F480862
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 788 | 553 | 483 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100057722|Ga0070704_1000577222 |
| Length | 390 |
| Sequence | VPHTRFVRGLGERGGHFWAPAYKIMLRARIIATGMSVPEPVVTNELLSRCMSTSDEWITQRTGIRERRMSPDTYRMLLRLAEAPDKPAFMREVRDRGLDGQIDSSLTVTDLALEASRMALKHAGIAAEDLDCIIQSSTLPDLAYPAPGCVMQGRLGLTSTPVFNLAQGCAGFVYGLALADQLIRGGMYRRVLVVGAELLSSAFDYTDEGRDMAVLFADGAGAAVLEAVETDAVRPRGLISHHLHSDGSALDALYGEMWGSSTFPPVSKKKIDDGRTRPRMNGRAVFVNAVRRVREVVQECLDANGLRAADVDCYLFHQANLRIIEAAAEHFQIPAERYFNNLDRYGNTAGASVPICLHEALSEARIKDGDLVMLVAFGTGFSWGATLLRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 8 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 9 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 10 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 11 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 12 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 13 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 14 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 15 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 16 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 17 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 18 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 19 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 20 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 21 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 22 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 23 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 24 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 25 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 26 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 27 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 28 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 29 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 30 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 31 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 32 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 33 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 34 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 35 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 36 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 37 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 38 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 39 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 40 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 41 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 42 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 43 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 44 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 45 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 46 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 47 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 48 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 49 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 50 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 51 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 52 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 53 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 54 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 55 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 56 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 57 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 58 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 59 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 60 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 61 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 62 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 63 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 64 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 65 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 66 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 67 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 68 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 69 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 70 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 71 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 72 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 73 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 74 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 75 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 76 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 77 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 78 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 79 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 80 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 81 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 82 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 83 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 84 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 85 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 86 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 87 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 88 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 89 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 90 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 91 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 92 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 93 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 94 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 95 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 96 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 97 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 98 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 99 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 100 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 101 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 102 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 103 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 104 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 105 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 106 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 107 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 108 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 109 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 110 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 111 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 112 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 113 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 114 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 115 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 116 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 117 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 118 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 119 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 120 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 121 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 122 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 123 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 124 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 125 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 126 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 127 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 128 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 129 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 130 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 131 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 132 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 133 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 134 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 135 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 136 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 137 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 138 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 139 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 140 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 141 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 142 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 143 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 144 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 145 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 146 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 147 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 148 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 149 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 150 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 151 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 152 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 153 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 154 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 155 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 156 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 157 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 158 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 159 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 160 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 161 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 162 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 163 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 164 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 165 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 166 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 167 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 168 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 169 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 170 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 171 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 172 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 173 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 174 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 175 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 176 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 177 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 178 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 179 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 180 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 181 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 182 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 183 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 184 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 185 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 186 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 187 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 188 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 189 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 190 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 191 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 192 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 193 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 194 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 195 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 196 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 197 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 198 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 199 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 200 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 201 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 202 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 203 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 204 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 205 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 206 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 207 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 208 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 209 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 210 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 211 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 212 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 213 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 214 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 215 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 216 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 217 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 218 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 219 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 220 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 221 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 222 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 223 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 224 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 225 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 226 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 227 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 228 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 229 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 230 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 231 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 232 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 