39 Ga0070668_101366014 3300005347 Unclassified 645
40 Ga0070669_100026514 3300005353 Bacteria 4169
41 Ga0070669_100294532 3300005353 Unclassified 1304
42 Ga0070675_100107989 3300005354 Bacteria 2350
43 Ga0070675_101237323 3300005354 Bacteria 687
44 Ga0070671_100026407 3300005355 Bacteria 4772
45 Ga0070671_100152838 3300005355 Bacteria 1949
46 Ga0070671_100347509 3300005355 Bacteria 1266
47 Ga0070671_100642231 3300005355 Bacteria 919
48 Ga0070671_101715348 3300005355 Unclassified 557
49 Ga0070674_100009328 3300005356 Bacteria 5874
50 Ga0070674_100115551 3300005356 Bacteria 1978
51 Ga0070674_100837843 3300005356 Unclassified 797
52 Ga0070673_100166892 3300005364 Unclassified 1876
53 Ga0070673_100797247 3300005364 Bacteria 872
54 Ga0070673_100923831 3300005364 Bacteria 810
55 Ga0070673_101549429 3300005364 Unclassified 625
56 Ga0070688_101364514 3300005365 Bacteria 574
57 Ga0070667_100078030 3300005367 Bacteria 2828
58 Ga0070667_100192334 3300005367 Bacteria 1808
59 Ga0070667_100236666 3300005367 Unclassified 1629
60 Ga0070709_10024337 3300005434 Bacteria 3563
61 Ga0070714_100337539 3300005435 Bacteria 1412
62 Ga0070714_101950995 3300005435 Bacteria 573
63 Ga0070714_102474877 3300005435 Unclassified 504
64 Ga0070713_100861929 3300005436 Bacteria 870
65 Ga0070713_102369173 3300005436 Unclassified 513
66 Ga0070711_100022781 3300005439 Bacteria 4064
67 Ga0070711_100029506 3300005439 Bacteria 3620
68 Ga0070711_100192256 3300005439 Unclassified 1569
69 Ga0070711_100644478 3300005439 Bacteria 887
70 Ga0070705_100263616 3300005440 Unclassified 1217
71 Ga0070705_100512563 3300005440 Unclassified 913
72 Ga0070705_101194980 3300005440 Unclassified 626
73 Ga0070700_100211174 3300005441 Bacteria 1369
74 Ga0070694_100015098 3300005444 Bacteria 4843
75 Ga0070694_100130332 3300005444 Bacteria 1816
76 Ga0070694_100820537 3300005444 Unclassified 764
77 Ga0070708_100116545 3300005445 Bacteria 2460
78 Ga0070708_100295517 3300005445 Unclassified 1525
79 Ga0070663_100120316 3300005455 Bacteria 1983
80 Ga0070663_100854722 3300005455 Bacteria 783
81 Ga0070678_100421787 3300005456 Bacteria 1163
82 Ga0070678_100478952 3300005456 Bacteria 1095
83 Ga0070662_100001968 3300005457 Bacteria 12618
84 Ga0070662_100070412 3300005457 Unclassified 2577
85 Ga0070662_100216166 3300005457 Bacteria 1527
86 Ga0070662_101574691 3300005457 Bacteria 567
87 Ga0068867_100043479 3300005459 Bacteria 3289
88 Ga0070685_10158200 3300005466 Bacteria 1442
89 Ga0070706_100016401 3300005467 Bacteria 6845
90 Ga0070706_100090619 3300005467 Bacteria 2836
91 Ga0070706_100209341 3300005467 Bacteria 1821
92 Ga0070706_101027547 3300005467 Bacteria 760
93 Ga0070706_101553148 3300005467 Bacteria 604
94 Ga0070707_100117285 3300005468 Unclassified 2584
95 Ga0070707_100137858 3300005468 Bacteria 2374
96 Ga0070707_100315248 3300005468 Bacteria 1520
97 Ga0070707_100406986 3300005468 Bacteria 1321
98 Ga0070698_100026359 3300005471 Bacteria 6050
99 Ga0070698_100102123 3300005471 Bacteria 2839
100 Ga0070698_100199609 3300005471 Bacteria 1936
101 Ga0070698_101485353 3300005471 Bacteria 629
102 Ga0070698_101667220 3300005471 Unclassified 590
103 Ga0070699_100026407 3300005518 Bacteria 5008
104 Ga0070699_100032083 3300005518 Bacteria 4536
105 Ga0070699_100669048 3300005518 Bacteria 948
106 Ga0070699_100786518 3300005518 Bacteria 871
107 Ga0070699_101503371 3300005518 Unclassified 617
108 Ga0070684_100269935 3300005535 Bacteria 1557
109 Ga0070684_101520490 3300005535 Bacteria 631
110 Ga0070697_100012363 3300005536 Bacteria 6687
111 Ga0070697_100088580 3300005536 Bacteria 2556
112 Ga0070697_100179450 3300005536 Unclassified 1795
113 Ga0070697_100276316 3300005536 Bacteria 1440
114 Ga0068853_100775896 3300005539 Bacteria 917
115 Ga0070672_100023238 3300005543 Bacteria 4566
116 Ga0070686_100125890 3300005544 Bacteria 1765
117 Ga0070695_100007828 3300005545 Bacteria 6333
118 Ga0070696_100106903 3300005546 Unclassified 2012
119 Ga0070696_100303867 3300005546 Bacteria 1223
120 Ga0070665_100065510 3300005548 Bacteria 3644
121 Ga0070665_100089068 3300005548 Bacteria 3092
122 Ga0070665_100105607 3300005548 Bacteria 2818
123 Ga0070704_100155319 3300005549 Bacteria 1804
124 Ga0070704_100530261 3300005549 Bacteria 1026
125 Ga0070664_100054358 3300005564 Bacteria 3397
126 Ga0070664_100062456 3300005564 Bacteria 3175
127 Ga0070664_100719347 3300005564 Bacteria 931
128 Ga0068856_100183688 3300005614 Unclassified 2105
129 Ga0068856_102038171 3300005614 Unclassified 584
130 Ga0068859_100108835 3300005617 Bacteria 2832
131 Ga0068859_101817570 3300005617 Bacteria 673
132 Ga0068864_100118087 3300005618 Bacteria 2368
133 Ga0068864_100334759 3300005618 Bacteria 1425
134 Ga0068864_100472524 3300005618 Bacteria 1202
135 Ga0068861_100094103 3300005719 Bacteria 2370
136 Ga0068861_100159188 3300005719 Bacteria 1861
137 Ga0068861_100537854 3300005719 Unclassified 1062
138 Ga0068861_101020016 3300005719 Bacteria 791
139 Ga0068863_100236484 3300005841 Bacteria 1763
140 Ga0068863_100697107 3300005841 Bacteria 1009
141 Ga0068863_100776597 3300005841 Bacteria 955
142 Ga0068858_100060776 3300005842 Bacteria 3492
143 Ga0068860_100094551 3300005843 Bacteria 2849
144 Ga0068860_100997198 3300005843 Bacteria 855
145 Ga0068860_101514709 3300005843 Bacteria 692
146 Ga0068862_100000326 3300005844 Bacteria 51888
147 Ga0068862_100210541 3300005844 Bacteria 1756
148 Ga0068862_100227790 3300005844 Unclassified 1690
149 Ga0068862_100259155 3300005844 Bacteria 1587
150 Ga0081455_10002550 3300005937 Bacteria 21626
151 Ga0081455_10014139 3300005937 Bacteria 7845
152 Ga0081538_10008916 3300005981 Bacteria 8432
153 Ga0081538_10386386 3300005981 Bacteria 504
154 Ga0081540_1038402 3300005983 Bacteria 2524
155 Ga0081539_10000070 3300005985 Bacteria 235651
156 Ga0081539_10001374 3300005985 Bacteria 42092
157 Ga0081539_10001803 3300005985 Bacteria 33905
158 Ga0081539_10001984 3300005985 Bacteria 31132
159 Ga0081539_10002192 3300005985 Bacteria 28654
160 Ga0081539_10004130 3300005985 Bacteria 16525
161 Ga0081539_10006135 3300005985 Bacteria 11702
162 Ga0081539_10010909 3300005985 Bacteria 7293
163 Ga0081539_10017622 3300005985 Bacteria 5003
164 Ga0081539_10038575 3300005985 Bacteria 2829
165 Ga0070717_10039365 3300006028 Bacteria 3846
166 Ga0070717_10573895 3300006028 Bacteria 1022
167 Ga0070717_10665360 3300006028 Unclassified 945
168 Ga0070717_11015346 3300006028 Unclassified 755
169 Ga0070717_11797901 3300006028 Unclassified 554
170 Ga0075365_10945216 3300006038 Bacteria 608
171 Ga0070715_10197138 3300006163 Unclassified 1020
172 Ga0070716_100735194 3300006173 Unclassified 757
173 Ga0097621_100726805 3300006237 Unclassified 916
174 Ga0097621_101533688 3300006237 Bacteria 633
175 Ga0097621_101541192 3300006237 Bacteria 631
176 Ga0068871_100147444 3300006358 Bacteria 2005
177 Ga0068871_100724299 3300006358 Unclassified 913
178 Ga0075428_100002481 3300006844 Bacteria 20023
179 Ga0075428_100055496 3300006844 Bacteria 4340
180 Ga0075428_100221481 3300006844 Bacteria 2043
181 Ga0075428_100233620 3300006844 Bacteria 1984
