F480862

General Info

Members Datasets Scaffolds Average Seq Length
788 553 483 330

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100057722|Ga0070704_1000577222
Length 390
Sequence VPHTRFVRGLGERGGHFWAPAYKIMLRARIIATGMSVPEPVVTNELLSRCMSTSDEWITQRTGIRERRMSPDTYRMLLRLAEAPDKPAFMREVRDRGLDGQIDSSLTVTDLALEASRMALKHAGIAAEDLDCIIQSSTLPDLAYPAPGCVMQGRLGLTSTPVFNLAQGCAGFVYGLALADQLIRGGMYRRVLVVGAELLSSAFDYTDEGRDMAVLFADGAGAAVLEAVETDAVRPRGLISHHLHSDGSALDALYGEMWGSSTFPPVSKKKIDDGRTRPRMNGRAVFVNAVRRVREVVQECLDANGLRAADVDCYLFHQANLRIIEAAAEHFQIPAERYFNNLDRYGNTAGASVPICLHEALSEARIKDGDLVMLVAFGTGFSWGATLLRW

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
15 2534681786 Brucella suis 92/29 Isolate Unclassified
16 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
17 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
18 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
19 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
20 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
21 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
22 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
23 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
24 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
25 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
26 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
27 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
28 2643221719 Rhizobium sp. Root274 Isolate Unclassified
29 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
30 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
31 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
32 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
34 2738543024 Aminobacter sp. AP02 Isolate Unclassified
35 2751185800 Brucella pituitosa AA2 Isolate Unclassified
36 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
37 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
38 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
39 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
40 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
41 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
42 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
43 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
44 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
45 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
46 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
47 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
48 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
49 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
50 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
51 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
52 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
53 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
54 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
55 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
56 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
57 2854911287 Brucella lupini LUP21 Isolate Unclassified
58 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
59 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
60 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
61 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
62 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
63 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
64 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
65 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
66 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
67 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
68 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
69 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
70 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
71 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
72 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
73 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
74 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
75 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
76 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
77 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
78 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
79 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
80 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
81 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
82 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
83 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
84 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
85 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
86 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
87 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
88 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
89 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
90 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
91 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
92 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
93 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
94 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
95 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
96 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
97 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
98 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
99 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
100 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
101 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
102 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
103 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
104 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
105 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
106 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
107 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
108 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
109 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
110 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
111 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
112 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
113 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
114 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
115 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
116 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
117 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
118 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
119 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
120 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
121 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
122 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
123 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
124 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
125 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
126 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
127 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
128 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
129 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
130 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
131 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
132 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
133 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
134 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
135 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
136 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
137 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
138 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
139 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
140 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
141 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
142 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
143 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
144 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
145 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
146 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
147 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
148 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
149 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
150 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
151 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
152 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
153 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
154 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
155 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
156 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
157 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
158 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
159 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
160 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
161 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
162 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
163 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
164 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
165 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
166 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
167 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
168 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
169 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
170 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
171 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
172 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
173 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
174 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
175 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
176 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
177 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
178 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
179 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
180 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
181 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
182 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
183 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
184 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
185 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
186 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
187 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
188 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
189 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
190 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
191 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
192 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
193 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
194 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
195 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
196 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
197 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
198 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
199 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
200 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
201 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
202 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
203 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
204 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
205 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
206 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
207 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
208 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
209 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
210 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
211 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
212 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
213 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
214 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
215 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
216 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
217 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
218 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
219 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
220 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
221 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
222 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
223 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
224 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
225 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
226 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
227 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
228 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
229 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
230 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
231 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
232 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
233 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
234 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
235 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
236 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
237 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
238 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
239 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
240 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
241 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
242 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
243 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
244 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
245 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
246 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
247 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
248 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
249 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
250 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
251 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
252 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
253 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
254 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
255 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
256 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
257 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
258 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
259 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
260 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
261 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
262 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
263 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
264 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
265 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
266 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
267 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
268 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
269 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
270 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
271 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
272 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
273 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
274 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
275 3004167301 Mesorhizobium loti 582 Isolate Unclassified
276 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
277 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
278 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
279 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
280 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
281 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
282 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
283 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
284 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
285 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
286 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
287 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
288 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
289 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
290 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
291 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
292 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
293 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
294 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
295 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
296 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
297 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
298 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
299 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
300 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
301 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
302 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