233 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 234 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 235 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 236 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 237 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 238 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 239 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 240 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 241 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 242 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 243 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 244 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 245 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 246 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 247 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 248 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 249 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 250 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 251 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 252 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 253 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 254 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 255 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 256 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 257 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 258 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 259 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 260 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 261 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 262 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 263 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 264 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 265 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 266 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 267 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 268 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 269 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 270 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 271 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 272 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 273 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 274 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 275 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 276 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 277 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 278 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 279 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 280 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 281 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 282 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 283 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 284 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 285 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 286 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 287 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 288 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 289 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 290 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 291 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 292 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 293 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 294 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 295 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 296 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 297 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 298 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 299 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 300 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 301 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 303 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 304 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 308 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 309 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 311 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 312 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 313 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 314 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 316 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 317 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 320 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 321 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 323 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 324 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 325 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 326 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 327 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 328 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 329 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 330 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 331 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 332 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 333 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 334 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 335 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 336 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 337 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 338 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 339 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 340 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 341 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 342 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 343 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 345 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 346 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 348 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 356 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 358 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 386 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 387 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 391 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 392 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 393 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 394 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 395 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 396 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 397 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 398 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 399 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 400 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 401 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 402 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 403 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 404 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 405 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 406 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 407 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 408 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 411 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 412 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 413 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 414 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 415 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 416 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 417 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 418 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 419 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 420 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 421 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 422 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 423 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 424 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 425 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 426 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 427 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 428 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 429 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 469 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 470 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 471 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 472 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 473 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 474 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 475 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 476 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 477 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 478 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 479 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 480 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 481 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 514 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 515 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 516 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 517 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 530 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 533 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 536 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 537 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 538 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 539 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 540 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 541 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 542 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 543 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 544 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 545 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 546 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 547 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 548 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 549 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 550 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 551 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 552 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 553 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.91 |
| Metatranscriptomes | 0.38 |
| Isolates | 38.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.43 |
| Nodule | 29.19 |
| Rhizoplane | 1.02 |
| Rhizosphere | 56.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007842 | 3300001979 | Bacteria | 4308 |
| 2 | JGI24735J21928_10001139 | 3300002067 | Bacteria | 9487 |
| 3 | JGI25157J39369_1000849 | 3300002741 | Bacteria | 15049 |
| 4 | JGI25165J46597_1000219 | 3300003214 | Bacteria | 79946 |
| 5 | rootH2_10025044 | 3300003320 | Bacteria | 3625 |
| 6 | rootH1_10012854 | 3300003323 | Bacteria | 4783 |
| 7 | Ga0006562J51391_1008400 | 3300003578 | Bacteria | 5010 |
| 8 | Ga0055542_1000572 | 3300003762 | Bacteria | 32254 |
| 9 | Ga0055529_1003128 | 3300003763 | Bacteria | 2864 |
| 10 | Ga0058859_11785646 | 3300004798 | Bacteria | 5091 |
| 11 | Ga0058860_11846802 | 3300004801 | Bacteria | 1401 |
| 12 | Ga0065165_1001977 | 3300005262 | Bacteria | 19345 |
| 13 | Ga0065704_10114003 | 3300005289 | Bacteria | 1901 |
| 14 | Ga0065707_10130544 | 3300005295 | Bacteria | 1928 |
| 15 | Ga0070676_10223955 | 3300005328 | Bacteria | 1244 |
| 16 | Ga0068869_100008715 | 3300005334 | Bacteria | 6550 |
| 17 | Ga0070682_100003380 | 3300005337 | Bacteria | 8849 |
| 18 | Ga0070668_100149088 | 3300005347 | Bacteria | 1890 |
| 19 | Ga0070668_100173088 | 3300005347 | Bacteria | 1759 |
| 20 | Ga0070674_100061115 | 3300005356 | Bacteria | 2628 |
| 21 | Ga0070714_100000144 | 3300005435 | Bacteria | 57133 |
| 22 | Ga0070713_100138922 | 3300005436 | Bacteria | 2150 |
| 23 | Ga0070694_100155277 | 3300005444 | Bacteria | 1675 |
| 24 | Ga0070708_100008304 | 3300005445 | Bacteria | 8339 |
| 25 | Ga0070708_100101575 | 3300005445 | Bacteria | 2634 |
| 26 | Ga0068867_100080138 | 3300005459 | Bacteria | 2458 |
| 27 | Ga0070706_100008474 | 3300005467 | Bacteria | 9578 |
| 28 | Ga0070706_100193585 | 3300005467 | Bacteria | 1900 |
| 29 | Ga0070706_100212818 | 3300005467 | Unclassified | 1805 |
| 30 | Ga0070707_100004103 | 3300005468 | Bacteria | 13680 |
| 31 | Ga0070707_100032977 | 3300005468 | Bacteria | 4936 |
| 32 | Ga0070707_100128562 | 3300005468 | Bacteria | 2462 |
| 33 | Ga0070698_100048437 | 3300005471 | Bacteria | 4342 |
| 34 | Ga0070698_100088332 | 3300005471 | Bacteria | 3085 |
| 35 | Ga0070698_100103437 | 3300005471 | Bacteria | 2818 |
| 36 | Ga0070698_100140372 | 3300005471 | Bacteria | 2368 |
| 37 | Ga0070699_100041963 | 3300005518 | Bacteria | 3958 |
| 38 | Ga0070699_100042416 | 3300005518 | Bacteria | 3937 |
| 39 | Ga0070697_100289025 | 3300005536 | Unclassified | 1408 |
| 40 | Ga0070695_100001839 | 3300005545 | Bacteria | 11964 |
| 41 | Ga0070696_100008411 | 3300005546 | Bacteria | 6904 |
| 42 | Ga0070665_100003727 | 3300005548 | Bacteria | 16137 |
| 43 | Ga0070665_100159776 | 3300005548 | Bacteria | 2255 |
| 44 | Ga0070704_100057722 | 3300005549 | Bacteria | 2761 |
| 45 | Ga0068855_100065026 | 3300005563 | Bacteria | 4252 |
| 46 | Ga0068855_100113372 | 3300005563 | Bacteria | 3110 |