182 Ga0075428_100307448 3300006844 Bacteria 1704
183 Ga0075428_100376923 3300006844 Bacteria 1521
184 Ga0075428_100582366 3300006844 Bacteria 1196
185 Ga0075428_100742101 3300006844 Unclassified 1045
186 Ga0075428_100820714 3300006844 Unclassified 988
187 Ga0075428_101236626 3300006844 Bacteria 786
188 Ga0075430_100000325 3300006846 Bacteria 34035
189 Ga0075430_100092069 3300006846 Bacteria 2535
190 Ga0075430_100092139 3300006846 Bacteria 2534
191 Ga0075430_100512655 3300006846 Bacteria 990
192 Ga0075430_100571781 3300006846 Bacteria 932
193 Ga0075430_100797833 3300006846 Bacteria 778
194 Ga0075431_100042360 3300006847 Bacteria 4695
195 Ga0075431_100088219 3300006847 Bacteria 3201
196 Ga0075431_100182045 3300006847 Bacteria 2156
197 Ga0075431_100278985 3300006847 Bacteria 1692
198 Ga0075431_100380130 3300006847 Bacteria 1416
199 Ga0075431_100438065 3300006847 Bacteria 1304
200 Ga0075431_100731262 3300006847 Bacteria 966
201 Ga0075431_101562213 3300006847 Unclassified 618
202 Ga0075433_10044269 3300006852 Bacteria 3867
203 Ga0075433_10231847 3300006852 Bacteria 1639
204 Ga0075433_10241424 3300006852 Bacteria 1604
205 Ga0075433_10561272 3300006852 Bacteria 1003
206 Ga0075433_10623627 3300006852 Unclassified 946
207 Ga0075433_10825130 3300006852 Unclassified 810
208 Ga0075434_100077266 3300006871 Bacteria 3324
209 Ga0075434_100088630 3300006871 Bacteria 3095
210 Ga0075434_101849860 3300006871 Unclassified 610
211 Ga0075429_100005683 3300006880 Bacteria 10753
212 Ga0075429_100019907 3300006880 Bacteria 5819
213 Ga0075429_100029431 3300006880 Bacteria 4770
214 Ga0075429_100041146 3300006880 Bacteria 4025
215 Ga0075429_100080567 3300006880 Bacteria 2838
216 Ga0075429_100088060 3300006880 Bacteria 2706
217 Ga0075429_100347812 3300006880 Bacteria 1298
218 Ga0075429_100711361 3300006880 Unclassified 880
219 Ga0075429_100884182 3300006880 Unclassified 782
220 Ga0097620_100108836 3300006931 Bacteria 2832
221 Ga0097620_101817365 3300006931 Bacteria 673
222 Ga0075435_100085405 3300007076 Bacteria 2598
223 Ga0075435_100455963 3300007076 Bacteria 1103
224 Ga0075435_100508454 3300007076 Bacteria 1042
225 Ga0099794_10199718 3300007265 Unclassified 1024
226 Ga0105251_10459373 3300009011 Bacteria 591
227 Ga0105250_10338000 3300009092 Bacteria 657
228 Ga0105240_10257165 3300009093 Bacteria 2016
229 Ga0111539_10068947 3300009094 Bacteria 4176
230 Ga0111539_10079440 3300009094 Bacteria 3859
231 Ga0111539_10303184 3300009094 Bacteria 1859
232 Ga0111539_10422815 3300009094 Bacteria 1552
233 Ga0111539_11548600 3300009094 Bacteria 769
234 Ga0105245_10006025 3300009098 Bacteria 10656
235 Ga0105245_10579264 3300009098 Bacteria 1147
236 Ga0105247_10111109 3300009101 Bacteria 1764
237 Ga0105247_10521825 3300009101 Unclassified 869
238 Ga0105247_10529772 3300009101 Bacteria 863
239 Ga0114129_10002746 3300009147 Bacteria 24536
240 Ga0114129_10015317 3300009147 Bacteria 10911
241 Ga0114129_10027565 3300009147 Bacteria 8043
242 Ga0114129_10038320 3300009147 Bacteria 6763
243 Ga0114129_10041383 3300009147 Bacteria 6493
244 Ga0114129_10065860 3300009147 Bacteria 5055
245 Ga0114129_10073788 3300009147 Bacteria 4753
246 Ga0114129_10139135 3300009147 Bacteria 3329
247 Ga0114129_10167688 3300009147 Bacteria 2995
248 Ga0114129_10273361 3300009147 Bacteria 2260
249 Ga0114129_10344558 3300009147 Bacteria 1975
250 Ga0114129_10481490 3300009147 Bacteria 1624
251 Ga0114129_10671319 3300009147 Bacteria 1335
252 Ga0114129_10673008 3300009147 Bacteria 1333
253 Ga0114129_10737156 3300009147 Unclassified 1263
254 Ga0114129_10827133 3300009147 Bacteria 1179
255 Ga0114129_11167582 3300009147 Bacteria 961
256 Ga0114129_11196955 3300009147 Bacteria 946
257 Ga0114129_11235924 3300009147 Bacteria 929
258 Ga0114129_11240572 3300009147 Bacteria 927
259 Ga0114129_11254140 3300009147 Bacteria 921
260 Ga0114129_12107404 3300009147 Bacteria 680
261 Ga0105243_10008709 3300009148 Bacteria 7780
262 Ga0105243_10045280 3300009148 Bacteria 3456
263 Ga0105243_10979320 3300009148 Bacteria 847
264 Ga0105242_10064779 3300009176 Unclassified 3013
265 Ga0105242_10747146 3300009176 Bacteria 963
266 Ga0105242_11298699 3300009176 Bacteria 751
267 Ga0105248_11221862 3300009177 Bacteria 850
268 Ga0105248_11413082 3300009177 Bacteria 787
269 Ga0105237_10534164 3300009545 Bacteria 1179
270 Ga0105238_11346196 3300009551 Bacteria 740
271 Ga0105249_10330915 3300009553 Bacteria 1537
272 Ga0105249_10440753 3300009553 Bacteria 1340
273 Ga0099796_10005699 3300010159 Bacteria 3125
274 Ga0105239_10013380 3300010375 Bacteria 9116
275 Ga0105239_10497135 3300010375 Bacteria 1386
276 Ga0105239_11203217 3300010375 Unclassified 873
277 Ga0105239_12018602 3300010375 Bacteria 670
278 Ga0105239_13076402 3300010375 Bacteria 543
279 Ga0105246_10397932 3300011119 Unclassified 1143
280 Ga0105246_10783907 3300011119 Unclassified 844
281 Ga0157373_10344236 3300013100 Unclassified 1063
282 Ga0157373_11372578 3300013100 Bacteria 537
283 Ga0157370_11375232 3300013104 Bacteria 635
284 Ga0157374_10068668 3300013296 Bacteria 3335
285 Ga0157374_10171919 3300013296 Bacteria 2114
286 Ga0157374_10870170 3300013296 Bacteria 918
287 Ga0157374_11599997 3300013296 Unclassified 676
288 Ga0157374_11607043 3300013296 Bacteria 674
289 Ga0157378_10093799 3300013297 Bacteria 2733
290 Ga0157378_10147800 3300013297 Bacteria 2187
291 Ga0157378_10433047 3300013297 Bacteria 1302
292 Ga0157378_10772414 3300013297 Unclassified 985
293 Ga0157378_11317448 3300013297 Bacteria 764
294 Ga0163162_10006856 3300013306 Bacteria 11053
295 Ga0163162_10424826 3300013306 Bacteria 1461
296 Ga0163162_10529622 3300013306 Unclassified 1307
297 Ga0163162_10999753 3300013306 Bacteria 946
298 Ga0163162_11228859 3300013306 Bacteria 851
299 Ga0157372_10620756 3300013307 Bacteria 1260
300 Ga0157375_10810009 3300013308 Bacteria 1085
301 Ga0157375_11631631 3300013308 Bacteria 763
302 Ga0157375_11897310 3300013308 Bacteria 707
303 Ga0163163_10076891 3300014325 Bacteria 3334
304 Ga0163163_10378271 3300014325 Bacteria 1474
305 Ga0163163_11273375 3300014325 Unclassified 798
306 Ga0157380_10585019 3300014326 Bacteria 1101
307 Ga0157380_10808242 3300014326 Bacteria 955
308 Ga0157379_11935907 3300014968 Bacteria 581
309 Ga0157376_10099294 3300014969 Bacteria 2540
310 Ga0157376_10164248 3300014969 Bacteria 2016
311 Ga0157376_10343037 3300014969 Unclassified 1427
312 Ga0163161_10061942 3300017792 Bacteria 2725
313 Ga0163161_10116001 3300017792 Unclassified 2007
314 Ga0206354_10311746 3300020081 Unclassified 532
315 Ga0206353_11917053 3300020082 Unclassified 523
316 Ga0207673_1013051 3300025290 Bacteria 1086
317 Ga0207697_10001869 3300025315 Bacteria 11247
318 Ga0207697_10008030 3300025315 Bacteria 4659
319 Ga0207696_1137314 3300025711 Bacteria 655
320 Ga0207682_10027266 3300025893 Bacteria 2274
321 Ga0207692_10167533 3300025898 Bacteria 1271
322 Ga0207642_10053251 3300025899 Unclassified 1840
323 Ga0207710_10328168 3300025900 Bacteria 777
324 Ga0207688_10092447 3300025901 Bacteria 1738
325 Ga0207688_10122259 3300025901 Bacteria 1520