303 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
304 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
305 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
306 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
307 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
308 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
309 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
310 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
311 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
312 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
313 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
314 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
315 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
316 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
317 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
318 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
319 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
320 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
321 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
322 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
323 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
324 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
325 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
326 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
327 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
328 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
329 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
330 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
331 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
332 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
333 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
334 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
335 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
336 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
337 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
338 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
339 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
340 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
341 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
342 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
343 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
344 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
345 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
346 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
347 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
348 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
349 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
350 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
351 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
352 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
353 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
354 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
355 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
356 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
358 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
359 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
361 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
386 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
387 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
391 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
392 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
393 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
394 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
395 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
396 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
397 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
398 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
399 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
400 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
401 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
402 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
403 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
404 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
405 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
406 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
407 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
408 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
410 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
411 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
412 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
413 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
414 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
415 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
416 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
417 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
418 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
419 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
420 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
421 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
422 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
423 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
424 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
425 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
426 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
427 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
428 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
429 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
430 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
431 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
432 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
433 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
434 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
435 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
436 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
437 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
438 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
439 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
440 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
441 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
442 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
443 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
444 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
445 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
446 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
447 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
448 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
449 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
450 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
451 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
452 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
453 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
454 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
455 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
456 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
457 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
458 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
459 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
460 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
461 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
462 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
463 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
464 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
465 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
466 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
467 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
468 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
469 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
470 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
471 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
474 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
475 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
476 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
477 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
478 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
479 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
480 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
481 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
482 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
497 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
498 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
499 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
500 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
501 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
502 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
503 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
504 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
505 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
509 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
514 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
515 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
516 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
519 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
520 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
521 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
522 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
523 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
524 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
525 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
526 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
527 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
528 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
529 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
530 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
533 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
536 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
537 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
538 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
539 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
540 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
541 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
542 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
543 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
544 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
545 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
546 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
547 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
548 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
549 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
550 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
551 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
552 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
553 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.91
Metatranscriptomes 0.38
Isolates 38.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 29.19
Rhizoplane 1.02
Rhizosphere 56.22
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007842 3300001979 Bacteria 4308
2 JGI24735J21928_10001139 3300002067 Bacteria 9487
3 JGI25157J39369_1000849 3300002741 Bacteria 15049
4 JGI25165J46597_1000219 3300003214 Bacteria 79946
5 rootH2_10025044 3300003320 Bacteria 3625
6 rootH1_10012854 3300003323 Bacteria 4783
7 Ga0006562J51391_1008400 3300003578 Bacteria 5010
8 Ga0055542_1000572 3300003762 Bacteria 32254
9 Ga0055529_1003128 3300003763 Bacteria 2864
10 Ga0058859_11785646 3300004798 Bacteria 5091
11 Ga0058860_11846802 3300004801 Bacteria 1401
12 Ga0065165_1001977 3300005262 Bacteria 19345
13 Ga0065704_10114003 3300005289 Bacteria 1901
14 Ga0065707_10130544 3300005295 Bacteria 1928
15 Ga0070676_10223955 3300005328 Bacteria 1244
16 Ga0068869_100008715 3300005334 Bacteria 6550
17 Ga0070682_100003380 3300005337 Bacteria 8849
18 Ga0070668_100149088 3300005347 Bacteria 1890
19 Ga0070668_100173088 3300005347 Bacteria 1759
20 Ga0070674_100061115 3300005356 Bacteria 2628
21 Ga0070714_100000144 3300005435 Bacteria 57133
22 Ga0070713_100138922 3300005436 Bacteria 2150
23 Ga0070694_100155277 3300005444 Bacteria 1675
24 Ga0070708_100008304 3300005445 Bacteria 8339
25 Ga0070708_100101575 3300005445 Bacteria 2634
26 Ga0068867_100080138 3300005459 Bacteria 2458
27 Ga0070706_100008474 3300005467 Bacteria 9578
28 Ga0070706_100193585 3300005467 Bacteria 1900
29 Ga0070706_100212818 3300005467 Unclassified 1805
30 Ga0070707_100004103 3300005468 Bacteria 13680
31 Ga0070707_100032977 3300005468 Bacteria 4936
32 Ga0070707_100128562 3300005468 Bacteria 2462
33 Ga0070698_100048437 3300005471 Bacteria 4342
34 Ga0070698_100088332 3300005471 Bacteria 3085
35 Ga0070698_100103437 3300005471 Bacteria 2818
36 Ga0070698_100140372 3300005471 Bacteria 2368
37 Ga0070699_100041963 3300005518 Bacteria 3958
38 Ga0070699_100042416 3300005518 Bacteria 3937
39 Ga0070697_100289025 3300005536 Unclassified 1408
40 Ga0070695_100001839 3300005545 Bacteria 11964
41 Ga0070696_100008411 3300005546 Bacteria 6904
42 Ga0070665_100003727 3300005548 Bacteria 16137
43 Ga0070665_100159776 3300005548 Bacteria 2255
44 Ga0070704_100057722 3300005549 Bacteria 2761
45 Ga0068855_100065026 3300005563 Bacteria 4252
46 Ga0068855_100113372 3300005563 Bacteria 3110
47 Ga0070664_100118887 3300005564 Unclassified 2312
48 Ga0068857_100304351 3300005577 Bacteria 1470
49 Ga0068854_100089153 3300005578 Bacteria 2292
50 Ga0068856_100200983 3300005614 Bacteria 2007
51 Ga0068852_100094392 3300005616 Bacteria 2683
52 Ga0068859_100460918 3300005617 Bacteria 1367
53 Ga0068860_100017606 3300005843 Bacteria 6961
54 Ga0068860_100033861 3300005843 Bacteria 4902
55 Ga0068862_100010573 3300005844 Bacteria 7627
56 Ga0068862_100026271 3300005844 Bacteria 4894
57 Ga0081455_10000829 3300005937 Bacteria 39780
58 Ga0081455_10012592 3300005937 Bacteria 8430
59 Ga0081538_10002229 3300005981 Bacteria 19200
60 Ga0081538_10002703 3300005981 Bacteria 17055
61 Ga0075365_10002014 3300006038 Bacteria 9638
62 Ga0075365_10087327 3300006038 Bacteria 2120
63 Ga0075363_100028371 3300006048 Bacteria 2878
64 Ga0070715_10124045 3300006163 Bacteria 1235
65 Ga0070716_100019012 3300006173 Bacteria 3587
66 Ga0070712_100003421 3300006175 Bacteria 9763
67 Ga0075362_10019633 3300006177 Bacteria 2813
68 Ga0075367_10019474 3300006178 Bacteria 3764
69 Ga0068871_100064668 3300006358 Unclassified 2995
70 Ga0075428_100042448 3300006844 Bacteria 5000
71 Ga0075431_100090019 3300006847 Bacteria 3167
72 Ga0075431_100108453 3300006847 Bacteria 2865
73 Ga0075431_100273127 3300006847 Bacteria 1713
74 Ga0075434_100020904 3300006871 Bacteria 6355
75 Ga0075434_100314766 3300006871 Bacteria 1586
76 Ga0068865_100096498 3300006881 Bacteria 2156
77 Ga0097620_100460863 3300006931 Bacteria 1367
78 Ga0075435_100000577 3300007076 Bacteria 22442
79 Ga0099794_10103089 3300007265 Unclassified 1425
80 Ga0111539_10024445 3300009094 Bacteria 7412
81 Ga0111539_10164656 3300009094 Bacteria 2593
82 Ga0111539_10550105 3300009094 Bacteria 1344
83 Ga0105245_10041733 3300009098 Bacteria 4090
84 Ga0105245_10202004 3300009098 Bacteria 1909
85 Ga0114129_10000977 3300009147 Bacteria 37424
86 Ga0114129_10355517 3300009147 Bacteria 1939
87 Ga0114129_10448952 3300009147 Bacteria 1691
88 Ga0114129_10610156 3300009147 Bacteria 1413
89 Ga0105241_10042991 3300009174 Bacteria 3421
90 Ga0105249_10060995 3300009553 Bacteria 3460
91 Ga0105239_10159253 3300010375 Bacteria 2522
92 Ga0105246_10222363 3300011119 Bacteria 1481
93 Ga0157378_10317029 3300013297 Bacteria 1514
94 Ga0163162_10000446 3300013306 Bacteria 38191
95 Ga0163162_10463863 3300013306 Bacteria 1398
96 Ga0163162_10627519 3300013306 Bacteria 1199
97 Ga0209026_1000002 3300025250 Bacteria 1136158
98 Ga0209148_1000038 3300025254 Bacteria 493744
99 Ga0209759_1000156 3300025256 Bacteria 117222
100 Ga0209233_1000258 3300025261 Bacteria 80118
101 Ga0209233_1009319 3300025261 Bacteria 2993
102 Ga0209233_1011172 3300025261 Bacteria 2654
103 Ga0209455_1000376 3300025272 Bacteria 40749
104 Ga0209758_1008950 3300025297 Bacteria 6343
105 Ga0207680_10035673 3300025903 Bacteria 2857
106 Ga0207647_10008543 3300025904 Bacteria 7333
107 Ga0207685_10046411 3300025905 Bacteria 1653
108 Ga0207684_10007744 3300025910 Bacteria 9617
109 Ga0207695_10494764 3300025913 Bacteria 1105
110 Ga0207671_10014553 3300025914 Bacteria 6210
111 Ga0207671_10179387 3300025914 Bacteria 1647
112 Ga0207646_10015361 3300025922 Bacteria 7233
113 Ga0207646_10055940 3300025922 Bacteria 3527
114 Ga0207694_10010009 3300025924 Bacteria 7147
115 Ga0207687_10036370 3300025927 Bacteria 3354
116 Ga0207687_10158394 3300025927 Bacteria 1735
117 Ga0207664_10000494 3300025929 Bacteria 28084
118 Ga0207709_10201684 3300025935 Bacteria 1421
119 Ga0207665_10046375 3300025939 Bacteria 2912
120 Ga0207665_10136885 3300025939 Bacteria 1743
121 Ga0207689_10007335 3300025942 Bacteria 9671
122 Ga0207679_10164765 3300025945 Unclassified 1819
123 Ga0207667_10261796 3300025949 Bacteria 1768