| 47 | Ga0070664_100118887 | 3300005564 | Unclassified | 2312 |
| 48 | Ga0068857_100304351 | 3300005577 | Bacteria | 1470 |
| 49 | Ga0068854_100089153 | 3300005578 | Bacteria | 2292 |
| 50 | Ga0068856_100200983 | 3300005614 | Bacteria | 2007 |
| 51 | Ga0068852_100094392 | 3300005616 | Bacteria | 2683 |
| 52 | Ga0068859_100460918 | 3300005617 | Bacteria | 1367 |
| 53 | Ga0068860_100017606 | 3300005843 | Bacteria | 6961 |
| 54 | Ga0068860_100033861 | 3300005843 | Bacteria | 4902 |
| 55 | Ga0068862_100010573 | 3300005844 | Bacteria | 7627 |
| 56 | Ga0068862_100026271 | 3300005844 | Bacteria | 4894 |
| 57 | Ga0081455_10000829 | 3300005937 | Bacteria | 39780 |
| 58 | Ga0081455_10012592 | 3300005937 | Bacteria | 8430 |
| 59 | Ga0081538_10002229 | 3300005981 | Bacteria | 19200 |
| 60 | Ga0081538_10002703 | 3300005981 | Bacteria | 17055 |
| 61 | Ga0075365_10002014 | 3300006038 | Bacteria | 9638 |
| 62 | Ga0075365_10087327 | 3300006038 | Bacteria | 2120 |
| 63 | Ga0075363_100028371 | 3300006048 | Bacteria | 2878 |
| 64 | Ga0070715_10124045 | 3300006163 | Bacteria | 1235 |
| 65 | Ga0070716_100019012 | 3300006173 | Bacteria | 3587 |
| 66 | Ga0070712_100003421 | 3300006175 | Bacteria | 9763 |
| 67 | Ga0075362_10019633 | 3300006177 | Bacteria | 2813 |
| 68 | Ga0075367_10019474 | 3300006178 | Bacteria | 3764 |
| 69 | Ga0068871_100064668 | 3300006358 | Unclassified | 2995 |
| 70 | Ga0075428_100042448 | 3300006844 | Bacteria | 5000 |
| 71 | Ga0075431_100090019 | 3300006847 | Bacteria | 3167 |
| 72 | Ga0075431_100108453 | 3300006847 | Bacteria | 2865 |
| 73 | Ga0075431_100273127 | 3300006847 | Bacteria | 1713 |
| 74 | Ga0075434_100020904 | 3300006871 | Bacteria | 6355 |
| 75 | Ga0075434_100314766 | 3300006871 | Bacteria | 1586 |
| 76 | Ga0068865_100096498 | 3300006881 | Bacteria | 2156 |
| 77 | Ga0097620_100460863 | 3300006931 | Bacteria | 1367 |
| 78 | Ga0075435_100000577 | 3300007076 | Bacteria | 22442 |
| 79 | Ga0099794_10103089 | 3300007265 | Unclassified | 1425 |
| 80 | Ga0111539_10024445 | 3300009094 | Bacteria | 7412 |
| 81 | Ga0111539_10164656 | 3300009094 | Bacteria | 2593 |
| 82 | Ga0111539_10550105 | 3300009094 | Bacteria | 1344 |
| 83 | Ga0105245_10041733 | 3300009098 | Bacteria | 4090 |
| 84 | Ga0105245_10202004 | 3300009098 | Bacteria | 1909 |
| 85 | Ga0114129_10000977 | 3300009147 | Bacteria | 37424 |
| 86 | Ga0114129_10355517 | 3300009147 | Bacteria | 1939 |
| 87 | Ga0114129_10448952 | 3300009147 | Bacteria | 1691 |
| 88 | Ga0114129_10610156 | 3300009147 | Bacteria | 1413 |
| 89 | Ga0105241_10042991 | 3300009174 | Bacteria | 3421 |
| 90 | Ga0105249_10060995 | 3300009553 | Bacteria | 3460 |
| 91 | Ga0105239_10159253 | 3300010375 | Bacteria | 2522 |
| 92 | Ga0105246_10222363 | 3300011119 | Bacteria | 1481 |
| 93 | Ga0157378_10317029 | 3300013297 | Bacteria | 1514 |
| 94 | Ga0163162_10000446 | 3300013306 | Bacteria | 38191 |
| 95 | Ga0163162_10463863 | 3300013306 | Bacteria | 1398 |
| 96 | Ga0163162_10627519 | 3300013306 | Bacteria | 1199 |
| 97 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 98 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 99 | Ga0209759_1000156 | 3300025256 | Bacteria | 117222 |
| 100 | Ga0209233_1000258 | 3300025261 | Bacteria | 80118 |
| 101 | Ga0209233_1009319 | 3300025261 | Bacteria | 2993 |
| 102 | Ga0209233_1011172 | 3300025261 | Bacteria | 2654 |
| 103 | Ga0209455_1000376 | 3300025272 | Bacteria | 40749 |
| 104 | Ga0209758_1008950 | 3300025297 | Bacteria | 6343 |
| 105 | Ga0207680_10035673 | 3300025903 | Bacteria | 2857 |
| 106 | Ga0207647_10008543 | 3300025904 | Bacteria | 7333 |
| 107 | Ga0207685_10046411 | 3300025905 | Bacteria | 1653 |
| 108 | Ga0207684_10007744 | 3300025910 | Bacteria | 9617 |
| 109 | Ga0207695_10494764 | 3300025913 | Bacteria | 1105 |
| 110 | Ga0207671_10014553 | 3300025914 | Bacteria | 6210 |
| 111 | Ga0207671_10179387 | 3300025914 | Bacteria | 1647 |
| 112 | Ga0207646_10015361 | 3300025922 | Bacteria | 7233 |
| 113 | Ga0207646_10055940 | 3300025922 | Bacteria | 3527 |
| 114 | Ga0207694_10010009 | 3300025924 | Bacteria | 7147 |
| 115 | Ga0207687_10036370 | 3300025927 | Bacteria | 3354 |
| 116 | Ga0207687_10158394 | 3300025927 | Bacteria | 1735 |
| 117 | Ga0207664_10000494 | 3300025929 | Bacteria | 28084 |
| 118 | Ga0207709_10201684 | 3300025935 | Bacteria | 1421 |
| 119 | Ga0207665_10046375 | 3300025939 | Bacteria | 2912 |
| 120 | Ga0207665_10136885 | 3300025939 | Bacteria | 1743 |
| 121 | Ga0207689_10007335 | 3300025942 | Bacteria | 9671 |
| 122 | Ga0207679_10164765 | 3300025945 | Unclassified | 1819 |
| 123 | Ga0207667_10261796 | 3300025949 | Bacteria | 1768 |
| 124 | Ga0207667_10266432 | 3300025949 | Bacteria | 1752 |
| 125 | Ga0207712_10096398 | 3300025961 | Bacteria | 2189 |
| 126 | Ga0207668_10103788 | 3300025972 | Bacteria | 2118 |
| 127 | Ga0207640_10041060 | 3300025981 | Bacteria | 2940 |
| 128 | Ga0207639_10042288 | 3300026041 | Bacteria | 3414 |
| 129 | Ga0207639_10112174 | 3300026041 | Bacteria | 2224 |
| 130 | Ga0207708_10161633 | 3300026075 | Bacteria | 1769 |
| 131 | Ga0207702_10223646 | 3300026078 | Bacteria | 1755 |
| 132 | Ga0207702_10294481 | 3300026078 | Bacteria | 1538 |
| 133 | Ga0207641_10010425 | 3300026088 | Bacteria | 7637 |
| 134 | Ga0207648_10097245 | 3300026089 | Bacteria | 2576 |
| 135 | Ga0207648_10190385 | 3300026089 | Bacteria | 1818 |
| 136 | Ga0207683_10094039 | 3300026121 | Bacteria | 2671 |
| 137 | Ga0209813_10025597 | 3300027866 | Bacteria | 1699 |
| 138 | Ga0207428_10033649 | 3300027907 | Bacteria | 4207 |
| 139 | Ga0207428_10165991 | 3300027907 | Bacteria | 1674 |
| 140 | Ga0268266_10054796 | 3300028379 | Bacteria | 3427 |
| 141 | Ga0268266_10298381 | 3300028379 | Bacteria | 1502 |
| 142 | Ga0268265_10013573 | 3300028380 | Bacteria | 5538 |
| 143 | Ga0268264_10000558 | 3300028381 | Bacteria | 45913 |
| 144 | Ga0268264_10041618 | 3300028381 | Bacteria | 3802 |
| 145 | Ga0307515_10000056 | 3300028794 | Bacteria | 261973 |
| 146 | Ga0265325_10060496 | 3300031241 | Bacteria | 1924 |
| 147 | Ga0265313_10042643 | 3300031595 | Bacteria | 2227 |
| 148 | Ga0265314_10006793 | 3300031711 | Bacteria | 10032 |
| 149 | Ga0316576_10000975 | 3300031727 | Bacteria | 14705 |
| 150 | Ga0316577_10001094 | 3300031733 | Bacteria | 12294 |
| 151 | Ga0307413_10095618 | 3300031824 | Bacteria | 1948 |
| 152 | Ga0307412_10000131 | 3300031911 | Bacteria | 54361 |
| 153 | Ga0307416_100114071 | 3300032002 | Bacteria | 2390 |
| 154 | Ga0373926_0039620 | 3300035083 | Bacteria | 1680 |
| 155 | Ga0373923_0001019 | 3300035111 | Bacteria | 7610 |
| 156 | Ga0373936_0000230 | 3300035113 | Bacteria | 18464 |
| 157 | Ga0373945_0001082 | 3300035116 | Bacteria | 8196 |
| 158 | Ga0373953_0000282 | 3300035117 | Bacteria | 14066 |
| 159 | Ga0373954_0000163 | 3300035118 | Bacteria | 23852 |
| 160 | Ga0373943_0080606 | 3300035170 | Bacteria | 1668 |
| 161 | Ga0373946_0000412 | 3300035171 | Bacteria | 13925 |
| 162 | Ga0373955_0000071 | 3300035172 | Bacteria | 40941 |
| 163 | Ga0373924_0002670 | 3300035410 | Bacteria | 6013 |
| 164 | Ga0373935_0001582 | 3300035692 | Bacteria | 12695 |
| 165 | Ga0373927_0001396 | 3300035695 | Bacteria | 18191 |
| 166 | Ga0373933_0002030 | 3300035724 | Bacteria | 11646 |
| 167 | Ga0373947_0001895 | 3300035725 | Bacteria | 12777 |
| 168 | Ga0373937_0000162 | 3300036401 | Bacteria | 64742 |
| 169 | Ga0373937_0317528 | 3300036401 | Bacteria | 1474 |
| 170 | Ga0316582_0064163 | 3300036647 | Bacteria | 2362 |
| 171 | Ga0316584_0082462 | 3300036712 | Bacteria | 2409 |
| 172 | Ga0373925_0000025 | 3300037068 | Bacteria | 154937 |
| 173 | Ga0395900_0029285 | 3300037418 | Bacteria | 5649 |
| 174 | Ga0395900_0054140 | 3300037418 | Bacteria | 4131 |
| 175 | Ga0395898_0031042 | 3300037466 | Bacteria | 5344 |
| 176 | Ga0395905_0000995 | 3300037471 | Bacteria | 36267 |
| 177 | Ga0395905_0001481 | 3300037471 | Bacteria | 28106 |
| 178 | Ga0395905_0027828 | 3300037471 | Bacteria | 5330 |
| 179 | Ga0395905_0079042 | 3300037471 | Bacteria | 3083 |
| 180 | Ga0395905_0152442 | 3300037471 | Bacteria | 2174 |
| 181 | Ga0395905_0550889 | 3300037471 | Bacteria | 1054 |
| 182 | Ga0395901_0221571 | 3300038443 | Bacteria | 1977 |
| 183 | Ga0395901_0223331 | 3300038443 | Bacteria | 1968 |
| 184 | Ga0439450_000521 | 3300042008 | Bacteria | 5010 |
| 185 | Ga0439463_001336 | 3300042016 | Bacteria | 6574 |
| 186 | Ga0451577_0001676 | 3300042876 | Bacteria | 28603 |
| 187 | Ga0451577_0001818 | 3300042876 | Bacteria | 27291 |
| 188 | Ga0451577_0002212 | 3300042876 | Bacteria | 23681 |
| 189 | Ga0451577_0028398 | 3300042876 | Bacteria | 5059 |
| 190 | Ga0451577_0095980 | 3300042876 | Bacteria | 2647 |
| 191 | Ga0466972_0053238 | 3300044658 | Bacteria | 1949 |
| 192 | Ga0453683_0001036 | 3300044673 | Bacteria | 26046 |
| 193 | Ga0453683_0002536 | 3300044673 | Bacteria | 14094 |
| 194 | Ga0453683_0010466 | 3300044673 | Bacteria | 6145 |
| 195 | Ga0453683_0077158 | 3300044673 | Bacteria | 2086 |
| 196 | Ga0453683_0120393 | 3300044673 | Bacteria | 1652 |
| 197 | Ga0453683_0209860 | 3300044673 | Bacteria | 1237 |
| 198 | Ga0453684_0000066 | 3300044712 | Bacteria | 465545 |
| 199 | Ga0453684_0001327 | 3300044712 | Bacteria | 72967 |
| 200 | Ga0453684_0003490 | 3300044712 | Bacteria | 35318 |
| 201 | Ga0453684_0016384 | 3300044712 | Bacteria | 11595 |
| 202 | Ga0453684_0021711 | 3300044712 | Bacteria | 9571 |
| 203 | Ga0453684_0037244 | 3300044712 | Bacteria | 6679 |
| 204 | Ga0453684_0102182 | 3300044712 | Bacteria | 3505 |
| 205 | Ga0453684_0221830 | 3300044712 | Bacteria | 2189 |
| 206 | Ga0453684_0370119 | 3300044712 | Bacteria | 1611 |
| 207 | Ga0466960_0036087 | 3300044901 | Bacteria | 2314 |
| 208 | Ga0451576_0007592 | 3300045051 | Bacteria | 12919 |
| 209 | Ga0451576_0146542 | 3300045051 | Bacteria | 2461 |
| 210 | Ga0451576_0169544 | 3300045051 | Bacteria | 2278 |
| 211 | Ga0451576_0376490 | 3300045051 | Bacteria | 1488 |
| 212 | Ga0451576_0401818 | 3300045051 | Bacteria | 1436 |
| 213 | Ga0495592_0000132 | 3300046454 | Bacteria | 66310 |
| 214 | Ga0495638_0183332 | 3300046460 | Bacteria | 1193 |
| 215 | Ga0495651_0000308 | 3300046462 | Bacteria | 38022 |
| 216 | Ga0495653_0000041 | 3300046463 | Bacteria | 118366 |
| 217 | Ga0495582_0032493 | 3300046473 | Bacteria | 2869 |
| 218 | Ga0495662_0003042 | 3300046476 | Bacteria | 8456 |
| 219 | Ga0495664_0000005 | 3300046477 | Bacteria | 439635 |
| 220 | Ga0495607_0071860 | 3300046501 | Bacteria | 1928 |
| 221 | Ga0495608_0000003 | 3300046511 | Bacteria | 369831 |
| 222 | Ga0495608_0001600 | 3300046511 | Bacteria | 16214 |
| 223 | Ga0495610_0030806 | 3300046512 | Bacteria | 2805 |
| 224 | Ga0495618_0000010 | 3300046514 | Bacteria | 189314 |
| 225 | Ga0495620_0087605 | 3300046515 | Bacteria | 1252 |
| 226 | Ga0495628_0000019 | 3300046516 | Bacteria | 154435 |
| 227 | Ga0495628_0079751 | 3300046516 | Bacteria | 2545 |
| 228 | Ga0495630_0016988 | 3300046517 | Bacteria | 5326 |
| 229 | Ga0495643_0019534 | 3300046522 | Bacteria | 3918 |
| 230 | Ga0495652_0000028 | 3300046529 | Bacteria | 157336 |
| 231 | Ga0495665_0029847 | 3300046531 | Bacteria | 2920 |
| 232 | Ga0495640_0000014 | 3300046533 | Bacteria | 161741 |
| 233 | Ga0495587_0000026 | 3300046536 | Bacteria | 147819 |
| 234 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 235 | Ga0495667_0000003 | 3300046559 | Bacteria | 295404 |
| 236 | Ga0495667_0001691 | 3300046559 | Bacteria | 14642 |
| 237 | Ga0495667_0099095 | 3300046559 | Bacteria | 1887 |
| 238 | Ga0495668_0098708 | 3300046616 | Bacteria | 1598 |
| 239 | Ga0495634_0000017 | 3300046642 | Bacteria | 122411 |
| 240 | Ga0495625_0083324 | 3300046660 | Bacteria | 2223 |
| 241 | Ga0495625_0172444 | 3300046660 | Bacteria | 1444 |
| 242 | Ga0495635_0000024 | 3300046663 | Bacteria | 148235 |
| 243 | Ga0495657_0000034 | 3300046675 | Bacteria | 122360 |
| 244 | Ga0495599_0000017 | 3300046678 | Bacteria | 162507 |
| 245 | Ga0495623_0000028 | 3300046679 | Bacteria | 87634 |
| 246 | Ga0495646_0000015 | 3300046680 | Bacteria | 141718 |
| 247 | Ga0495624_0070657 | 3300046690 | Bacteria | 2173 |
| 248 | Ga0495600_0000058 | 3300046809 | Bacteria | 65689 |
| 249 | Ga0495581_0001732 | 3300047315 | Bacteria | 12161 |
| 250 | Ga0495604_0000021 | 3300047317 | Bacteria | 169432 |
| 251 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 252 | Ga0495680_0000503 | 3300047322 | Bacteria | 44080 |
| 253 | Ga0495675_0000085 | 3300047444 | Bacteria | 65846 |
| 254 | Ga0495684_0000001 | 3300047471 | Bacteria | 369809 |
| 255 | Ga0495593_0001873 | 3300047673 | Bacteria | 12527 |
| 256 | Ga0495602_0000003 | 3300048088 | Bacteria | 357240 |
| 257 | Ga0496102_0370096 | 3300048905 | Bacteria | 1349 |
| 258 | Ga0496106_0233848 | 3300048909 | Bacteria | 1468 |
| 259 | Ga0496110_0140347 | 3300048913 | Bacteria | 2185 |
| 260 | Ga0496112_0008399 | 3300048915 | Bacteria | 9249 |
| 261 | Ga0496116_0009549 | 3300048919 | Bacteria | 8261 |
| 262 | Ga0496116_0117828 | 3300048919 | Bacteria | 1544 |
| 263 | Ga0496118_0113767 | 3300048921 | Bacteria | 1786 |
| 264 | Ga0496119_0009046 | 3300048922 | Bacteria | 8632 |
| 265 | Ga0496119_0031911 | 3300048922 | Bacteria | 3520 |
| 266 | Ga0496120_0001687 | 3300048923 | Bacteria | 25349 |
| 267 | Ga0496120_0007399 | 3300048923 | Bacteria | 8176 |
| 268 | Ga0496120_0039794 | 3300048923 | Bacteria | 2770 |
| 269 | Ga0496121_0084884 | 3300048924 | Bacteria | 2494 |
| 270 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 271 | Ga0496122_0014530 | 3300048925 | Bacteria | 7601 |
| 272 | Ga0496122_0061698 | 3300048925 | Bacteria | 2749 |
| 273 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 274 | Ga0496124_0000206 | 3300048927 | Bacteria | 116591 |