326 Ga0207680_10032343 3300025903 Bacteria 2973
327 Ga0207680_10554880 3300025903 Unclassified 820
328 Ga0207680_10602883 3300025903 Bacteria 786
329 Ga0207699_10381665 3300025906 Unclassified 1000
330 Ga0207645_10006819 3300025907 Bacteria 8152
331 Ga0207645_10045453 3300025907 Unclassified 2806
332 Ga0207645_10259481 3300025907 Bacteria 1151
333 Ga0207684_10016870 3300025910 Bacteria 6271
334 Ga0207684_10048066 3300025910 Bacteria 3619
335 Ga0207684_10079574 3300025910 Bacteria 2788
336 Ga0207671_10272049 3300025914 Unclassified 1335
337 Ga0207693_10189244 3300025915 Unclassified 1620
338 Ga0207663_10298123 3300025916 Unclassified 1203
339 Ga0207663_10392842 3300025916 Unclassified 1059
340 Ga0207646_10004642 3300025922 Bacteria 14827
341 Ga0207646_10092942 3300025922 Bacteria 2701
342 Ga0207646_10404182 3300025922 Bacteria 1233
343 Ga0207646_10687256 3300025922 Bacteria 915
344 Ga0207646_10853145 3300025922 Unclassified 809
345 Ga0207681_10141492 3300025923 Bacteria 1792
346 Ga0207650_10090220 3300025925 Bacteria 2340
347 Ga0207659_10053425 3300025926 Unclassified 2881
348 Ga0207659_10112658 3300025926 Unclassified 2071
349 Ga0207659_10484549 3300025926 Bacteria 1045
350 Ga0207700_10058362 3300025928 Unclassified 2914
351 Ga0207700_10135687 3300025928 Bacteria 2015
352 Ga0207700_11783418 3300025928 Unclassified 541
353 Ga0207664_10587500 3300025929 Bacteria 1000
354 Ga0207644_10024337 3300025931 Bacteria 4155
355 Ga0207644_10024991 3300025931 Bacteria 4103
356 Ga0207644_10071813 3300025931 Bacteria 2533
357 Ga0207706_10017316 3300025933 Bacteria 6491
358 Ga0207706_10080010 3300025933 Bacteria 2873
359 Ga0207706_10237837 3300025933 Bacteria 1592
360 Ga0207706_10646123 3300025933 Bacteria 906
361 Ga0207686_10400846 3300025934 Unclassified 1045
362 Ga0207709_10399795 3300025935 Bacteria 1050
363 Ga0207670_10089769 3300025936 Unclassified 2169
364 Ga0207670_10210832 3300025936 Bacteria 1481
365 Ga0207670_10679003 3300025936 Bacteria 851
366 Ga0207669_10007862 3300025937 Bacteria 4967
367 Ga0207669_10102146 3300025937 Bacteria 1898
368 Ga0207669_10295075 3300025937 Unclassified 1229
369 Ga0207669_11375613 3300025937 Bacteria 601
370 Ga0207665_10025683 3300025939 Unclassified 3887
371 Ga0207665_11342159 3300025939 Bacteria 570
372 Ga0207691_10007318 3300025940 Bacteria 10648
373 Ga0207691_10044930 3300025940 Bacteria 4064
374 Ga0207711_10328722 3300025941 Bacteria 1414
375 Ga0207689_10351673 3300025942 Bacteria 1225
376 Ga0207689_11184352 3300025942 Bacteria 643
377 Ga0207661_11192156 3300025944 Bacteria 701
378 Ga0207668_10001042 3300025972 Bacteria 16562
379 Ga0207668_10037064 3300025972 Bacteria 3260
380 Ga0207668_10116459 3300025972 Unclassified 2015
381 Ga0207668_10191176 3300025972 Bacteria 1622
382 Ga0207668_10713061 3300025972 Bacteria 882
383 Ga0207640_10573279 3300025981 Unclassified 952
384 Ga0207658_10055305 3300025986 Bacteria 2940
385 Ga0207658_10439331 3300025986 Unclassified 1153
386 Ga0207658_10900513 3300025986 Bacteria 805
387 Ga0207677_10277911 3300026023 Bacteria 1373
388 Ga0207677_10419749 3300026023 Unclassified 1139
389 Ga0207677_10533351 3300026023 Bacteria 1020
390 Ga0207703_10157651 3300026035 Bacteria 1985
391 Ga0207703_10195240 3300026035 Bacteria 1795
392 Ga0207639_10710806 3300026041 Bacteria 933
393 Ga0207678_10171773 3300026067 Bacteria 1851
394 Ga0207678_10693034 3300026067 Bacteria 896
395 Ga0207708_10112652 3300026075 Bacteria 2113
396 Ga0207708_10532121 3300026075 Bacteria 989
397 Ga0207702_10447558 3300026078 Bacteria 1253
398 Ga0207702_10555884 3300026078 Unclassified 1123
399 Ga0207641_10387768 3300026088 Bacteria 1339
400 Ga0207641_11312437 3300026088 Bacteria 724
401 Ga0207648_10173497 3300026089 Bacteria 1906
402 Ga0207648_10349355 3300026089 Unclassified 1333
403 Ga0207676_10326886 3300026095 Bacteria 1410
404 Ga0207676_10436038 3300026095 Bacteria 1232
405 Ga0207676_10551882 3300026095 Bacteria 1101
406 Ga0207676_10691959 3300026095 Bacteria 987
407 Ga0207674_10900084 3300026116 Bacteria 853
408 Ga0207674_10969451 3300026116 Bacteria 819
409 Ga0207675_100001774 3300026118 Bacteria 21561
410 Ga0207675_100182031 3300026118 Bacteria 2012
411 Ga0207675_100196036 3300026118 Bacteria 1938
412 Ga0207675_100522204 3300026118 Bacteria 1184
413 Ga0207675_100546606 3300026118 Unclassified 1157
414 Ga0207683_10008702 3300026121 Bacteria 8672
415 Ga0207683_10145254 3300026121 Bacteria 2139
416 Ga0207683_10204124 3300026121 Unclassified 1797
417 Ga0207683_10236334 3300026121 Bacteria 1667
418 Ga0207428_10008508 3300027907 Bacteria 9263
419 Ga0268266_10086518 3300028379 Bacteria 2741
420 Ga0268266_10095287 3300028379 Bacteria 2614
421 Ga0268266_10333517 3300028379 Bacteria 1422
422 Ga0268265_10000138 3300028380 Bacteria 92824
423 Ga0268265_10047434 3300028380 Unclassified 3219
424 Ga0268265_10231561 3300028380 Bacteria 1624
425 Ga0268265_11407569 3300028380 Bacteria 699
426 Ga0268264_10067687 3300028381 Bacteria 3015
427 Ga0307517_10127523 3300028786 Bacteria 1849
428 Ga0307515_10004739 3300028794 Bacteria 27867
429 Ga0307515_10007075 3300028794 Bacteria 22286
430 Ga0307515_10802512 3300028794 Bacteria 564
431 Ga0307512_10002245 3300030522 Bacteria 25098
432 Ga0307513_10002908 3300031456 Bacteria 23416
433 Ga0307408_100365566 3300031548 Bacteria 1229
434 Ga0307508_10005441 3300031616 Bacteria 12103
435 Ga0307508_10060277 3300031616 Bacteria 3356
436 Ga0307508_10114605 3300031616 Bacteria 2296
437 Ga0307508_10146523 3300031616 Bacteria 1965
438 Ga0316578_10473298 3300031728 Unclassified 739
439 Ga0307516_10000528 3300031730 Bacteria 51172
440 Ga0307516_10076953 3300031730 Bacteria 3186
441 Ga0307516_10115978 3300031730 Bacteria 2474
442 Ga0307516_10127005 3300031730 Bacteria 2334
443 Ga0307516_10213579 3300031730 Bacteria 1642
444 Ga0307405_10005279 3300031731 Bacteria 6212
445 Ga0307405_10237887 3300031731 Unclassified 1347
446 Ga0307413_10060027 3300031824 Bacteria 2339
447 Ga0307413_10118800 3300031824 Bacteria 1786
448 Ga0307413_10700439 3300031824 Bacteria 841
449 Ga0307413_11659278 3300031824 Bacteria 569
450 Ga0307410_10156195 3300031852 Bacteria 1704
451 Ga0307410_10186027 3300031852 Bacteria 1576
452 Ga0307410_10386022 3300031852 Bacteria 1128
453 Ga0307410_10423445 3300031852 Bacteria 1080
454 Ga0307410_10755759 3300031852 Bacteria 824
455 Ga0307406_10005652 3300031901 Bacteria 6837
456 Ga0307406_10006884 3300031901 Bacteria 6296
457 Ga0307406_10932489 3300031901 Bacteria 741
458 Ga0307406_10958409 3300031901 Bacteria 732
459 Ga0307407_10023579 3300031903 Bacteria 3213
460 Ga0307407_10188817 3300031903 Bacteria 1372
461 Ga0307407_10194712 3300031903 Bacteria 1354
462 Ga0307407_10238526 3300031903 Bacteria 1239
463 Ga0307412_10059594 3300031911 Bacteria 2559
464 Ga0307412_10796735 3300031911 Bacteria 820
465 Ga0307412_10880524 3300031911 Bacteria 783
466 Ga0307409_100015616 3300031995 Bacteria 4990
467 Ga0307409_100195813 3300031995 Bacteria 1803
468 Ga0307409_100202313 3300031995 Bacteria 1778
469 Ga0307409_100360272 3300031995 Bacteria 1375