124 Ga0207667_10266432 3300025949 Bacteria 1752
125 Ga0207712_10096398 3300025961 Bacteria 2189
126 Ga0207668_10103788 3300025972 Bacteria 2118
127 Ga0207640_10041060 3300025981 Bacteria 2940
128 Ga0207639_10042288 3300026041 Bacteria 3414
129 Ga0207639_10112174 3300026041 Bacteria 2224
130 Ga0207708_10161633 3300026075 Bacteria 1769
131 Ga0207702_10223646 3300026078 Bacteria 1755
132 Ga0207702_10294481 3300026078 Bacteria 1538
133 Ga0207641_10010425 3300026088 Bacteria 7637
134 Ga0207648_10097245 3300026089 Bacteria 2576
135 Ga0207648_10190385 3300026089 Bacteria 1818
136 Ga0207683_10094039 3300026121 Bacteria 2671
137 Ga0209813_10025597 3300027866 Bacteria 1699
138 Ga0207428_10033649 3300027907 Bacteria 4207
139 Ga0207428_10165991 3300027907 Bacteria 1674
140 Ga0268266_10054796 3300028379 Bacteria 3427
141 Ga0268266_10298381 3300028379 Bacteria 1502
142 Ga0268265_10013573 3300028380 Bacteria 5538
143 Ga0268264_10000558 3300028381 Bacteria 45913
144 Ga0268264_10041618 3300028381 Bacteria 3802
145 Ga0307515_10000056 3300028794 Bacteria 261973
146 Ga0265325_10060496 3300031241 Bacteria 1924
147 Ga0265313_10042643 3300031595 Bacteria 2227
148 Ga0265314_10006793 3300031711 Bacteria 10032
149 Ga0316576_10000975 3300031727 Bacteria 14705
150 Ga0316577_10001094 3300031733 Bacteria 12294
151 Ga0307413_10095618 3300031824 Bacteria 1948
152 Ga0307412_10000131 3300031911 Bacteria 54361
153 Ga0307416_100114071 3300032002 Bacteria 2390
154 Ga0373926_0039620 3300035083 Bacteria 1680
155 Ga0373923_0001019 3300035111 Bacteria 7610
156 Ga0373936_0000230 3300035113 Bacteria 18464
157 Ga0373945_0001082 3300035116 Bacteria 8196
158 Ga0373953_0000282 3300035117 Bacteria 14066
159 Ga0373954_0000163 3300035118 Bacteria 23852
160 Ga0373943_0080606 3300035170 Bacteria 1668
161 Ga0373946_0000412 3300035171 Bacteria 13925
162 Ga0373955_0000071 3300035172 Bacteria 40941
163 Ga0373924_0002670 3300035410 Bacteria 6013
164 Ga0373935_0001582 3300035692 Bacteria 12695
165 Ga0373927_0001396 3300035695 Bacteria 18191
166 Ga0373933_0002030 3300035724 Bacteria 11646
167 Ga0373947_0001895 3300035725 Bacteria 12777
168 Ga0373937_0000162 3300036401 Bacteria 64742
169 Ga0373937_0317528 3300036401 Bacteria 1474
170 Ga0316582_0064163 3300036647 Bacteria 2362
171 Ga0316584_0082462 3300036712 Bacteria 2409
172 Ga0373925_0000025 3300037068 Bacteria 154937
173 Ga0395900_0029285 3300037418 Bacteria 5649
174 Ga0395900_0054140 3300037418 Bacteria 4131
175 Ga0395898_0031042 3300037466 Bacteria 5344
176 Ga0395905_0000995 3300037471 Bacteria 36267
177 Ga0395905_0001481 3300037471 Bacteria 28106
178 Ga0395905_0027828 3300037471 Bacteria 5330
179 Ga0395905_0079042 3300037471 Bacteria 3083
180 Ga0395905_0152442 3300037471 Bacteria 2174
181 Ga0395905_0550889 3300037471 Bacteria 1054
182 Ga0395901_0221571 3300038443 Bacteria 1977
183 Ga0395901_0223331 3300038443 Bacteria 1968
184 Ga0439450_000521 3300042008 Bacteria 5010
185 Ga0439463_001336 3300042016 Bacteria 6574
186 Ga0451577_0001676 3300042876 Bacteria 28603
187 Ga0451577_0001818 3300042876 Bacteria 27291
188 Ga0451577_0002212 3300042876 Bacteria 23681
189 Ga0451577_0028398 3300042876 Bacteria 5059
190 Ga0451577_0095980 3300042876 Bacteria 2647
191 Ga0466972_0053238 3300044658 Bacteria 1949
192 Ga0453683_0001036 3300044673 Bacteria 26046
193 Ga0453683_0002536 3300044673 Bacteria 14094
194 Ga0453683_0010466 3300044673 Bacteria 6145
195 Ga0453683_0077158 3300044673 Bacteria 2086
196 Ga0453683_0120393 3300044673 Bacteria 1652
197 Ga0453683_0209860 3300044673 Bacteria 1237
198 Ga0453684_0000066 3300044712 Bacteria 465545
199 Ga0453684_0001327 3300044712 Bacteria 72967
200 Ga0453684_0003490 3300044712 Bacteria 35318
201 Ga0453684_0016384 3300044712 Bacteria 11595
202 Ga0453684_0021711 3300044712 Bacteria 9571
203 Ga0453684_0037244 3300044712 Bacteria 6679
204 Ga0453684_0102182 3300044712 Bacteria 3505
205 Ga0453684_0221830 3300044712 Bacteria 2189
206 Ga0453684_0370119 3300044712 Bacteria 1611
207 Ga0466960_0036087 3300044901 Bacteria 2314
208 Ga0451576_0007592 3300045051 Bacteria 12919
209 Ga0451576_0146542 3300045051 Bacteria 2461
210 Ga0451576_0169544 3300045051 Bacteria 2278
211 Ga0451576_0376490 3300045051 Bacteria 1488
212 Ga0451576_0401818 3300045051 Bacteria 1436
213 Ga0495592_0000132 3300046454 Bacteria 66310
214 Ga0495638_0183332 3300046460 Bacteria 1193
215 Ga0495651_0000308 3300046462 Bacteria 38022
216 Ga0495653_0000041 3300046463 Bacteria 118366
217 Ga0495582_0032493 3300046473 Bacteria 2869
218 Ga0495662_0003042 3300046476 Bacteria 8456
219 Ga0495664_0000005 3300046477 Bacteria 439635
220 Ga0495607_0071860 3300046501 Bacteria 1928
221 Ga0495608_0000003 3300046511 Bacteria 369831
222 Ga0495608_0001600 3300046511 Bacteria 16214
223 Ga0495610_0030806 3300046512 Bacteria 2805
224 Ga0495618_0000010 3300046514 Bacteria 189314
225 Ga0495620_0087605 3300046515 Bacteria 1252
226 Ga0495628_0000019 3300046516 Bacteria 154435
227 Ga0495628_0079751 3300046516 Bacteria 2545
228 Ga0495630_0016988 3300046517 Bacteria 5326
229 Ga0495643_0019534 3300046522 Bacteria 3918
230 Ga0495652_0000028 3300046529 Bacteria 157336
231 Ga0495665_0029847 3300046531 Bacteria 2920
232 Ga0495640_0000014 3300046533 Bacteria 161741
233 Ga0495587_0000026 3300046536 Bacteria 147819
234 Ga0495645_0000005 3300046543 Bacteria 443917
235 Ga0495667_0000003 3300046559 Bacteria 295404
236 Ga0495667_0001691 3300046559 Bacteria 14642
237 Ga0495667_0099095 3300046559 Bacteria 1887
238 Ga0495668_0098708 3300046616 Bacteria 1598
239 Ga0495634_0000017 3300046642 Bacteria 122411
240 Ga0495625_0083324 3300046660 Bacteria 2223
241 Ga0495625_0172444 3300046660 Bacteria 1444
242 Ga0495635_0000024 3300046663 Bacteria 148235
243 Ga0495657_0000034 3300046675 Bacteria 122360
244 Ga0495599_0000017 3300046678 Bacteria 162507
245 Ga0495623_0000028 3300046679 Bacteria 87634
246 Ga0495646_0000015 3300046680 Bacteria 141718
247 Ga0495624_0070657 3300046690 Bacteria 2173
248 Ga0495600_0000058 3300046809 Bacteria 65689
249 Ga0495581_0001732 3300047315 Bacteria 12161
250 Ga0495604_0000021 3300047317 Bacteria 169432
251 Ga0495674_0000005 3300047319 Bacteria 375129
252 Ga0495680_0000503 3300047322 Bacteria 44080
253 Ga0495675_0000085 3300047444 Bacteria 65846
254 Ga0495684_0000001 3300047471 Bacteria 369809
255 Ga0495593_0001873 3300047673 Bacteria 12527
256 Ga0495602_0000003 3300048088 Bacteria 357240
257 Ga0496102_0370096 3300048905 Bacteria 1349
258 Ga0496106_0233848 3300048909 Bacteria 1468
259 Ga0496110_0140347 3300048913 Bacteria 2185
260 Ga0496112_0008399 3300048915 Bacteria 9249
261 Ga0496116_0009549 3300048919 Bacteria 8261
262 Ga0496116_0117828 3300048919 Bacteria 1544
263 Ga0496118_0113767 3300048921 Bacteria 1786
264 Ga0496119_0009046 3300048922 Bacteria 8632
265 Ga0496119_0031911 3300048922 Bacteria 3520
266 Ga0496120_0001687 3300048923 Bacteria 25349
267 Ga0496120_0007399 3300048923 Bacteria 8176
268 Ga0496120_0039794 3300048923 Bacteria 2770
269 Ga0496121_0084884 3300048924 Bacteria 2494
270 Ga0496122_0000160 3300048925 Bacteria 159236
271 Ga0496122_0014530 3300048925 Bacteria 7601
272 Ga0496122_0061698 3300048925 Bacteria 2749
273 Ga0496123_0000034 3300048926 Bacteria 274836
274 Ga0496124_0000206 3300048927 Bacteria 116591
275 Ga0496124_0131601 3300048927 Bacteria 1987
276 Ga0496124_0131800 3300048927 Bacteria 1985
277 Ga0496126_0004064 3300048929 Bacteria 17751
278 Ga0501031_0000108 3300049568 Bacteria 44121
279 Ga0501031_0000220 3300049568 Bacteria 32658
280 Ga0501031_0001228 3300049568 Bacteria 15703
281 Ga0501031_0011891 3300049568 Bacteria 5674
282 Ga0501031_0018777 3300049568 Bacteria 4502
283 Ga0501031_0032347 3300049568 Bacteria 3410
284 Ga0501032_0000022 3300049569 Bacteria 146790
285 Ga0501032_0000031 3300049569 Bacteria 130204
286 Ga0501033_0000037 3300049570 Bacteria 146582
287 Ga0501033_0000763 3300049570 Bacteria 29600
288 Ga0501033_0001161 3300049570 Bacteria 23830
289 Ga0501033_0012044 3300049570 Bacteria 6603
290 Ga0501033_0070246 3300049570 Bacteria 2573
291 Ga0501034_0000064 3300049571 Bacteria 189461
292 Ga0501034_0000269 3300049571 Bacteria 94144
293 Ga0501034_0000302 3300049571 Bacteria 87888
294 Ga0501034_0017525 3300049571 Bacteria 7346
295 Ga0501034_0044693 3300049571 Bacteria 4478
296 Ga0501036_0000013 3300049572 Bacteria 155326
297 Ga0501036_0005240 3300049572 Bacteria 10490
298 Ga0501036_0014732 3300049572 Bacteria 6521
299 Ga0501036_0014748 3300049572 Bacteria 6517
300 Ga0501036_0033890 3300049572 Bacteria 4319
301 Ga0501036_0041544 3300049572 Bacteria 3890
302 Ga0501036_0087408 3300049572 Bacteria 2635
303 Ga0501036_0097160 3300049572 Bacteria 2490
304 Ga0501037_0000016 3300049573 Bacteria 161027
305 Ga0501037_0000132 3300049573 Bacteria 69775
306 Ga0501037_0023829 3300049573 Bacteria 4526
307 Ga0501037_0027918 3300049573 Bacteria 4170
308 Ga0501038_0000015 3300049574 Bacteria 161983
309 Ga0501038_0000055 3300049574 Bacteria 93761
310 Ga0501038_0020136 3300049574 Bacteria 6003
311 Ga0501038_0064922 3300049574 Bacteria 3112
312 Ga0501038_0099895 3300049574 Bacteria 2418
313 Ga0501038_0143485 3300049574 Bacteria 1951
314 Ga0501038_0203813 3300049574 Bacteria 1586
315 Ga0501039_0000013 3300049575 Bacteria 234418
316 Ga0501039_0000045 3300049575 Bacteria 104513
317 Ga0501039_0000503 3300049575 Bacteria 28338
318 Ga0501039_0001875 3300049575 Bacteria 15542
319 Ga0501039_0007918 3300049575 Bacteria 8097
320 Ga0501039_0039043 3300049575 Bacteria 3667
321 Ga0501039_0054009 3300049575 Bacteria 3110
322 Ga0501039_0055204 3300049575 Bacteria 3075
323 Ga0501039_0180005 3300049575 Bacteria 1663
324 Ga0501040_0000694 3300049576 Bacteria 20757
325 Ga0501040_0002047 3300049576 Bacteria 12981
326 Ga0501040_0008017 3300049576 Bacteria 6860
327 Ga0501040_0202135 3300049576 Bacteria 1411
328 Ga0501040_0221184 3300049576 Bacteria 1347
329 Ga0501041_0000010 3300049577 Bacteria 59427
330 Ga0501041_0001027 3300049577 Bacteria 15260
331 Ga0501041_0011454 3300049577 Bacteria 5242
332 Ga0501041_0057562 3300049577 Bacteria 2377
333 Ga0501041_0081698 3300049577 Bacteria 1990
334 Ga0501042_0000074 3300049578 Bacteria 37119
335 Ga0501042_0002854 3300049578 Bacteria 10711
336 Ga0501042_0017882 3300049578 Bacteria 4898
337 Ga0501042_0022515 3300049578 Bacteria 4402
338 Ga0501042_0037875 3300049578 Bacteria 3423
339 Ga0501042_0075894 3300049578 Bacteria 2405
340 Ga0501042_0328716 3300049578 Bacteria 1105
341 Ga0501043_0000015 3300049579 Bacteria 175932
342 Ga0501043_0000388 3300049579 Bacteria 39664
343 Ga0501043_0013030 3300049579 Bacteria 6500
344 Ga0501043_0094561 3300049579 Bacteria 2349
345 Ga0501043_0152995 3300049579 Bacteria 1805
346 Ga0501046_0001425 3300049580 Bacteria 23008
347 Ga0501046_0002776 3300049580 Bacteria 16297
348 Ga0501046_0004035 3300049580 Bacteria 13397
349 Ga0501046_0017760 3300049580 Bacteria 5934
350 Ga0501046_0168353 3300049580 Bacteria 1645
351 Ga0501046_0200897 3300049580 Bacteria 1483
352 Ga0501046_0291218 3300049580 Bacteria 1194
353 Ga0501046_0329402 3300049580 Bacteria 1111
354 Ga0501047_0000157 3300049581 Bacteria 82600
355 Ga0501047_0001528 3300049581 Bacteria 22604
356 Ga0501047_0003989 3300049581 Bacteria 13869
357 Ga0501047_0076477 3300049581 Bacteria 3221
358 Ga0501047_0186428 3300049581 Bacteria 1940
359 Ga0501048_0001631 3300049582 Bacteria 17077
360 Ga0501048_0014467 3300049582 Bacteria 5842
361 Ga0501048_0020719 3300049582 Bacteria 4820
362 Ga0501067_0083758 3300049583 Bacteria 1769
363 Ga0501068_0054184 3300049584 Bacteria 2429
364 Ga0501068_0129887 3300049584 Bacteria 1575
365 Ga0501068_0226754 3300049584 Bacteria 1188
366 Ga0501069_0076809 3300049585 Bacteria 1878
367 Ga0501070_0025811 3300049586 Bacteria 4929
368 Ga0501070_0069484 3300049586 Bacteria 2916
369 Ga0501070_0069539 3300049586 Bacteria 2915
370 Ga0501070_0173629 3300049586 Bacteria 1775
371 Ga0501070_0249781 3300049586 Bacteria 1451
372 Ga0501071_0000002 3300049587 Bacteria 101947
373 Ga0501071_0021035 3300049587 Bacteria 4542
374 Ga0501071_0110667 3300049587 Bacteria 2030
375 Ga0501071_0208424 3300049587 Bacteria 1469
376 Ga0501072_0000552 3300049588 Bacteria 26934
377 Ga0501072_0050712 3300049588 Bacteria 3268
378 Ga0501072_0120993 3300049588 Bacteria 2085
379 Ga0501072_0124529 3300049588 Bacteria 2053
380 Ga0501072_0249052 3300049588 Bacteria 1415
381 Ga0501074_0001117 3300049590 Bacteria 17526
382 Ga0501074_0059926 3300049590 Bacteria 2742
383 Ga0501074_0109723 3300049590 Bacteria 1974
384 Ga0501074_0143412 3300049590 Bacteria 1708
385 Ga0501074_0178739 3300049590 Bacteria 1514
386 Ga0501075_0000438 3300049591 Bacteria 24580
387 Ga0501075_0002105 3300049591 Bacteria 13168
388 Ga0501075_0071450 3300049591 Bacteria 2623
389 Ga0501075_0107371 3300049591 Bacteria 2122
390 Ga0501075_0242812 3300049591 Bacteria 1373
391 Ga0501075_0270091 3300049591 Bacteria 1296
392 Ga0501076_0001978 3300049592 Bacteria 13998
393 Ga0501076_0003443 3300049592 Bacteria 11097
394 Ga0501076_0019551 3300049592 Bacteria 5178
395 Ga0501076_0029963 3300049592 Bacteria 4236
396 Ga0501076_0060798 3300049592 Bacteria 3006
397 Ga0501076_0118373 3300049592 Bacteria 2144
398 Ga0501076_0158502 3300049592 Bacteria 1843
399 Ga0501076_0203272 3300049592 Bacteria 1618
400 Ga0501076_0369717 3300049592 Bacteria 1178
401 Ga0501077_0000579 3300049593 Bacteria 22191
402 Ga0501077_0079777 3300049593 Bacteria 2074
403 Ga0501077_0244915 3300049593 Bacteria 1139
404 Ga0501079_0000559 3300049741 Bacteria 24405
405 Ga0501079_0021956 3300049741 Bacteria 4889
406 Ga0501079_0071671 3300049741 Bacteria 2677
407 Ga0501080_0001834 3300049742 Bacteria 18215
408 Ga0501080_0048146 3300049742 Bacteria 3968
409 Ga0501080_0156703 3300049742 Bacteria 2103
410 Ga0501081_0003100 3300049743 Bacteria 10557
411 Ga0501081_0005987 3300049743 Bacteria 7872
412 Ga0501081_0008804 3300049743 Bacteria 6559
413 Ga0501081_0017358 3300049743 Bacteria 4763
414 Ga0501081_0069589 3300049743 Bacteria 2452
415 Ga0501081_0100003 3300049743 Bacteria 2049
416 Ga0501081_0209033 3300049743 Bacteria 1417
417 Ga0501083_0007292 3300049744 Bacteria 7841
418 Ga0501035_0000046 3300049822 Bacteria 146599
419 Ga0501035_0000287 3300049822 Bacteria 59891
420 Ga0501035_0000306 3300049822 Bacteria 57505
421 Ga0501035_0006656 3300049822 Bacteria 10807
422 Ga0501035_0006898 3300049822 Bacteria 10608
423 Ga0501035_0027158 3300049822 Bacteria 5234
424 Ga0501035_0096734 3300049822 Bacteria 2594
425 Ga0501035_0195149 3300049822 Bacteria 1739
426 Ga0501035_0213948 3300049822 Bacteria 1648
427 Ga0501044_0000038 3300049823 Bacteria 161027
428 Ga0501044_0011903 3300049823 Bacteria 9427
429 Ga0501044_0136312 3300049823 Bacteria 2446
430 Ga0501044_0137013 3300049823 Bacteria 2439
431 Ga0501044_0189941 3300049823 Bacteria 2017
432 Ga0501044_0200939 3300049823 Bacteria 1951
433 Ga0501044_0420207 3300049823 Bacteria 1247
434 Ga0501045_0000471 3300049824 Bacteria 24988
435 Ga0501045_0044858 3300049824 Bacteria 3220
436 Ga0501045_0057555 3300049824 Bacteria 2844
437 Ga0501045_0107355 3300049824 Bacteria 2069
438 Ga0501045_0141128 3300049824 Bacteria 1791
439 Ga0501045_0177201 3300049824 Unclassified 1588
440 nmdc:mga03683_98740_c1 3300050489 Bacteria 1281
441 nmdc:mga0yw44_136124_c1 3300050492 Bacteria 1594
442 nmdc:mga0yw44_5882_c1 3300050492 Bacteria 5860
443 nmdc:mga0yw44_6871_c1 3300050492 Bacteria 5540
444 nmdc:mga0k408_45530_c1 3300050493 Bacteria 2531
445 nmdc:mga04h51_55674_c1 3300050495 Bacteria 1340
446 nmdc:mga05p37_18875_c1 3300050507 Bacteria 8336
447 nmdc:mga05p37_29718_c1 3300050507 Bacteria 6668
448 nmdc:mga05p37_318_c1 3300050507 Bacteria 51124
449 nmdc:mga05p37_358455_c1 3300050507 Bacteria 1715
450 nmdc:mga0qj67_64675_c1 3300050509 Bacteria 2910
451 nmdc:mga06r32_176490_c1 3300050510 Bacteria 2121
452 nmdc:mga06r32_91044_c1 3300050510 Bacteria 2980
453 nmdc:mga08y16_16415_c1 3300050511 Bacteria 7785
454 nmdc:mga08y16_264624_c1 3300050511 Bacteria 1775
455 nmdc:mga0n895_178162_c1 3300050512 Bacteria 2157
456 nmdc:mga0rr50_8055_c1 3300050513 Bacteria 6536
457 nmdc:mga0a205_95769_c1 3300050515 Bacteria 2867
458 Ga0495601_0000005 3300053077 Bacteria 387079
459 Ga0495612_0000001 3300053078 Bacteria 418244
460 Ga0500610_0058742 3300053079 Bacteria 2007
461 Ga0495595_0000166 3300053084 Bacteria 25987
462 Ga0495619_0000007 3300053085 Bacteria 369936
463 Ga0500559_0090602 3300053136 Bacteria 1399
464 Ga0500604_0024871 3300053151 Bacteria 1718
465 Ga0500616_0004108 3300053153 Bacteria 10566
466 Ga0500627_0065300 3300053158 Bacteria 1605
467 Ga0501084_0000026 3300054114 Bacteria 132271
468 Ga0501084_0013773 3300054114 Bacteria 6692
469 Ga0501084_0018337 3300054114 Bacteria 5828
470 Ga0501084_0024487 3300054114 Bacteria 5036
471 Ga0501084_0036034 3300054114 Bacteria 4134
472 Ga0501084_0064107 3300054114 Bacteria 3075
473 Ga0501084_0096653 3300054114 Bacteria 2480
474 Ga0501082_0000675 3300060353 Bacteria 30010
475 Ga0501082_0087225 3300060353 Bacteria 2692
476 Ga0501082_0138363 3300060353 Bacteria 2113
477 Ga0501082_0166079 3300060353 Bacteria 1918
478 Ga0530510_0000525 3300061734 Bacteria 24486
479 Ga0530510_0001238 3300061734 Bacteria 17030
480 Ga0530510_0053252 3300061734 Bacteria 2925
481 Ga0530510_0073616 3300061734 Bacteria 2480
482 Ga0530510_0093004 3300061734 Bacteria 2201
483 Ga0530510_0149967 3300061734 Bacteria 1721