| 275 | Ga0496124_0131601 | 3300048927 | Bacteria | 1987 |
| 276 | Ga0496124_0131800 | 3300048927 | Bacteria | 1985 |
| 277 | Ga0496126_0004064 | 3300048929 | Bacteria | 17751 |
| 278 | Ga0501031_0000108 | 3300049568 | Bacteria | 44121 |
| 279 | Ga0501031_0000220 | 3300049568 | Bacteria | 32658 |
| 280 | Ga0501031_0001228 | 3300049568 | Bacteria | 15703 |
| 281 | Ga0501031_0011891 | 3300049568 | Bacteria | 5674 |
| 282 | Ga0501031_0018777 | 3300049568 | Bacteria | 4502 |
| 283 | Ga0501031_0032347 | 3300049568 | Bacteria | 3410 |
| 284 | Ga0501032_0000022 | 3300049569 | Bacteria | 146790 |
| 285 | Ga0501032_0000031 | 3300049569 | Bacteria | 130204 |
| 286 | Ga0501033_0000037 | 3300049570 | Bacteria | 146582 |
| 287 | Ga0501033_0000763 | 3300049570 | Bacteria | 29600 |
| 288 | Ga0501033_0001161 | 3300049570 | Bacteria | 23830 |
| 289 | Ga0501033_0012044 | 3300049570 | Bacteria | 6603 |
| 290 | Ga0501033_0070246 | 3300049570 | Bacteria | 2573 |
| 291 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 292 | Ga0501034_0000269 | 3300049571 | Bacteria | 94144 |
| 293 | Ga0501034_0000302 | 3300049571 | Bacteria | 87888 |
| 294 | Ga0501034_0017525 | 3300049571 | Bacteria | 7346 |
| 295 | Ga0501034_0044693 | 3300049571 | Bacteria | 4478 |
| 296 | Ga0501036_0000013 | 3300049572 | Bacteria | 155326 |
| 297 | Ga0501036_0005240 | 3300049572 | Bacteria | 10490 |
| 298 | Ga0501036_0014732 | 3300049572 | Bacteria | 6521 |
| 299 | Ga0501036_0014748 | 3300049572 | Bacteria | 6517 |
| 300 | Ga0501036_0033890 | 3300049572 | Bacteria | 4319 |
| 301 | Ga0501036_0041544 | 3300049572 | Bacteria | 3890 |
| 302 | Ga0501036_0087408 | 3300049572 | Bacteria | 2635 |
| 303 | Ga0501036_0097160 | 3300049572 | Bacteria | 2490 |
| 304 | Ga0501037_0000016 | 3300049573 | Bacteria | 161027 |
| 305 | Ga0501037_0000132 | 3300049573 | Bacteria | 69775 |
| 306 | Ga0501037_0023829 | 3300049573 | Bacteria | 4526 |
| 307 | Ga0501037_0027918 | 3300049573 | Bacteria | 4170 |
| 308 | Ga0501038_0000015 | 3300049574 | Bacteria | 161983 |
| 309 | Ga0501038_0000055 | 3300049574 | Bacteria | 93761 |
| 310 | Ga0501038_0020136 | 3300049574 | Bacteria | 6003 |
| 311 | Ga0501038_0064922 | 3300049574 | Bacteria | 3112 |
| 312 | Ga0501038_0099895 | 3300049574 | Bacteria | 2418 |
| 313 | Ga0501038_0143485 | 3300049574 | Bacteria | 1951 |
| 314 | Ga0501038_0203813 | 3300049574 | Bacteria | 1586 |
| 315 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 316 | Ga0501039_0000045 | 3300049575 | Bacteria | 104513 |
| 317 | Ga0501039_0000503 | 3300049575 | Bacteria | 28338 |
| 318 | Ga0501039_0001875 | 3300049575 | Bacteria | 15542 |
| 319 | Ga0501039_0007918 | 3300049575 | Bacteria | 8097 |
| 320 | Ga0501039_0039043 | 3300049575 | Bacteria | 3667 |
| 321 | Ga0501039_0054009 | 3300049575 | Bacteria | 3110 |
| 322 | Ga0501039_0055204 | 3300049575 | Bacteria | 3075 |
| 323 | Ga0501039_0180005 | 3300049575 | Bacteria | 1663 |
| 324 | Ga0501040_0000694 | 3300049576 | Bacteria | 20757 |
| 325 | Ga0501040_0002047 | 3300049576 | Bacteria | 12981 |
| 326 | Ga0501040_0008017 | 3300049576 | Bacteria | 6860 |
| 327 | Ga0501040_0202135 | 3300049576 | Bacteria | 1411 |
| 328 | Ga0501040_0221184 | 3300049576 | Bacteria | 1347 |
| 329 | Ga0501041_0000010 | 3300049577 | Bacteria | 59427 |
| 330 | Ga0501041_0001027 | 3300049577 | Bacteria | 15260 |
| 331 | Ga0501041_0011454 | 3300049577 | Bacteria | 5242 |
| 332 | Ga0501041_0057562 | 3300049577 | Bacteria | 2377 |
| 333 | Ga0501041_0081698 | 3300049577 | Bacteria | 1990 |
| 334 | Ga0501042_0000074 | 3300049578 | Bacteria | 37119 |
| 335 | Ga0501042_0002854 | 3300049578 | Bacteria | 10711 |
| 336 | Ga0501042_0017882 | 3300049578 | Bacteria | 4898 |
| 337 | Ga0501042_0022515 | 3300049578 | Bacteria | 4402 |
| 338 | Ga0501042_0037875 | 3300049578 | Bacteria | 3423 |
| 339 | Ga0501042_0075894 | 3300049578 | Bacteria | 2405 |
| 340 | Ga0501042_0328716 | 3300049578 | Bacteria | 1105 |
| 341 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 342 | Ga0501043_0000388 | 3300049579 | Bacteria | 39664 |
| 343 | Ga0501043_0013030 | 3300049579 | Bacteria | 6500 |
| 344 | Ga0501043_0094561 | 3300049579 | Bacteria | 2349 |
| 345 | Ga0501043_0152995 | 3300049579 | Bacteria | 1805 |
| 346 | Ga0501046_0001425 | 3300049580 | Bacteria | 23008 |
| 347 | Ga0501046_0002776 | 3300049580 | Bacteria | 16297 |
| 348 | Ga0501046_0004035 | 3300049580 | Bacteria | 13397 |
| 349 | Ga0501046_0017760 | 3300049580 | Bacteria | 5934 |
| 350 | Ga0501046_0168353 | 3300049580 | Bacteria | 1645 |
| 351 | Ga0501046_0200897 | 3300049580 | Bacteria | 1483 |
| 352 | Ga0501046_0291218 | 3300049580 | Bacteria | 1194 |
| 353 | Ga0501046_0329402 | 3300049580 | Bacteria | 1111 |
| 354 | Ga0501047_0000157 | 3300049581 | Bacteria | 82600 |
| 355 | Ga0501047_0001528 | 3300049581 | Bacteria | 22604 |
| 356 | Ga0501047_0003989 | 3300049581 | Bacteria | 13869 |
| 357 | Ga0501047_0076477 | 3300049581 | Bacteria | 3221 |
| 358 | Ga0501047_0186428 | 3300049581 | Bacteria | 1940 |
| 359 | Ga0501048_0001631 | 3300049582 | Bacteria | 17077 |
| 360 | Ga0501048_0014467 | 3300049582 | Bacteria | 5842 |
| 361 | Ga0501048_0020719 | 3300049582 | Bacteria | 4820 |
| 362 | Ga0501067_0083758 | 3300049583 | Bacteria | 1769 |
| 363 | Ga0501068_0054184 | 3300049584 | Bacteria | 2429 |
| 364 | Ga0501068_0129887 | 3300049584 | Bacteria | 1575 |
| 365 | Ga0501068_0226754 | 3300049584 | Bacteria | 1188 |
| 366 | Ga0501069_0076809 | 3300049585 | Bacteria | 1878 |
| 367 | Ga0501070_0025811 | 3300049586 | Bacteria | 4929 |
| 368 | Ga0501070_0069484 | 3300049586 | Bacteria | 2916 |
| 369 | Ga0501070_0069539 | 3300049586 | Bacteria | 2915 |
| 370 | Ga0501070_0173629 | 3300049586 | Bacteria | 1775 |
| 371 | Ga0501070_0249781 | 3300049586 | Bacteria | 1451 |
| 372 | Ga0501071_0000002 | 3300049587 | Bacteria | 101947 |
| 373 | Ga0501071_0021035 | 3300049587 | Bacteria | 4542 |
| 374 | Ga0501071_0110667 | 3300049587 | Bacteria | 2030 |
| 375 | Ga0501071_0208424 | 3300049587 | Bacteria | 1469 |
| 376 | Ga0501072_0000552 | 3300049588 | Bacteria | 26934 |
| 377 | Ga0501072_0050712 | 3300049588 | Bacteria | 3268 |
| 378 | Ga0501072_0120993 | 3300049588 | Bacteria | 2085 |
| 379 | Ga0501072_0124529 | 3300049588 | Bacteria | 2053 |
| 380 | Ga0501072_0249052 | 3300049588 | Bacteria | 1415 |
| 381 | Ga0501074_0001117 | 3300049590 | Bacteria | 17526 |
| 382 | Ga0501074_0059926 | 3300049590 | Bacteria | 2742 |
| 383 | Ga0501074_0109723 | 3300049590 | Bacteria | 1974 |
| 384 | Ga0501074_0143412 | 3300049590 | Bacteria | 1708 |
| 385 | Ga0501074_0178739 | 3300049590 | Bacteria | 1514 |
| 386 | Ga0501075_0000438 | 3300049591 | Bacteria | 24580 |
| 387 | Ga0501075_0002105 | 3300049591 | Bacteria | 13168 |
| 388 | Ga0501075_0071450 | 3300049591 | Bacteria | 2623 |
| 389 | Ga0501075_0107371 | 3300049591 | Bacteria | 2122 |
| 390 | Ga0501075_0242812 | 3300049591 | Bacteria | 1373 |
| 391 | Ga0501075_0270091 | 3300049591 | Bacteria | 1296 |
| 392 | Ga0501076_0001978 | 3300049592 | Bacteria | 13998 |
| 393 | Ga0501076_0003443 | 3300049592 | Bacteria | 11097 |
| 394 | Ga0501076_0019551 | 3300049592 | Bacteria | 5178 |
| 395 | Ga0501076_0029963 | 3300049592 | Bacteria | 4236 |
| 396 | Ga0501076_0060798 | 3300049592 | Bacteria | 3006 |
| 397 | Ga0501076_0118373 | 3300049592 | Bacteria | 2144 |
| 398 | Ga0501076_0158502 | 3300049592 | Bacteria | 1843 |
| 399 | Ga0501076_0203272 | 3300049592 | Bacteria | 1618 |
| 400 | Ga0501076_0369717 | 3300049592 | Bacteria | 1178 |
| 401 | Ga0501077_0000579 | 3300049593 | Bacteria | 22191 |
| 402 | Ga0501077_0079777 | 3300049593 | Bacteria | 2074 |
| 403 | Ga0501077_0244915 | 3300049593 | Bacteria | 1139 |
| 404 | Ga0501079_0000559 | 3300049741 | Bacteria | 24405 |
| 405 | Ga0501079_0021956 | 3300049741 | Bacteria | 4889 |
| 406 | Ga0501079_0071671 | 3300049741 | Bacteria | 2677 |
| 407 | Ga0501080_0001834 | 3300049742 | Bacteria | 18215 |
| 408 | Ga0501080_0048146 | 3300049742 | Bacteria | 3968 |
| 409 | Ga0501080_0156703 | 3300049742 | Bacteria | 2103 |
| 410 | Ga0501081_0003100 | 3300049743 | Bacteria | 10557 |
| 411 | Ga0501081_0005987 | 3300049743 | Bacteria | 7872 |
| 412 | Ga0501081_0008804 | 3300049743 | Bacteria | 6559 |
| 413 | Ga0501081_0017358 | 3300049743 | Bacteria | 4763 |
| 414 | Ga0501081_0069589 | 3300049743 | Bacteria | 2452 |
| 415 | Ga0501081_0100003 | 3300049743 | Bacteria | 2049 |
| 416 | Ga0501081_0209033 | 3300049743 | Bacteria | 1417 |
| 417 | Ga0501083_0007292 | 3300049744 | Bacteria | 7841 |
| 418 | Ga0501035_0000046 | 3300049822 | Bacteria | 146599 |
| 419 | Ga0501035_0000287 | 3300049822 | Bacteria | 59891 |
| 420 | Ga0501035_0000306 | 3300049822 | Bacteria | 57505 |
| 421 | Ga0501035_0006656 | 3300049822 | Bacteria | 10807 |
| 422 | Ga0501035_0006898 | 3300049822 | Bacteria | 10608 |
| 423 | Ga0501035_0027158 | 3300049822 | Bacteria | 5234 |
| 424 | Ga0501035_0096734 | 3300049822 | Bacteria | 2594 |
| 425 | Ga0501035_0195149 | 3300049822 | Bacteria | 1739 |
| 426 | Ga0501035_0213948 | 3300049822 | Bacteria | 1648 |
| 427 | Ga0501044_0000038 | 3300049823 | Bacteria | 161027 |
| 428 | Ga0501044_0011903 | 3300049823 | Bacteria | 9427 |
| 429 | Ga0501044_0136312 | 3300049823 | Bacteria | 2446 |
| 430 | Ga0501044_0137013 | 3300049823 | Bacteria | 2439 |
| 431 | Ga0501044_0189941 | 3300049823 | Bacteria | 2017 |
| 432 | Ga0501044_0200939 | 3300049823 | Bacteria | 1951 |
| 433 | Ga0501044_0420207 | 3300049823 | Bacteria | 1247 |
| 434 | Ga0501045_0000471 | 3300049824 | Bacteria | 24988 |
| 435 | Ga0501045_0044858 | 3300049824 | Bacteria | 3220 |
| 436 | Ga0501045_0057555 | 3300049824 | Bacteria | 2844 |
| 437 | Ga0501045_0107355 | 3300049824 | Bacteria | 2069 |
| 438 | Ga0501045_0141128 | 3300049824 | Bacteria | 1791 |
| 439 | Ga0501045_0177201 | 3300049824 | Unclassified | 1588 |
| 440 | nmdc:mga03683_98740_c1 | 3300050489 | Bacteria | 1281 |
| 441 | nmdc:mga0yw44_136124_c1 | 3300050492 | Bacteria | 1594 |
| 442 | nmdc:mga0yw44_5882_c1 | 3300050492 | Bacteria | 5860 |
| 443 | nmdc:mga0yw44_6871_c1 | 3300050492 | Bacteria | 5540 |
| 444 | nmdc:mga0k408_45530_c1 | 3300050493 | Bacteria | 2531 |
| 445 | nmdc:mga04h51_55674_c1 | 3300050495 | Bacteria | 1340 |
| 446 | nmdc:mga05p37_18875_c1 | 3300050507 | Bacteria | 8336 |
| 447 | nmdc:mga05p37_29718_c1 | 3300050507 | Bacteria | 6668 |
| 448 | nmdc:mga05p37_318_c1 | 3300050507 | Bacteria | 51124 |
| 449 | nmdc:mga05p37_358455_c1 | 3300050507 | Bacteria | 1715 |
| 450 | nmdc:mga0qj67_64675_c1 | 3300050509 | Bacteria | 2910 |
| 451 | nmdc:mga06r32_176490_c1 | 3300050510 | Bacteria | 2121 |
| 452 | nmdc:mga06r32_91044_c1 | 3300050510 | Bacteria | 2980 |
| 453 | nmdc:mga08y16_16415_c1 | 3300050511 | Bacteria | 7785 |
| 454 | nmdc:mga08y16_264624_c1 | 3300050511 | Bacteria | 1775 |
| 455 | nmdc:mga0n895_178162_c1 | 3300050512 | Bacteria | 2157 |
| 456 | nmdc:mga0rr50_8055_c1 | 3300050513 | Bacteria | 6536 |
| 457 | nmdc:mga0a205_95769_c1 | 3300050515 | Bacteria | 2867 |
| 458 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 459 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 460 | Ga0500610_0058742 | 3300053079 | Bacteria | 2007 |
| 461 | Ga0495595_0000166 | 3300053084 | Bacteria | 25987 |
| 462 | Ga0495619_0000007 | 3300053085 | Bacteria | 369936 |
| 463 | Ga0500559_0090602 | 3300053136 | Bacteria | 1399 |
| 464 | Ga0500604_0024871 | 3300053151 | Bacteria | 1718 |
| 465 | Ga0500616_0004108 | 3300053153 | Bacteria | 10566 |
| 466 | Ga0500627_0065300 | 3300053158 | Bacteria | 1605 |
| 467 | Ga0501084_0000026 | 3300054114 | Bacteria | 132271 |
| 468 | Ga0501084_0013773 | 3300054114 | Bacteria | 6692 |
| 469 | Ga0501084_0018337 | 3300054114 | Bacteria | 5828 |
| 470 | Ga0501084_0024487 | 3300054114 | Bacteria | 5036 |
| 471 | Ga0501084_0036034 | 3300054114 | Bacteria | 4134 |
| 472 | Ga0501084_0064107 | 3300054114 | Bacteria | 3075 |
| 473 | Ga0501084_0096653 | 3300054114 | Bacteria | 2480 |
| 474 | Ga0501082_0000675 | 3300060353 | Bacteria | 30010 |
| 475 | Ga0501082_0087225 | 3300060353 | Bacteria | 2692 |
| 476 | Ga0501082_0138363 | 3300060353 | Bacteria | 2113 |
| 477 | Ga0501082_0166079 | 3300060353 | Bacteria | 1918 |
| 478 | Ga0530510_0000525 | 3300061734 | Bacteria | 24486 |
| 479 | Ga0530510_0001238 | 3300061734 | Bacteria | 17030 |
| 480 | Ga0530510_0053252 | 3300061734 | Bacteria | 2925 |
| 481 | Ga0530510_0073616 | 3300061734 | Bacteria | 2480 |
| 482 | Ga0530510_0093004 | 3300061734 | Bacteria | 2201 |
| 483 | Ga0530510_0149967 | 3300061734 | Bacteria | 1721 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2888337043 | 2888341007 | 261 |
| 2 | iso_pu_bacteria | 2878781027 | 2878786869 | 269 |
| 3 | 3300045051 | Ga0451576_0376490 | Ga0451576_0376490_56_1000 | 271 |
| 4 | 3300049578 | Ga0501042_0328716 | Ga0501042_0328716_121_1083 | 274 |
| 5 | iso_pu_bacteria | 2885334103 | 2885341251 | 274 |
| 6 | 3300049590 | Ga0501074_0143412 | Ga0501074_0143412_27_995 | 276 |
| 7 | iso_pu_bacteria | 8004727605 | 8004731591 | 277 |
| 8 | 3300050513 | nmdc:mga0rr50_8055_c1 | nmdc:mga0rr50_8055_c1_4563_5630 | 285 |
| 9 | 3300025939 | Ga0207665_10046375 | Ga0207665_100463752 | 289 |
| 10 | 3300061734 | Ga0530510_0149967 | Ga0530510_0149967_790_1707 | 291 |
| 11 | iso_pu_bacteria | 3004334049 | 3004339773 | 291 |
| 12 | 3300007076 | Ga0075435_100000577 | Ga0075435_10000057720 | 295 |
| 13 | iso_pu_bacteria | 2874102143 | 2874108124 | 296 |
| 14 | 3300046616 | Ga0495668_0098708 | Ga0495668_0098708_17_913 | 298 |
| 15 | 3300054114 | Ga0501084_0000026 | Ga0501084_0000026_83691_84686 | 298 |