470 Ga0307409_101507754 3300031995 Bacteria 700
471 Ga0307409_102245235 3300031995 Bacteria 575
472 Ga0307416_100003064 3300032002 Bacteria 9768
473 Ga0307416_100112914 3300032002 Bacteria 2399
474 Ga0307416_100115944 3300032002 Bacteria 2373
475 Ga0307416_100137557 3300032002 Bacteria 2213
476 Ga0307416_100781008 3300032002 Bacteria 1050
477 Ga0307416_101384949 3300032002 Bacteria 809
478 Ga0307414_10085593 3300032004 Bacteria 2323
479 Ga0307414_10447562 3300032004 Bacteria 1132
480 Ga0307411_10291946 3300032005 Bacteria 1303
481 Ga0307411_10328803 3300032005 Bacteria 1238
482 Ga0307411_11127489 3300032005 Bacteria 708
483 Ga0307415_100000009 3300032126 Bacteria 90122
484 Ga0307415_100026967 3300032126 Bacteria 3632
485 Ga0307415_100063058 3300032126 Bacteria 2574
486 Ga0307415_100182134 3300032126 Bacteria 1649
487 Ga0307415_100331579 3300032126 Bacteria 1273
488 Ga0307415_100369931 3300032126 Bacteria 1213
489 Ga0307415_100395534 3300032126 Bacteria 1178
490 Ga0307415_100947675 3300032126 Bacteria 796
491 Ga0307415_101076631 3300032126 Bacteria 751
492 Ga0307415_101416489 3300032126 Unclassified 662
493 Ga0307507_10312587 3300033179 Bacteria 953
494 Ga0307510_10413871 3300033180 Bacteria 791
495 Ga0316592_1160856 3300033524 Unclassified 532
496 Ga0373938_0025835 3300034957 Bacteria 1225
497 Ga0373928_0087956 3300035084 Bacteria 793
498 Ga0373940_0003039 3300035088 Bacteria 3364
499 Ga0373951_0000134 3300035091 Bacteria 28118
500 Ga0373932_0014431 3300035112 Bacteria 1986
501 Ga0373941_0355056 3300035115 Unclassified 597
502 Ga0373941_0507976 3300035115 Bacteria 513
503 Ga0373945_0025421 3300035116 Bacteria 2057
504 Ga0373945_0244856 3300035116 Bacteria 756
505 Ga0373957_0100775 3300035120 Bacteria 1156
506 Ga0373943_0266668 3300035170 Unclassified 965
507 Ga0373946_0193978 3300035171 Bacteria 970
508 Ga0373942_0001030 3300035207 Bacteria 7573
509 Ga0373962_0002273 3300035242 Bacteria 4588
510 Ga0373924_0142514 3300035410 Bacteria 1046
511 Ga0373931_0119349 3300035691 Unclassified 1506
512 Ga0373931_0305682 3300035691 Bacteria 983
513 Ga0373935_0007029 3300035692 Bacteria 6719
514 Ga0373935_0068307 3300035692 Bacteria 2287
515 Ga0373935_0234771 3300035692 Bacteria 1278
516 Ga0373935_0450549 3300035692 Unclassified 930
517 Ga0373935_0503620 3300035692 Bacteria 879
518 Ga0373927_0399762 3300035695 Unclassified 906
519 Ga0373927_1089844 3300035695 Bacteria 527
520 Ga0373947_0096275 3300035725 Bacteria 1853
521 Ga0373947_0103015 3300035725 Bacteria 1796
522 Ga0373937_0048253 3300036401 Bacteria 3897
523 Ga0373937_0114090 3300036401 Bacteria 2515
524 Ga0373937_0923116 3300036401 Unclassified 822
525 Ga0316582_0008790 3300036647 Bacteria 5445
526 Ga0395899_0064801 3300037312 Bacteria 2686
527 Ga0395900_0137234 3300037418 Bacteria 2506
528 Ga0395900_0356829 3300037418 Bacteria 1434
529 Ga0395900_0375212 3300037418 Bacteria 1391
530 Ga0395900_0591377 3300037418 Bacteria 1051
531 Ga0395898_0036138 3300037466 Bacteria 4907
532 Ga0395898_0049949 3300037466 Bacteria 4096
533 Ga0395898_1778338 3300037466 Bacteria 538
534 Ga0316581_0118649 3300037588 Unclassified 815
535 Ga0436364_1383891 3300037853 Bacteria 842
536 Ga0395901_0305353 3300038443 Bacteria 1649
537 Ga0451793_1633125 3300041452 Bacteria 1019
538 Ga0451802_1771638 3300041460 Bacteria 948
539 Ga0451804_0377329 3300041463 Bacteria 562
540 Ga0451833_0074111 3300041491 Bacteria 1207
541 Ga0451841_1387006 3300041498 Bacteria 572
542 Ga0451853_1233207 3300041512 Unclassified 755
543 Ga0451853_3441805 3300041512 Bacteria 3168
544 Ga0439463_045945 3300042016 Bacteria 1112
545 Ga0439459_0035868 3300042438 Bacteria 1032
546 Ga0466963_0445644 3300044694 Bacteria 913
547 Ga0466963_0795704 3300044694 Bacteria 667
548 Ga0466968_0067229 3300044735 Bacteria 1554
549 Ga0466960_0731854 3300044901 Bacteria 595
550 Ga0466967_0154970 3300045976 Bacteria 2145
551 Ga0466967_2311311 3300045976 Bacteria 533
552 Ga0495603_0292970 3300046455 Bacteria 935
553 Ga0495629_0550211 3300046459 Bacteria 775
554 Ga0495651_0106096 3300046462 Bacteria 2083
555 Ga0495653_0188118 3300046463 Bacteria 1411
556 Ga0495664_0239086 3300046477 Bacteria 1099
557 Ga0495606_0001573 3300046507 Bacteria 29909
558 Ga0495630_0214769 3300046517 Bacteria 1468
559 Ga0495630_0256370 3300046517 Bacteria 1336
560 Ga0495630_1346219 3300046517 Unclassified 538
561 Ga0495632_0034183 3300046519 Bacteria 2604
562 Ga0495632_0044122 3300046519 Bacteria 2226
563 Ga0495652_0046702 3300046529 Bacteria 3716
564 Ga0495640_0790254 3300046533 Bacteria 566
565 Ga0495667_0391448 3300046559 Bacteria 876
566 Ga0495668_0000668 3300046616 Bacteria 41278
567 Ga0495634_0380083 3300046642 Bacteria 842
568 Ga0495625_0004244 3300046660 Bacteria 13649
569 Ga0495625_0120926 3300046660 Bacteria 1782
570 Ga0495625_0369701 3300046660 Bacteria 902
571 Ga0495635_0273673 3300046663 Bacteria 1135
572 Ga0495657_0502354 3300046675 Bacteria 707
573 Ga0495599_0367453 3300046678 Bacteria 861
574 Ga0495669_0063375 3300046684 Unclassified 1677
575 Ga0495669_0232573 3300046684 Bacteria 884
576 Ga0495669_0373383 3300046684 Bacteria 690
577 Ga0495613_0483300 3300046689 Bacteria 836
578 Ga0495624_0168220 3300046690 Bacteria 1338
579 Ga0495672_0115586 3300047320 Bacteria 1434
580 Ga0495683_0163957 3300047323 Bacteria 1026
581 Ga0495675_0082267 3300047444 Bacteria 2027
582 Ga0495684_0026233 3300047471 Bacteria 4477
583 Ga0495626_0000282 3300048091 Bacteria 55428
584 Ga0496100_0006316 3300048903 Bacteria 6456
585 Ga0496101_1446446 3300048904 Bacteria 536
586 Ga0496102_0034791 3300048905 Bacteria 4533
587 Ga0496102_0861799 3300048905 Bacteria 828
588 Ga0496102_1256001 3300048905 Bacteria 660
589 Ga0496103_0169487 3300048906 Unclassified 1402
590 Ga0496103_0611563 3300048906 Unclassified 694
591 Ga0496104_0208342 3300048907 Unclassified 1867
592 Ga0496104_0638423 3300048907 Bacteria 974
593 Ga0496106_0059977 3300048909 Unclassified 2883
594 Ga0496106_0495313 3300048909 Unclassified 982
595 Ga0496106_0502663 3300048909 Bacteria 974
596 Ga0496107_0082591 3300048910 Unclassified 2343
597 Ga0496107_0209819 3300048910 Unclassified 1448
598 Ga0496107_0452108 3300048910 Unclassified 954
599 Ga0496108_0000247 3300048911 Bacteria 48233
600 Ga0496108_0172262 3300048911 Unclassified 1873
601 Ga0496109_0000040 3300048912 Bacteria 145496
602 Ga0496109_0207460 3300048912 Unclassified 1843
603 Ga0496110_1213631 3300048913 Unclassified 663
604 Ga0496112_0021085 3300048915 Bacteria 6190
605 Ga0496112_0116312 3300048915 Bacteria 2645
606 Ga0496112_0121762 3300048915 Bacteria 2579
607 Ga0496112_0710727 3300048915 Unclassified 933
608 Ga0496112_1398161 3300048915 Unclassified 614
609 Ga0496113_0321701 3300048916 Unclassified 1240
610 Ga0496114_1140820 3300048917 Bacteria 665
611 Ga0496115_0020650 3300048918 Bacteria 5081
612 Ga0496115_0438291 3300048918 Unclassified 1057
613 Ga0496119_0456829 3300048922 Bacteria 601
614 Ga0496126_0069897 3300048929 Bacteria 3130
615 Ga0501031_0005760 3300049568 Bacteria 8073
616 Ga0501032_0064110 3300049569 Bacteria 2460