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2888337043 2888341007 261
2 iso_pu_bacteria 2878781027 2878786869 269
3 3300045051 Ga0451576_0376490 Ga0451576_0376490_56_1000 271
4 3300049578 Ga0501042_0328716 Ga0501042_0328716_121_1083 274
5 iso_pu_bacteria 2885334103 2885341251 274
6 3300049590 Ga0501074_0143412 Ga0501074_0143412_27_995 276
7 iso_pu_bacteria 8004727605 8004731591 277
8 3300050513 nmdc:mga0rr50_8055_c1 nmdc:mga0rr50_8055_c1_4563_5630 285
9 3300025939 Ga0207665_10046375 Ga0207665_100463752 289
10 3300061734 Ga0530510_0149967 Ga0530510_0149967_790_1707 291
11 iso_pu_bacteria 3004334049 3004339773 291
12 3300007076 Ga0075435_100000577 Ga0075435_10000057720 295
13 iso_pu_bacteria 2874102143 2874108124 296
14 3300046616 Ga0495668_0098708 Ga0495668_0098708_17_913 298
15 3300054114 Ga0501084_0000026 Ga0501084_0000026_83691_84686 298
16 3300031727 Ga0316576_10000975 Ga0316576_100009754 299
17 3300031733 Ga0316577_10001094 Ga0316577_1000109410 299
18 3300036401 Ga0373937_0317528 Ga0373937_0317528_489_1436 299
19 3300050512 nmdc:mga0n895_178162_c1 nmdc:mga0n895_178162_c1_804_1871 299
20 3300031595 Ga0265313_10042643 Ga0265313_100426432 302
21 iso_pu_bacteria 2871435913 2871439915 302
22 iso_pu_bacteria 2903513507 2903515046 302
23 iso_pu_bacteria 2922130491 2922137828 302
24 3300048919 Ga0496116_0117828 Ga0496116_0117828_205_1122 303
25 3300048919 Ga0496116_0009549 Ga0496116_0009549_1453_2403 304
26 3300048921 Ga0496118_0113767 Ga0496118_0113767_213_1163 304
27 3300048922 Ga0496119_0009046 Ga0496119_0009046_3717_4667 304
28 3300048923 Ga0496120_0007399 Ga0496120_0007399_1272_2222 304
29 3300048924 Ga0496121_0084884 Ga0496121_0084884_752_1702 304
30 3300048925 Ga0496122_0014530 Ga0496122_0014530_2675_3625 304
31 3300048929 Ga0496126_0004064 Ga0496126_0004064_6649_7599 304
32 iso_pu_bacteria 2721755693 2723601854 304
33 iso_pu_bacteria 2751185905 2753811825 304
34 iso_pu_bacteria 2802428803 2802439259 304
35 iso_pu_bacteria 2889276214 2889277929 304
36 iso_pu_bacteria 2904595352 2904597864 304
37 iso_pu_bacteria 2996706504 2996711476 304
38 3300013297 Ga0157378_10317029 Ga0157378_103170292 306
39 3300013306 Ga0163162_10627519 Ga0163162_106275191 306
40 3300037418 Ga0395900_0054140 Ga0395900_0054140_2993_3913 306
41 3300037466 Ga0395898_0031042 Ga0395898_0031042_1244_2164 306
42 3300037471 Ga0395905_0550889 Ga0395905_0550889_16_936 306
43 3300038443 Ga0395901_0223331 Ga0395901_0223331_879_1799 306
44 3300044901 Ga0466960_0036087 Ga0466960_0036087_838_1758 306
45 3300045051 Ga0451576_0146542 Ga0451576_0146542_873_1868 306
46 3300046515 Ga0495620_0087605 Ga0495620_0087605_67_987 306
47 3300046522 Ga0495643_0019534 Ga0495643_0019534_1045_1965 306
48 3300048905 Ga0496102_0370096 Ga0496102_0370096_402_1322 306
49 3300048925 Ga0496122_0061698 Ga0496122_0061698_714_1634 306
50 3300048927 Ga0496124_0131601 Ga0496124_0131601_644_1564 306
51 3300049572 Ga0501036_0033890 Ga0501036_0033890_156_1076 306
52 3300049574 Ga0501038_0143485 Ga0501038_0143485_289_1209 306
53 3300049575 Ga0501039_0055204 Ga0501039_0055204_1646_2566 306
54 3300049578 Ga0501042_0017882 Ga0501042_0017882_578_1498 306
55 3300049579 Ga0501043_0094561 Ga0501043_0094561_506_1426 306
56 3300049580 Ga0501046_0168353 Ga0501046_0168353_220_1140 306
57 3300049581 Ga0501047_0076477 Ga0501047_0076477_656_1576 306
58 3300049583 Ga0501067_0083758 Ga0501067_0083758_341_1261 306
59 3300049584 Ga0501068_0054184 Ga0501068_0054184_1221_2141 306
60 3300049587 Ga0501071_0208424 Ga0501071_0208424_324_1244 306
61 3300049823 Ga0501044_0200939 Ga0501044_0200939_289_1209 306
62 3300049823 Ga0501044_0420207 Ga0501044_0420207_85_1005 306
63 3300049824 Ga0501045_0057555 Ga0501045_0057555_492_1412 306
64 3300050492 nmdc:mga0yw44_136124_c1 nmdc:mga0yw44_136124_c1_601_1521 306
65 3300053079 Ga0500610_0058742 Ga0500610_0058742_29_949 306
66 3300053151 Ga0500604_0024871 Ga0500604_0024871_150_1070 306
67 3300053158 Ga0500627_0065300 Ga0500627_0065300_652_1572 306
68 iso_pu_bacteria 2876369609 2876370102 306
69 iso_pu_bacteria 8004395343 8004397195 306
70 3300005471 Ga0070698_100140372 Ga0070698_1001403722 308
71 3300049580 Ga0501046_0329402 Ga0501046_0329402_16_1080 308
72 3300006871 Ga0075434_100020904 Ga0075434_1000209043 309
73 3300049581 Ga0501047_0186428 Ga0501047_0186428_653_1717 309
74 3300049585 Ga0501069_0076809 Ga0501069_0076809_503_1516 309
75 3300049586 Ga0501070_0249781 Ga0501070_0249781_58_1071 309
76 3300005467 Ga0070706_100193585 Ga0070706_1001935852 310
77 3300005468 Ga0070707_100032977 Ga0070707_1000329773 310
78 3300005471 Ga0070698_100048437 Ga0070698_1000484374 310
79 3300005518 Ga0070699_100042416 Ga0070699_1000424163 310
80 3300009098 Ga0105245_10041733 Ga0105245_100417334 310
81 3300025927 Ga0207687_10036370 Ga0207687_100363702 310
82 3300049575 Ga0501039_0180005 Ga0501039_0180005_271_1341 310
83 3300049577 Ga0501041_0081698 Ga0501041_0081698_383_1453 310
84 3300049587 Ga0501071_0110667 Ga0501071_0110667_12_1082 310
85 3300049591 Ga0501075_0071450 Ga0501075_0071450_1491_2561 310
86 3300049593 Ga0501077_0244915 Ga0501077_0244915_27_1097 310
87 3300054114 Ga0501084_0096653 Ga0501084_0096653_76_1146 310
88 3300060353 Ga0501082_0166079 Ga0501082_0166079_471_1541 310
89 3300006173 Ga0070716_100019012 Ga0070716_1000190123 312
90 3300006871 Ga0075434_100314766 Ga0075434_1003147662 312
91 3300009094 Ga0111539_10164656 Ga0111539_101646562 312
92 3300028794 Ga0307515_10000056 Ga0307515_1000005696 312
93 3300042016 Ga0439463_001336 Ga0439463_001336_3181_4275 312
94 iso_pu_bacteria 3004289098 3004290510 312
95 3300005937 Ga0081455_10012592 Ga0081455_100125926 313
96 3300005981 Ga0081538_10002703 Ga0081538_1000270310 313
97 3300006847 Ga0075431_100090019 Ga0075431_1000900194 314
98 3300031711 Ga0265314_10006793 Ga0265314_100067932 314
99 3300042008 Ga0439450_000521 Ga0439450_000521_2331_3425 314
100 3300053153 Ga0500616_0004108 Ga0500616_0004108_6927_7922 314
101 iso_pu_bacteria 2643221551 2643775246 314
102 iso_pu_bacteria 2643221555 2643793692 314
103 iso_pu_bacteria 2958092219 2958093041 314
104 3300005471 Ga0070698_100088332 Ga0070698_1000883323 315
105 3300005564 Ga0070664_100118887 Ga0070664_1001188871 315
106 3300009094 Ga0111539_10550105 Ga0111539_105501052 315
107 3300025261 Ga0209233_1011172 Ga0209233_10111723 315
108 3300025945 Ga0207679_10164765 Ga0207679_101647651 315
109 3300035170 Ga0373943_0080606 Ga0373943_0080606_482_1477 315
110 3300046511 Ga0495608_0001600 Ga0495608_0001600_992_1978 315
111 3300046516 Ga0495628_0079751 Ga0495628_0079751_915_1901 315
112 3300046559 Ga0495667_0001691 Ga0495667_0001691_7440_8426 315
113 3300050511 nmdc:mga08y16_264624_c1 nmdc:mga08y16_264624_c1_217_1206 315
114 iso_pu_bacteria 2643221547 2643756299 315
115 iso_pu_bacteria 2987666974 2987667691 315
116 iso_pu_bacteria 8004445564 8004447454 315
117 3300005337 Ga0070682_100003380 Ga0070682_1000033809 316
118 3300005536 Ga0070697_100289025 Ga0070697_1002890252 316
119 3300005563 Ga0068855_100065026 Ga0068855_1000650262 316
120 3300005617 Ga0068859_100460918 Ga0068859_1004609182 316
121 3300006931 Ga0097620_100460863 Ga0097620_1004608632 316
122 3300031241 Ga0265325_10060496 Ga0265325_100604962 316
123 3300037471 Ga0395905_0027828 Ga0395905_0027828_2918_3910 316
124 3300042876 Ga0451577_0001818 Ga0451577_0001818_10688_11680 316
125 3300042876 Ga0451577_0095980 Ga0451577_0095980_25_1017 316
126 3300044712 Ga0453684_0102182 Ga0453684_0102182_2085_3077 316
127 3300049568 Ga0501031_0000220 Ga0501031_0000220_6945_7919 316
128 3300049568 Ga0501031_0001228 Ga0501031_0001228_11529_12503 316
129 3300049572 Ga0501036_0005240 Ga0501036_0005240_5187_6161 316
130 3300049572 Ga0501036_0041544 Ga0501036_0041544_2884_3858 316
131 3300049573 Ga0501037_0023829 Ga0501037_0023829_455_1429 316
132 3300049573 Ga0501037_0027918 Ga0501037_0027918_1497_2471 316
133 3300049574 Ga0501038_0064922 Ga0501038_0064922_1735_2709 316
134 3300049575 Ga0501039_0000503 Ga0501039_0000503_6820_7794 316
135 3300049575 Ga0501039_0007918 Ga0501039_0007918_2233_3207 316
136 3300049576 Ga0501040_0202135 Ga0501040_0202135_274_1248 316
137 3300049576 Ga0501040_0221184 Ga0501040_0221184_341_1315 316
138 3300049577 Ga0501041_0001027 Ga0501041_0001027_9062_10036 316
139 3300049577 Ga0501041_0011454 Ga0501041_0011454_166_1140 316
140 3300049578 Ga0501042_0002854 Ga0501042_0002854_2122_3096 316
141 3300049578 Ga0501042_0037875 Ga0501042_0037875_302_1276 316
142 3300049580 Ga0501046_0001425 Ga0501046_0001425_8205_9179 316
143 3300049580 Ga0501046_0002776 Ga0501046_0002776_11224_12198 316
144 3300049582 Ga0501048_0001631 Ga0501048_0001631_13327_14301 316
145 3300049588 Ga0501072_0050712 Ga0501072_0050712_1382_2356 316
146 3300049590 Ga0501074_0059926 Ga0501074_0059926_1117_2091 316
147 3300049591 Ga0501075_0270091 Ga0501075_0270091_157_1131 316
148 3300049592 Ga0501076_0203272 Ga0501076_0203272_227_1201 316
149 3300049822 Ga0501035_0006898 Ga0501035_0006898_5424_6398 316
150 3300049822 Ga0501035_0213948 Ga0501035_0213948_244_1218 316
151 iso_pu_bacteria 2970540015 2970540729 316
152 iso_pu_bacteria 8004361976 8004364198 316
153 3300005435 Ga0070714_100000144 Ga0070714_10000014458 317
154 3300005577 Ga0068857_100304351 Ga0068857_1003043512 317