| 16 | 3300031727 | Ga0316576_10000975 | Ga0316576_100009754 | 299 |
| 17 | 3300031733 | Ga0316577_10001094 | Ga0316577_1000109410 | 299 |
| 18 | 3300036401 | Ga0373937_0317528 | Ga0373937_0317528_489_1436 | 299 |
| 19 | 3300050512 | nmdc:mga0n895_178162_c1 | nmdc:mga0n895_178162_c1_804_1871 | 299 |
| 20 | 3300031595 | Ga0265313_10042643 | Ga0265313_100426432 | 302 |
| 21 | iso_pu_bacteria | 2871435913 | 2871439915 | 302 |
| 22 | iso_pu_bacteria | 2903513507 | 2903515046 | 302 |
| 23 | iso_pu_bacteria | 2922130491 | 2922137828 | 302 |
| 24 | 3300048919 | Ga0496116_0117828 | Ga0496116_0117828_205_1122 | 303 |
| 25 | 3300048919 | Ga0496116_0009549 | Ga0496116_0009549_1453_2403 | 304 |
| 26 | 3300048921 | Ga0496118_0113767 | Ga0496118_0113767_213_1163 | 304 |
| 27 | 3300048922 | Ga0496119_0009046 | Ga0496119_0009046_3717_4667 | 304 |
| 28 | 3300048923 | Ga0496120_0007399 | Ga0496120_0007399_1272_2222 | 304 |
| 29 | 3300048924 | Ga0496121_0084884 | Ga0496121_0084884_752_1702 | 304 |
| 30 | 3300048925 | Ga0496122_0014530 | Ga0496122_0014530_2675_3625 | 304 |
| 31 | 3300048929 | Ga0496126_0004064 | Ga0496126_0004064_6649_7599 | 304 |
| 32 | iso_pu_bacteria | 2721755693 | 2723601854 | 304 |
| 33 | iso_pu_bacteria | 2751185905 | 2753811825 | 304 |
| 34 | iso_pu_bacteria | 2802428803 | 2802439259 | 304 |
| 35 | iso_pu_bacteria | 2889276214 | 2889277929 | 304 |
| 36 | iso_pu_bacteria | 2904595352 | 2904597864 | 304 |
| 37 | iso_pu_bacteria | 2996706504 | 2996711476 | 304 |
| 38 | 3300013297 | Ga0157378_10317029 | Ga0157378_103170292 | 306 |
| 39 | 3300013306 | Ga0163162_10627519 | Ga0163162_106275191 | 306 |
| 40 | 3300037418 | Ga0395900_0054140 | Ga0395900_0054140_2993_3913 | 306 |
| 41 | 3300037466 | Ga0395898_0031042 | Ga0395898_0031042_1244_2164 | 306 |
| 42 | 3300037471 | Ga0395905_0550889 | Ga0395905_0550889_16_936 | 306 |
| 43 | 3300038443 | Ga0395901_0223331 | Ga0395901_0223331_879_1799 | 306 |
| 44 | 3300044901 | Ga0466960_0036087 | Ga0466960_0036087_838_1758 | 306 |
| 45 | 3300045051 | Ga0451576_0146542 | Ga0451576_0146542_873_1868 | 306 |
| 46 | 3300046515 | Ga0495620_0087605 | Ga0495620_0087605_67_987 | 306 |
| 47 | 3300046522 | Ga0495643_0019534 | Ga0495643_0019534_1045_1965 | 306 |
| 48 | 3300048905 | Ga0496102_0370096 | Ga0496102_0370096_402_1322 | 306 |
| 49 | 3300048925 | Ga0496122_0061698 | Ga0496122_0061698_714_1634 | 306 |
| 50 | 3300048927 | Ga0496124_0131601 | Ga0496124_0131601_644_1564 | 306 |
| 51 | 3300049572 | Ga0501036_0033890 | Ga0501036_0033890_156_1076 | 306 |
| 52 | 3300049574 | Ga0501038_0143485 | Ga0501038_0143485_289_1209 | 306 |
| 53 | 3300049575 | Ga0501039_0055204 | Ga0501039_0055204_1646_2566 | 306 |
| 54 | 3300049578 | Ga0501042_0017882 | Ga0501042_0017882_578_1498 | 306 |
| 55 | 3300049579 | Ga0501043_0094561 | Ga0501043_0094561_506_1426 | 306 |
| 56 | 3300049580 | Ga0501046_0168353 | Ga0501046_0168353_220_1140 | 306 |
| 57 | 3300049581 | Ga0501047_0076477 | Ga0501047_0076477_656_1576 | 306 |
| 58 | 3300049583 | Ga0501067_0083758 | Ga0501067_0083758_341_1261 | 306 |
| 59 | 3300049584 | Ga0501068_0054184 | Ga0501068_0054184_1221_2141 | 306 |
| 60 | 3300049587 | Ga0501071_0208424 | Ga0501071_0208424_324_1244 | 306 |
| 61 | 3300049823 | Ga0501044_0200939 | Ga0501044_0200939_289_1209 | 306 |
| 62 | 3300049823 | Ga0501044_0420207 | Ga0501044_0420207_85_1005 | 306 |
| 63 | 3300049824 | Ga0501045_0057555 | Ga0501045_0057555_492_1412 | 306 |
| 64 | 3300050492 | nmdc:mga0yw44_136124_c1 | nmdc:mga0yw44_136124_c1_601_1521 | 306 |
| 65 | 3300053079 | Ga0500610_0058742 | Ga0500610_0058742_29_949 | 306 |
| 66 | 3300053151 | Ga0500604_0024871 | Ga0500604_0024871_150_1070 | 306 |
| 67 | 3300053158 | Ga0500627_0065300 | Ga0500627_0065300_652_1572 | 306 |
| 68 | iso_pu_bacteria | 2876369609 | 2876370102 | 306 |
| 69 | iso_pu_bacteria | 8004395343 | 8004397195 | 306 |
| 70 | 3300005471 | Ga0070698_100140372 | Ga0070698_1001403722 | 308 |
| 71 | 3300049580 | Ga0501046_0329402 | Ga0501046_0329402_16_1080 | 308 |
| 72 | 3300006871 | Ga0075434_100020904 | Ga0075434_1000209043 | 309 |
| 73 | 3300049581 | Ga0501047_0186428 | Ga0501047_0186428_653_1717 | 309 |
| 74 | 3300049585 | Ga0501069_0076809 | Ga0501069_0076809_503_1516 | 309 |
| 75 | 3300049586 | Ga0501070_0249781 | Ga0501070_0249781_58_1071 | 309 |
| 76 | 3300005467 | Ga0070706_100193585 | Ga0070706_1001935852 | 310 |
| 77 | 3300005468 | Ga0070707_100032977 | Ga0070707_1000329773 | 310 |
| 78 | 3300005471 | Ga0070698_100048437 | Ga0070698_1000484374 | 310 |
| 79 | 3300005518 | Ga0070699_100042416 | Ga0070699_1000424163 | 310 |
| 80 | 3300009098 | Ga0105245_10041733 | Ga0105245_100417334 | 310 |
| 81 | 3300025927 | Ga0207687_10036370 | Ga0207687_100363702 | 310 |
| 82 | 3300049575 | Ga0501039_0180005 | Ga0501039_0180005_271_1341 | 310 |
| 83 | 3300049577 | Ga0501041_0081698 | Ga0501041_0081698_383_1453 | 310 |
| 84 | 3300049587 | Ga0501071_0110667 | Ga0501071_0110667_12_1082 | 310 |
| 85 | 3300049591 | Ga0501075_0071450 | Ga0501075_0071450_1491_2561 | 310 |
| 86 | 3300049593 | Ga0501077_0244915 | Ga0501077_0244915_27_1097 | 310 |
| 87 | 3300054114 | Ga0501084_0096653 | Ga0501084_0096653_76_1146 | 310 |
| 88 | 3300060353 | Ga0501082_0166079 | Ga0501082_0166079_471_1541 | 310 |
| 89 | 3300006173 | Ga0070716_100019012 | Ga0070716_1000190123 | 312 |
| 90 | 3300006871 | Ga0075434_100314766 | Ga0075434_1003147662 | 312 |
| 91 | 3300009094 | Ga0111539_10164656 | Ga0111539_101646562 | 312 |
| 92 | 3300028794 | Ga0307515_10000056 | Ga0307515_1000005696 | 312 |
| 93 | 3300042016 | Ga0439463_001336 | Ga0439463_001336_3181_4275 | 312 |
| 94 | iso_pu_bacteria | 3004289098 | 3004290510 | 312 |
| 95 | 3300005937 | Ga0081455_10012592 | Ga0081455_100125926 | 313 |
| 96 | 3300005981 | Ga0081538_10002703 | Ga0081538_1000270310 | 313 |
| 97 | 3300006847 | Ga0075431_100090019 | Ga0075431_1000900194 | 314 |
| 98 | 3300031711 | Ga0265314_10006793 | Ga0265314_100067932 | 314 |
| 99 | 3300042008 | Ga0439450_000521 | Ga0439450_000521_2331_3425 | 314 |
| 100 | 3300053153 | Ga0500616_0004108 | Ga0500616_0004108_6927_7922 | 314 |
| 101 | iso_pu_bacteria | 2643221551 | 2643775246 | 314 |
| 102 | iso_pu_bacteria | 2643221555 | 2643793692 | 314 |
| 103 | iso_pu_bacteria | 2958092219 | 2958093041 | 314 |
| 104 | 3300005471 | Ga0070698_100088332 | Ga0070698_1000883323 | 315 |
| 105 | 3300005564 | Ga0070664_100118887 | Ga0070664_1001188871 | 315 |
| 106 | 3300009094 | Ga0111539_10550105 | Ga0111539_105501052 | 315 |
| 107 | 3300025261 | Ga0209233_1011172 | Ga0209233_10111723 | 315 |
| 108 | 3300025945 | Ga0207679_10164765 | Ga0207679_101647651 | 315 |
| 109 | 3300035170 | Ga0373943_0080606 | Ga0373943_0080606_482_1477 | 315 |
| 110 | 3300046511 | Ga0495608_0001600 | Ga0495608_0001600_992_1978 | 315 |
| 111 | 3300046516 | Ga0495628_0079751 | Ga0495628_0079751_915_1901 | 315 |
| 112 | 3300046559 | Ga0495667_0001691 | Ga0495667_0001691_7440_8426 | 315 |
| 113 | 3300050511 | nmdc:mga08y16_264624_c1 | nmdc:mga08y16_264624_c1_217_1206 | 315 |
| 114 | iso_pu_bacteria | 2643221547 | 2643756299 | 315 |
| 115 | iso_pu_bacteria | 2987666974 | 2987667691 | 315 |
| 116 | iso_pu_bacteria | 8004445564 | 8004447454 | 315 |
| 117 | 3300005337 | Ga0070682_100003380 | Ga0070682_1000033809 | 316 |
| 118 | 3300005536 | Ga0070697_100289025 | Ga0070697_1002890252 | 316 |
| 119 | 3300005563 | Ga0068855_100065026 | Ga0068855_1000650262 | 316 |
| 120 | 3300005617 | Ga0068859_100460918 | Ga0068859_1004609182 | 316 |
| 121 | 3300006931 | Ga0097620_100460863 | Ga0097620_1004608632 | 316 |
| 122 | 3300031241 | Ga0265325_10060496 | Ga0265325_100604962 | 316 |
| 123 | 3300037471 | Ga0395905_0027828 | Ga0395905_0027828_2918_3910 | 316 |
| 124 | 3300042876 | Ga0451577_0001818 | Ga0451577_0001818_10688_11680 | 316 |
| 125 | 3300042876 | Ga0451577_0095980 | Ga0451577_0095980_25_1017 | 316 |
| 126 | 3300044712 | Ga0453684_0102182 | Ga0453684_0102182_2085_3077 | 316 |
| 127 | 3300049568 | Ga0501031_0000220 | Ga0501031_0000220_6945_7919 | 316 |
| 128 | 3300049568 | Ga0501031_0001228 | Ga0501031_0001228_11529_12503 | 316 |
| 129 | 3300049572 | Ga0501036_0005240 | Ga0501036_0005240_5187_6161 | 316 |
| 130 | 3300049572 | Ga0501036_0041544 | Ga0501036_0041544_2884_3858 | 316 |
| 131 | 3300049573 | Ga0501037_0023829 | Ga0501037_0023829_455_1429 | 316 |
| 132 | 3300049573 | Ga0501037_0027918 | Ga0501037_0027918_1497_2471 | 316 |
| 133 | 3300049574 | Ga0501038_0064922 | Ga0501038_0064922_1735_2709 | 316 |
| 134 | 3300049575 | Ga0501039_0000503 | Ga0501039_0000503_6820_7794 | 316 |
| 135 | 3300049575 | Ga0501039_0007918 | Ga0501039_0007918_2233_3207 | 316 |
| 136 | 3300049576 | Ga0501040_0202135 | Ga0501040_0202135_274_1248 | 316 |
| 137 | 3300049576 | Ga0501040_0221184 | Ga0501040_0221184_341_1315 | 316 |
| 138 | 3300049577 | Ga0501041_0001027 | Ga0501041_0001027_9062_10036 | 316 |
| 139 | 3300049577 | Ga0501041_0011454 | Ga0501041_0011454_166_1140 | 316 |
| 140 | 3300049578 | Ga0501042_0002854 | Ga0501042_0002854_2122_3096 | 316 |
| 141 | 3300049578 | Ga0501042_0037875 | Ga0501042_0037875_302_1276 | 316 |
| 142 | 3300049580 | Ga0501046_0001425 | Ga0501046_0001425_8205_9179 | 316 |
| 143 | 3300049580 | Ga0501046_0002776 | Ga0501046_0002776_11224_12198 | 316 |
| 144 | 3300049582 | Ga0501048_0001631 | Ga0501048_0001631_13327_14301 | 316 |
| 145 | 3300049588 | Ga0501072_0050712 | Ga0501072_0050712_1382_2356 | 316 |
| 146 | 3300049590 | Ga0501074_0059926 | Ga0501074_0059926_1117_2091 | 316 |
| 147 | 3300049591 | Ga0501075_0270091 | Ga0501075_0270091_157_1131 | 316 |
| 148 | 3300049592 | Ga0501076_0203272 | Ga0501076_0203272_227_1201 | 316 |
| 149 | 3300049822 | Ga0501035_0006898 | Ga0501035_0006898_5424_6398 | 316 |
| 150 | 3300049822 | Ga0501035_0213948 | Ga0501035_0213948_244_1218 | 316 |
| 151 | iso_pu_bacteria | 2970540015 | 2970540729 | 316 |
| 152 | iso_pu_bacteria | 8004361976 | 8004364198 | 316 |
| 153 | 3300005435 | Ga0070714_100000144 | Ga0070714_10000014458 | 317 |
| 154 | 3300005577 | Ga0068857_100304351 | Ga0068857_1003043512 | 317 |
| 155 | 3300005843 | Ga0068860_100017606 | Ga0068860_1000176064 | 317 |
| 156 | 3300006358 | Ga0068871_100064668 | Ga0068871_1000646682 | 317 |
| 157 | 3300013306 | Ga0163162_10000446 | Ga0163162_1000044628 | 317 |
| 158 | 3300025929 | Ga0207664_10000494 | Ga0207664_100004946 | 317 |
| 159 | 3300028381 | Ga0268264_10000558 | Ga0268264_100005584 | 317 |
| 160 | 3300042876 | Ga0451577_0001676 | Ga0451577_0001676_1251_2261 | 317 |
| 161 | 3300042876 | Ga0451577_0002212 | Ga0451577_0002212_8760_9755 | 317 |
| 162 | 3300042876 | Ga0451577_0028398 | Ga0451577_0028398_644_1639 | 317 |
| 163 | 3300044673 | Ga0453683_0001036 | Ga0453683_0001036_6170_7165 | 317 |
| 164 | 3300044673 | Ga0453683_0002536 | Ga0453683_0002536_5506_6501 | 317 |
| 165 | 3300044673 | Ga0453683_0010466 | Ga0453683_0010466_4318_5313 | 317 |
| 166 | 3300044673 | Ga0453683_0077158 | Ga0453683_0077158_53_1063 | 317 |
| 167 | 3300044673 | Ga0453683_0120393 | Ga0453683_0120393_357_1352 | 317 |
| 168 | 3300044673 | Ga0453683_0209860 | Ga0453683_0209860_184_1179 | 317 |
| 169 | 3300044712 | Ga0453684_0000066 | Ga0453684_0000066_455763_456758 | 317 |
| 170 | 3300044712 | Ga0453684_0001327 | Ga0453684_0001327_66923_67918 | 317 |
| 171 | 3300044712 | Ga0453684_0003490 | Ga0453684_0003490_23956_24951 | 317 |
| 172 | 3300044712 | Ga0453684_0016384 | Ga0453684_0016384_1274_2269 | 317 |
| 173 | 3300044712 | Ga0453684_0021711 | Ga0453684_0021711_6222_7217 | 317 |
| 174 | 3300044712 | Ga0453684_0037244 | Ga0453684_0037244_1079_2074 | 317 |
| 175 | 3300044712 | Ga0453684_0370119 | Ga0453684_0370119_368_1363 | 317 |
| 176 | 3300045051 | Ga0451576_0007592 | Ga0451576_0007592_10480_11490 | 317 |
| 177 | 3300045051 | Ga0451576_0169544 | Ga0451576_0169544_205_1200 | 317 |
| 178 | 3300045051 | Ga0451576_0401818 | Ga0451576_0401818_10_1005 | 317 |
| 179 | iso_pu_bacteria | 2888350351 | 2888357068 | 317 |
| 180 | iso_pu_bacteria | 2922185730 | 2922193029 | 317 |
| 181 | iso_pu_bacteria | 2977971508 | 2977979925 | 317 |
| 182 | iso_pu_bacteria | 3004248173 | 3004250978 | 317 |
| 183 | 3300004798 | Ga0058859_11785646 | Ga0058859_117856462 | 318 |
| 184 | 3300004801 | Ga0058860_11846802 | Ga0058860_118468021 | 318 |
| 185 | 3300005289 | Ga0065704_10114003 | Ga0065704_101140031 | 318 |
| 186 | 3300005328 | Ga0070676_10223955 | Ga0070676_102239552 | 318 |
| 187 | 3300005347 | Ga0070668_100149088 | Ga0070668_1001490882 | 318 |
| 188 | 3300005347 | Ga0070668_100173088 | Ga0070668_1001730882 | 318 |
| 189 | 3300005356 | Ga0070674_100061115 | Ga0070674_1000611151 | 318 |
| 190 | 3300005844 | Ga0068862_100026271 | Ga0068862_1000262713 | 318 |
| 191 | 3300005937 | Ga0081455_10000829 | Ga0081455_1000082928 | 318 |
| 192 | 3300005981 | Ga0081538_10002229 | Ga0081538_1000222912 | 318 |
| 193 | 3300006844 | Ga0075428_100042448 | Ga0075428_1000424485 | 318 |
| 194 | 3300006847 | Ga0075431_100108453 | Ga0075431_1001084533 | 318 |
| 195 | 3300006847 | Ga0075431_100273127 | Ga0075431_1002731272 | 318 |
| 196 | 3300007265 | Ga0099794_10103089 | Ga0099794_101030892 | 318 |
| 197 | 3300009094 | Ga0111539_10024445 | Ga0111539_100244452 | 318 |
| 198 | 3300009098 | Ga0105245_10202004 | Ga0105245_102020042 | 318 |
| 199 | 3300009147 | Ga0114129_10000977 | Ga0114129_1000097719 | 318 |
| 200 | 3300009147 | Ga0114129_10355517 | Ga0114129_103555172 | 318 |
| 201 | 3300009147 | Ga0114129_10448952 | Ga0114129_104489522 | 318 |
| 202 | 3300009174 | Ga0105241_10042991 | Ga0105241_100429915 | 318 |
| 203 | 3300010375 | Ga0105239_10159253 | Ga0105239_101592532 | 318 |
| 204 | 3300011119 | Ga0105246_10222363 | Ga0105246_102223631 | 318 |