617 Ga0501032_0595214 3300049569 Bacteria 704
618 Ga0501033_0015722 3300049570 Bacteria 5738
619 Ga0501036_0000376 3300049572 Bacteria 31534
620 Ga0501037_1050545 3300049573 Bacteria 529
621 Ga0501038_0000696 3300049574 Bacteria 29904
622 Ga0501038_0638230 3300049574 Bacteria 803
623 Ga0501039_0000734 3300049575 Bacteria 23642
624 Ga0501039_0041300 3300049575 Bacteria 3562
625 Ga0501039_0452166 3300049575 Bacteria 1009
626 Ga0501039_1129625 3300049575 Bacteria 607
627 Ga0501040_0002456 3300049576 Bacteria 11932
628 Ga0501040_0088609 3300049576 Bacteria 2149
629 Ga0501040_0382075 3300049576 Bacteria 1010
630 Ga0501040_0637072 3300049576 Bacteria 770
631 Ga0501041_0000196 3300049577 Bacteria 27844
632 Ga0501041_1110030 3300049577 Bacteria 510
633 Ga0501042_0000854 3300049578 Bacteria 16986
634 Ga0501042_0199377 3300049578 Bacteria 1443
635 Ga0501042_0244965 3300049578 Bacteria 1293
636 Ga0501042_0592949 3300049578 Bacteria 806
637 Ga0501042_0605464 3300049578 Bacteria 797
638 Ga0501043_0005448 3300049579 Bacteria 10286
639 Ga0501043_0862055 3300049579 Bacteria 652
640 Ga0501046_0001223 3300049580 Bacteria 24877
641 Ga0501046_0073171 3300049580 Bacteria 2660
642 Ga0501047_0125479 3300049581 Bacteria 2447
643 Ga0501047_1334544 3300049581 Bacteria 532
644 Ga0501048_0001630 3300049582 Bacteria 17080
645 Ga0501068_0005176 3300049584 Bacteria 7115
646 Ga0501068_0470754 3300049584 Bacteria 814
647 Ga0501070_0159492 3300049586 Unclassified 1860
648 Ga0501070_0587328 3300049586 Bacteria 889
649 Ga0501071_0001306 3300049587 Bacteria 14206
650 Ga0501071_0162807 3300049587 Bacteria 1668
651 Ga0501072_0011907 3300049588 Bacteria 6643
652 Ga0501072_0016960 3300049588 Bacteria 5596
653 Ga0501072_1047805 3300049588 Bacteria 635
654 Ga0501074_0028137 3300049590 Bacteria 4073
655 Ga0501075_0021301 3300049591 Bacteria 4724
656 Ga0501075_0087770 3300049591 Bacteria 2357
657 Ga0501075_0344507 3300049591 Bacteria 1136
658 Ga0501075_0351804 3300049591 Bacteria 1123
659 Ga0501075_1006316 3300049591 Bacteria 633
660 Ga0501076_0006204 3300049592 Bacteria 8651
661 Ga0501076_0054541 3300049592 Bacteria 3168
662 Ga0501076_0979189 3300049592 Bacteria 697
663 Ga0501077_0026053 3300049593 Bacteria 3710
664 Ga0501077_1027650 3300049593 Bacteria 530
665 Ga0501079_0005835 3300049741 Bacteria 9207
666 Ga0501080_0002956 3300049742 Bacteria 14941
667 Ga0501081_0005772 3300049743 Bacteria 8014
668 Ga0501081_0029860 3300049743 Bacteria 3686
669 Ga0501081_0216852 3300049743 Bacteria 1391
670 Ga0501083_0043108 3300049744 Bacteria 3057
671 Ga0501035_0007957 3300049822 Bacteria 9891
672 Ga0501035_0435950 3300049822 Bacteria 1086
673 Ga0501044_0062803 3300049823 Bacteria 3796
674 Ga0501044_0068715 3300049823 Bacteria 3609
675 Ga0501045_0020270 3300049824 Bacteria 4748
676 Ga0501045_0021597 3300049824 Bacteria 4606
677 nmdc:mga05p37_1017172_c1 3300050507 Bacteria 878
678 nmdc:mga05p37_1033795_c1 3300050507 Bacteria 869
679 nmdc:mga05p37_11061_c1 3300050507 Bacteria 10722
680 nmdc:mga05p37_1637217_c1 3300050507 Bacteria 632
681 nmdc:mga05p37_16753_c1 3300050507 Bacteria 8834
682 nmdc:mga05p37_175888_c1 3300050507 Bacteria 2608
683 nmdc:mga05p37_215197_c1 3300050507 Bacteria 2321
684 nmdc:mga05p37_216593_c1 3300050507 Bacteria 2313
685 nmdc:mga05p37_2273_c1 3300050507 Bacteria 22397
686 nmdc:mga05p37_351219_c1 3300050507 Bacteria 1736
687 nmdc:mga05p37_354305_c1 3300050507 Unclassified 1727
688 nmdc:mga05p37_390070_c1 3300050507 Bacteria 1629
689 nmdc:mga05p37_400314_c1 3300050507 Bacteria 1603
690 nmdc:mga05p37_63507_c1 3300050507 Bacteria 4544
691 nmdc:mga05p37_660391_c1 3300050507 Bacteria 1169
692 nmdc:mga05p37_67721_c1 3300050507 Bacteria 4392
693 nmdc:mga05p37_69274_c1 3300050507 Unclassified 4339
694 nmdc:mga09592_123920_c1 3300050508 Bacteria 2221
695 nmdc:mga09592_1373845_c1 3300050508 Unclassified 578
696 nmdc:mga09592_194_c1 3300050508 Bacteria 43708
697 nmdc:mga09592_219646_c1 3300050508 Unclassified 1647
698 nmdc:mga09592_554503_c1 3300050508 Bacteria 987
699 nmdc:mga09592_63909_c1 3300050508 Bacteria 3116
700 nmdc:mga09592_81120_c1 3300050508 Bacteria 2764
701 nmdc:mga0qj67_104446_c1 3300050509 Bacteria 2285
702 nmdc:mga0qj67_1184589_c1 3300050509 Bacteria 595
703 nmdc:mga0qj67_21563_c1 3300050509 Unclassified 4942
704 nmdc:mga0qj67_877_c1 3300050509 Bacteria 20625
705 nmdc:mga06r32_1335420_c1 3300050510 Bacteria 660
706 nmdc:mga06r32_1381081_c1 3300050510 Unclassified 646
707 nmdc:mga06r32_217922_c2 3300050510 Bacteria 1447
708 nmdc:mga06r32_265703_c1 3300050510 Bacteria 1703
709 nmdc:mga06r32_428231_c1 3300050510 Bacteria 1304
710 nmdc:mga06r32_497210_c1 3300050510 Bacteria 1197
711 nmdc:mga06r32_534241_c1 3300050510 Bacteria 1148
712 nmdc:mga06r32_736427_c1 3300050510 Bacteria 950
713 nmdc:mga06r32_830538_c1 3300050510 Bacteria 883
714 nmdc:mga06r32_83277_c1 3300050510 Bacteria 3117
715 nmdc:mga06r32_919249_c1 3300050510 Unclassified 831
716 nmdc:mga08y16_1291915_c1 3300050511 Bacteria 697
717 nmdc:mga08y16_1494729_c1 3300050511 Bacteria 636
718 nmdc:mga08y16_32240_c1 3300050511 Bacteria 5510
719 nmdc:mga08y16_600046_c1 3300050511 Bacteria 1110
720 nmdc:mga0n895_1244610_c1 3300050512 Unclassified 717
721 nmdc:mga0rr50_126760_c1 3300050513 Bacteria 2039
722 nmdc:mga0rr50_1364470_c1 3300050513 Bacteria 600
723 nmdc:mga0rr50_442756_c1 3300050513 Bacteria 1101
724 nmdc:mga0a205_1197703_c1 3300050515 Unclassified 607
725 nmdc:mga0a205_250821_c1 3300050515 Bacteria 1649
726 nmdc:mga0a205_31629_c1 3300050515 Bacteria 5072
727 Ga0495619_0157046 3300053085 Bacteria 1570
728 Ga0500644_0117806 3300053088 Bacteria 1031
729 Ga0500583_0135872 3300053092 Bacteria 1221
730 Ga0500651_0050721 3300053093 Bacteria 2603
731 Ga0500641_0005174 3300053096 Bacteria 4622
732 Ga0500660_098312 3300053100 Bacteria 1285
733 Ga0500555_004378 3300053103 Bacteria 4014
734 Ga0500556_0132369 3300053104 Unclassified 978
735 Ga0500562_086245 3300053108 Bacteria 851
736 Ga0500562_136680 3300053108 Unclassified 668
737 Ga0500569_020587 3300053109 Bacteria 1733
738 Ga0500594_0095449 3300053118 Bacteria 908
739 Ga0500652_015178 3300053131 Bacteria 2774
740 Ga0500600_0217209 3300053149 Bacteria 885
741 Ga0500627_0291028 3300053158 Unclassified 715
742 Ga0500633_0023451 3300053160 Bacteria 1905
743 Ga0501084_0004927 3300054114 Bacteria 10908
744 Ga0501084_0049963 3300054114 Bacteria 3501
745 Ga0501082_0002856 3300060353 Bacteria 15053
746 Ga0501082_1018873 3300060353 Unclassified 724
747 Ga0530510_0006318 3300061734 Bacteria 8241
748 Ga0530510_0027646 3300061734 Bacteria 4065
749 Ga0530510_0129188 3300061734 Bacteria 1858
750 2501943695 2501939600 Bacteria 6907073
751 2623585701 2622736626 Bacteria 7181580
752 2676482933 2675903059 Bacteria 8644972
753 2753269673 2751185782 Bacteria 11227053
754 2772642894 2772190715 Bacteria 6959372
755 2831938832 2831935698 Bacteria 5963223
756 2832006870 2832004796 Bacteria 6538017
757 2855674171 2855670206 Bacteria 7120389
758 2855679828 2855676851 Bacteria 7063653
759 2855689844 2855683550 Bacteria 7134265
760 2856859592 2856858025 Bacteria 7255264
761 2857290824 2857288857 Bacteria 7189066
762 2858853802 2858848962 Bacteria 6963058
763 2858869746 2858868258 Bacteria 7683772
764 2858885175 2858882152 Bacteria 7230291
765 2858893222 2858888857 Bacteria 7060307
766 2858901906 2858895516 Bacteria 7378898
767 2858904978 2858902515 Bacteria 7086037
768 2867307946 2867302475 Bacteria 7087181
769 2867318663 2867312974 Bacteria 7058875
770 2867324023 2867319477 Bacteria 7069771
771 2869053274 2869048445 Bacteria 6875584
772 2869064161 2869061728 Bacteria 7112407
773 2869071238 2869068681 Bacteria 7205615
774 2880494537 2880489317 Bacteria 7096270
775 2880497770 2880495981 Bacteria 7340502
776 2887486405 2887478801 Bacteria 8972725
777 2902588459 2902582711 Bacteria 6187705
778 2929226344 2929219909 Bacteria 6984360
779 2929233041 2929226422 Bacteria 7248583
780 2996222880 2996221748 Bacteria 6799777
781 649816300 649633069 Bacteria 6962533
782 8001782606 8001781756 Bacteria 9586736
783 8003834354 8003830390 Bacteria 6541657
784 8003876491 8003870546 Bacteria 7396674
785 8054709645 8054704163 Bacteria 7247792
786 8054729567 8054727385 Bacteria 7558670
787 8054740411 8054734606 Bacteria 6947278
788 8055413249 8055412473 Bacteria 6257500
789 Ga0501292_048237
790 JGI25406J46586_10015007
791 JGI25406J46586_10017660
792 JGI25406J46586_10032081
793 JGI25406J46586_10065930
794 JGI25406J46586_10098817
795 Ga0065704_10003919
796 Ga0065704_10131556
797 Ga0065712_10144598
798 Ga0065712_10187289
799 Ga0065712_10378705
800 Ga0065715_10057372
801 Ga0065715_10138730
802 Ga0065707_10030111
803 Ga0065707_10086277
804 Ga0065707_10089040
805 Ga0065707_10410709
806 Ga0070676_10034089
807 Ga0070676_10267932
808 Ga0070690_100196698
809 Ga0070690_100664726
810 Ga0068869_100372955
811 Ga0070666_10211856
812 Ga0070680_100500215
813 Ga0070682_100849695
814 Ga0068868_100106743
815 Ga0068868_100154148
816 Ga0068868_100479053
817 Ga0070660_101242638
818 Ga0070689_100252378
819 Ga0070689_100740811
820 Ga0070689_100830776
821 Ga0070689_102007194
822 Ga0070687_100402547
823 Ga0070687_101350361
824 Ga0070668_100000635
825 Ga0070668_100124925
826 Ga0070668_100828119
827 Ga0070668_101366014
828 Ga0070669_100026514
829 Ga0070669_100294532
830 Ga0070675_100107989
831 Ga0070675_101237323
832 Ga0070671_100026407
833 Ga0070671_100152838
834 Ga0070671_100347509
835 Ga0070671_100642231
836 Ga0070671_101715348
837 Ga0070674_100009328
838 Ga0070674_100115551
839 Ga0070674_100837843
840 Ga0070673_100166892
841 Ga0070673_100797247
842 Ga0070673_100923831
843 Ga0070673_101549429
844 Ga0070688_101364514
845 Ga0070667_100078030
846 Ga0070667_100192334
847 Ga0070667_100236666
848 Ga0070709_10024337
849 Ga0070714_100337539
850 Ga0070714_101950995
851 Ga0070714_102474877
852 Ga0070713_100861929
853 Ga0070713_102369173
854 Ga0070711_100022781
855 Ga0070711_100029506
856 Ga0070711_100192256
857 Ga0070711_100644478
858 Ga0070705_100263616
859 Ga0070705_100512563
860 Ga0070705_101194980
861 Ga0070700_100211174
862 Ga0070694_100015098
863 Ga0070694_100130332
864 Ga0070694_100820537
865 Ga0070708_100116545
866 Ga0070708_100295517
867 Ga0070663_100120316
868 Ga0070663_100854722
869 Ga0070678_100421787
870 Ga0070678_100478952
871 Ga0070662_100001968
872 Ga0070662_100070412
873 Ga0070662_100216166
874 Ga0070662_101574691
875 Ga0068867_100043479
876 Ga0070685_10158200
877 Ga0070706_100016401
878 Ga0070706_100090619
879 Ga0070706_100209341
880 Ga0070706_101027547
881 Ga0070706_101553148
882 Ga0070707_100117285
883 Ga0070707_100137858
884 Ga0070707_100315248
885 Ga0070707_100406986
886 Ga0070698_100026359
887 Ga0070698_100102123
888 Ga0070698_100199609
889 Ga0070698_101485353
890 Ga0070698_101667220
891 Ga0070699_100026407
892 Ga0070699_100032083
893 Ga0070699_100669048
894 Ga0070699_100786518
895 Ga0070699_101503371
896 Ga0070684_100269935
897 Ga0070684_101520490
898 Ga0070697_100012363
899 Ga0070697_100088580
900 Ga0070697_100179450
901 Ga0070697_100276316
902 Ga0068853_100775896
903 Ga0070672_100023238
904 Ga0070686_100125890
905 Ga0070695_100007828
906 Ga0070696_100106903
907 Ga0070696_100303867
908 Ga0070665_100065510
909 Ga0070665_100089068
910 Ga0070665_100105607
911 Ga0070704_100155319
912 Ga0070704_100530261
913 Ga0070664_100054358
914 Ga0070664_100062456
915 Ga0070664_100719347
916 Ga0068856_100183688
917 Ga0068856_102038171
918 Ga0068859_100108835
919 Ga0068859_101817570
920 Ga0068864_100118087
921 Ga0068864_100334759
922 Ga0068864_100472524
923 Ga0068861_100094103
924 Ga0068861_100159188
925 Ga0068861_100537854
926 Ga0068861_101020016
927 Ga0068863_100236484
928 Ga0068863_100697107
929 Ga0068863_100776597
930 Ga0068858_100060776
931 Ga0068860_100094551
932 Ga0068860_100997198
933 Ga0068860_101514709
934 Ga0068862_100000326
935 Ga0068862_100210541
936 Ga0068862_100227790
937 Ga0068862_100259155
938 Ga0081455_10002550
939 Ga0081455_10014139
940 Ga0081538_10008916
941 Ga0081538_10386386
942 Ga0081540_1038402
943 Ga0081539_10000070
944 Ga0081539_10001374
945 Ga0081539_10001803
946 Ga0081539_10001984
947 Ga0081539_10002192
948 Ga0081539_10004130
949 Ga0081539_10006135
950 Ga0081539_10010909
951 Ga0081539_10017622
952 Ga0081539_10038575
953 Ga0070717_10039365
954 Ga0070717_10573895
955 Ga0070717_10665360
956 Ga0070717_11015346
957 Ga0070717_11797901
958 Ga0075365_10945216
959 Ga0070715_10197138
960 Ga0070716_100735194
961 Ga0097621_100726805
962 Ga0097621_101533688
963 Ga0097621_101541192
964 Ga0068871_100147444
965 Ga0068871_100724299
966 Ga0075428_100002481
967 Ga0075428_100055496
968 Ga0075428_100221481
969 Ga0075428_100233620
970 Ga0075428_100307448
971 Ga0075428_100376923
972 Ga0075428_100582366
973 Ga0075428_100742101
974 Ga0075428_100820714
975 Ga0075428_101236626
976 Ga0075430_100000325
977 Ga0075430_100092069
978 Ga0075430_100092139
979 Ga0075430_100512655
980 Ga0075430_100571781
981 Ga0075430_100797833
982 Ga0075431_100042360
983 Ga0075431_100088219
984 Ga0075431_100182045
985 Ga0075431_100278985
986 Ga0075431_100380130
987 Ga0075431_100438065
988 Ga0075431_100731262
989 Ga0075431_101562213
990 Ga0075433_10044269
991 Ga0075433_10231847
992 Ga0075433_10241424
993 Ga0075433_10561272
994 Ga0075433_10623627
995 Ga0075433_10825130
996 Ga0075434_100077266
997 Ga0075434_100088630
998 Ga0075434_101849860
999 Ga0075429_100005683
1000 Ga0075429_100019907
1001 Ga0075429_100029431
1002 Ga0075429_100041146
1003 Ga0075429_100080567
1004 Ga0075429_100088060
1005 Ga0075429_100347812
1006 Ga0075429_100711361
1007 Ga0075429_100884182
1008 Ga0097620_100108836
1009 Ga0097620_101817365
1010 Ga0075435_100085405
1011 Ga0075435_100455963
1012 Ga0075435_100508454
1013 Ga0099794_10199718
1014 Ga0105251_10459373
1015 Ga0105250_10338000
1016 Ga0105240_10257165
1017 Ga0111539_10068947
1018 Ga0111539_10079440
1019 Ga0111539_10303184
1020 Ga0111539_10422815
1021 Ga0111539_11548600
1022 Ga0105245_10006025
1023 Ga0105245_10579264
1024 Ga0105247_10111109
1025 Ga0105247_10521825
1026 Ga0105247_10529772
1027 Ga0114129_10002746
1028 Ga0114129_10015317
1029 Ga0114129_10027565
1030 Ga0114129_10038320
1031 Ga0114129_10041383
1032 Ga0114129_10065860
1033 Ga0114129_10073788
1034 Ga0114129_10139135
1035 Ga0114129_10167688
1036 Ga0114129_10273361
1037 Ga0114129_10344558
1038 Ga0114129_10481490
1039 Ga0114129_10671319
1040 Ga0114129_10673008
1041 Ga0114129_10737156
1042 Ga0114129_10827133
1043 Ga0114129_11167582
1044 Ga0114129_11196955
1045 Ga0114129_11235924
1046 Ga0114129_11240572
1047 Ga0114129_11254140
1048 Ga0114129_12107404
1049 Ga0105243_10008709
1050 Ga0105243_10045280
1051 Ga0105243_10979320
1052 Ga0105242_10064779
1053 Ga0105242_10747146
1054 Ga0105242_11298699
1055 Ga0105248_11221862
1056 Ga0105248_11413082
1057 Ga0105237_10534164
1058 Ga0105238_11346196
1059 Ga0105249_10330915
1060 Ga0105249_10440753
1061 Ga0099796_10005699
1062 Ga0105239_10013380
1063 Ga0105239_10497135
1064 Ga0105239_11203217
1065 Ga0105239_12018602
1066 Ga0105239_13076402
1067 Ga0105246_10397932
1068 Ga0105246_10783907
1069 Ga0157373_10344236
1070 Ga0157373_11372578
1071 Ga0157370_11375232
1072 Ga0157374_10068668
1073 Ga0157374_10171919
1074 Ga0157374_10870170
1075 Ga0157374_11599997
1076 Ga0157374_11607043
1077 Ga0157378_10093799
1078 Ga0157378_10147800
1079 Ga0157378_10433047
1080 Ga0157378_10772414
1081 Ga0157378_11317448
1082 Ga0163162_10006856
1083 Ga0163162_10424826
1084 Ga0163162_10529622
1085 Ga0163162_10999753
1086 Ga0163162_11228859
1087 Ga0157372_10620756
1088 Ga0157375_10810009
1089 Ga0157375_11631631
1090 Ga0157375_11897310
1091 Ga0163163_10076891
1092 Ga0163163_10378271
1093 Ga0163163_11273375
1094 Ga0157380_10585019
1095 Ga0157380_10808242
1096 Ga0157379_11935907
1097 Ga0157376_10099294
1098 Ga0157376_10164248
1099 Ga0157376_10343037
1100 Ga0163161_10061942
1101 Ga0163161_10116001
1102 Ga0206354_10311746
1103 Ga0206353_11917053
1104 Ga0207673_1013051
1105 Ga0207697_10001869
1106 Ga0207697_10008030
1107 Ga0207696_1137314
1108 Ga0207682_10027266
1109 Ga0207692_10167533
1110 Ga0207642_10053251
1111 Ga0207710_10328168
1112 Ga0207688_10092447
1113 Ga0207688_10122259
1114 Ga0207680_10032343
1115 Ga0207680_10554880
1116 Ga0207680_10602883
1117 Ga0207699_10381665
1118 Ga0207645_10006819
1119 Ga0207645_10045453
1120 Ga0207645_10259481
1121 Ga0207684_10016870
1122 Ga0207684_10048066
1123 Ga0207684_10079574
1124 Ga0207671_10272049
1125 Ga0207693_10189244
1126 Ga0207663_10298123
1127 Ga0207663_10392842
1128 Ga0207646_10004642
1129 Ga0207646_10092942
1130 Ga0207646_10404182
1131 Ga0207646_10687256
1132 Ga0207646_10853145
1133 Ga0207681_10141492
1134 Ga0207650_10090220
1135 Ga0207659_10053425
1136 Ga0207659_10112658
1137 Ga0207659_10484549
1138 Ga0207700_10058362
1139 Ga0207700_10135687
1140 Ga0207700_11783418
1141 Ga0207664_10587500
1142 Ga0207644_10024337
1143 Ga0207644_10024991
1144 Ga0207644_10071813
1145 Ga0207706_10017316
1146 Ga0207706_10080010
1147 Ga0207706_10237837
1148 Ga0207706_10646123
1149 Ga0207686_10400846
1150 Ga0207709_10399795
1151 Ga0207670_10089769
1152 Ga0207670_10210832
1153 Ga0207670_10679003
1154 Ga0207669_10007862
1155 Ga0207669_10102146
1156 Ga0207669_10295075
1157 Ga0207669_11375613
1158 Ga0207665_10025683
1159 Ga0207665_11342159
1160 Ga0207691_10007318
1161 Ga0207691_10044930
1162 Ga0207711_10328722
1163 Ga0207689_10351673
1164 Ga0207689_11184352
1165 Ga0207661_11192156
1166 Ga0207668_10001042
1167 Ga0207668_10037064
1168 Ga0207668_10116459
1169 Ga0207668_10191176
1170 Ga0207668_10713061
1171 Ga0207640_10573279
1172 Ga0207658_10055305
1173 Ga0207658_10439331
1174 Ga0207658_10900513
1175 Ga0207677_10277911
1176 Ga0207677_10419749
1177 Ga0207677_10533351
1178 Ga0207703_10157651
1179 Ga0207703_10195240
1180 Ga0207639_10710806
1181 Ga0207678_10171773
1182 Ga0207678_10693034
1183 Ga0207708_10112652
1184 Ga0207708_10532121
1185 Ga0207702_10447558
1186 Ga0207702_10555884
1187 Ga0207641_10387768
1188 Ga0207641_11312437
1189 Ga0207648_10173497
1190 Ga0207648_10349355
1191 Ga0207676_10326886
1192 Ga0207676_10436038
1193 Ga0207676_10551882
1194 Ga0207676_10691959
1195 Ga0207674_10900084
1196 Ga0207674_10969451
1197 Ga0207675_100001774
1198 Ga0207675_100182031
1199 Ga0207675_100196036
1200 Ga0207675_100522204
1201 Ga0207675_100546606
1202 Ga0207683_10008702
1203 Ga0207683_10145254
1204 Ga0207683_10204124
1205 Ga0207683_10236334
1206 Ga0207428_10008508
1207 Ga0268266_10086518
1208 Ga0268266_10095287
1209 Ga0268266_10333517
1210 Ga0268265_10000138
1211 Ga0268265_10047434
1212 Ga0268265_10231561
1213 Ga0268265_11407569
1214 Ga0268264_10067687
1215 Ga0307517_10127523
1216 Ga0307515_10004739
1217 Ga0307515_10007075
1218 Ga0307515_10802512
1219 Ga0307512_10002245
1220 Ga0307513_10002908
1221 Ga0307408_100365566
1222 Ga0307508_10005441
1223 Ga0307508_10060277
1224 Ga0307508_10114605
1225 Ga0307508_10146523
1226 Ga0316578_10473298
1227 Ga0307516_10000528
1228 Ga0307516_10076953
1229 Ga0307516_10115978
1230 Ga0307516_10127005
1231 Ga0307516_10213579
1232 Ga0307405_10005279
1233 Ga0307405_10237887
1234 Ga0307413_10060027
1235 Ga0307413_10118800
1236 Ga0307413_10700439
1237 Ga0307413_11659278
1238 Ga0307410_10156195
1239 Ga0307410_10186027
1240 Ga0307410_10386022
1241 Ga0307410_10423445
1242 Ga0307410_10755759
1243 Ga0307406_10005652
1244 Ga0307406_10006884
1245 Ga0307406_10932489
1246 Ga0307406_10958409
1247 Ga0307407_10023579
1248 Ga0307407_10188817
1249 Ga0307407_10194712
1250 Ga0307407_10238526
1251 Ga0307412_10059594
1252 Ga0307412_10796735
1253 Ga0307412_10880524
1254 Ga0307409_100015616
1255 Ga0307409_100195813
1256 Ga0307409_100202313
1257 Ga0307409_100360272
1258 Ga0307409_101507754
1259 Ga0307409_102245235
1260 Ga0307416_100003064
1261 Ga0307416_100112914
1262 Ga0307416_100115944
1263 Ga0307416_100137557
1264 Ga0307416_100781008
1265 Ga0307416_101384949
1266 Ga0307414_10085593
1267 Ga0307414_10447562
1268 Ga0307411_10291946
1269 Ga0307411_10328803
1270 Ga0307411_11127489
1271 Ga0307415_100000009
1272 Ga0307415_100026967
1273 Ga0307415_100063058
1274 Ga0307415_100182134
1275 Ga0307415_100331579
1276 Ga0307415_100369931
1277 Ga0307415_100395534
1278 Ga0307415_100947675
1279 Ga0307415_101076631
1280 Ga0307415_101416489
1281 Ga0307507_10312587
1282 Ga0307510_10413871
1283 Ga0316592_1160856
1284 Ga0373938_0025835
1285 Ga0373928_0087956
1286 Ga0373940_0003039
1287 Ga0373951_0000134
1288 Ga0373932_0014431
1289 Ga0373941_0355056
1290 Ga0373941_0507976
1291 Ga0373945_0025421
1292 Ga0373945_0244856
1293 Ga0373957_0100775
1294 Ga0373943_0266668
1295 Ga0373946_0193978
1296 Ga0373942_0001030
1297 Ga0373962_0002273
1298 Ga0373924_0142514
1299 Ga0373931_0119349
1300 Ga0373931_0305682
1301 Ga0373935_0007029
1302 Ga0373935_0068307
1303 Ga0373935_0234771
1304 Ga0373935_0450549
1305 Ga0373935_0503620
1306 Ga0373927_0399762
1307 Ga0373927_1089844
1308 Ga0373947_0096275
1309 Ga0373947_0103015
1310 Ga0373937_0048253
1311 Ga0373937_0114090
1312 Ga0373937_0923116
1313 Ga0316582_0008790
1314 Ga0395899_0064801
1315 Ga0395900_0137234
1316 Ga0395900_0356829
1317 Ga0395900_0375212
1318 Ga0395900_0591377
1319 Ga0395898_0036138
1320 Ga0395898_0049949
1321 Ga0395898_1778338
1322 Ga0316581_0118649