155 3300005843 Ga0068860_100017606 Ga0068860_1000176064 317
156 3300006358 Ga0068871_100064668 Ga0068871_1000646682 317
157 3300013306 Ga0163162_10000446 Ga0163162_1000044628 317
158 3300025929 Ga0207664_10000494 Ga0207664_100004946 317
159 3300028381 Ga0268264_10000558 Ga0268264_100005584 317
160 3300042876 Ga0451577_0001676 Ga0451577_0001676_1251_2261 317
161 3300042876 Ga0451577_0002212 Ga0451577_0002212_8760_9755 317
162 3300042876 Ga0451577_0028398 Ga0451577_0028398_644_1639 317
163 3300044673 Ga0453683_0001036 Ga0453683_0001036_6170_7165 317
164 3300044673 Ga0453683_0002536 Ga0453683_0002536_5506_6501 317
165 3300044673 Ga0453683_0010466 Ga0453683_0010466_4318_5313 317
166 3300044673 Ga0453683_0077158 Ga0453683_0077158_53_1063 317
167 3300044673 Ga0453683_0120393 Ga0453683_0120393_357_1352 317
168 3300044673 Ga0453683_0209860 Ga0453683_0209860_184_1179 317
169 3300044712 Ga0453684_0000066 Ga0453684_0000066_455763_456758 317
170 3300044712 Ga0453684_0001327 Ga0453684_0001327_66923_67918 317
171 3300044712 Ga0453684_0003490 Ga0453684_0003490_23956_24951 317
172 3300044712 Ga0453684_0016384 Ga0453684_0016384_1274_2269 317
173 3300044712 Ga0453684_0021711 Ga0453684_0021711_6222_7217 317
174 3300044712 Ga0453684_0037244 Ga0453684_0037244_1079_2074 317
175 3300044712 Ga0453684_0370119 Ga0453684_0370119_368_1363 317
176 3300045051 Ga0451576_0007592 Ga0451576_0007592_10480_11490 317
177 3300045051 Ga0451576_0169544 Ga0451576_0169544_205_1200 317
178 3300045051 Ga0451576_0401818 Ga0451576_0401818_10_1005 317
179 iso_pu_bacteria 2888350351 2888357068 317
180 iso_pu_bacteria 2922185730 2922193029 317
181 iso_pu_bacteria 2977971508 2977979925 317
182 iso_pu_bacteria 3004248173 3004250978 317
183 3300004798 Ga0058859_11785646 Ga0058859_117856462 318
184 3300004801 Ga0058860_11846802 Ga0058860_118468021 318
185 3300005289 Ga0065704_10114003 Ga0065704_101140031 318
186 3300005328 Ga0070676_10223955 Ga0070676_102239552 318
187 3300005347 Ga0070668_100149088 Ga0070668_1001490882 318
188 3300005347 Ga0070668_100173088 Ga0070668_1001730882 318
189 3300005356 Ga0070674_100061115 Ga0070674_1000611151 318
190 3300005844 Ga0068862_100026271 Ga0068862_1000262713 318
191 3300005937 Ga0081455_10000829 Ga0081455_1000082928 318
192 3300005981 Ga0081538_10002229 Ga0081538_1000222912 318
193 3300006844 Ga0075428_100042448 Ga0075428_1000424485 318
194 3300006847 Ga0075431_100108453 Ga0075431_1001084533 318
195 3300006847 Ga0075431_100273127 Ga0075431_1002731272 318
196 3300007265 Ga0099794_10103089 Ga0099794_101030892 318
197 3300009094 Ga0111539_10024445 Ga0111539_100244452 318
198 3300009098 Ga0105245_10202004 Ga0105245_102020042 318
199 3300009147 Ga0114129_10000977 Ga0114129_1000097719 318
200 3300009147 Ga0114129_10355517 Ga0114129_103555172 318
201 3300009147 Ga0114129_10448952 Ga0114129_104489522 318
202 3300009174 Ga0105241_10042991 Ga0105241_100429915 318
203 3300010375 Ga0105239_10159253 Ga0105239_101592532 318
204 3300011119 Ga0105246_10222363 Ga0105246_102223631 318
205 3300013306 Ga0163162_10463863 Ga0163162_104638631 318
206 3300025972 Ga0207668_10103788 Ga0207668_101037882 318
207 3300026075 Ga0207708_10161633 Ga0207708_101616331 318
208 3300027907 Ga0207428_10033649 Ga0207428_100336492 318
209 3300027907 Ga0207428_10165991 Ga0207428_101659912 318
210 3300037418 Ga0395900_0029285 Ga0395900_0029285_2010_2966 318
211 3300037471 Ga0395905_0001481 Ga0395905_0001481_9993_10976 318
212 3300037471 Ga0395905_0152442 Ga0395905_0152442_113_1069 318
213 3300038443 Ga0395901_0221571 Ga0395901_0221571_43_999 318
214 3300044658 Ga0466972_0053238 Ga0466972_0053238_419_1375 318
215 3300048909 Ga0496106_0233848 Ga0496106_0233848_98_1192 318
216 3300048913 Ga0496110_0140347 Ga0496110_0140347_843_1799 318
217 3300048922 Ga0496119_0031911 Ga0496119_0031911_1336_2292 318
218 3300048923 Ga0496120_0001687 Ga0496120_0001687_16190_17146 318
219 3300048923 Ga0496120_0039794 Ga0496120_0039794_395_1351 318
220 3300049568 Ga0501031_0032347 Ga0501031_0032347_941_2035 318
221 3300049571 Ga0501034_0000302 Ga0501034_0000302_86448_87443 318
222 3300049572 Ga0501036_0014748 Ga0501036_0014748_1865_2959 318
223 3300049572 Ga0501036_0097160 Ga0501036_0097160_921_1916 318
224 3300049574 Ga0501038_0020136 Ga0501038_0020136_1301_2395 318
225 3300049574 Ga0501038_0099895 Ga0501038_0099895_467_1561 318
226 3300049574 Ga0501038_0203813 Ga0501038_0203813_132_1226 318
227 3300049575 Ga0501039_0001875 Ga0501039_0001875_8094_9188 318
228 3300049575 Ga0501039_0039043 Ga0501039_0039043_2479_3573 318
229 3300049575 Ga0501039_0054009 Ga0501039_0054009_931_2025 318
230 3300049576 Ga0501040_0000694 Ga0501040_0000694_16131_17225 318
231 3300049576 Ga0501040_0008017 Ga0501040_0008017_1886_2980 318
232 3300049577 Ga0501041_0000010 Ga0501041_0000010_7806_8900 318
233 3300049577 Ga0501041_0057562 Ga0501041_0057562_964_2058 318
234 3300049578 Ga0501042_0000074 Ga0501042_0000074_32876_33970 318
235 3300049578 Ga0501042_0022515 Ga0501042_0022515_1284_2378 318
236 3300049578 Ga0501042_0075894 Ga0501042_0075894_18_1112 318
237 3300049579 Ga0501043_0013030 Ga0501043_0013030_185_1279 318
238 3300049580 Ga0501046_0004035 Ga0501046_0004035_7992_9086 318
239 3300049580 Ga0501046_0291218 Ga0501046_0291218_71_1165 318
240 3300049582 Ga0501048_0014467 Ga0501048_0014467_4293_5387 318
241 3300049582 Ga0501048_0020719 Ga0501048_0020719_543_1637 318
242 3300049584 Ga0501068_0129887 Ga0501068_0129887_208_1302 318
243 3300049584 Ga0501068_0226754 Ga0501068_0226754_70_1164 318
244 3300049586 Ga0501070_0069484 Ga0501070_0069484_413_1507 318
245 3300049586 Ga0501070_0069539 Ga0501070_0069539_1538_2494 318
246 3300049586 Ga0501070_0173629 Ga0501070_0173629_104_1198 318
247 3300049587 Ga0501071_0000002 Ga0501071_0000002_99444_100538 318
248 3300049587 Ga0501071_0021035 Ga0501071_0021035_687_1781 318
249 3300049588 Ga0501072_0000552 Ga0501072_0000552_19463_20557 318
250 3300049588 Ga0501072_0120993 Ga0501072_0120993_745_1839 318
251 3300049588 Ga0501072_0124529 Ga0501072_0124529_917_2011 318
252 3300049588 Ga0501072_0249052 Ga0501072_0249052_221_1315 318
253 3300049590 Ga0501074_0001117 Ga0501074_0001117_14462_15556 318
254 3300049590 Ga0501074_0109723 Ga0501074_0109723_271_1365 318
255 3300049590 Ga0501074_0178739 Ga0501074_0178739_337_1431 318
256 3300049591 Ga0501075_0000438 Ga0501075_0000438_3457_4551 318
257 3300049591 Ga0501075_0002105 Ga0501075_0002105_12063_13157 318
258 3300049591 Ga0501075_0107371 Ga0501075_0107371_61_1155 318
259 3300049591 Ga0501075_0242812 Ga0501075_0242812_123_1217 318
260 3300049592 Ga0501076_0001978 Ga0501076_0001978_11603_12697 318
261 3300049592 Ga0501076_0003443 Ga0501076_0003443_5173_6267 318
262 3300049592 Ga0501076_0019551 Ga0501076_0019551_3832_4926 318
263 3300049592 Ga0501076_0029963 Ga0501076_0029963_2766_3860 318
264 3300049592 Ga0501076_0118373 Ga0501076_0118373_25_1119 318
265 3300049592 Ga0501076_0158502 Ga0501076_0158502_271_1365 318
266 3300049592 Ga0501076_0369717 Ga0501076_0369717_19_1113 318
267 3300049593 Ga0501077_0000579 Ga0501077_0000579_17746_18840 318
268 3300049741 Ga0501079_0000559 Ga0501079_0000559_15203_16297 318
269 3300049741 Ga0501079_0021956 Ga0501079_0021956_2993_4087 318
270 3300049741 Ga0501079_0071671 Ga0501079_0071671_651_1745 318
271 3300049742 Ga0501080_0001834 Ga0501080_0001834_13046_14140 318
272 3300049743 Ga0501081_0003100 Ga0501081_0003100_8395_9489 318
273 3300049743 Ga0501081_0005987 Ga0501081_0005987_697_1791 318
274 3300049743 Ga0501081_0017358 Ga0501081_0017358_1836_2930 318
275 3300049743 Ga0501081_0069589 Ga0501081_0069589_1188_2282 318
276 3300049743 Ga0501081_0100003 Ga0501081_0100003_176_1270 318
277 3300049743 Ga0501081_0209033 Ga0501081_0209033_233_1327 318
278 3300049744 Ga0501083_0007292 Ga0501083_0007292_1609_2703 318
279 3300049822 Ga0501035_0006656 Ga0501035_0006656_6198_7292 318
280 3300049822 Ga0501035_0195149 Ga0501035_0195149_32_1126 318
281 3300049823 Ga0501044_0137013 Ga0501044_0137013_365_1459 318
282 3300049824 Ga0501045_0000471 Ga0501045_0000471_16059_17153 318
283 3300049824 Ga0501045_0044858 Ga0501045_0044858_78_1172 318
284 3300049824 Ga0501045_0107355 Ga0501045_0107355_938_2032 318
285 3300049824 Ga0501045_0141128 Ga0501045_0141128_209_1303 318
286 3300049824 Ga0501045_0177201 Ga0501045_0177201_83_1177 318
287 3300050489 nmdc:mga03683_98740_c1 nmdc:mga03683_98740_c1_285_1241 318
288 3300050492 nmdc:mga0yw44_5882_c1 nmdc:mga0yw44_5882_c1_1187_2143 318
289 3300050493 nmdc:mga0k408_45530_c1 nmdc:mga0k408_45530_c1_663_1619 318
290 3300050495 nmdc:mga04h51_55674_c1 nmdc:mga04h51_55674_c1_280_1236 318
291 3300050507 nmdc:mga05p37_18875_c1 nmdc:mga05p37_18875_c1_6503_7597 318
292 3300050507 nmdc:mga05p37_29718_c1 nmdc:mga05p37_29718_c1_425_1519 318
293 3300050507 nmdc:mga05p37_318_c1 nmdc:mga05p37_318_c1_15573_16667 318
294 3300050509 nmdc:mga0qj67_64675_c1 nmdc:mga0qj67_64675_c1_1636_2730 318
295 3300050510 nmdc:mga06r32_176490_c1 nmdc:mga06r32_176490_c1_702_1796 318
296 3300050510 nmdc:mga06r32_91044_c1 nmdc:mga06r32_91044_c1_938_2032 318
297 3300050511 nmdc:mga08y16_16415_c1 nmdc:mga08y16_16415_c1_2016_3110 318
298 3300050515 nmdc:mga0a205_95769_c1 nmdc:mga0a205_95769_c1_1667_2761 318
299 3300054114 Ga0501084_0013773 Ga0501084_0013773_455_1549 318