| 205 | 3300013306 | Ga0163162_10463863 | Ga0163162_104638631 | 318 |
| 206 | 3300025972 | Ga0207668_10103788 | Ga0207668_101037882 | 318 |
| 207 | 3300026075 | Ga0207708_10161633 | Ga0207708_101616331 | 318 |
| 208 | 3300027907 | Ga0207428_10033649 | Ga0207428_100336492 | 318 |
| 209 | 3300027907 | Ga0207428_10165991 | Ga0207428_101659912 | 318 |
| 210 | 3300037418 | Ga0395900_0029285 | Ga0395900_0029285_2010_2966 | 318 |
| 211 | 3300037471 | Ga0395905_0001481 | Ga0395905_0001481_9993_10976 | 318 |
| 212 | 3300037471 | Ga0395905_0152442 | Ga0395905_0152442_113_1069 | 318 |
| 213 | 3300038443 | Ga0395901_0221571 | Ga0395901_0221571_43_999 | 318 |
| 214 | 3300044658 | Ga0466972_0053238 | Ga0466972_0053238_419_1375 | 318 |
| 215 | 3300048909 | Ga0496106_0233848 | Ga0496106_0233848_98_1192 | 318 |
| 216 | 3300048913 | Ga0496110_0140347 | Ga0496110_0140347_843_1799 | 318 |
| 217 | 3300048922 | Ga0496119_0031911 | Ga0496119_0031911_1336_2292 | 318 |
| 218 | 3300048923 | Ga0496120_0001687 | Ga0496120_0001687_16190_17146 | 318 |
| 219 | 3300048923 | Ga0496120_0039794 | Ga0496120_0039794_395_1351 | 318 |
| 220 | 3300049568 | Ga0501031_0032347 | Ga0501031_0032347_941_2035 | 318 |
| 221 | 3300049571 | Ga0501034_0000302 | Ga0501034_0000302_86448_87443 | 318 |
| 222 | 3300049572 | Ga0501036_0014748 | Ga0501036_0014748_1865_2959 | 318 |
| 223 | 3300049572 | Ga0501036_0097160 | Ga0501036_0097160_921_1916 | 318 |
| 224 | 3300049574 | Ga0501038_0020136 | Ga0501038_0020136_1301_2395 | 318 |
| 225 | 3300049574 | Ga0501038_0099895 | Ga0501038_0099895_467_1561 | 318 |
| 226 | 3300049574 | Ga0501038_0203813 | Ga0501038_0203813_132_1226 | 318 |
| 227 | 3300049575 | Ga0501039_0001875 | Ga0501039_0001875_8094_9188 | 318 |
| 228 | 3300049575 | Ga0501039_0039043 | Ga0501039_0039043_2479_3573 | 318 |
| 229 | 3300049575 | Ga0501039_0054009 | Ga0501039_0054009_931_2025 | 318 |
| 230 | 3300049576 | Ga0501040_0000694 | Ga0501040_0000694_16131_17225 | 318 |
| 231 | 3300049576 | Ga0501040_0008017 | Ga0501040_0008017_1886_2980 | 318 |
| 232 | 3300049577 | Ga0501041_0000010 | Ga0501041_0000010_7806_8900 | 318 |
| 233 | 3300049577 | Ga0501041_0057562 | Ga0501041_0057562_964_2058 | 318 |
| 234 | 3300049578 | Ga0501042_0000074 | Ga0501042_0000074_32876_33970 | 318 |
| 235 | 3300049578 | Ga0501042_0022515 | Ga0501042_0022515_1284_2378 | 318 |
| 236 | 3300049578 | Ga0501042_0075894 | Ga0501042_0075894_18_1112 | 318 |
| 237 | 3300049579 | Ga0501043_0013030 | Ga0501043_0013030_185_1279 | 318 |
| 238 | 3300049580 | Ga0501046_0004035 | Ga0501046_0004035_7992_9086 | 318 |
| 239 | 3300049580 | Ga0501046_0291218 | Ga0501046_0291218_71_1165 | 318 |
| 240 | 3300049582 | Ga0501048_0014467 | Ga0501048_0014467_4293_5387 | 318 |
| 241 | 3300049582 | Ga0501048_0020719 | Ga0501048_0020719_543_1637 | 318 |
| 242 | 3300049584 | Ga0501068_0129887 | Ga0501068_0129887_208_1302 | 318 |
| 243 | 3300049584 | Ga0501068_0226754 | Ga0501068_0226754_70_1164 | 318 |
| 244 | 3300049586 | Ga0501070_0069484 | Ga0501070_0069484_413_1507 | 318 |
| 245 | 3300049586 | Ga0501070_0069539 | Ga0501070_0069539_1538_2494 | 318 |
| 246 | 3300049586 | Ga0501070_0173629 | Ga0501070_0173629_104_1198 | 318 |
| 247 | 3300049587 | Ga0501071_0000002 | Ga0501071_0000002_99444_100538 | 318 |
| 248 | 3300049587 | Ga0501071_0021035 | Ga0501071_0021035_687_1781 | 318 |
| 249 | 3300049588 | Ga0501072_0000552 | Ga0501072_0000552_19463_20557 | 318 |
| 250 | 3300049588 | Ga0501072_0120993 | Ga0501072_0120993_745_1839 | 318 |
| 251 | 3300049588 | Ga0501072_0124529 | Ga0501072_0124529_917_2011 | 318 |
| 252 | 3300049588 | Ga0501072_0249052 | Ga0501072_0249052_221_1315 | 318 |
| 253 | 3300049590 | Ga0501074_0001117 | Ga0501074_0001117_14462_15556 | 318 |
| 254 | 3300049590 | Ga0501074_0109723 | Ga0501074_0109723_271_1365 | 318 |
| 255 | 3300049590 | Ga0501074_0178739 | Ga0501074_0178739_337_1431 | 318 |
| 256 | 3300049591 | Ga0501075_0000438 | Ga0501075_0000438_3457_4551 | 318 |
| 257 | 3300049591 | Ga0501075_0002105 | Ga0501075_0002105_12063_13157 | 318 |
| 258 | 3300049591 | Ga0501075_0107371 | Ga0501075_0107371_61_1155 | 318 |
| 259 | 3300049591 | Ga0501075_0242812 | Ga0501075_0242812_123_1217 | 318 |
| 260 | 3300049592 | Ga0501076_0001978 | Ga0501076_0001978_11603_12697 | 318 |
| 261 | 3300049592 | Ga0501076_0003443 | Ga0501076_0003443_5173_6267 | 318 |
| 262 | 3300049592 | Ga0501076_0019551 | Ga0501076_0019551_3832_4926 | 318 |
| 263 | 3300049592 | Ga0501076_0029963 | Ga0501076_0029963_2766_3860 | 318 |
| 264 | 3300049592 | Ga0501076_0118373 | Ga0501076_0118373_25_1119 | 318 |
| 265 | 3300049592 | Ga0501076_0158502 | Ga0501076_0158502_271_1365 | 318 |
| 266 | 3300049592 | Ga0501076_0369717 | Ga0501076_0369717_19_1113 | 318 |
| 267 | 3300049593 | Ga0501077_0000579 | Ga0501077_0000579_17746_18840 | 318 |
| 268 | 3300049741 | Ga0501079_0000559 | Ga0501079_0000559_15203_16297 | 318 |
| 269 | 3300049741 | Ga0501079_0021956 | Ga0501079_0021956_2993_4087 | 318 |
| 270 | 3300049741 | Ga0501079_0071671 | Ga0501079_0071671_651_1745 | 318 |
| 271 | 3300049742 | Ga0501080_0001834 | Ga0501080_0001834_13046_14140 | 318 |
| 272 | 3300049743 | Ga0501081_0003100 | Ga0501081_0003100_8395_9489 | 318 |
| 273 | 3300049743 | Ga0501081_0005987 | Ga0501081_0005987_697_1791 | 318 |
| 274 | 3300049743 | Ga0501081_0017358 | Ga0501081_0017358_1836_2930 | 318 |
| 275 | 3300049743 | Ga0501081_0069589 | Ga0501081_0069589_1188_2282 | 318 |
| 276 | 3300049743 | Ga0501081_0100003 | Ga0501081_0100003_176_1270 | 318 |
| 277 | 3300049743 | Ga0501081_0209033 | Ga0501081_0209033_233_1327 | 318 |
| 278 | 3300049744 | Ga0501083_0007292 | Ga0501083_0007292_1609_2703 | 318 |
| 279 | 3300049822 | Ga0501035_0006656 | Ga0501035_0006656_6198_7292 | 318 |
| 280 | 3300049822 | Ga0501035_0195149 | Ga0501035_0195149_32_1126 | 318 |
| 281 | 3300049823 | Ga0501044_0137013 | Ga0501044_0137013_365_1459 | 318 |
| 282 | 3300049824 | Ga0501045_0000471 | Ga0501045_0000471_16059_17153 | 318 |
| 283 | 3300049824 | Ga0501045_0044858 | Ga0501045_0044858_78_1172 | 318 |
| 284 | 3300049824 | Ga0501045_0107355 | Ga0501045_0107355_938_2032 | 318 |
| 285 | 3300049824 | Ga0501045_0141128 | Ga0501045_0141128_209_1303 | 318 |
| 286 | 3300049824 | Ga0501045_0177201 | Ga0501045_0177201_83_1177 | 318 |
| 287 | 3300050489 | nmdc:mga03683_98740_c1 | nmdc:mga03683_98740_c1_285_1241 | 318 |
| 288 | 3300050492 | nmdc:mga0yw44_5882_c1 | nmdc:mga0yw44_5882_c1_1187_2143 | 318 |
| 289 | 3300050493 | nmdc:mga0k408_45530_c1 | nmdc:mga0k408_45530_c1_663_1619 | 318 |
| 290 | 3300050495 | nmdc:mga04h51_55674_c1 | nmdc:mga04h51_55674_c1_280_1236 | 318 |
| 291 | 3300050507 | nmdc:mga05p37_18875_c1 | nmdc:mga05p37_18875_c1_6503_7597 | 318 |
| 292 | 3300050507 | nmdc:mga05p37_29718_c1 | nmdc:mga05p37_29718_c1_425_1519 | 318 |
| 293 | 3300050507 | nmdc:mga05p37_318_c1 | nmdc:mga05p37_318_c1_15573_16667 | 318 |
| 294 | 3300050509 | nmdc:mga0qj67_64675_c1 | nmdc:mga0qj67_64675_c1_1636_2730 | 318 |
| 295 | 3300050510 | nmdc:mga06r32_176490_c1 | nmdc:mga06r32_176490_c1_702_1796 | 318 |
| 296 | 3300050510 | nmdc:mga06r32_91044_c1 | nmdc:mga06r32_91044_c1_938_2032 | 318 |
| 297 | 3300050511 | nmdc:mga08y16_16415_c1 | nmdc:mga08y16_16415_c1_2016_3110 | 318 |
| 298 | 3300050515 | nmdc:mga0a205_95769_c1 | nmdc:mga0a205_95769_c1_1667_2761 | 318 |
| 299 | 3300054114 | Ga0501084_0013773 | Ga0501084_0013773_455_1549 | 318 |
| 300 | 3300054114 | Ga0501084_0018337 | Ga0501084_0018337_1971_3065 | 318 |
| 301 | 3300054114 | Ga0501084_0024487 | Ga0501084_0024487_480_1574 | 318 |
| 302 | 3300054114 | Ga0501084_0064107 | Ga0501084_0064107_835_1929 | 318 |
| 303 | 3300060353 | Ga0501082_0000675 | Ga0501082_0000675_15203_16297 | 318 |
| 304 | 3300060353 | Ga0501082_0138363 | Ga0501082_0138363_69_1163 | 318 |
| 305 | 3300061734 | Ga0530510_0000525 | Ga0530510_0000525_12090_13184 | 318 |
| 306 | 3300061734 | Ga0530510_0001238 | Ga0530510_0001238_14867_15961 | 318 |
| 307 | 3300061734 | Ga0530510_0073616 | Ga0530510_0073616_474_1568 | 318 |
| 308 | 3300061734 | Ga0530510_0093004 | Ga0530510_0093004_499_1593 | 318 |
| 309 | 3300005295 | Ga0065707_10130544 | Ga0065707_101305442 | 319 |
| 310 | 3300005467 | Ga0070706_100212818 | Ga0070706_1002128182 | 319 |
| 311 | 3300006175 | Ga0070712_100003421 | Ga0070712_10000342112 | 319 |
| 312 | 3300026088 | Ga0207641_10010425 | Ga0207641_100104253 | 319 |
| 313 | 3300031824 | Ga0307413_10095618 | Ga0307413_100956182 | 319 |
| 314 | 3300032002 | Ga0307416_100114071 | Ga0307416_1001140712 | 319 |
| 315 | 3300049580 | Ga0501046_0017760 | Ga0501046_0017760_3846_4871 | 319 |
| 316 | 3300049581 | Ga0501047_0000157 | Ga0501047_0000157_25938_26963 | 319 |
| 317 | iso_pu_bacteria | 2503198000 | 2503202963 | 319 |
| 318 | iso_pu_bacteria | 2508501123 | 2509115316 | 319 |
| 319 | iso_pu_bacteria | 2508501127 | 2509144319 | 319 |
| 320 | iso_pu_bacteria | 2509276018 | 2509372455 | 319 |
| 321 | iso_pu_bacteria | 2509276022 | 2509397440 | 319 |
| 322 | iso_pu_bacteria | 2510065059 | 2510319480 | 319 |
| 323 | iso_pu_bacteria | 2511231027 | 2511392524 | 319 |
| 324 | iso_pu_bacteria | 2512875016 | 2512930215 | 319 |
| 325 | iso_pu_bacteria | 2512875024 | 2512957934 | 319 |
| 326 | iso_pu_bacteria | 2513237090 | 2513611703 | 319 |
| 327 | iso_pu_bacteria | 2513237164 | 2514032897 | 319 |
| 328 | iso_pu_bacteria | 2513237305 | 2514418788 | 319 |
| 329 | iso_pu_bacteria | 2513237351 | 2514588841 | 319 |
| 330 | iso_pu_bacteria | 2534681786 | 2535484516 | 319 |
| 331 | iso_pu_bacteria | 2588253730 | 2588515851 | 319 |
| 332 | iso_pu_bacteria | 2597489875 | 2597814420 | 319 |
| 333 | iso_pu_bacteria | 2599185301 | 2599937479 | 319 |
| 334 | iso_pu_bacteria | 2643221550 | 2643773160 | 319 |
| 335 | iso_pu_bacteria | 2643221564 | 2643839884 | 319 |
| 336 | iso_pu_bacteria | 2643221595 | 2643986809 | 319 |
| 337 | iso_pu_bacteria | 2643221623 | 2644130169 | 319 |
| 338 | iso_pu_bacteria | 2643221627 | 2644157654 | 319 |
| 339 | iso_pu_bacteria | 2643221653 | 2644296739 | 319 |
| 340 | iso_pu_bacteria | 2643221719 | 2644654993 | 319 |
| 341 | iso_pu_bacteria | 2687453392 | 2688599844 | 319 |
| 342 | iso_pu_bacteria | 2693429783 | 2694633885 | 319 |
| 343 | iso_pu_bacteria | 2693429784 | 2694637710 | 319 |
| 344 | iso_pu_bacteria | 2721755686 | 2723576597 | 319 |
| 345 | iso_pu_bacteria | 2738543024 | 2739308793 | 319 |
| 346 | iso_pu_bacteria | 2751185800 | 2753359077 | 319 |
| 347 | iso_pu_bacteria | 2756170246 | 2756675590 | 319 |
| 348 | iso_pu_bacteria | 2757320392 | 2757571672 | 319 |
| 349 | iso_pu_bacteria | 2758568016 | 2758641316 | 319 |
| 350 | iso_pu_bacteria | 2765235802 | 2765465331 | 319 |
| 351 | iso_pu_bacteria | 2767802442 | 2770197801 | 319 |
| 352 | iso_pu_bacteria | 2775506902 | 2776271834 | 319 |
| 353 | iso_pu_bacteria | 2775506904 | 2776279651 | 319 |
| 354 | iso_pu_bacteria | 2791355123 | 2792745874 | 319 |
| 355 | iso_pu_bacteria | 2818991272 | 2819242439 | 319 |
| 356 | iso_pu_bacteria | 2818991461 | 2819684014 | 319 |
| 357 | iso_pu_bacteria | 2837651117 | 2837652706 | 319 |
| 358 | iso_pu_bacteria | 2839993093 | 2839995774 | 319 |
| 359 | iso_pu_bacteria | 2840764183 | 2840769805 | 319 |
| 360 | iso_pu_bacteria | 2841734538 | 2841740778 | 319 |
| 361 | iso_pu_bacteria | 2842871566 | 2842874390 | 319 |
| 362 | iso_pu_bacteria | 2844002411 | 2844006089 | 319 |
| 363 | iso_pu_bacteria | 2844009547 | 2844015105 | 319 |
| 364 | iso_pu_bacteria | 2847670302 | 2847671026 | 319 |
| 365 | iso_pu_bacteria | 2847686936 | 2847687191 | 319 |
| 366 | iso_pu_bacteria | 2854911287 | 2854914613 | 319 |
| 367 | iso_pu_bacteria | 2856314179 | 2856316521 | 319 |
| 368 | iso_pu_bacteria | 2856320880 | 2856324703 | 319 |
| 369 | iso_pu_bacteria | 2856328259 | 2856333096 | 319 |
| 370 | iso_pu_bacteria | 2856334872 | 2856337655 | 319 |
| 371 | iso_pu_bacteria | 2856342000 | 2856342629 | 319 |
| 372 | iso_pu_bacteria | 2856364286 | 2856371093 | 319 |
| 373 | iso_pu_bacteria | 2857349434 | 2857355442 | 319 |
| 374 | iso_pu_bacteria | 2857367948 | 2857369366 | 319 |
| 375 | iso_pu_bacteria | 2869162929 | 2869165547 | 319 |
| 376 | iso_pu_bacteria | 2869169390 | 2869174678 | 319 |
| 377 | iso_pu_bacteria | 2869234852 | 2869238370 | 319 |
| 378 | iso_pu_bacteria | 2869242130 | 2869247307 | 319 |
| 379 | iso_pu_bacteria | 2869249662 | 2869251341 | 319 |
| 380 | iso_pu_bacteria | 2869256925 | 2869259928 | 319 |
| 381 | iso_pu_bacteria | 2869264136 | 2869269242 | 319 |
| 382 | iso_pu_bacteria | 2869271264 | 2869277033 | 319 |
| 383 | iso_pu_bacteria | 2869278585 | 2869281302 | 319 |
| 384 | iso_pu_bacteria | 2869285874 | 2869292014 | 319 |
| 385 | iso_pu_bacteria | 2871429161 | 2871435221 | 319 |
| 386 | iso_pu_bacteria | 2871444079 | 2871451294 | 319 |
| 387 | iso_pu_bacteria | 2871451962 | 2871458334 | 319 |
| 388 | iso_pu_bacteria | 2871459585 | 2871460878 | 319 |
| 389 | iso_pu_bacteria | 2871466892 | 2871472150 | 319 |
| 390 | iso_pu_bacteria | 2871474448 | 2871479832 | 319 |
| 391 | iso_pu_bacteria | 2871481445 | 2871482261 | 319 |
| 392 | iso_pu_bacteria | 2871488783 | 2871488934 | 319 |
| 393 | iso_pu_bacteria | 2871495908 | 2871496100 | 319 |
| 394 | iso_pu_bacteria | 2874109183 | 2874110097 | 319 |
| 395 | iso_pu_bacteria | 2874116593 | 2874123424 | 319 |
| 396 | iso_pu_bacteria | 2874123672 | 2874126187 | 319 |
| 397 | iso_pu_bacteria | 2874131515 | 2874133164 | 319 |
| 398 | iso_pu_bacteria | 2874139085 | 2874141032 | 319 |
| 399 | iso_pu_bacteria | 2874146452 | 2874151145 | 319 |
| 400 | iso_pu_bacteria | 2874155637 | 2874161172 | 319 |
| 401 | iso_pu_bacteria | 2874162495 | 2874167805 | 319 |