1323 Ga0436364_1383891
1324 Ga0395901_0305353
1325 Ga0451793_1633125
1326 Ga0451802_1771638
1327 Ga0451804_0377329
1328 Ga0451833_0074111
1329 Ga0451841_1387006
1330 Ga0451853_1233207
1331 Ga0451853_3441805
1332 Ga0439463_045945
1333 Ga0439459_0035868
1334 Ga0466963_0445644
1335 Ga0466963_0795704
1336 Ga0466968_0067229
1337 Ga0466960_0731854
1338 Ga0466967_0154970
1339 Ga0466967_2311311
1340 Ga0495603_0292970
1341 Ga0495629_0550211
1342 Ga0495651_0106096
1343 Ga0495653_0188118
1344 Ga0495664_0239086
1345 Ga0495606_0001573
1346 Ga0495630_0214769
1347 Ga0495630_0256370
1348 Ga0495630_1346219
1349 Ga0495632_0034183
1350 Ga0495632_0044122
1351 Ga0495652_0046702
1352 Ga0495640_0790254
1353 Ga0495667_0391448
1354 Ga0495668_0000668
1355 Ga0495634_0380083
1356 Ga0495625_0004244
1357 Ga0495625_0120926
1358 Ga0495625_0369701
1359 Ga0495635_0273673
1360 Ga0495657_0502354
1361 Ga0495599_0367453
1362 Ga0495669_0063375
1363 Ga0495669_0232573
1364 Ga0495669_0373383
1365 Ga0495613_0483300
1366 Ga0495624_0168220
1367 Ga0495672_0115586
1368 Ga0495683_0163957
1369 Ga0495675_0082267
1370 Ga0495684_0026233
1371 Ga0495626_0000282
1372 Ga0496100_0006316
1373 Ga0496101_1446446
1374 Ga0496102_0034791
1375 Ga0496102_0861799
1376 Ga0496102_1256001
1377 Ga0496103_0169487
1378 Ga0496103_0611563
1379 Ga0496104_0208342
1380 Ga0496104_0638423
1381 Ga0496106_0059977
1382 Ga0496106_0495313
1383 Ga0496106_0502663
1384 Ga0496107_0082591
1385 Ga0496107_0209819
1386 Ga0496107_0452108
1387 Ga0496108_0000247
1388 Ga0496108_0172262
1389 Ga0496109_0000040
1390 Ga0496109_0207460
1391 Ga0496110_1213631
1392 Ga0496112_0021085
1393 Ga0496112_0116312
1394 Ga0496112_0121762
1395 Ga0496112_0710727
1396 Ga0496112_1398161
1397 Ga0496113_0321701
1398 Ga0496114_1140820
1399 Ga0496115_0020650
1400 Ga0496115_0438291
1401 Ga0496119_0456829
1402 Ga0496126_0069897
1403 Ga0501031_0005760
1404 Ga0501032_0064110
1405 Ga0501032_0595214
1406 Ga0501033_0015722
1407 Ga0501036_0000376
1408 Ga0501037_1050545
1409 Ga0501038_0000696
1410 Ga0501038_0638230
1411 Ga0501039_0000734
1412 Ga0501039_0041300
1413 Ga0501039_0452166
1414 Ga0501039_1129625
1415 Ga0501040_0002456
1416 Ga0501040_0088609
1417 Ga0501040_0382075
1418 Ga0501040_0637072
1419 Ga0501041_0000196
1420 Ga0501041_1110030
1421 Ga0501042_0000854
1422 Ga0501042_0199377
1423 Ga0501042_0244965
1424 Ga0501042_0592949
1425 Ga0501042_0605464
1426 Ga0501043_0005448
1427 Ga0501043_0862055
1428 Ga0501046_0001223
1429 Ga0501046_0073171
1430 Ga0501047_0125479
1431 Ga0501047_1334544
1432 Ga0501048_0001630
1433 Ga0501068_0005176
1434 Ga0501068_0470754
1435 Ga0501070_0159492
1436 Ga0501070_0587328
1437 Ga0501071_0001306
1438 Ga0501071_0162807
1439 Ga0501072_0011907
1440 Ga0501072_0016960
1441 Ga0501072_1047805
1442 Ga0501074_0028137
1443 Ga0501075_0021301
1444 Ga0501075_0087770
1445 Ga0501075_0344507
1446 Ga0501075_0351804
1447 Ga0501075_1006316
1448 Ga0501076_0006204
1449 Ga0501076_0054541
1450 Ga0501076_0979189
1451 Ga0501077_0026053
1452 Ga0501077_1027650
1453 Ga0501079_0005835
1454 Ga0501080_0002956
1455 Ga0501081_0005772
1456 Ga0501081_0029860
1457 Ga0501081_0216852
1458 Ga0501083_0043108
1459 Ga0501035_0007957
1460 Ga0501035_0435950
1461 Ga0501044_0062803
1462 Ga0501044_0068715
1463 Ga0501045_0020270
1464 Ga0501045_0021597
1465 nmdc:mga05p37_1017172_c1
1466 nmdc:mga05p37_1033795_c1
1467 nmdc:mga05p37_11061_c1
1468 nmdc:mga05p37_1637217_c1
1469 nmdc:mga05p37_16753_c1
1470 nmdc:mga05p37_175888_c1
1471 nmdc:mga05p37_215197_c1
1472 nmdc:mga05p37_216593_c1
1473 nmdc:mga05p37_2273_c1
1474 nmdc:mga05p37_351219_c1
1475 nmdc:mga05p37_354305_c1
1476 nmdc:mga05p37_390070_c1
1477 nmdc:mga05p37_400314_c1
1478 nmdc:mga05p37_63507_c1
1479 nmdc:mga05p37_660391_c1
1480 nmdc:mga05p37_67721_c1
1481 nmdc:mga05p37_69274_c1
1482 nmdc:mga09592_123920_c1
1483 nmdc:mga09592_1373845_c1
1484 nmdc:mga09592_194_c1
1485 nmdc:mga09592_219646_c1
1486 nmdc:mga09592_554503_c1
1487 nmdc:mga09592_63909_c1
1488 nmdc:mga09592_81120_c1
1489 nmdc:mga0qj67_104446_c1
1490 nmdc:mga0qj67_1184589_c1
1491 nmdc:mga0qj67_21563_c1
1492 nmdc:mga0qj67_877_c1
1493 nmdc:mga06r32_1335420_c1
1494 nmdc:mga06r32_1381081_c1
1495 nmdc:mga06r32_217922_c2
1496 nmdc:mga06r32_265703_c1
1497 nmdc:mga06r32_428231_c1
1498 nmdc:mga06r32_497210_c1
1499 nmdc:mga06r32_534241_c1
1500 nmdc:mga06r32_736427_c1
1501 nmdc:mga06r32_830538_c1
1502 nmdc:mga06r32_83277_c1
1503 nmdc:mga06r32_919249_c1
1504 nmdc:mga08y16_1291915_c1
1505 nmdc:mga08y16_1494729_c1
1506 nmdc:mga08y16_32240_c1
1507 nmdc:mga08y16_600046_c1
1508 nmdc:mga0n895_1244610_c1
1509 nmdc:mga0rr50_126760_c1
1510 nmdc:mga0rr50_1364470_c1
1511 nmdc:mga0rr50_442756_c1
1512 nmdc:mga0a205_1197703_c1
1513 nmdc:mga0a205_250821_c1
1514 nmdc:mga0a205_31629_c1
1515 Ga0495619_0157046
1516 Ga0500644_0117806
1517 Ga0500583_0135872
1518 Ga0500651_0050721
1519 Ga0500641_0005174
1520 Ga0500660_098312
1521 Ga0500555_004378
1522 Ga0500556_0132369
1523 Ga0500562_086245
1524 Ga0500562_136680
1525 Ga0500569_020587
1526 Ga0500594_0095449
1527 Ga0500652_015178
1528 Ga0500600_0217209
1529 Ga0500627_0291028
1530 Ga0500633_0023451
1531 Ga0501084_0004927
1532 Ga0501084_0049963
1533 Ga0501082_0002856
1534 Ga0501082_1018873
1535 Ga0530510_0006318
1536 Ga0530510_0027646
1537 Ga0530510_0129188
1538 2501943695
1539 2623585701
1540 2676482933
1541 2753269673
1542 2772642894
1543 2831938832
1544 2832006870
1545 2855674171
1546 2855679828
1547 2855689844
1548 2856859592
1549 2857290824
1550 2858853802
1551 2858869746
1552 2858885175
1553 2858893222
1554 2858901906
1555 2858904978
1556 2867307946
1557 2867318663
1558 2867324023
1559 2869053274
1560 2869064161
1561 2869071238
1562 2880494537
1563 2880497770
1564 2887486405
1565 2902588459
1566 2929226344
1567 2929233041
1568 2996222880
1569 649816300
1570 8001782606
1571 8003834354
1572 8003876491
1573 8054709645
1574 8054729567
1575 8054740411
1576 8055413249

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

59

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9158 2 127
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9154 10 128
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9091 1 128
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9023 1 128
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.8968 1 128
ID Description Score Start End Superfamily
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9331 32 126 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.919 35 127 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9089 1 128 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9022 1 128 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8894 2 127 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 0.9796 41 128 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9787 33 128 GO:0004601
GO:0006979
AF-A0A7J4VA71-F1-model_v4 OsmC family peroxiredoxin 0.9779 22 128 GO:0004601
GO:0006979
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9779 36 127 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.9779 33 127 GO:0004601
GO:0006979

Map