300 3300054114 Ga0501084_0018337 Ga0501084_0018337_1971_3065 318
301 3300054114 Ga0501084_0024487 Ga0501084_0024487_480_1574 318
302 3300054114 Ga0501084_0064107 Ga0501084_0064107_835_1929 318
303 3300060353 Ga0501082_0000675 Ga0501082_0000675_15203_16297 318
304 3300060353 Ga0501082_0138363 Ga0501082_0138363_69_1163 318
305 3300061734 Ga0530510_0000525 Ga0530510_0000525_12090_13184 318
306 3300061734 Ga0530510_0001238 Ga0530510_0001238_14867_15961 318
307 3300061734 Ga0530510_0073616 Ga0530510_0073616_474_1568 318
308 3300061734 Ga0530510_0093004 Ga0530510_0093004_499_1593 318
309 3300005295 Ga0065707_10130544 Ga0065707_101305442 319
310 3300005467 Ga0070706_100212818 Ga0070706_1002128182 319
311 3300006175 Ga0070712_100003421 Ga0070712_10000342112 319
312 3300026088 Ga0207641_10010425 Ga0207641_100104253 319
313 3300031824 Ga0307413_10095618 Ga0307413_100956182 319
314 3300032002 Ga0307416_100114071 Ga0307416_1001140712 319
315 3300049580 Ga0501046_0017760 Ga0501046_0017760_3846_4871 319
316 3300049581 Ga0501047_0000157 Ga0501047_0000157_25938_26963 319
317 iso_pu_bacteria 2503198000 2503202963 319
318 iso_pu_bacteria 2508501123 2509115316 319
319 iso_pu_bacteria 2508501127 2509144319 319
320 iso_pu_bacteria 2509276018 2509372455 319
321 iso_pu_bacteria 2509276022 2509397440 319
322 iso_pu_bacteria 2510065059 2510319480 319
323 iso_pu_bacteria 2511231027 2511392524 319
324 iso_pu_bacteria 2512875016 2512930215 319
325 iso_pu_bacteria 2512875024 2512957934 319
326 iso_pu_bacteria 2513237090 2513611703 319
327 iso_pu_bacteria 2513237164 2514032897 319
328 iso_pu_bacteria 2513237305 2514418788 319
329 iso_pu_bacteria 2513237351 2514588841 319
330 iso_pu_bacteria 2534681786 2535484516 319
331 iso_pu_bacteria 2588253730 2588515851 319
332 iso_pu_bacteria 2597489875 2597814420 319
333 iso_pu_bacteria 2599185301 2599937479 319
334 iso_pu_bacteria 2643221550 2643773160 319
335 iso_pu_bacteria 2643221564 2643839884 319
336 iso_pu_bacteria 2643221595 2643986809 319
337 iso_pu_bacteria 2643221623 2644130169 319
338 iso_pu_bacteria 2643221627 2644157654 319
339 iso_pu_bacteria 2643221653 2644296739 319
340 iso_pu_bacteria 2643221719 2644654993 319
341 iso_pu_bacteria 2687453392 2688599844 319
342 iso_pu_bacteria 2693429783 2694633885 319
343 iso_pu_bacteria 2693429784 2694637710 319
344 iso_pu_bacteria 2721755686 2723576597 319
345 iso_pu_bacteria 2738543024 2739308793 319
346 iso_pu_bacteria 2751185800 2753359077 319
347 iso_pu_bacteria 2756170246 2756675590 319
348 iso_pu_bacteria 2757320392 2757571672 319
349 iso_pu_bacteria 2758568016 2758641316 319
350 iso_pu_bacteria 2765235802 2765465331 319
351 iso_pu_bacteria 2767802442 2770197801 319
352 iso_pu_bacteria 2775506902 2776271834 319
353 iso_pu_bacteria 2775506904 2776279651 319
354 iso_pu_bacteria 2791355123 2792745874 319
355 iso_pu_bacteria 2818991272 2819242439 319
356 iso_pu_bacteria 2818991461 2819684014 319
357 iso_pu_bacteria 2837651117 2837652706 319
358 iso_pu_bacteria 2839993093 2839995774 319
359 iso_pu_bacteria 2840764183 2840769805 319
360 iso_pu_bacteria 2841734538 2841740778 319
361 iso_pu_bacteria 2842871566 2842874390 319
362 iso_pu_bacteria 2844002411 2844006089 319
363 iso_pu_bacteria 2844009547 2844015105 319
364 iso_pu_bacteria 2847670302 2847671026 319
365 iso_pu_bacteria 2847686936 2847687191 319
366 iso_pu_bacteria 2854911287 2854914613 319
367 iso_pu_bacteria 2856314179 2856316521 319
368 iso_pu_bacteria 2856320880 2856324703 319
369 iso_pu_bacteria 2856328259 2856333096 319
370 iso_pu_bacteria 2856334872 2856337655 319
371 iso_pu_bacteria 2856342000 2856342629 319
372 iso_pu_bacteria 2856364286 2856371093 319
373 iso_pu_bacteria 2857349434 2857355442 319
374 iso_pu_bacteria 2857367948 2857369366 319
375 iso_pu_bacteria 2869162929 2869165547 319
376 iso_pu_bacteria 2869169390 2869174678 319
377 iso_pu_bacteria 2869234852 2869238370 319
378 iso_pu_bacteria 2869242130 2869247307 319
379 iso_pu_bacteria 2869249662 2869251341 319
380 iso_pu_bacteria 2869256925 2869259928 319
381 iso_pu_bacteria 2869264136 2869269242 319
382 iso_pu_bacteria 2869271264 2869277033 319
383 iso_pu_bacteria 2869278585 2869281302 319
384 iso_pu_bacteria 2869285874 2869292014 319
385 iso_pu_bacteria 2871429161 2871435221 319
386 iso_pu_bacteria 2871444079 2871451294 319
387 iso_pu_bacteria 2871451962 2871458334 319
388 iso_pu_bacteria 2871459585 2871460878 319
389 iso_pu_bacteria 2871466892 2871472150 319
390 iso_pu_bacteria 2871474448 2871479832 319
391 iso_pu_bacteria 2871481445 2871482261 319
392 iso_pu_bacteria 2871488783 2871488934 319
393 iso_pu_bacteria 2871495908 2871496100 319
394 iso_pu_bacteria 2874109183 2874110097 319
395 iso_pu_bacteria 2874116593 2874123424 319
396 iso_pu_bacteria 2874123672 2874126187 319
397 iso_pu_bacteria 2874131515 2874133164 319
398 iso_pu_bacteria 2874139085 2874141032 319
399 iso_pu_bacteria 2874146452 2874151145 319
400 iso_pu_bacteria 2874155637 2874161172 319
401 iso_pu_bacteria 2874162495 2874167805 319
402 iso_pu_bacteria 2874168670 2874170287 319
403 iso_pu_bacteria 2876363079 2876366220 319
404 iso_pu_bacteria 2876386047 2876386266 319
405 iso_pu_bacteria 2876392853 2876395399 319
406 iso_pu_bacteria 2876399893 2876403497 319
407 iso_pu_bacteria 2876406927 2876407438 319
408 iso_pu_bacteria 2876413966 2876417165 319
409 iso_pu_bacteria 2876420981 2876421309 319
410 iso_pu_bacteria 2878035449 2878036855 319
411 iso_pu_bacteria 2878730984 2878736137 319
412 iso_pu_bacteria 2878738818 2878742812 319
413 iso_pu_bacteria 2878745973 2878752356 319
414 iso_pu_bacteria 2878753008 2878753696 319
415 iso_pu_bacteria 2878760144 2878760333 319
416 iso_pu_bacteria 2878767105 2878767293 319
417 iso_pu_bacteria 2878774303 2878779868 319
418 iso_pu_bacteria 2878788777 2878796589 319
419 iso_pu_bacteria 2881147464 2881152424 319
420 iso_pu_bacteria 2881155292 2881156556 319
421 iso_pu_bacteria 2881161766 2881161935 319
422 iso_pu_bacteria 2881845957 2881846161 319
423 iso_pu_bacteria 2881861095 2881864102 319
424 iso_pu_bacteria 2882632389 2882633615 319
425 iso_pu_bacteria 2882912400 2882918545 319
426 iso_pu_bacteria 2885305155 2885310816 319
427 iso_pu_bacteria 2885312484 2885316716 319
428 iso_pu_bacteria 2885326080 2885329084 319
429 iso_pu_bacteria 2885342637 2885347807 319
430 iso_pu_bacteria 2885350715 2885355540 319
431 iso_pu_bacteria 2888343758 2888348203 319
432 iso_pu_bacteria 2889010040 2889012083 319
433 iso_pu_bacteria 2889016732 2889022988 319
434 iso_pu_bacteria 2889790730 2889793951 319
435 iso_pu_bacteria 2894652903 2894654762 319
436 iso_pu_bacteria 2903448605 2903452424 319
437 iso_pu_bacteria 2903492973 2903495593 319
438 iso_pu_bacteria 2903492973 2903505471 319
439 iso_pu_bacteria 2903521522 2903524088 319
440 iso_pu_bacteria 2903528002 2903533729 319
441 iso_pu_bacteria 2903540706 2903540895 319
442 iso_pu_bacteria 2904578770 2904581499 319
443 iso_pu_bacteria 2904659560 2904662029 319
444 iso_pu_bacteria 2906308376 2906314750 319
445 iso_pu_bacteria 2906321335 2906327922 319
446 iso_pu_bacteria 2906328253 2906332796 319
447 iso_pu_bacteria 2906363423 2906369784 319
448 iso_pu_bacteria 2906370794 2906372719 319
449 iso_pu_bacteria 2906378014 2906386378 319
450 iso_pu_bacteria 2906386501 2906387843 319
451 iso_pu_bacteria 2906393657 2906393975 319
452 iso_pu_bacteria 2906401398 2906405873 319
453 iso_pu_bacteria 2906408224 2906409522 319
454 iso_pu_bacteria 2906414383 2906416658 319
455 iso_pu_bacteria 2906427513 2906428122 319
456 iso_pu_bacteria 2915650412 2915651589 319
457 iso_pu_bacteria 2919119836 2919122733 319
458 iso_pu_bacteria 2922151315 2922153835 319
459 iso_pu_bacteria 2922158528 2922159132 319
460 iso_pu_bacteria 2922172374 2922175927 319
461 iso_pu_bacteria 2922178524 2922181462 319
462 iso_pu_bacteria 2924726620 2924729968 319
463 iso_pu_bacteria 2924733363 2924735088 319
464 iso_pu_bacteria 2924741084 2924743371 319
465 iso_pu_bacteria 2924748358 2924752074 319
466 iso_pu_bacteria 2924754689 2924758359 319
467 iso_pu_bacteria 2924762789 2924763482 319
468 iso_pu_bacteria 2924776078 2924780612 319
469 iso_pu_bacteria 2924784321 2924789985 319
470 iso_pu_bacteria 2928521798 2928524572 319
471 iso_pu_bacteria 2937813078 2937821077 319
472 iso_pu_bacteria 2937822353 2937823629 319
473 iso_pu_bacteria 2937836603 2937836949 319
474 iso_pu_bacteria 2937843397 2937845451 319
475 iso_pu_bacteria 2937848649 2937854417 319
476 iso_pu_bacteria 2937861824 2937868839 319
477 iso_pu_bacteria 2937868953 2937870889 319
478 iso_pu_bacteria 2937877337 2937879886 319
479 iso_pu_bacteria 2937891427 2937896685 319
480 iso_pu_bacteria 2937972304 2937974518 319
481 iso_pu_bacteria 2937980651 2937985970 319
482 iso_pu_bacteria 2937994558 2937994750 319
483 iso_pu_bacteria 2954011201 2954015234 319
484 iso_pu_bacteria 2958034702 2958037264 319
485 iso_pu_bacteria 2958041894 2958046976 319
486 iso_pu_bacteria 2958064165 2958067489 319
487 iso_pu_bacteria 2958071322 2958076776 319
488 iso_pu_bacteria 2958084443 2958087064 319
489 iso_pu_bacteria 2958100919 2958107975 319
490 iso_pu_bacteria 2958108152 2958111197 319
491 iso_pu_bacteria 2958115193 2958117827 319
492 iso_pu_bacteria 2958122699 2958127689 319
493 iso_pu_bacteria 2958130278 2958136414 319