| 402 | iso_pu_bacteria | 2874168670 | 2874170287 | 319 |
| 403 | iso_pu_bacteria | 2876363079 | 2876366220 | 319 |
| 404 | iso_pu_bacteria | 2876386047 | 2876386266 | 319 |
| 405 | iso_pu_bacteria | 2876392853 | 2876395399 | 319 |
| 406 | iso_pu_bacteria | 2876399893 | 2876403497 | 319 |
| 407 | iso_pu_bacteria | 2876406927 | 2876407438 | 319 |
| 408 | iso_pu_bacteria | 2876413966 | 2876417165 | 319 |
| 409 | iso_pu_bacteria | 2876420981 | 2876421309 | 319 |
| 410 | iso_pu_bacteria | 2878035449 | 2878036855 | 319 |
| 411 | iso_pu_bacteria | 2878730984 | 2878736137 | 319 |
| 412 | iso_pu_bacteria | 2878738818 | 2878742812 | 319 |
| 413 | iso_pu_bacteria | 2878745973 | 2878752356 | 319 |
| 414 | iso_pu_bacteria | 2878753008 | 2878753696 | 319 |
| 415 | iso_pu_bacteria | 2878760144 | 2878760333 | 319 |
| 416 | iso_pu_bacteria | 2878767105 | 2878767293 | 319 |
| 417 | iso_pu_bacteria | 2878774303 | 2878779868 | 319 |
| 418 | iso_pu_bacteria | 2878788777 | 2878796589 | 319 |
| 419 | iso_pu_bacteria | 2881147464 | 2881152424 | 319 |
| 420 | iso_pu_bacteria | 2881155292 | 2881156556 | 319 |
| 421 | iso_pu_bacteria | 2881161766 | 2881161935 | 319 |
| 422 | iso_pu_bacteria | 2881845957 | 2881846161 | 319 |
| 423 | iso_pu_bacteria | 2881861095 | 2881864102 | 319 |
| 424 | iso_pu_bacteria | 2882632389 | 2882633615 | 319 |
| 425 | iso_pu_bacteria | 2882912400 | 2882918545 | 319 |
| 426 | iso_pu_bacteria | 2885305155 | 2885310816 | 319 |
| 427 | iso_pu_bacteria | 2885312484 | 2885316716 | 319 |
| 428 | iso_pu_bacteria | 2885326080 | 2885329084 | 319 |
| 429 | iso_pu_bacteria | 2885342637 | 2885347807 | 319 |
| 430 | iso_pu_bacteria | 2885350715 | 2885355540 | 319 |
| 431 | iso_pu_bacteria | 2888343758 | 2888348203 | 319 |
| 432 | iso_pu_bacteria | 2889010040 | 2889012083 | 319 |
| 433 | iso_pu_bacteria | 2889016732 | 2889022988 | 319 |
| 434 | iso_pu_bacteria | 2889790730 | 2889793951 | 319 |
| 435 | iso_pu_bacteria | 2894652903 | 2894654762 | 319 |
| 436 | iso_pu_bacteria | 2903448605 | 2903452424 | 319 |
| 437 | iso_pu_bacteria | 2903492973 | 2903495593 | 319 |
| 438 | iso_pu_bacteria | 2903492973 | 2903505471 | 319 |
| 439 | iso_pu_bacteria | 2903521522 | 2903524088 | 319 |
| 440 | iso_pu_bacteria | 2903528002 | 2903533729 | 319 |
| 441 | iso_pu_bacteria | 2903540706 | 2903540895 | 319 |
| 442 | iso_pu_bacteria | 2904578770 | 2904581499 | 319 |
| 443 | iso_pu_bacteria | 2904659560 | 2904662029 | 319 |
| 444 | iso_pu_bacteria | 2906308376 | 2906314750 | 319 |
| 445 | iso_pu_bacteria | 2906321335 | 2906327922 | 319 |
| 446 | iso_pu_bacteria | 2906328253 | 2906332796 | 319 |
| 447 | iso_pu_bacteria | 2906363423 | 2906369784 | 319 |
| 448 | iso_pu_bacteria | 2906370794 | 2906372719 | 319 |
| 449 | iso_pu_bacteria | 2906378014 | 2906386378 | 319 |
| 450 | iso_pu_bacteria | 2906386501 | 2906387843 | 319 |
| 451 | iso_pu_bacteria | 2906393657 | 2906393975 | 319 |
| 452 | iso_pu_bacteria | 2906401398 | 2906405873 | 319 |
| 453 | iso_pu_bacteria | 2906408224 | 2906409522 | 319 |
| 454 | iso_pu_bacteria | 2906414383 | 2906416658 | 319 |
| 455 | iso_pu_bacteria | 2906427513 | 2906428122 | 319 |
| 456 | iso_pu_bacteria | 2915650412 | 2915651589 | 319 |
| 457 | iso_pu_bacteria | 2919119836 | 2919122733 | 319 |
| 458 | iso_pu_bacteria | 2922151315 | 2922153835 | 319 |
| 459 | iso_pu_bacteria | 2922158528 | 2922159132 | 319 |
| 460 | iso_pu_bacteria | 2922172374 | 2922175927 | 319 |
| 461 | iso_pu_bacteria | 2922178524 | 2922181462 | 319 |
| 462 | iso_pu_bacteria | 2924726620 | 2924729968 | 319 |
| 463 | iso_pu_bacteria | 2924733363 | 2924735088 | 319 |
| 464 | iso_pu_bacteria | 2924741084 | 2924743371 | 319 |
| 465 | iso_pu_bacteria | 2924748358 | 2924752074 | 319 |
| 466 | iso_pu_bacteria | 2924754689 | 2924758359 | 319 |
| 467 | iso_pu_bacteria | 2924762789 | 2924763482 | 319 |
| 468 | iso_pu_bacteria | 2924776078 | 2924780612 | 319 |
| 469 | iso_pu_bacteria | 2924784321 | 2924789985 | 319 |
| 470 | iso_pu_bacteria | 2928521798 | 2928524572 | 319 |
| 471 | iso_pu_bacteria | 2937813078 | 2937821077 | 319 |
| 472 | iso_pu_bacteria | 2937822353 | 2937823629 | 319 |
| 473 | iso_pu_bacteria | 2937836603 | 2937836949 | 319 |
| 474 | iso_pu_bacteria | 2937843397 | 2937845451 | 319 |
| 475 | iso_pu_bacteria | 2937848649 | 2937854417 | 319 |
| 476 | iso_pu_bacteria | 2937861824 | 2937868839 | 319 |
| 477 | iso_pu_bacteria | 2937868953 | 2937870889 | 319 |
| 478 | iso_pu_bacteria | 2937877337 | 2937879886 | 319 |
| 479 | iso_pu_bacteria | 2937891427 | 2937896685 | 319 |
| 480 | iso_pu_bacteria | 2937972304 | 2937974518 | 319 |
| 481 | iso_pu_bacteria | 2937980651 | 2937985970 | 319 |
| 482 | iso_pu_bacteria | 2937994558 | 2937994750 | 319 |
| 483 | iso_pu_bacteria | 2954011201 | 2954015234 | 319 |
| 484 | iso_pu_bacteria | 2958034702 | 2958037264 | 319 |
| 485 | iso_pu_bacteria | 2958041894 | 2958046976 | 319 |
| 486 | iso_pu_bacteria | 2958064165 | 2958067489 | 319 |
| 487 | iso_pu_bacteria | 2958071322 | 2958076776 | 319 |
| 488 | iso_pu_bacteria | 2958084443 | 2958087064 | 319 |
| 489 | iso_pu_bacteria | 2958100919 | 2958107975 | 319 |
| 490 | iso_pu_bacteria | 2958108152 | 2958111197 | 319 |
| 491 | iso_pu_bacteria | 2958115193 | 2958117827 | 319 |
| 492 | iso_pu_bacteria | 2958122699 | 2958127689 | 319 |
| 493 | iso_pu_bacteria | 2958130278 | 2958136414 | 319 |
| 494 | iso_pu_bacteria | 2958137437 | 2958141523 | 319 |
| 495 | iso_pu_bacteria | 2958158011 | 2958164551 | 319 |
| 496 | iso_pu_bacteria | 2958165035 | 2958165228 | 319 |
| 497 | iso_pu_bacteria | 2958172287 | 2958173310 | 319 |
| 498 | iso_pu_bacteria | 2958179912 | 2958185881 | 319 |
| 499 | iso_pu_bacteria | 2961077736 | 2961084362 | 319 |
| 500 | iso_pu_bacteria | 2961114664 | 2961117183 | 319 |
| 501 | iso_pu_bacteria | 2961127735 | 2961133165 | 319 |
| 502 | iso_pu_bacteria | 2961163497 | 2961163689 | 319 |
| 503 | iso_pu_bacteria | 2961170736 | 2961170884 | 319 |
| 504 | iso_pu_bacteria | 2961183825 | 2961188600 | 319 |
| 505 | iso_pu_bacteria | 2963644680 | 2963649016 | 319 |
| 506 | iso_pu_bacteria | 2965018300 | 2965018491 | 319 |
| 507 | iso_pu_bacteria | 2965025482 | 2965030369 | 319 |
| 508 | iso_pu_bacteria | 2965032056 | 2965034161 | 319 |
| 509 | iso_pu_bacteria | 2965047637 | 2965051644 | 319 |
| 510 | iso_pu_bacteria | 2965062239 | 2965063943 | 319 |
| 511 | iso_pu_bacteria | 2965110997 | 2965115245 | 319 |
| 512 | iso_pu_bacteria | 2965119406 | 2965126311 | 319 |
| 513 | iso_pu_bacteria | 2967996073 | 2968003463 | 319 |
| 514 | iso_pu_bacteria | 2968003550 | 2968004230 | 319 |
| 515 | iso_pu_bacteria | 2968016561 | 2968019917 | 319 |
| 516 | iso_pu_bacteria | 2968083720 | 2968084204 | 319 |
| 517 | iso_pu_bacteria | 2968091066 | 2968096841 | 319 |
| 518 | iso_pu_bacteria | 2968097103 | 2968100118 | 319 |
| 519 | iso_pu_bacteria | 2968110612 | 2968113091 | 319 |
| 520 | iso_pu_bacteria | 2968117919 | 2968123743 | 319 |
| 521 | iso_pu_bacteria | 2968128360 | 2968133005 | 319 |
| 522 | iso_pu_bacteria | 2968138860 | 2968140101 | 319 |
| 523 | iso_pu_bacteria | 2968171901 | 2968172091 | 319 |
| 524 | iso_pu_bacteria | 2970469710 | 2970473238 | 319 |
| 525 | iso_pu_bacteria | 2970489779 | 2970495368 | 319 |
| 526 | iso_pu_bacteria | 2970503327 | 2970503474 | 319 |
| 527 | iso_pu_bacteria | 2970510686 | 2970516193 | 319 |
| 528 | iso_pu_bacteria | 2970524798 | 2970531458 | 319 |
| 529 | iso_pu_bacteria | 2970547951 | 2970549105 | 319 |
| 530 | iso_pu_bacteria | 2970554993 | 2970555183 | 319 |
| 531 | iso_pu_bacteria | 2970593180 | 2970595906 | 319 |
| 532 | iso_pu_bacteria | 2970619444 | 2970622016 | 319 |
| 533 | iso_pu_bacteria | 2970627176 | 2970628923 | 319 |
| 534 | iso_pu_bacteria | 2977821940 | 2977822911 | 319 |
| 535 | iso_pu_bacteria | 2977828996 | 2977835522 | 319 |
| 536 | iso_pu_bacteria | 2977843712 | 2977849721 | 319 |
| 537 | iso_pu_bacteria | 2977851361 | 2977858017 | 319 |
| 538 | iso_pu_bacteria | 2977858184 | 2977861759 | 319 |
| 539 | iso_pu_bacteria | 2977864932 | 2977866732 | 319 |
| 540 | iso_pu_bacteria | 2977872689 | 2977876271 | 319 |
| 541 | iso_pu_bacteria | 2977898635 | 2977903524 | 319 |
| 542 | iso_pu_bacteria | 2977907340 | 2977914520 | 319 |
| 543 | iso_pu_bacteria | 2977922695 | 2977926831 | 319 |
| 544 | iso_pu_bacteria | 2977935797 | 2977939268 | 319 |
| 545 | iso_pu_bacteria | 2977942078 | 2977948945 | 319 |
| 546 | iso_pu_bacteria | 2977950692 | 2977956860 | 319 |
| 547 | iso_pu_bacteria | 2977957713 | 2977962618 | 319 |
| 548 | iso_pu_bacteria | 2977986579 | 2977987182 | 319 |
| 549 | iso_pu_bacteria | 2979710463 | 2979711683 | 319 |
| 550 | iso_pu_bacteria | 2979764755 | 2979768504 | 319 |
| 551 | iso_pu_bacteria | 2979779861 | 2979780268 | 319 |
| 552 | iso_pu_bacteria | 2979793036 | 2979799228 | 319 |
| 553 | iso_pu_bacteria | 2979808191 | 2979815703 | 319 |
| 554 | iso_pu_bacteria | 2987636660 | 2987640575 | 319 |
| 555 | iso_pu_bacteria | 2987645492 | 2987650978 | 319 |
| 556 | iso_pu_bacteria | 2987652177 | 2987653780 | 319 |
| 557 | iso_pu_bacteria | 2987659509 | 2987659696 | 319 |
| 558 | iso_pu_bacteria | 2989776772 | 2989778281 | 319 |
| 559 | iso_pu_bacteria | 2996310559 | 2996312192 | 319 |
| 560 | iso_pu_bacteria | 2996336353 | 2996340761 | 319 |
| 561 | iso_pu_bacteria | 2996341866 | 2996345739 | 319 |
| 562 | iso_pu_bacteria | 2996348954 | 2996351660 | 319 |
| 563 | iso_pu_bacteria | 2996386984 | 2996389460 | 319 |
| 564 | iso_pu_bacteria | 3000135777 | 3000138940 | 319 |
| 565 | iso_pu_bacteria | 3002141150 | 3002143470 | 319 |
| 566 | iso_pu_bacteria | 3004167301 | 3004170542 | 319 |
| 567 | iso_pu_bacteria | 3004188549 | 3004188740 | 319 |
| 568 | iso_pu_bacteria | 3004195979 | 3004201191 | 319 |
| 569 | iso_pu_bacteria | 3004203850 | 3004208773 | 319 |
| 570 | iso_pu_bacteria | 3004211236 | 3004214957 | 319 |
| 571 | iso_pu_bacteria | 3004218560 | 3004222452 | 319 |
| 572 | iso_pu_bacteria | 3004232784 | 3004233099 | 319 |
| 573 | iso_pu_bacteria | 3004239961 | 3004247177 | 319 |
| 574 | iso_pu_bacteria | 3004275668 | 3004278360 | 319 |
| 575 | iso_pu_bacteria | 637000159 | 637079995 | 319 |
| 576 | iso_pu_bacteria | 649633066 | 649874323 | 319 |
| 577 | iso_pu_bacteria | 8002285264 | 8002285316 | 319 |
| 578 | iso_pu_bacteria | 8004300914 | 8004303649 | 319 |
| 579 | iso_pu_bacteria | 8004312739 | 8004315465 | 319 |
| 580 | iso_pu_bacteria | 8004374579 | 8004375267 | 319 |
| 581 | iso_pu_bacteria | 8004387939 | 8004395006 | 319 |
| 582 | iso_pu_bacteria | 8004633249 | 8004635900 | 319 |
| 583 | iso_pu_bacteria | 8004640170 | 8004642960 | 319 |
| 584 | iso_pu_bacteria | 8004695233 | 8004701503 | 319 |
| 585 | iso_pu_bacteria | 8004703790 | 8004711710 | 319 |
| 586 | iso_pu_bacteria | 8004714634 | 8004721011 | 319 |
| 587 | iso_pu_bacteria | 8055617313 | 8055622380 | 319 |
| 588 | 3300002067 | JGI24735J21928_10001139 | JGI24735J21928_100011393 | 320 |
| 589 | 3300003320 | rootH2_10025044 | rootH2_100250442 | 320 |
| 590 | 3300003323 | rootH1_10012854 | rootH1_100128543 | 320 |
| 591 | 3300005334 | Ga0068869_100008715 | Ga0068869_1000087152 | 320 |
| 592 | 3300005444 | Ga0070694_100155277 | Ga0070694_1001552771 | 320 |
| 593 | 3300005445 | Ga0070708_100008304 | Ga0070708_1000083045 | 320 |
| 594 | 3300005445 | Ga0070708_100101575 | Ga0070708_1001015752 | 320 |
| 595 | 3300005459 | Ga0068867_100080138 | Ga0068867_1000801382 | 320 |
| 596 | 3300005467 | Ga0070706_100008474 | Ga0070706_1000084743 | 320 |
| 597 | 3300005468 | Ga0070707_100004103 | Ga0070707_1000041032 | 320 |
| 598 | 3300005468 | Ga0070707_100128562 | Ga0070707_1001285622 | 320 |
| 599 | 3300005471 | Ga0070698_100103437 | Ga0070698_1001034372 | 320 |
| 600 | 3300005518 | Ga0070699_100041963 | Ga0070699_1000419631 | 320 |
| 601 | 3300005545 | Ga0070695_100001839 | Ga0070695_1000018396 | 320 |
| 602 | 3300005546 | Ga0070696_100008411 | Ga0070696_1000084116 | 320 |
| 603 | 3300005549 | Ga0070704_100057722 | Ga0070704_1000577222 | 320 |
| 604 | 3300005843 | Ga0068860_100033861 | Ga0068860_1000338613 | 320 |
| 605 | 3300005844 | Ga0068862_100010573 | Ga0068862_1000105736 | 320 |
| 606 | 3300009147 | Ga0114129_10610156 | Ga0114129_106101562 | 320 |
| 607 | 3300009553 | Ga0105249_10060995 | Ga0105249_100609952 | 320 |
| 608 | 3300025910 | Ga0207684_10007744 | Ga0207684_100077443 | 320 |
| 609 | 3300025922 | Ga0207646_10015361 | Ga0207646_100153615 | 320 |
| 610 | 3300025922 | Ga0207646_10055940 | Ga0207646_100559403 | 320 |
| 611 | 3300025935 | Ga0207709_10201684 | Ga0207709_102016841 | 320 |
| 612 | 3300025942 | Ga0207689_10007335 | Ga0207689_100073357 | 320 |
| 613 | 3300025961 | Ga0207712_10096398 | Ga0207712_100963982 | 320 |
| 614 | 3300026089 | Ga0207648_10097245 | Ga0207648_100972453 | 320 |
| 615 | 3300028380 | Ga0268265_10013573 | Ga0268265_100135735 | 320 |
| 616 | 3300028381 | Ga0268264_10041618 | Ga0268264_100416183 | 320 |
| 617 | 3300031911 | Ga0307412_10000131 | Ga0307412_1000013125 | 320 |
| 618 | 3300044712 | Ga0453684_0221830 | Ga0453684_0221830_103_1203 | 320 |
| 619 | 3300049592 | Ga0501076_0060798 | Ga0501076_0060798_23_1135 | 320 |
| 620 | 3300049593 | Ga0501077_0079777 | Ga0501077_0079777_172_1284 | 320 |
| 621 | 3300049742 | Ga0501080_0048146 | Ga0501080_0048146_2431_3543 | 320 |
| 622 | 3300049743 | Ga0501081_0008804 | Ga0501081_0008804_3869_4981 | 320 |
| 623 | 3300050507 | nmdc:mga05p37_358455_c1 | nmdc:mga05p37_358455_c1_38_1138 | 320 |
| 624 | 3300054114 | Ga0501084_0036034 | Ga0501084_0036034_1776_2888 | 320 |
| 625 | 3300060353 | Ga0501082_0087225 | Ga0501082_0087225_1165_2277 | 320 |
| 626 | 3300061734 | Ga0530510_0053252 | Ga0530510_0053252_841_1953 | 320 |