494 iso_pu_bacteria 2958137437 2958141523 319
495 iso_pu_bacteria 2958158011 2958164551 319
496 iso_pu_bacteria 2958165035 2958165228 319
497 iso_pu_bacteria 2958172287 2958173310 319
498 iso_pu_bacteria 2958179912 2958185881 319
499 iso_pu_bacteria 2961077736 2961084362 319
500 iso_pu_bacteria 2961114664 2961117183 319
501 iso_pu_bacteria 2961127735 2961133165 319
502 iso_pu_bacteria 2961163497 2961163689 319
503 iso_pu_bacteria 2961170736 2961170884 319
504 iso_pu_bacteria 2961183825 2961188600 319
505 iso_pu_bacteria 2963644680 2963649016 319
506 iso_pu_bacteria 2965018300 2965018491 319
507 iso_pu_bacteria 2965025482 2965030369 319
508 iso_pu_bacteria 2965032056 2965034161 319
509 iso_pu_bacteria 2965047637 2965051644 319
510 iso_pu_bacteria 2965062239 2965063943 319
511 iso_pu_bacteria 2965110997 2965115245 319
512 iso_pu_bacteria 2965119406 2965126311 319
513 iso_pu_bacteria 2967996073 2968003463 319
514 iso_pu_bacteria 2968003550 2968004230 319
515 iso_pu_bacteria 2968016561 2968019917 319
516 iso_pu_bacteria 2968083720 2968084204 319
517 iso_pu_bacteria 2968091066 2968096841 319
518 iso_pu_bacteria 2968097103 2968100118 319
519 iso_pu_bacteria 2968110612 2968113091 319
520 iso_pu_bacteria 2968117919 2968123743 319
521 iso_pu_bacteria 2968128360 2968133005 319
522 iso_pu_bacteria 2968138860 2968140101 319
523 iso_pu_bacteria 2968171901 2968172091 319
524 iso_pu_bacteria 2970469710 2970473238 319
525 iso_pu_bacteria 2970489779 2970495368 319
526 iso_pu_bacteria 2970503327 2970503474 319
527 iso_pu_bacteria 2970510686 2970516193 319
528 iso_pu_bacteria 2970524798 2970531458 319
529 iso_pu_bacteria 2970547951 2970549105 319
530 iso_pu_bacteria 2970554993 2970555183 319
531 iso_pu_bacteria 2970593180 2970595906 319
532 iso_pu_bacteria 2970619444 2970622016 319
533 iso_pu_bacteria 2970627176 2970628923 319
534 iso_pu_bacteria 2977821940 2977822911 319
535 iso_pu_bacteria 2977828996 2977835522 319
536 iso_pu_bacteria 2977843712 2977849721 319
537 iso_pu_bacteria 2977851361 2977858017 319
538 iso_pu_bacteria 2977858184 2977861759 319
539 iso_pu_bacteria 2977864932 2977866732 319
540 iso_pu_bacteria 2977872689 2977876271 319
541 iso_pu_bacteria 2977898635 2977903524 319
542 iso_pu_bacteria 2977907340 2977914520 319
543 iso_pu_bacteria 2977922695 2977926831 319
544 iso_pu_bacteria 2977935797 2977939268 319
545 iso_pu_bacteria 2977942078 2977948945 319
546 iso_pu_bacteria 2977950692 2977956860 319
547 iso_pu_bacteria 2977957713 2977962618 319
548 iso_pu_bacteria 2977986579 2977987182 319
549 iso_pu_bacteria 2979710463 2979711683 319
550 iso_pu_bacteria 2979764755 2979768504 319
551 iso_pu_bacteria 2979779861 2979780268 319
552 iso_pu_bacteria 2979793036 2979799228 319
553 iso_pu_bacteria 2979808191 2979815703 319
554 iso_pu_bacteria 2987636660 2987640575 319
555 iso_pu_bacteria 2987645492 2987650978 319
556 iso_pu_bacteria 2987652177 2987653780 319
557 iso_pu_bacteria 2987659509 2987659696 319
558 iso_pu_bacteria 2989776772 2989778281 319
559 iso_pu_bacteria 2996310559 2996312192 319
560 iso_pu_bacteria 2996336353 2996340761 319
561 iso_pu_bacteria 2996341866 2996345739 319
562 iso_pu_bacteria 2996348954 2996351660 319
563 iso_pu_bacteria 2996386984 2996389460 319
564 iso_pu_bacteria 3000135777 3000138940 319
565 iso_pu_bacteria 3002141150 3002143470 319
566 iso_pu_bacteria 3004167301 3004170542 319
567 iso_pu_bacteria 3004188549 3004188740 319
568 iso_pu_bacteria 3004195979 3004201191 319
569 iso_pu_bacteria 3004203850 3004208773 319
570 iso_pu_bacteria 3004211236 3004214957 319
571 iso_pu_bacteria 3004218560 3004222452 319
572 iso_pu_bacteria 3004232784 3004233099 319
573 iso_pu_bacteria 3004239961 3004247177 319
574 iso_pu_bacteria 3004275668 3004278360 319
575 iso_pu_bacteria 637000159 637079995 319
576 iso_pu_bacteria 649633066 649874323 319
577 iso_pu_bacteria 8002285264 8002285316 319
578 iso_pu_bacteria 8004300914 8004303649 319
579 iso_pu_bacteria 8004312739 8004315465 319
580 iso_pu_bacteria 8004374579 8004375267 319
581 iso_pu_bacteria 8004387939 8004395006 319
582 iso_pu_bacteria 8004633249 8004635900 319
583 iso_pu_bacteria 8004640170 8004642960 319
584 iso_pu_bacteria 8004695233 8004701503 319
585 iso_pu_bacteria 8004703790 8004711710 319
586 iso_pu_bacteria 8004714634 8004721011 319
587 iso_pu_bacteria 8055617313 8055622380 319
588 3300002067 JGI24735J21928_10001139 JGI24735J21928_100011393 320
589 3300003320 rootH2_10025044 rootH2_100250442 320
590 3300003323 rootH1_10012854 rootH1_100128543 320
591 3300005334 Ga0068869_100008715 Ga0068869_1000087152 320
592 3300005444 Ga0070694_100155277 Ga0070694_1001552771 320
593 3300005445 Ga0070708_100008304 Ga0070708_1000083045 320
594 3300005445 Ga0070708_100101575 Ga0070708_1001015752 320
595 3300005459 Ga0068867_100080138 Ga0068867_1000801382 320
596 3300005467 Ga0070706_100008474 Ga0070706_1000084743 320
597 3300005468 Ga0070707_100004103 Ga0070707_1000041032 320
598 3300005468 Ga0070707_100128562 Ga0070707_1001285622 320
599 3300005471 Ga0070698_100103437 Ga0070698_1001034372 320
600 3300005518 Ga0070699_100041963 Ga0070699_1000419631 320
601 3300005545 Ga0070695_100001839 Ga0070695_1000018396 320
602 3300005546 Ga0070696_100008411 Ga0070696_1000084116 320
603 3300005549 Ga0070704_100057722 Ga0070704_1000577222 320
604 3300005843 Ga0068860_100033861 Ga0068860_1000338613 320
605 3300005844 Ga0068862_100010573 Ga0068862_1000105736 320
606 3300009147 Ga0114129_10610156 Ga0114129_106101562 320
607 3300009553 Ga0105249_10060995 Ga0105249_100609952 320
608 3300025910 Ga0207684_10007744 Ga0207684_100077443 320
609 3300025922 Ga0207646_10015361 Ga0207646_100153615 320
610 3300025922 Ga0207646_10055940 Ga0207646_100559403 320
611 3300025935 Ga0207709_10201684 Ga0207709_102016841 320
612 3300025942 Ga0207689_10007335 Ga0207689_100073357 320
613 3300025961 Ga0207712_10096398 Ga0207712_100963982 320
614 3300026089 Ga0207648_10097245 Ga0207648_100972453 320
615 3300028380 Ga0268265_10013573 Ga0268265_100135735 320
616 3300028381 Ga0268264_10041618 Ga0268264_100416183 320
617 3300031911 Ga0307412_10000131 Ga0307412_1000013125 320
618 3300044712 Ga0453684_0221830 Ga0453684_0221830_103_1203 320
619 3300049592 Ga0501076_0060798 Ga0501076_0060798_23_1135 320
620 3300049593 Ga0501077_0079777 Ga0501077_0079777_172_1284 320
621 3300049742 Ga0501080_0048146 Ga0501080_0048146_2431_3543 320
622 3300049743 Ga0501081_0008804 Ga0501081_0008804_3869_4981 320
623 3300050507 nmdc:mga05p37_358455_c1 nmdc:mga05p37_358455_c1_38_1138 320
624 3300054114 Ga0501084_0036034 Ga0501084_0036034_1776_2888 320
625 3300060353 Ga0501082_0087225 Ga0501082_0087225_1165_2277 320
626 3300061734 Ga0530510_0053252 Ga0530510_0053252_841_1953 320
627 iso_pu_bacteria 2524023250 2524612876 320
628 iso_pu_bacteria 2889914905 2889915821 320
629 iso_pu_bacteria 2894817345 2894819779 320
630 iso_pu_bacteria 641736151 642425665 320
631 3300046476 Ga0495662_0003042 Ga0495662_0003042_7220_8194 322
632 3300049568 Ga0501031_0018777 Ga0501031_0018777_521_1495 322
633 3300049570 Ga0501033_0012044 Ga0501033_0012044_2979_3953 322
634 3300049571 Ga0501034_0017525 Ga0501034_0017525_4782_5756 322
635 3300049581 Ga0501047_0003989 Ga0501047_0003989_9882_10856 322
636 3300049586 Ga0501070_0025811 Ga0501070_0025811_3058_4032 322
637 3300049742 Ga0501080_0156703 Ga0501080_0156703_25_999 322
638 3300049823 Ga0501044_0011903 Ga0501044_0011903_4804_5778 322
639 3300001979 JGI24740J21852_10007842 JGI24740J21852_100078425 323
640 3300002741 JGI25157J39369_1000849 JGI25157J39369_100084913 323
641 3300003214 JGI25165J46597_1000219 JGI25165J46597_100021975 323
642 3300003578 Ga0006562J51391_1008400 Ga0006562J51391_10084004 323
643 3300003762 Ga0055542_1000572 Ga0055542_10005723 323
644 3300003763 Ga0055529_1003128 Ga0055529_10031281 323
645 3300005262 Ga0065165_1001977 Ga0065165_10019774 323
646 3300005436 Ga0070713_100138922 Ga0070713_1001389222 323
647 3300005548 Ga0070665_100003727 Ga0070665_10000372721 323
648 3300005548 Ga0070665_100159776 Ga0070665_1001597762 323
649 3300005563 Ga0068855_100113372 Ga0068855_1001133725 323
650 3300005578 Ga0068854_100089153 Ga0068854_1000891532 323
651 3300005614 Ga0068856_100200983 Ga0068856_1002009833 323
652 3300005616 Ga0068852_100094392 Ga0068852_1000943921 323
653 3300006038 Ga0075365_10002014 Ga0075365_100020146 323
654 3300006038 Ga0075365_10087327 Ga0075365_100873272 323
655 3300006048 Ga0075363_100028371 Ga0075363_1000283713 323
656 3300006163 Ga0070715_10124045 Ga0070715_101240452 323
657 3300006177 Ga0075362_10019633 Ga0075362_100196332 323
658 3300006178 Ga0075367_10019474 Ga0075367_100194742 323
659 3300006881 Ga0068865_100096498 Ga0068865_1000964983 323
660 3300025250 Ga0209026_1000002 Ga0209026_1000002837 323
661 3300025254 Ga0209148_1000038 Ga0209148_1000038476 323
662 3300025256 Ga0209759_1000156 Ga0209759_100015648 323
663 3300025261 Ga0209233_1000258 Ga0209233_100025875 323
664 3300025261 Ga0209233_1009319 Ga0209233_10093191 323
665 3300025272 Ga0209455_1000376 Ga0209455_100037622 323
666 3300025297 Ga0209758_1008950 Ga0209758_10089507 323
667 3300025903 Ga0207680_10035673 Ga0207680_100356732 323
668 3300025904 Ga0207647_10008543 Ga0207647_100085438 323
669 3300025905 Ga0207685_10046411 Ga0207685_100464112 323
670 3300025913 Ga0207695_10494764 Ga0207695_104947641 323
671 3300025914 Ga0207671_10014553 Ga0207671_100145533 323
672 3300025914 Ga0207671_10179387 Ga0207671_101793872 323
673 3300025924 Ga0207694_10010009 Ga0207694_1001000911 323
674 3300025927 Ga0207687_10158394 Ga0207687_101583941 323
675 3300025939 Ga0207665_10136885 Ga0207665_101368852 323
676 3300025949 Ga0207667_10261796 Ga0207667_102617962 323
677 3300025949 Ga0207667_10266432 Ga0207667_102664322 323
678 3300025981 Ga0207640_10041060 Ga0207640_100410602 323
679 3300026041 Ga0207639_10042288 Ga0207639_100422886 323
680 3300026041 Ga0207639_10112174 Ga0207639_101121742 323
681 3300026078 Ga0207702_10223646 Ga0207702_102236462 323
682 3300026078 Ga0207702_10294481 Ga0207702_102944812 323
683 3300026089 Ga0207648_10190385 Ga0207648_101903851 323
684 3300026121 Ga0207683_10094039 Ga0207683_100940394 323
685 3300027866 Ga0209813_10025597 Ga0209813_100255972 323
686 3300028379 Ga0268266_10054796 Ga0268266_100547962 323
687 3300028379 Ga0268266_10298381 Ga0268266_102983812 323
688 3300035083 Ga0373926_0039620 Ga0373926_0039620_531_1508 323
689 3300035111 Ga0373923_0001019 Ga0373923_0001019_1070_2047 323
690 3300035113 Ga0373936_0000230 Ga0373936_0000230_3855_4832 323
691 3300035116 Ga0373945_0001082 Ga0373945_0001082_5385_6362 323
692 3300035117 Ga0373953_0000282 Ga0373953_0000282_10909_11886 323
693 3300035118 Ga0373954_0000163 Ga0373954_0000163_6796_7773 323
694 3300035171 Ga0373946_0000412 Ga0373946_0000412_5967_6944 323
695 3300035172 Ga0373955_0000071 Ga0373955_0000071_30377_31354 323
696 3300035410 Ga0373924_0002670 Ga0373924_0002670_3367_4344 323
697 3300035692 Ga0373935_0001582 Ga0373935_0001582_89_1066 323
698 3300035695 Ga0373927_0001396 Ga0373927_0001396_15104_16081 323
699 3300035724 Ga0373933_0002030 Ga0373933_0002030_1534_2511 323
700 3300035725 Ga0373947_0001895 Ga0373947_0001895_9026_10003 323
701 3300036401 Ga0373937_0000162 Ga0373937_0000162_10803_11780 323
702 3300036647 Ga0316582_0064163 Ga0316582_0064163_793_1764 323
703 3300036712 Ga0316584_0082462 Ga0316584_0082462_1300_2271 323
704 3300037068 Ga0373925_0000025 Ga0373925_0000025_100998_101975 323
705 3300037471 Ga0395905_0000995 Ga0395905_0000995_25554_26525 323
706 3300037471 Ga0395905_0079042 Ga0395905_0079042_401_1372 323
707 3300046454 Ga0495592_0000132 Ga0495592_0000132_29081_30058 323
708 3300046460 Ga0495638_0183332 Ga0495638_0183332_112_1083 323
709 3300046462 Ga0495651_0000308 Ga0495651_0000308_13097_14074 323
710 3300046463 Ga0495653_0000041 Ga0495653_0000041_83877_84854 323
711 3300046473 Ga0495582_0032493 Ga0495582_0032493_215_1192 323
712 3300046477 Ga0495664_0000005 Ga0495664_0000005_122705_123682 323
713 3300046501 Ga0495607_0071860 Ga0495607_0071860_654_1625 323
714 3300046511 Ga0495608_0000003 Ga0495608_0000003_315896_316873 323
715 3300046512 Ga0495610_0030806 Ga0495610_0030806_591_1562 323
716 3300046514 Ga0495618_0000010 Ga0495618_0000010_94050_95027 323
717 3300046516 Ga0495628_0000019 Ga0495628_0000019_52963_53940 323
718 3300046517 Ga0495630_0016988 Ga0495630_0016988_1445_2422 323
719 3300046529 Ga0495652_0000028 Ga0495652_0000028_52963_53940 323
720 3300046531 Ga0495665_0029847 Ga0495665_0029847_1796_2773 323
721 3300046533 Ga0495640_0000014 Ga0495640_0000014_107802_108779 323
722 3300046536 Ga0495587_0000026 Ga0495587_0000026_93880_94857 323
723 3300046543 Ga0495645_0000005 Ga0495645_0000005_122676_123653 323
724 3300046559 Ga0495667_0000003 Ga0495667_0000003_240980_241957 323
725 3300046559 Ga0495667_0099095 Ga0495667_0099095_539_1516 323
726 3300046642 Ga0495634_0000017 Ga0495634_0000017_70592_71569 323
727 3300046660 Ga0495625_0083324 Ga0495625_0083324_719_1690 323
728 3300046660 Ga0495625_0172444 Ga0495625_0172444_456_1427 323
729 3300046663 Ga0495635_0000024 Ga0495635_0000024_94274_95251 323
730 3300046675 Ga0495657_0000034 Ga0495657_0000034_33717_34694 323
731 3300046678 Ga0495599_0000017 Ga0495599_0000017_53282_54259 323
732 3300046679 Ga0495623_0000028 Ga0495623_0000028_23651_24628 323
733 3300046680 Ga0495646_0000015 Ga0495646_0000015_87781_88758 323
734 3300046690 Ga0495624_0070657 Ga0495624_0070657_329_1306 323
735 3300046809 Ga0495600_0000058 Ga0495600_0000058_5337_6314 323
736 3300047315 Ga0495581_0001732 Ga0495581_0001732_5895_6872 323
737 3300047317 Ga0495604_0000021 Ga0495604_0000021_52960_53937 323
738 3300047319 Ga0495674_0000005 Ga0495674_0000005_321190_322167 323
739 3300047322 Ga0495680_0000503 Ga0495680_0000503_29126_30103 323
740 3300047444 Ga0495675_0000085 Ga0495675_0000085_30388_31365 323
741 3300047471 Ga0495684_0000001 Ga0495684_0000001_52939_53916 323
742 3300047673 Ga0495593_0001873 Ga0495593_0001873_5327_6304 323
743 3300048088 Ga0495602_0000003 Ga0495602_0000003_303301_304278 323
744 3300048915 Ga0496112_0008399 Ga0496112_0008399_6403_7374 323
745 3300048925 Ga0496122_0000160 Ga0496122_0000160_29358_30329 323
746 3300048926 Ga0496123_0000034 Ga0496123_0000034_59036_60007 323
747 3300048927 Ga0496124_0000206 Ga0496124_0000206_11790_12761 323
748 3300048927 Ga0496124_0131800 Ga0496124_0131800_837_1808 323
749 3300049568 Ga0501031_0000108 Ga0501031_0000108_4406_5377 323
750 3300049568 Ga0501031_0011891 Ga0501031_0011891_527_1498 323
751 3300049569 Ga0501032_0000022 Ga0501032_0000022_85474_86445 323
752 3300049569 Ga0501032_0000031 Ga0501032_0000031_57956_58927 323
753 3300049570 Ga0501033_0000037 Ga0501033_0000037_60329_61300 323
754 3300049570 Ga0501033_0000763 Ga0501033_0000763_11051_12022 323
755 3300049570 Ga0501033_0001161 Ga0501033_0001161_11280_12251 323
756 3300049570 Ga0501033_0070246 Ga0501033_0070246_14_985 323
757 3300049571 Ga0501034_0000064 Ga0501034_0000064_130535_131506 323
758 3300049571 Ga0501034_0000269 Ga0501034_0000269_45258_46229 323
759 3300049571 Ga0501034_0044693 Ga0501034_0044693_128_1117 323
760 3300049572 Ga0501036_0000013 Ga0501036_0000013_99718_100689 323
761 3300049572 Ga0501036_0014732 Ga0501036_0014732_4091_5062 323
762 3300049572 Ga0501036_0087408 Ga0501036_0087408_1491_2480 323
763 3300049573 Ga0501037_0000016 Ga0501037_0000016_99711_100682 323
764 3300049573 Ga0501037_0000132 Ga0501037_0000132_66405_67376 323
765 3300049574 Ga0501038_0000015 Ga0501038_0000015_60346_61317 323
766 3300049574 Ga0501038_0000055 Ga0501038_0000055_3830_4801 323
767 3300049575 Ga0501039_0000013 Ga0501039_0000013_173102_174073 323
768 3300049575 Ga0501039_0000045 Ga0501039_0000045_30827_31798 323
769 3300049576 Ga0501040_0002047 Ga0501040_0002047_2118_3089 323
770 3300049579 Ga0501043_0000015 Ga0501043_0000015_77677_78648 323
771 3300049579 Ga0501043_0000388 Ga0501043_0000388_34345_35316 323
772 3300049579 Ga0501043_0152995 Ga0501043_0152995_12_1001 323
773 3300049580 Ga0501046_0200897 Ga0501046_0200897_72_1043 323
774 3300049581 Ga0501047_0001528 Ga0501047_0001528_18558_19529 323
775 3300049822 Ga0501035_0000046 Ga0501035_0000046_85283_86254 323
776 3300049822 Ga0501035_0000287 Ga0501035_0000287_11112_12083 323
777 3300049822 Ga0501035_0000306 Ga0501035_0000306_30854_31825 323
778 3300049822 Ga0501035_0027158 Ga0501035_0027158_1429_2400 323
779 3300049822 Ga0501035_0096734 Ga0501035_0096734_1611_2582 323
780 3300049823 Ga0501044_0000038 Ga0501044_0000038_60346_61317 323
781 3300049823 Ga0501044_0136312 Ga0501044_0136312_65_1054 323
782 3300049823 Ga0501044_0189941 Ga0501044_0189941_779_1750 323
783 3300050492 nmdc:mga0yw44_6871_c1 nmdc:mga0yw44_6871_c1_3466_4437 323
784 3300053077 Ga0495601_0000005 Ga0495601_0000005_50843_51820 323
785 3300053078 Ga0495612_0000001 Ga0495612_0000001_364305_365282 323
786 3300053084 Ga0495595_0000166 Ga0495595_0000166_14386_15363 323
787 3300053085 Ga0495619_0000007 Ga0495619_0000007_52963_53940 323
788 3300053136 Ga0500559_0090602 Ga0500559_0090602_360_1331 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

301

390

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

163

247

0.89

PF00108

Thiolase_N

Thiolase, N-terminal domain

96

248

0.86

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

25

228

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9857 3 323
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9853 4 323
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9805 3 323
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9799 3 323
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9794 3 323
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9877 3 171 3.40.47.10
2ebdB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9805 181 323 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9789 3 323 3.40.47.10
4ewpF01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9768 3 170 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9762 3 171 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A4V1UGK4-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9993 243 323 GO:0033818
GO:0044550
AF-A0A538M788-F1-model_v4 3-oxoacyl-ACP synthase 0.9945 224 323 GO:0016746
AF-A0A3B9NPJ8-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9938 212 323 GO:0033818
AF-A0A661PT68-F1-model_v4 3-oxoacyl-ACP synthase 0.993 8 116 GO:0016746
GO:0044550
AF-A0A800M9R9-F1-model_v4 3-oxoacyl-ACP synthase 0.992 7 155 GO:0004315
GO:0006633
GO:0044550

Feature Viewer

pLDDT pTM Quality
95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map