| 627 | iso_pu_bacteria | 2524023250 | 2524612876 | 320 |
| 628 | iso_pu_bacteria | 2889914905 | 2889915821 | 320 |
| 629 | iso_pu_bacteria | 2894817345 | 2894819779 | 320 |
| 630 | iso_pu_bacteria | 641736151 | 642425665 | 320 |
| 631 | 3300046476 | Ga0495662_0003042 | Ga0495662_0003042_7220_8194 | 322 |
| 632 | 3300049568 | Ga0501031_0018777 | Ga0501031_0018777_521_1495 | 322 |
| 633 | 3300049570 | Ga0501033_0012044 | Ga0501033_0012044_2979_3953 | 322 |
| 634 | 3300049571 | Ga0501034_0017525 | Ga0501034_0017525_4782_5756 | 322 |
| 635 | 3300049581 | Ga0501047_0003989 | Ga0501047_0003989_9882_10856 | 322 |
| 636 | 3300049586 | Ga0501070_0025811 | Ga0501070_0025811_3058_4032 | 322 |
| 637 | 3300049742 | Ga0501080_0156703 | Ga0501080_0156703_25_999 | 322 |
| 638 | 3300049823 | Ga0501044_0011903 | Ga0501044_0011903_4804_5778 | 322 |
| 639 | 3300001979 | JGI24740J21852_10007842 | JGI24740J21852_100078425 | 323 |
| 640 | 3300002741 | JGI25157J39369_1000849 | JGI25157J39369_100084913 | 323 |
| 641 | 3300003214 | JGI25165J46597_1000219 | JGI25165J46597_100021975 | 323 |
| 642 | 3300003578 | Ga0006562J51391_1008400 | Ga0006562J51391_10084004 | 323 |
| 643 | 3300003762 | Ga0055542_1000572 | Ga0055542_10005723 | 323 |
| 644 | 3300003763 | Ga0055529_1003128 | Ga0055529_10031281 | 323 |
| 645 | 3300005262 | Ga0065165_1001977 | Ga0065165_10019774 | 323 |
| 646 | 3300005436 | Ga0070713_100138922 | Ga0070713_1001389222 | 323 |
| 647 | 3300005548 | Ga0070665_100003727 | Ga0070665_10000372721 | 323 |
| 648 | 3300005548 | Ga0070665_100159776 | Ga0070665_1001597762 | 323 |
| 649 | 3300005563 | Ga0068855_100113372 | Ga0068855_1001133725 | 323 |
| 650 | 3300005578 | Ga0068854_100089153 | Ga0068854_1000891532 | 323 |
| 651 | 3300005614 | Ga0068856_100200983 | Ga0068856_1002009833 | 323 |
| 652 | 3300005616 | Ga0068852_100094392 | Ga0068852_1000943921 | 323 |
| 653 | 3300006038 | Ga0075365_10002014 | Ga0075365_100020146 | 323 |
| 654 | 3300006038 | Ga0075365_10087327 | Ga0075365_100873272 | 323 |
| 655 | 3300006048 | Ga0075363_100028371 | Ga0075363_1000283713 | 323 |
| 656 | 3300006163 | Ga0070715_10124045 | Ga0070715_101240452 | 323 |
| 657 | 3300006177 | Ga0075362_10019633 | Ga0075362_100196332 | 323 |
| 658 | 3300006178 | Ga0075367_10019474 | Ga0075367_100194742 | 323 |
| 659 | 3300006881 | Ga0068865_100096498 | Ga0068865_1000964983 | 323 |
| 660 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002837 | 323 |
| 661 | 3300025254 | Ga0209148_1000038 | Ga0209148_1000038476 | 323 |
| 662 | 3300025256 | Ga0209759_1000156 | Ga0209759_100015648 | 323 |
| 663 | 3300025261 | Ga0209233_1000258 | Ga0209233_100025875 | 323 |
| 664 | 3300025261 | Ga0209233_1009319 | Ga0209233_10093191 | 323 |
| 665 | 3300025272 | Ga0209455_1000376 | Ga0209455_100037622 | 323 |
| 666 | 3300025297 | Ga0209758_1008950 | Ga0209758_10089507 | 323 |
| 667 | 3300025903 | Ga0207680_10035673 | Ga0207680_100356732 | 323 |
| 668 | 3300025904 | Ga0207647_10008543 | Ga0207647_100085438 | 323 |
| 669 | 3300025905 | Ga0207685_10046411 | Ga0207685_100464112 | 323 |
| 670 | 3300025913 | Ga0207695_10494764 | Ga0207695_104947641 | 323 |
| 671 | 3300025914 | Ga0207671_10014553 | Ga0207671_100145533 | 323 |
| 672 | 3300025914 | Ga0207671_10179387 | Ga0207671_101793872 | 323 |
| 673 | 3300025924 | Ga0207694_10010009 | Ga0207694_1001000911 | 323 |
| 674 | 3300025927 | Ga0207687_10158394 | Ga0207687_101583941 | 323 |
| 675 | 3300025939 | Ga0207665_10136885 | Ga0207665_101368852 | 323 |
| 676 | 3300025949 | Ga0207667_10261796 | Ga0207667_102617962 | 323 |
| 677 | 3300025949 | Ga0207667_10266432 | Ga0207667_102664322 | 323 |
| 678 | 3300025981 | Ga0207640_10041060 | Ga0207640_100410602 | 323 |
| 679 | 3300026041 | Ga0207639_10042288 | Ga0207639_100422886 | 323 |
| 680 | 3300026041 | Ga0207639_10112174 | Ga0207639_101121742 | 323 |
| 681 | 3300026078 | Ga0207702_10223646 | Ga0207702_102236462 | 323 |
| 682 | 3300026078 | Ga0207702_10294481 | Ga0207702_102944812 | 323 |
| 683 | 3300026089 | Ga0207648_10190385 | Ga0207648_101903851 | 323 |
| 684 | 3300026121 | Ga0207683_10094039 | Ga0207683_100940394 | 323 |
| 685 | 3300027866 | Ga0209813_10025597 | Ga0209813_100255972 | 323 |
| 686 | 3300028379 | Ga0268266_10054796 | Ga0268266_100547962 | 323 |
| 687 | 3300028379 | Ga0268266_10298381 | Ga0268266_102983812 | 323 |
| 688 | 3300035083 | Ga0373926_0039620 | Ga0373926_0039620_531_1508 | 323 |
| 689 | 3300035111 | Ga0373923_0001019 | Ga0373923_0001019_1070_2047 | 323 |
| 690 | 3300035113 | Ga0373936_0000230 | Ga0373936_0000230_3855_4832 | 323 |
| 691 | 3300035116 | Ga0373945_0001082 | Ga0373945_0001082_5385_6362 | 323 |
| 692 | 3300035117 | Ga0373953_0000282 | Ga0373953_0000282_10909_11886 | 323 |
| 693 | 3300035118 | Ga0373954_0000163 | Ga0373954_0000163_6796_7773 | 323 |
| 694 | 3300035171 | Ga0373946_0000412 | Ga0373946_0000412_5967_6944 | 323 |
| 695 | 3300035172 | Ga0373955_0000071 | Ga0373955_0000071_30377_31354 | 323 |
| 696 | 3300035410 | Ga0373924_0002670 | Ga0373924_0002670_3367_4344 | 323 |
| 697 | 3300035692 | Ga0373935_0001582 | Ga0373935_0001582_89_1066 | 323 |
| 698 | 3300035695 | Ga0373927_0001396 | Ga0373927_0001396_15104_16081 | 323 |
| 699 | 3300035724 | Ga0373933_0002030 | Ga0373933_0002030_1534_2511 | 323 |
| 700 | 3300035725 | Ga0373947_0001895 | Ga0373947_0001895_9026_10003 | 323 |
| 701 | 3300036401 | Ga0373937_0000162 | Ga0373937_0000162_10803_11780 | 323 |
| 702 | 3300036647 | Ga0316582_0064163 | Ga0316582_0064163_793_1764 | 323 |
| 703 | 3300036712 | Ga0316584_0082462 | Ga0316584_0082462_1300_2271 | 323 |
| 704 | 3300037068 | Ga0373925_0000025 | Ga0373925_0000025_100998_101975 | 323 |
| 705 | 3300037471 | Ga0395905_0000995 | Ga0395905_0000995_25554_26525 | 323 |
| 706 | 3300037471 | Ga0395905_0079042 | Ga0395905_0079042_401_1372 | 323 |
| 707 | 3300046454 | Ga0495592_0000132 | Ga0495592_0000132_29081_30058 | 323 |
| 708 | 3300046460 | Ga0495638_0183332 | Ga0495638_0183332_112_1083 | 323 |
| 709 | 3300046462 | Ga0495651_0000308 | Ga0495651_0000308_13097_14074 | 323 |
| 710 | 3300046463 | Ga0495653_0000041 | Ga0495653_0000041_83877_84854 | 323 |
| 711 | 3300046473 | Ga0495582_0032493 | Ga0495582_0032493_215_1192 | 323 |
| 712 | 3300046477 | Ga0495664_0000005 | Ga0495664_0000005_122705_123682 | 323 |
| 713 | 3300046501 | Ga0495607_0071860 | Ga0495607_0071860_654_1625 | 323 |
| 714 | 3300046511 | Ga0495608_0000003 | Ga0495608_0000003_315896_316873 | 323 |
| 715 | 3300046512 | Ga0495610_0030806 | Ga0495610_0030806_591_1562 | 323 |
| 716 | 3300046514 | Ga0495618_0000010 | Ga0495618_0000010_94050_95027 | 323 |
| 717 | 3300046516 | Ga0495628_0000019 | Ga0495628_0000019_52963_53940 | 323 |
| 718 | 3300046517 | Ga0495630_0016988 | Ga0495630_0016988_1445_2422 | 323 |
| 719 | 3300046529 | Ga0495652_0000028 | Ga0495652_0000028_52963_53940 | 323 |
| 720 | 3300046531 | Ga0495665_0029847 | Ga0495665_0029847_1796_2773 | 323 |
| 721 | 3300046533 | Ga0495640_0000014 | Ga0495640_0000014_107802_108779 | 323 |
| 722 | 3300046536 | Ga0495587_0000026 | Ga0495587_0000026_93880_94857 | 323 |
| 723 | 3300046543 | Ga0495645_0000005 | Ga0495645_0000005_122676_123653 | 323 |
| 724 | 3300046559 | Ga0495667_0000003 | Ga0495667_0000003_240980_241957 | 323 |
| 725 | 3300046559 | Ga0495667_0099095 | Ga0495667_0099095_539_1516 | 323 |
| 726 | 3300046642 | Ga0495634_0000017 | Ga0495634_0000017_70592_71569 | 323 |
| 727 | 3300046660 | Ga0495625_0083324 | Ga0495625_0083324_719_1690 | 323 |
| 728 | 3300046660 | Ga0495625_0172444 | Ga0495625_0172444_456_1427 | 323 |
| 729 | 3300046663 | Ga0495635_0000024 | Ga0495635_0000024_94274_95251 | 323 |
| 730 | 3300046675 | Ga0495657_0000034 | Ga0495657_0000034_33717_34694 | 323 |
| 731 | 3300046678 | Ga0495599_0000017 | Ga0495599_0000017_53282_54259 | 323 |
| 732 | 3300046679 | Ga0495623_0000028 | Ga0495623_0000028_23651_24628 | 323 |
| 733 | 3300046680 | Ga0495646_0000015 | Ga0495646_0000015_87781_88758 | 323 |
| 734 | 3300046690 | Ga0495624_0070657 | Ga0495624_0070657_329_1306 | 323 |
| 735 | 3300046809 | Ga0495600_0000058 | Ga0495600_0000058_5337_6314 | 323 |
| 736 | 3300047315 | Ga0495581_0001732 | Ga0495581_0001732_5895_6872 | 323 |
| 737 | 3300047317 | Ga0495604_0000021 | Ga0495604_0000021_52960_53937 | 323 |
| 738 | 3300047319 | Ga0495674_0000005 | Ga0495674_0000005_321190_322167 | 323 |
| 739 | 3300047322 | Ga0495680_0000503 | Ga0495680_0000503_29126_30103 | 323 |
| 740 | 3300047444 | Ga0495675_0000085 | Ga0495675_0000085_30388_31365 | 323 |
| 741 | 3300047471 | Ga0495684_0000001 | Ga0495684_0000001_52939_53916 | 323 |
| 742 | 3300047673 | Ga0495593_0001873 | Ga0495593_0001873_5327_6304 | 323 |
| 743 | 3300048088 | Ga0495602_0000003 | Ga0495602_0000003_303301_304278 | 323 |
| 744 | 3300048915 | Ga0496112_0008399 | Ga0496112_0008399_6403_7374 | 323 |
| 745 | 3300048925 | Ga0496122_0000160 | Ga0496122_0000160_29358_30329 | 323 |
| 746 | 3300048926 | Ga0496123_0000034 | Ga0496123_0000034_59036_60007 | 323 |
| 747 | 3300048927 | Ga0496124_0000206 | Ga0496124_0000206_11790_12761 | 323 |
| 748 | 3300048927 | Ga0496124_0131800 | Ga0496124_0131800_837_1808 | 323 |
| 749 | 3300049568 | Ga0501031_0000108 | Ga0501031_0000108_4406_5377 | 323 |
| 750 | 3300049568 | Ga0501031_0011891 | Ga0501031_0011891_527_1498 | 323 |
| 751 | 3300049569 | Ga0501032_0000022 | Ga0501032_0000022_85474_86445 | 323 |
| 752 | 3300049569 | Ga0501032_0000031 | Ga0501032_0000031_57956_58927 | 323 |
| 753 | 3300049570 | Ga0501033_0000037 | Ga0501033_0000037_60329_61300 | 323 |
| 754 | 3300049570 | Ga0501033_0000763 | Ga0501033_0000763_11051_12022 | 323 |
| 755 | 3300049570 | Ga0501033_0001161 | Ga0501033_0001161_11280_12251 | 323 |
| 756 | 3300049570 | Ga0501033_0070246 | Ga0501033_0070246_14_985 | 323 |
| 757 | 3300049571 | Ga0501034_0000064 | Ga0501034_0000064_130535_131506 | 323 |
| 758 | 3300049571 | Ga0501034_0000269 | Ga0501034_0000269_45258_46229 | 323 |
| 759 | 3300049571 | Ga0501034_0044693 | Ga0501034_0044693_128_1117 | 323 |
| 760 | 3300049572 | Ga0501036_0000013 | Ga0501036_0000013_99718_100689 | 323 |
| 761 | 3300049572 | Ga0501036_0014732 | Ga0501036_0014732_4091_5062 | 323 |
| 762 | 3300049572 | Ga0501036_0087408 | Ga0501036_0087408_1491_2480 | 323 |
| 763 | 3300049573 | Ga0501037_0000016 | Ga0501037_0000016_99711_100682 | 323 |
| 764 | 3300049573 | Ga0501037_0000132 | Ga0501037_0000132_66405_67376 | 323 |
| 765 | 3300049574 | Ga0501038_0000015 | Ga0501038_0000015_60346_61317 | 323 |
| 766 | 3300049574 | Ga0501038_0000055 | Ga0501038_0000055_3830_4801 | 323 |
| 767 | 3300049575 | Ga0501039_0000013 | Ga0501039_0000013_173102_174073 | 323 |
| 768 | 3300049575 | Ga0501039_0000045 | Ga0501039_0000045_30827_31798 | 323 |
| 769 | 3300049576 | Ga0501040_0002047 | Ga0501040_0002047_2118_3089 | 323 |
| 770 | 3300049579 | Ga0501043_0000015 | Ga0501043_0000015_77677_78648 | 323 |
| 771 | 3300049579 | Ga0501043_0000388 | Ga0501043_0000388_34345_35316 | 323 |
| 772 | 3300049579 | Ga0501043_0152995 | Ga0501043_0152995_12_1001 | 323 |
| 773 | 3300049580 | Ga0501046_0200897 | Ga0501046_0200897_72_1043 | 323 |
| 774 | 3300049581 | Ga0501047_0001528 | Ga0501047_0001528_18558_19529 | 323 |
| 775 | 3300049822 | Ga0501035_0000046 | Ga0501035_0000046_85283_86254 | 323 |
| 776 | 3300049822 | Ga0501035_0000287 | Ga0501035_0000287_11112_12083 | 323 |
| 777 | 3300049822 | Ga0501035_0000306 | Ga0501035_0000306_30854_31825 | 323 |
| 778 | 3300049822 | Ga0501035_0027158 | Ga0501035_0027158_1429_2400 | 323 |
| 779 | 3300049822 | Ga0501035_0096734 | Ga0501035_0096734_1611_2582 | 323 |
| 780 | 3300049823 | Ga0501044_0000038 | Ga0501044_0000038_60346_61317 | 323 |
| 781 | 3300049823 | Ga0501044_0136312 | Ga0501044_0136312_65_1054 | 323 |
| 782 | 3300049823 | Ga0501044_0189941 | Ga0501044_0189941_779_1750 | 323 |
| 783 | 3300050492 | nmdc:mga0yw44_6871_c1 | nmdc:mga0yw44_6871_c1_3466_4437 | 323 |
| 784 | 3300053077 | Ga0495601_0000005 | Ga0495601_0000005_50843_51820 | 323 |
| 785 | 3300053078 | Ga0495612_0000001 | Ga0495612_0000001_364305_365282 | 323 |
| 786 | 3300053084 | Ga0495595_0000166 | Ga0495595_0000166_14386_15363 | 323 |
| 787 | 3300053085 | Ga0495619_0000007 | Ga0495619_0000007_52963_53940 | 323 |
| 788 | 3300053136 | Ga0500559_0090602 | Ga0500559_0090602_360_1331 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9857 | 3 | 323 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9853 | 4 | 323 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9805 | 3 | 323 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9799 | 3 | 323 |
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9794 | 3 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9877 | 3 | 171 | 3.40.47.10 |
| 2ebdB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9805 | 181 | 323 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9789 | 3 | 323 | 3.40.47.10 |
| 4ewpF01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9768 | 3 | 170 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9762 | 3 | 171 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1UGK4-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9993 | 243 | 323 |
GO:0033818
GO:0044550 |
| AF-A0A538M788-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9945 | 224 | 323 |
GO:0016746
|
| AF-A0A3B9NPJ8-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9938 | 212 | 323 |
GO:0033818
|
| AF-A0A661PT68-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.993 | 8 | 116 |
GO:0016746
GO:0044550 |
| AF-A0A800M9R9-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.992 | 7 | 155 |
GO:0004315
GO:0006633 GO:0044550 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar