F480826
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 787 | 333 | 787 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10095062|Ga0070717_100950622 |
| Length | 363 |
| Sequence | MWAIDAQQFTFYERQALFMRVLITGGAGFIGSHLADAYLTRGDTVFVLDDLSTGSISNVQHLKHHPNFHYAIESVQHEATVAEAIDDCDVIFHLAAAVGVRLIIESPVRTIETNVHGTEVVLTHANKKKKPVLIASTSEVYGLSTQVPFREDDPLVIGATNKGRWSYACSKALDEFLAFAYWREKKLPVIIARLFNTIGPRQTGQYGMVVPNFVKQALSGRPITVYGDGTQTRCFVDVLDVVQALMRLMDCGDAIGQVFNIGSTEEVTILALAHRIKELINSSSEIVMIPYDQAYEQGFEDMHRRIPDTTKIRETVGFQPQRTLDEVLERIVAHWAGRDPAGRPLPQPLGERLGPLPKRAGVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 210 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 211 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 212 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.96 |
| Nodule | 0 |
| Rhizoplane | 3.05 |
| Rhizosphere | 91.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_1248874 | 2162886011 | Bacteria | 2429 |
| 2 | MBSR1b_contig_6417879 | 2162886012 | Unclassified | 1523 |
| 3 | JGI24034J26672_10012296 | 3300002239 | Bacteria | 1289 |
| 4 | JGI24751J29686_10003915 | 3300002459 | Unclassified | 3007 |
| 5 | Ga0065714_10015360 | 3300005288 | Bacteria | 1819 |
| 6 | Ga0065714_10018882 | 3300005288 | Bacteria | 1235 |
| 7 | Ga0065712_10001700 | 3300005290 | Bacteria | 5626 |
| 8 | Ga0065712_10002413 | 3300005290 | Bacteria | 5026 |
| 9 | Ga0065712_10079342 | 3300005290 | Bacteria | 3220 |
| 10 | Ga0065712_10104939 | 3300005290 | Bacteria | 1950 |
| 11 | Ga0065712_10129186 | 3300005290 | Bacteria | 1569 |
| 12 | Ga0065715_10001036 | 3300005293 | Bacteria | 8463 |
| 13 | Ga0065715_10029631 | 3300005293 | Bacteria | 1250 |
| 14 | Ga0065715_10090431 | 3300005293 | Bacteria | 7025 |
| 15 | Ga0065715_10094824 | 3300005293 | Bacteria | 4231 |
| 16 | Ga0065715_10106654 | 3300005293 | Bacteria | 2816 |
| 17 | Ga0065715_10108738 | 3300005293 | Bacteria | 2703 |
| 18 | Ga0065715_10194301 | 3300005293 | Bacteria | 1397 |
| 19 | Ga0065707_10095269 | 3300005295 | Unclassified | 3399 |
| 20 | Ga0065707_10144105 | 3300005295 | Bacteria | 1735 |
| 21 | Ga0065707_10181009 | 3300005295 | Bacteria | 1409 |
| 22 | Ga0065707_10182545 | 3300005295 | Bacteria | 1409 |
| 23 | Ga0070676_10003338 | 3300005328 | Bacteria | 8349 |
| 24 | Ga0070676_10100165 | 3300005328 | Bacteria | 1789 |
| 25 | Ga0070683_100009991 | 3300005329 | Bacteria | 8137 |
| 26 | Ga0070670_100001016 | 3300005331 | Bacteria | 22144 |
| 27 | Ga0070670_100001433 | 3300005331 | Bacteria | 19191 |
| 28 | Ga0070670_100011278 | 3300005331 | Bacteria | 7642 |
| 29 | Ga0070670_100022053 | 3300005331 | Bacteria | 5481 |
| 30 | Ga0070670_100059070 | 3300005331 | Bacteria | 3292 |
| 31 | Ga0070677_10047232 | 3300005333 | Bacteria | 1725 |
| 32 | Ga0070666_10010821 | 3300005335 | Bacteria | 5714 |
| 33 | Ga0070666_10165291 | 3300005335 | Bacteria | 1548 |
| 34 | Ga0070680_100043713 | 3300005336 | Bacteria | 3639 |
| 35 | Ga0070680_100116334 | 3300005336 | Bacteria | 2229 |
| 36 | Ga0068868_100026828 | 3300005338 | Bacteria | 4392 |
| 37 | Ga0068868_100235144 | 3300005338 | Bacteria | 1538 |
| 38 | Ga0068868_100240922 | 3300005338 | Bacteria | 1519 |
| 39 | Ga0070660_100001966 | 3300005339 | Bacteria | 14175 |
| 40 | Ga0070660_100009277 | 3300005339 | Bacteria | 6916 |
| 41 | Ga0070689_100000517 | 3300005340 | Bacteria | 22784 |
| 42 | Ga0070689_100062388 | 3300005340 | Bacteria | 2900 |
| 43 | Ga0070689_100065709 | 3300005340 | Bacteria | 2826 |
| 44 | Ga0070687_100001265 | 3300005343 | Bacteria | 8803 |
| 45 | Ga0070687_100075332 | 3300005343 | Bacteria | 1824 |
| 46 | Ga0070687_100122766 | 3300005343 | Bacteria | 1488 |
| 47 | Ga0070661_100058021 | 3300005344 | Bacteria | 2837 |
| 48 | Ga0070661_100209931 | 3300005344 | Bacteria | 1490 |
| 49 | Ga0070692_10003674 | 3300005345 | Bacteria | 6277 |
| 50 | Ga0070668_100319143 | 3300005347 | Bacteria | 1307 |
| 51 | Ga0070669_100095771 | 3300005353 | Bacteria | 2233 |
| 52 | Ga0070675_100020053 | 3300005354 | Bacteria | 5333 |
| 53 | Ga0070675_100076323 | 3300005354 | Bacteria | 2787 |
| 54 | Ga0070675_100083193 | 3300005354 | Unclassified | 2671 |
| 55 | Ga0070671_100014494 | 3300005355 | Bacteria | 6372 |
| 56 | Ga0070671_100026525 | 3300005355 | Bacteria | 4762 |
| 57 | Ga0070671_100044066 | 3300005355 | Bacteria | 3707 |
| 58 | Ga0070671_100143471 | 3300005355 | Bacteria | 2015 |
| 59 | Ga0070674_100042001 | 3300005356 | Bacteria | 3104 |
| 60 | Ga0070674_100194499 | 3300005356 | Bacteria | 1562 |
| 61 | Ga0070673_100016161 | 3300005364 | Bacteria | 5268 |
| 62 | Ga0070673_100057615 | 3300005364 | Bacteria | 3070 |
| 63 | Ga0070688_100001469 | 3300005365 | Bacteria | 11704 |
| 64 | Ga0070688_100017491 | 3300005365 | Bacteria | 4115 |
| 65 | Ga0070688_100045357 | 3300005365 | Bacteria | 2715 |
| 66 | Ga0070688_100193177 | 3300005365 | Bacteria | 1419 |
| 67 | Ga0070667_100009590 | 3300005367 | Bacteria | 8028 |
| 68 | Ga0070667_100029291 | 3300005367 | Bacteria | 4587 |
| 69 | Ga0070667_100367550 | 3300005367 | Bacteria | 1305 |
| 70 | Ga0070714_100024329 | 3300005435 | Unclassified | 4984 |
| 71 | Ga0070701_10006490 | 3300005438 | Bacteria | 4927 |
| 72 | Ga0070701_10009060 | 3300005438 | Bacteria | 4344 |
| 73 | Ga0070705_100004206 | 3300005440 | Bacteria | 7030 |
| 74 | Ga0070705_100192408 | 3300005440 | Bacteria | 1392 |
| 75 | Ga0070700_100122190 | 3300005441 | Bacteria | 1747 |
| 76 | Ga0070700_100228863 | 3300005441 | Bacteria | 1322 |
| 77 | Ga0070700_100250156 | 3300005441 | Bacteria | 1271 |
| 78 | Ga0070694_100001421 | 3300005444 | Bacteria | 14035 |
| 79 | Ga0070694_100037182 | 3300005444 | Bacteria | 3228 |
| 80 | Ga0070694_100226098 | 3300005444 | Bacteria | 1406 |
| 81 | Ga0070708_100109235 | 3300005445 | Bacteria | 2541 |
| 82 | Ga0070708_100113454 | 3300005445 | Bacteria | 2493 |
| 83 | Ga0070708_100119566 | 3300005445 | Bacteria | 2429 |
| 84 | Ga0070678_100002591 | 3300005456 | Bacteria | 9937 |
| 85 | Ga0070678_100165401 | 3300005456 | Bacteria | 1796 |
| 86 | Ga0070662_100031607 | 3300005457 | Bacteria | 3716 |
| 87 | Ga0070681_10023309 | 3300005458 | Bacteria | 6225 |
| 88 | Ga0070681_10027541 | 3300005458 | Bacteria | 5714 |
| 89 | Ga0070681_10094363 | 3300005458 | Bacteria | 2941 |
| 90 | Ga0070681_10137645 | 3300005458 | Bacteria | 2372 |
| 91 | Ga0068867_100034592 | 3300005459 | Bacteria | 3662 |
| 92 | Ga0070685_10013390 | 3300005466 | Bacteria | 4324 |
| 93 | Ga0070685_10025686 | 3300005466 | Bacteria | 3243 |
| 94 | Ga0070706_100308399 | 3300005467 | Bacteria | 1476 |
| 95 | Ga0070707_100010426 | 3300005468 | Bacteria | 8655 |
| 96 | Ga0070707_100092942 | 3300005468 | Bacteria | 2920 |
| 97 | Ga0070698_100013325 | 3300005471 | Bacteria | 8702 |
| 98 | Ga0070698_100073888 | 3300005471 | Bacteria | 3415 |
| 99 | Ga0070698_100202348 | 3300005471 | Bacteria | 1921 |
| 100 | Ga0070699_100064656 | 3300005518 | Bacteria | 3173 |
| 101 | Ga0070699_100250667 | 3300005518 | Bacteria | 1582 |
| 102 | Ga0070679_100077372 | 3300005530 | Bacteria | 3316 |
| 103 | Ga0070679_100120164 | 3300005530 | Bacteria | 2612 |
| 104 | Ga0070684_100000477 | 3300005535 | Bacteria | 27392 |
| 105 | Ga0070697_100018537 | 3300005536 | Bacteria | 5487 |
| 106 | Ga0068853_100105264 | 3300005539 | Unclassified | 2499 |
| 107 | Ga0070672_100284189 | 3300005543 | Bacteria | 1400 |
| 108 | Ga0070695_100000155 | 3300005545 | Bacteria | 32258 |
| 109 | Ga0070696_100000499 | 3300005546 | Bacteria | 24777 |
| 110 | Ga0070696_100007757 | 3300005546 | Bacteria | 7161 |
| 111 | Ga0070696_100012876 | 3300005546 | Bacteria | 5613 |
| 112 | Ga0070696_100059283 | 3300005546 | Bacteria | 2675 |
| 113 | Ga0070665_100005335 | 3300005548 | Bacteria | 13281 |
| 114 | Ga0070665_100076339 | 3300005548 | Bacteria | 3358 |
| 115 | Ga0070665_100084755 | 3300005548 | Bacteria | 3174 |
| 116 | Ga0070704_100058749 | 3300005549 | Bacteria | 2740 |
| 117 | Ga0070704_100130970 | 3300005549 | Bacteria | 1944 |
| 118 | Ga0070704_100198539 | 3300005549 | Bacteria | 1618 |
| 119 | Ga0070704_100385069 | 3300005549 | Bacteria | 1192 |
| 120 | Ga0068855_100082652 | 3300005563 | Bacteria | 3722 |
| 121 | Ga0070664_100003519 | 3300005564 | Bacteria | 12645 |
| 122 | Ga0070664_100004562 | 3300005564 | Bacteria | 11113 |
| 123 | Ga0070664_100115735 | 3300005564 | Bacteria | 2344 |
| 124 | Ga0070664_100293883 | 3300005564 | Bacteria | 1467 |
| 125 | Ga0068857_100011444 | 3300005577 | Bacteria | 7720 |
| 126 | Ga0068857_100116300 | 3300005577 | Bacteria | 2406 |
| 127 | Ga0068854_100006236 | 3300005578 | Bacteria | 7571 |
| 128 | Ga0068856_100000849 | 3300005614 | Bacteria | 32891 |
| 129 | Ga0070702_100041302 | 3300005615 | Bacteria | 2586 |
| 130 | Ga0070702_100067530 | 3300005615 | Bacteria | 2101 |
| 131 | Ga0070702_100082924 | 3300005615 | Bacteria | 1925 |
| 132 | Ga0070702_100162598 | 3300005615 | Bacteria | 1444 |
| 133 | Ga0068852_100095072 | 3300005616 | Bacteria | 2675 |
| 134 | Ga0068852_100462422 | 3300005616 | Bacteria | 1258 |
| 135 | Ga0068852_100609298 | 3300005616 | Bacteria | 1097 |
| 136 | Ga0068859_100007974 | 3300005617 | Bacteria | 10742 |
| 137 | Ga0068859_100008402 | 3300005617 | Bacteria | 10460 |
| 138 | Ga0068859_100022365 | 3300005617 | Bacteria | 6339 |
| 139 | Ga0068859_100054464 | 3300005617 | Bacteria | 4023 |
| 140 | Ga0068859_100081521 | 3300005617 | Archaea | 3278 |
| 141 | Ga0068859_100096157 | 3300005617 | Bacteria | 3015 |
| 142 | Ga0068859_100317729 | 3300005617 | Unclassified | 1651 |
| 143 | Ga0068864_100045012 | 3300005618 | Bacteria | 3785 |
| 144 | Ga0068864_100066454 | 3300005618 | Bacteria | 3130 |
| 145 | Ga0068864_100089558 | 3300005618 | Unclassified | 2711 |
| 146 | Ga0068866_10034490 | 3300005718 | Bacteria | 2465 |
| 147 | Ga0068866_10143182 | 3300005718 | Bacteria | 1375 |
| 148 | Ga0068861_100005265 | 3300005719 | Bacteria | 8722 |
| 149 | Ga0068861_100033397 | 3300005719 | Bacteria | 3795 |
| 150 | Ga0068863_100017949 | 3300005841 | Bacteria | 6771 |
| 151 | Ga0068863_100265420 | 3300005841 | Bacteria | 1660 |
| 152 | Ga0068858_100006779 | 3300005842 | Bacteria | 11141 |
| 153 | Ga0068858_100108860 | 3300005842 | Bacteria | 2587 |
| 154 | Ga0068860_100106269 | 3300005843 | Bacteria | 2681 |
| 155 | Ga0068862_100299647 | 3300005844 | Bacteria | 1479 |
| 156 | Ga0081455_10062109 | 3300005937 | Bacteria | 3141 |
| 157 | Ga0081455_10114382 | 3300005937 | Bacteria | 2138 |
| 158 | Ga0081539_10052663 | 3300005985 | Bacteria | 2283 |
| 159 | Ga0070717_10095062 | 3300006028 | Bacteria | 2522 |
| 160 | Ga0075365_10000819 | 3300006038 | Bacteria | 12831 |
| 161 | Ga0075365_10009693 | 3300006038 | Bacteria | 5558 |
| 162 | Ga0075365_10035010 | 3300006038 | Bacteria | 3246 |
| 163 | Ga0075364_10011460 | 3300006051 | Bacteria | 5385 |
| 164 | Ga0075364_10027113 | 3300006051 | Bacteria | 3658 |
| 165 | Ga0075364_10032801 | 3300006051 | Bacteria | 3339 |
| 166 | Ga0075364_10112623 | 3300006051 | Bacteria | 1817 |
| 167 | Ga0075364_10147977 | 3300006051 | Bacteria | 1582 |
| 168 | Ga0070716_100098490 | 3300006173 | Bacteria | 1787 |
| 169 | Ga0070716_100212329 | 3300006173 | Bacteria | 1294 |
| 170 | Ga0075362_10000172 | 3300006177 | Bacteria | 17809 |
| 171 | Ga0075367_10083955 | 3300006178 | Bacteria | 1930 |
| 172 | Ga0075367_10123975 | 3300006178 | Bacteria | 1593 |
| 173 | Ga0075367_10150941 | 3300006178 | Bacteria | 1442 |
| 174 | Ga0075366_10002316 | 3300006195 | Bacteria | 9736 |
| 175 | Ga0075366_10019756 | 3300006195 | Bacteria | 3904 |
| 176 | Ga0075366_10031879 | 3300006195 | Bacteria | 3102 |
| 177 | Ga0097621_100086294 | 3300006237 | Bacteria | 2619 |
| 178 | Ga0097621_100092687 | 3300006237 | Bacteria | 2531 |
| 179 | Ga0097621_100102856 | 3300006237 | Bacteria | 2405 |
| 180 | Ga0097621_100132272 | 3300006237 | Bacteria | 2124 |
| 181 | Ga0097621_100139441 | 3300006237 | Unclassified | 2071 |
| 182 | Ga0075370_10049631 | 3300006353 | Bacteria | 2379 |
| 183 | Ga0068871_100002675 | 3300006358 | Bacteria | 12162 |
| 184 | Ga0068871_100033232 | 3300006358 | Bacteria | 4083 |
| 185 | Ga0068871_100273587 | 3300006358 | Bacteria | 1476 |
| 186 | Ga0075428_100001280 | 3300006844 | Bacteria | 26808 |
| 187 | Ga0075428_100008474 | 3300006844 | Bacteria | 11405 |
| 188 | Ga0075428_100013161 | 3300006844 | Bacteria | 9202 |
| 189 | Ga0075428_100025568 | 3300006844 | Bacteria | 6536 |
| 190 | Ga0075428_100112217 | 3300006844 | Bacteria | 2969 |
| 191 | Ga0075428_100140015 | 3300006844 | Bacteria | 2631 |
| 192 | Ga0075428_100265138 | 3300006844 | Bacteria | 1849 |
| 193 | Ga0075428_100504032 | 3300006844 | Bacteria | 1295 |
| 194 | Ga0075430_100003870 | 3300006846 | Bacteria | 12607 |
| 195 | Ga0075430_100007243 | 3300006846 | Bacteria | 9369 |
| 196 | Ga0075430_100026174 | 3300006846 | Bacteria | 4964 |
| 197 | Ga0075430_100062016 | 3300006846 | Bacteria | 3141 |
| 198 | Ga0075430_100268607 | 3300006846 | Bacteria | 1412 |
| 199 | Ga0075430_100383035 | 3300006846 | Bacteria | 1161 |
| 200 | Ga0075431_100002665 | 3300006847 | Bacteria | 17289 |
| 201 | Ga0075431_100011674 | 3300006847 | Bacteria | 8863 |
| 202 | Ga0075431_100016013 | 3300006847 | Bacteria | 7608 |
| 203 | Ga0075431_100033574 | 3300006847 | Bacteria | 5288 |
| 204 | Ga0075431_100197659 | 3300006847 | Unclassified | 2058 |
| 205 | Ga0075433_10087172 | 3300006852 | Bacteria | 2757 |
| 206 | Ga0075433_10104378 | 3300006852 | Bacteria | 2511 |
| 207 | Ga0075433_10140086 | 3300006852 | Unclassified | 2150 |
| 208 | Ga0075433_10165239 | 3300006852 | Bacteria | 1970 |
| 209 | Ga0075434_100011984 | 3300006871 | Bacteria | 8204 |
| 210 | Ga0075434_100029393 | 3300006871 | Bacteria | 5407 |
| 211 | Ga0075434_100035952 | 3300006871 | Bacteria | 4898 |
| 212 | Ga0075434_100219725 | 3300006871 | Unclassified | 1920 |
| 213 | Ga0075429_100005224 | 3300006880 | Bacteria | 11168 |
| 214 | Ga0075429_100033459 | 3300006880 | Bacteria | 4467 |
| 215 | Ga0075429_100050459 | 3300006880 | Bacteria | 3619 |
| 216 | Ga0075429_100214235 | 3300006880 | Bacteria | 1687 |
| 217 | Ga0068865_100005146 | 3300006881 | Bacteria | 7915 |
| 218 | Ga0068865_100115851 | 3300006881 | Bacteria | 1984 |
| 219 | Ga0068865_100209929 | 3300006881 | Bacteria | 1517 |
| 220 | Ga0075436_100001644 | 3300006914 | Bacteria | 15270 |
| 221 | Ga0075436_100099307 | 3300006914 | Bacteria | 2026 |
| 222 | Ga0097620_100007974 | 3300006931 | Bacteria | 10742 |
| 223 | Ga0097620_100008402 | 3300006931 | Bacteria | 10460 |
| 224 | Ga0097620_100022365 | 3300006931 | Bacteria | 6339 |
| 225 | Ga0097620_100054464 | 3300006931 | Bacteria | 4023 |
| 226 | Ga0097620_100081523 | 3300006931 | Archaea | 3278 |
| 227 | Ga0097620_100096157 | 3300006931 | Bacteria | 3015 |
| 228 | Ga0097620_100317735 | 3300006931 | Unclassified | 1651 |
| 229 | Ga0075435_100000115 | 3300007076 | Bacteria | 44397 |
| 230 | Ga0075435_100000404 | 3300007076 | Bacteria | 26487 |
| 231 | Ga0105240_10009865 | 3300009093 | Bacteria | 13478 |
| 232 | Ga0105240_10062219 | 3300009093 | Bacteria | 4647 |
| 233 | Ga0105240_10068347 | 3300009093 | Bacteria | 4400 |
| 234 | Ga0111539_10000156 | 3300009094 | Bacteria | 77946 |
| 235 | Ga0111539_10001042 | 3300009094 | Bacteria | 36422 |
| 236 | Ga0111539_10002555 | 3300009094 | Bacteria | 24100 |
| 237 | Ga0111539_10015953 | 3300009094 | Bacteria | 9332 |
| 238 | Ga0111539_10052174 | 3300009094 | Bacteria | 4868 |
| 239 | Ga0111539_10055606 | 3300009094 | Bacteria | 4705 |
| 240 | Ga0111539_10071541 | 3300009094 | Bacteria | 4092 |
| 241 | Ga0111539_10480530 | 3300009094 | Bacteria | 1447 |
| 242 | Ga0111539_10482665 | 3300009094 | Bacteria | 1443 |
| 243 | Ga0105245_10015209 | 3300009098 | Bacteria | 6704 |
| 244 | Ga0105245_10103996 | 3300009098 | Bacteria | 2632 |
| 245 | Ga0105245_10229234 | 3300009098 | Bacteria | 1796 |
| 246 | Ga0105247_10057544 | 3300009101 | Bacteria | 2404 |
| 247 | Ga0114129_10000047 | 3300009147 | Bacteria | 104957 |
| 248 | Ga0114129_10000295 | 3300009147 | Bacteria | 57637 |
| 249 | Ga0114129_10000408 | 3300009147 | Bacteria | 50625 |
| 250 | Ga0114129_10011033 | 3300009147 | Bacteria | 12874 |
| 251 | Ga0114129_10020472 | 3300009147 | Bacteria | 9409 |
| 252 | Ga0114129_10023607 | 3300009147 | Bacteria | 8716 |
| 253 | Ga0114129_10035313 | 3300009147 | Bacteria | 7062 |
| 254 | Ga0114129_10082780 | 3300009147 | Bacteria | 4458 |
| 255 | Ga0114129_10098439 | 3300009147 | Bacteria | 4048 |
| 256 | Ga0114129_10139810 | 3300009147 | Bacteria | 3320 |
| 257 | Ga0105243_10281761 | 3300009148 | Bacteria | 1497 |
| 258 | Ga0105241_10170650 | 3300009174 | Bacteria | 1797 |
| 259 | Ga0105241_10261170 | 3300009174 | Bacteria | 1472 |
| 260 | Ga0105242_10024360 | 3300009176 | Bacteria | 4779 |
| 261 | Ga0105242_10027488 | 3300009176 | Bacteria | 4517 |
| 262 | Ga0105242_10205517 | 3300009176 | Bacteria | 1751 |
| 263 | Ga0105242_10277257 | 3300009176 | Bacteria | 1521 |
| 264 | Ga0105242_10441554 | 3300009176 | Bacteria | 1224 |
| 265 | Ga0105248_10030214 | 3300009177 | Bacteria | 6048 |
| 266 | Ga0105248_10052999 | 3300009177 | Bacteria | 4552 |
| 267 | Ga0105248_10132314 | 3300009177 | Bacteria | 2814 |
| 268 | Ga0105248_10265753 | 3300009177 | Bacteria | 1931 |
| 269 | Ga0105248_10442394 | 3300009177 | Bacteria | 1464 |
| 270 | Ga0105248_10502317 | 3300009177 | Bacteria | 1367 |
| 271 | Ga0105237_10123489 | 3300009545 | Bacteria | 2583 |
| 272 | Ga0105249_10075780 | 3300009553 | Unclassified | 3116 |
| 273 | Ga0105249_10139558 | 3300009553 | Bacteria | 2322 |
| 274 | Ga0105249_10274107 | 3300009553 | Bacteria | 1682 |
| 275 | Ga0157370_10037109 | 3300013104 | Bacteria | 4725 |
| 276 | Ga0157374_10134859 | 3300013296 | Bacteria | 2392 |
| 277 | Ga0157374_10153188 | 3300013296 | Unclassified | 2242 |
| 278 | Ga0157374_10570705 | 3300013296 | Bacteria | 1140 |
| 279 | Ga0163162_10232413 | 3300013306 | Bacteria | 1974 |
| 280 | Ga0163162_10236525 | 3300013306 | Bacteria | 1957 |
| 281 | Ga0163162_10788607 | 3300013306 | Bacteria | 1068 |
| 282 | Ga0157372_10014369 | 3300013307 | Bacteria | 8466 |
| 283 | Ga0157375_10044798 | 3300013308 | Bacteria | 4302 |
| 284 | Ga0157375_10065779 | 3300013308 | Bacteria | 3615 |
| 285 | Ga0163163_10000071 | 3300014325 | Bacteria | 112778 |
| 286 | Ga0163163_10004809 | 3300014325 | Bacteria | 11600 |
| 287 | Ga0163163_10051015 | 3300014325 | Bacteria | 4077 |
| 288 | Ga0163163_10465932 | 3300014325 | Bacteria | 1324 |
| 289 | Ga0157380_10000200 | 3300014326 | Bacteria | 35152 |
| 290 | Ga0157380_10007044 | 3300014326 | Bacteria | 7958 |
| 291 | Ga0157380_10022516 | 3300014326 | Bacteria | 4747 |
| 292 | Ga0157380_10028264 | 3300014326 | Bacteria | 4273 |
| 293 | Ga0157380_10142979 | 3300014326 | Bacteria | 2058 |
| 294 | Ga0157380_10147610 | 3300014326 | Bacteria | 2028 |
| 295 | Ga0157380_10438814 | 3300014326 | Bacteria | 1250 |
| 296 | Ga0157377_10001507 | 3300014745 | Bacteria | 10096 |
| 297 | Ga0157377_10083660 | 3300014745 | Bacteria | 1870 |
| 298 | Ga0157377_10155643 | 3300014745 | Bacteria | 1417 |
| 299 | Ga0157379_10024463 | 3300014968 | Bacteria | 5361 |
| 300 | Ga0157379_10033243 | 3300014968 | Bacteria | 4600 |
| 301 | Ga0157379_10040072 | 3300014968 | Bacteria | 4180 |
| 302 | Ga0157379_10173402 | 3300014968 | Bacteria | 1947 |
| 303 | Ga0157376_10009204 | 3300014969 | Bacteria | 7165 |
| 304 | Ga0157376_10013838 | 3300014969 | Bacteria | 6033 |
| 305 | Ga0157376_10017805 | 3300014969 | Bacteria | 5430 |
| 306 | Ga0157376_10023360 | 3300014969 | Bacteria | 4838 |
| 307 | Ga0157376_10137419 | 3300014969 | Bacteria | 2189 |
| 308 | Ga0157376_10137953 | 3300014969 | Bacteria | 2185 |
| 309 | Ga0163161_10194998 | 3300017792 | Bacteria | 1558 |
| 310 | Ga0163161_10291034 | 3300017792 | Bacteria | 1284 |
| 311 | Ga0213876_10018303 | 3300021384 | Bacteria | 3699 |
| 312 | Ga0207682_10011562 | 3300025893 | Bacteria | 3447 |
| 313 | Ga0207642_10008472 | 3300025899 | Bacteria | 3530 |
| 314 | Ga0207642_10067033 | 3300025899 | Bacteria | 1693 |
| 315 | Ga0207642_10086226 | 3300025899 | Bacteria | 1538 |
| 316 | Ga0207647_10076704 | 3300025904 | Bacteria | 2010 |
| 317 | Ga0207645_10007961 | 3300025907 | Bacteria | 7440 |
| 318 | Ga0207645_10081824 | 3300025907 | Bacteria | 2070 |
| 319 | Ga0207645_10107246 | 3300025907 | Bacteria | 1806 |
| 320 | Ga0207645_10215734 | 3300025907 | Bacteria | 1264 |
| 321 | Ga0207643_10004895 | 3300025908 | Bacteria | 7167 |
| 322 | Ga0207643_10020153 | 3300025908 | Bacteria | 3659 |
| 323 | Ga0207643_10027758 | 3300025908 | Bacteria | 3141 |
| 324 | Ga0207684_10005792 | 3300025910 | Bacteria | 11333 |
| 325 | Ga0207684_10346446 | 3300025910 | Bacteria | 1279 |
| 326 | Ga0207654_10140749 | 3300025911 | Bacteria | 1538 |
| 327 | Ga0207707_10016615 | 3300025912 | Bacteria | 6417 |
| 328 | Ga0207707_10031377 | 3300025912 | Bacteria | 4650 |
| 329 | Ga0207707_10111201 | 3300025912 | Bacteria | 2395 |
| 330 | Ga0207695_10018579 | 3300025913 | Bacteria | 8032 |
| 331 | Ga0207695_10067552 | 3300025913 | Bacteria | 3666 |
| 332 | Ga0207695_10217391 | 3300025913 | Bacteria | 1819 |
| 333 | Ga0207660_10097088 | 3300025917 | Bacteria | 2195 |
| 334 | Ga0207662_10002744 | 3300025918 | Bacteria | 8887 |
| 335 | Ga0207662_10006429 | 3300025918 | Bacteria | 6340 |
| 336 | Ga0207662_10021057 | 3300025918 | Bacteria | 3722 |
| 337 | Ga0207657_10006060 | 3300025919 | Bacteria | 12572 |
| 338 | Ga0207649_10060700 | 3300025920 | Bacteria | 2377 |
| 339 | Ga0207652_10050849 | 3300025921 | Bacteria | 3551 |
| 340 | Ga0207646_10025062 | 3300025922 | Bacteria | 5459 |
| 341 | Ga0207646_10028669 | 3300025922 | Bacteria | 5065 |
| 342 | Ga0207681_10036698 | 3300025923 | Bacteria | 3235 |
| 343 | Ga0207681_10085224 | 3300025923 | Bacteria | 2242 |
| 344 | Ga0207650_10009640 | 3300025925 | Bacteria | 6602 |
| 345 | Ga0207650_10015278 | 3300025925 | Bacteria | 5343 |
| 346 | Ga0207650_10037895 | 3300025925 | Bacteria | 3516 |
| 347 | Ga0207650_10050594 | 3300025925 | Bacteria | 3074 |
| 348 | Ga0207659_10006571 | 3300025926 | Bacteria | 7136 |
| 349 | Ga0207659_10129622 | 3300025926 | Unclassified | 1945 |
| 350 | Ga0207659_10427046 | 3300025926 | Bacteria | 1112 |
| 351 | Ga0207659_10437082 | 3300025926 | Bacteria | 1100 |
| 352 | Ga0207687_10031315 | 3300025927 | Bacteria | 3593 |
| 353 | Ga0207664_10044947 | 3300025929 | Unclassified | 3461 |
| 354 | Ga0207664_10205958 | 3300025929 | Unclassified | 1700 |
| 355 | Ga0207644_10164316 | 3300025931 | Unclassified | 1728 |
| 356 | Ga0207690_10131335 | 3300025932 | Bacteria | 1833 |
| 357 | Ga0207706_10040547 | 3300025933 | Unclassified | 4126 |
| 358 | Ga0207706_10069925 | 3300025933 | Bacteria | 3087 |
| 359 | Ga0207706_10105227 | 3300025933 | Bacteria | 2483 |
| 360 | Ga0207686_10081713 | 3300025934 | Bacteria | 2110 |
| 361 | Ga0207686_10138608 | 3300025934 | Bacteria | 1678 |
| 362 | Ga0207686_10293253 | 3300025934 | Bacteria | 1205 |
| 363 | Ga0207709_10101369 | 3300025935 | Bacteria | 1904 |
| 364 | Ga0207709_10190281 | 3300025935 | Bacteria | 1457 |
| 365 | Ga0207670_10016295 | 3300025936 | Bacteria | 4463 |
| 366 | Ga0207670_10310761 | 3300025936 | Bacteria | 1237 |
| 367 | Ga0207670_10380521 | 3300025936 | Bacteria | 1124 |
| 368 | Ga0207669_10113005 | 3300025937 | Bacteria | 1825 |
| 369 | Ga0207669_10158237 | 3300025937 | Bacteria | 1596 |
| 370 | Ga0207669_10444309 | 3300025937 | Bacteria | 1026 |
| 371 | Ga0207704_10008319 | 3300025938 | Bacteria | 4952 |
| 372 | Ga0207704_10333189 | 3300025938 | Bacteria | 1175 |
| 373 | Ga0207665_10159775 | 3300025939 | Bacteria | 1620 |
| 374 | Ga0207665_10229979 | 3300025939 | Bacteria | 1362 |
| 375 | Ga0207691_10045230 | 3300025940 | Bacteria | 4047 |
| 376 | Ga0207691_10093145 | 3300025940 | Bacteria | 2698 |
| 377 | Ga0207691_10240492 | 3300025940 | Bacteria | 1565 |
| 378 | Ga0207691_10282649 | 3300025940 | Bacteria | 1428 |
| 379 | Ga0207711_10021439 | 3300025941 | Bacteria | 5398 |
| 380 | Ga0207711_10080642 | 3300025941 | Bacteria | 2843 |
| 381 | Ga0207711_10244687 | 3300025941 | Bacteria | 1645 |
| 382 | Ga0207711_10296307 | 3300025941 | Bacteria | 1491 |
| 383 | Ga0207689_10006799 | 3300025942 | Bacteria | 10063 |
| 384 | Ga0207689_10104723 | 3300025942 | Bacteria | 2324 |
| 385 | Ga0207689_10131078 | 3300025942 | Bacteria | 2063 |
| 386 | Ga0207689_10140194 | 3300025942 | Bacteria | 1992 |
| 387 | Ga0207689_10329151 | 3300025942 | Bacteria | 1268 |
| 388 | Ga0207689_10405372 | 3300025942 | Bacteria | 1137 |
| 389 | Ga0207661_10003683 | 3300025944 | Bacteria | 10680 |
| 390 | Ga0207661_10074090 | 3300025944 | Bacteria | 2790 |
| 391 | Ga0207679_10006385 | 3300025945 | Bacteria | 7445 |
| 392 | Ga0207679_10022084 | 3300025945 | Bacteria | 4327 |
| 393 | Ga0207679_10069971 | 3300025945 | Bacteria | 2643 |
| 394 | Ga0207679_10217729 | 3300025945 | Bacteria | 1605 |
| 395 | Ga0207667_10129591 | 3300025949 | Bacteria | 2598 |
| 396 | Ga0207651_10023871 | 3300025960 | Bacteria | 3771 |
| 397 | Ga0207651_10275292 | 3300025960 | Bacteria | 1388 |
| 398 | Ga0207712_10168648 | 3300025961 | Bacteria | 1709 |
| 399 | Ga0207640_10044228 | 3300025981 | Bacteria | 2852 |
| 400 | Ga0207640_10085408 | 3300025981 | Bacteria | 2170 |
| 401 | Ga0207658_10041095 | 3300025986 | Bacteria | 3347 |
| 402 | Ga0207677_10096400 | 3300026023 | Bacteria | 2164 |
| 403 | Ga0207677_10142654 | 3300026023 | Bacteria | 1836 |
| 404 | Ga0207703_10027280 | 3300026035 | Bacteria | 4497 |
| 405 | Ga0207703_10103292 | 3300026035 | Bacteria | 2419 |
| 406 | Ga0207639_10435338 | 3300026041 | Bacteria | 1188 |
| 407 | Ga0207678_10006364 | 3300026067 | Bacteria | 10483 |
| 408 | Ga0207678_10043339 | 3300026067 | Bacteria | 3894 |
| 409 | Ga0207708_10020780 | 3300026075 | Bacteria | 4952 |
| 410 | Ga0207708_10028204 | 3300026075 | Bacteria | 4251 |
| 411 | Ga0207708_10180064 | 3300026075 | Bacteria | 1678 |
| 412 | Ga0207702_10000535 | 3300026078 | Bacteria | 42526 |
| 413 | Ga0207641_10058516 | 3300026088 | Bacteria | 3280 |
| 414 | Ga0207641_10080796 | 3300026088 | Bacteria | 2821 |
| 415 | Ga0207641_10387720 | 3300026088 | Bacteria | 1339 |
| 416 | Ga0207648_10000455 | 3300026089 | Bacteria | 45441 |
| 417 | Ga0207648_10096364 | 3300026089 | Bacteria | 2589 |
| 418 | Ga0207676_10029836 | 3300026095 | Bacteria | 4087 |
| 419 | Ga0207676_10087755 | 3300026095 | Bacteria | 2545 |
| 420 | Ga0207676_10119895 | 3300026095 | Bacteria | 2216 |
| 421 | Ga0207676_10273399 | 3300026095 | Bacteria | 1531 |
| 422 | Ga0207676_10392299 | 3300026095 | Bacteria | 1295 |
| 423 | Ga0207676_10395786 | 3300026095 | Bacteria | 1290 |
| 424 | Ga0207674_10196858 | 3300026116 | Bacteria | 1965 |
| 425 | Ga0207674_10414055 | 3300026116 | Bacteria | 1302 |
| 426 | Ga0207675_100007007 | 3300026118 | Bacteria | 10660 |
| 427 | Ga0207675_100010456 | 3300026118 | Bacteria | 8690 |
| 428 | Ga0207675_100040529 | 3300026118 | Bacteria | 4349 |
| 429 | Ga0207675_100256314 | 3300026118 | Archaea | 1694 |
| 430 | Ga0207683_10008884 | 3300026121 | Bacteria | 8568 |
| 431 | Ga0207683_10184148 | 3300026121 | Bacteria | 1894 |
| 432 | Ga0207698_10439023 | 3300026142 | Bacteria | 1257 |
| 433 | Ga0207698_10559043 | 3300026142 | Bacteria | 1123 |
| 434 | Ga0209966_1008881 | 3300027695 | Bacteria | 1789 |
| 435 | Ga0209813_10013534 | 3300027866 | Bacteria | 2180 |
| 436 | Ga0207428_10000070 | 3300027907 | Bacteria | 147650 |
| 437 | Ga0207428_10000234 | 3300027907 | Bacteria | 76592 |
| 438 | Ga0207428_10000970 | 3300027907 | Bacteria | 31814 |
| 439 | Ga0207428_10002771 | 3300027907 | Bacteria | 17425 |
| 440 | Ga0207428_10006859 | 3300027907 | Bacteria | 10436 |
| 441 | Ga0207428_10020464 | 3300027907 | Bacteria | 5620 |
| 442 | Ga0207428_10031962 | 3300027907 | Bacteria | 4334 |
| 443 | Ga0268266_10018204 | 3300028379 | Bacteria | 5989 |
| 444 | Ga0268266_10062499 | 3300028379 | Bacteria | 3214 |
| 445 | Ga0268266_10075456 | 3300028379 | Bacteria | 2929 |
| 446 | Ga0268265_10113823 | 3300028380 | Bacteria | 2214 |
| 447 | Ga0268264_10087383 | 3300028381 | Bacteria | 2681 |
| 448 | Ga0268264_10115880 | 3300028381 | Bacteria | 2354 |
| 449 | Ga0268264_10218660 | 3300028381 | Bacteria | 1753 |
| 450 | Ga0265318_10010231 | 3300028577 | Bacteria | 4097 |
| 451 | Ga0265336_10038354 | 3300028666 | Bacteria | 1471 |
| 452 | Ga0265339_10041338 | 3300031249 | Bacteria | 2560 |
| 453 | Ga0307408_100017907 | 3300031548 | Bacteria | 4749 |
| 454 | Ga0307408_100086971 | 3300031548 | Bacteria | 2350 |
| 455 | Ga0307408_100121889 | 3300031548 | Bacteria | 2021 |
| 456 | Ga0265314_10017566 | 3300031711 | Bacteria | 5611 |
| 457 | Ga0265342_10181843 | 3300031712 | Bacteria | 1151 |
| 458 | Ga0307405_10000373 | 3300031731 | Bacteria | 16766 |
| 459 | Ga0307413_10193462 | 3300031824 | Bacteria | 1462 |
| 460 | Ga0307413_10305213 | 3300031824 | Bacteria | 1209 |
| 461 | Ga0307410_10177339 | 3300031852 | Bacteria | 1611 |
| 462 | Ga0307406_10073726 | 3300031901 | Bacteria | 2246 |
| 463 | Ga0307412_10003351 | 3300031911 | Bacteria | 8902 |
| 464 | Ga0307409_100001999 | 3300031995 | Bacteria | 10458 |
| 465 | Ga0307416_100019475 | 3300032002 | Bacteria | 4812 |
| 466 | Ga0307416_100026701 | 3300032002 | Bacteria | 4260 |
| 467 | Ga0307416_100036043 | 3300032002 | Bacteria | 3788 |
| 468 | Ga0307416_100094726 | 3300032002 | Bacteria | 2576 |
| 469 | Ga0307416_100108004 | 3300032002 | Bacteria | 2444 |
| 470 | Ga0307416_100133474 | 3300032002 | Bacteria | 2240 |
| 471 | Ga0307416_100235465 | 3300032002 | Bacteria | 1769 |
| 472 | Ga0307416_100487643 | 3300032002 | Bacteria | 1294 |
| 473 | Ga0307416_100764915 | 3300032002 | Archaea | 1059 |
| 474 | Ga0307411_10018425 | 3300032005 | Bacteria | 4004 |
| 475 | Ga0307411_10086936 | 3300032005 | Bacteria | 2170 |
| 476 | Ga0307415_100026945 | 3300032126 | Bacteria | 3634 |
| 477 | Ga0307415_100098696 | 3300032126 | Bacteria | 2136 |
| 478 | Ga0307415_100103932 | 3300032126 | Bacteria | 2091 |
| 479 | Ga0373926_0002044 | 3300035083 | Bacteria | 6346 |
| 480 | Ga0373929_0000969 | 3300035085 | Bacteria | 5568 |
| 481 | Ga0373940_0009458 | 3300035088 | Bacteria | 2268 |
| 482 | Ga0373949_0000541 | 3300035090 | Bacteria | 12469 |
| 483 | Ga0373932_0001051 | 3300035112 | Bacteria | 7950 |
| 484 | Ga0373941_0002913 | 3300035115 | Bacteria | 3816 |
| 485 | Ga0373953_0071496 | 3300035117 | Bacteria | 1432 |
| 486 | Ga0373954_0027171 | 3300035118 | Unclassified | 2625 |
| 487 | Ga0373956_0062293 | 3300035119 | Bacteria | 1691 |
| 488 | Ga0373960_0000470 | 3300035121 | Bacteria | 7983 |
| 489 | Ga0373946_0078371 | 3300035171 | Bacteria | 1442 |
| 490 | Ga0373955_0075899 | 3300035172 | Bacteria | 1890 |
| 491 | Ga0373942_0061978 | 3300035207 | Bacteria | 1074 |
| 492 | Ga0373961_0001177 | 3300035241 | Bacteria | 8144 |
| 493 | Ga0373924_0168610 | 3300035410 | Bacteria | 962 |
| 494 | Ga0373931_0000745 | 3300035691 | Bacteria | 13573 |
| 495 | Ga0373935_0004143 | 3300035692 | Bacteria | 8485 |
| 496 | Ga0373935_0143682 | 3300035692 | Bacteria | 1614 |
| 497 | Ga0373927_0001983 | 3300035695 | Bacteria | 15085 |
| 498 | Ga0373927_0153273 | 3300035695 | Bacteria | 1509 |
| 499 | Ga0373933_0198626 | 3300035724 | Bacteria | 1283 |
| 500 | Ga0373947_0002840 | 3300035725 | Bacteria | 10340 |
| 501 | Ga0373947_0076803 | 3300035725 | Bacteria | 2059 |
| 502 | Ga0373947_0196663 | 3300035725 | Bacteria | 1318 |
| 503 | Ga0373937_0083282 | 3300036401 | Bacteria | 2959 |
| 504 | Ga0373937_0119142 | 3300036401 | Unclassified | 2459 |
| 505 | Ga0373937_0205946 | 3300036401 | Bacteria | 1850 |
| 506 | Ga0373937_0499348 | 3300036401 | Bacteria | 1156 |
| 507 | Ga0373925_0129982 | 3300037068 | Bacteria | 1963 |
| 508 | Ga0373925_0198232 | 3300037068 | Bacteria | 1596 |
| 509 | Ga0395905_0187182 | 3300037471 | Unclassified | 1943 |
| 510 | Ga0400485_01916 | 3300038735 | Bacteria | 103745 |
| 511 | Ga0400488_29914 | 3300038741 | Bacteria | 20404 |
| 512 | Ga0400486_08682 | 3300038742 | Bacteria | 98233 |
| 513 | Ga0400487_47850 | 3300039110 | Bacteria | 103119 |
| 514 | Ga0436365_1745763 | 3300039437 | Bacteria | 5906 |
| 515 | Ga0436362_0587869 | 3300039453 | Bacteria | 1125 |
| 516 | Ga0451853_3907508 | 3300041512 | Bacteria | 1606 |
| 517 | Ga0439441_018439 | 3300042001 | Bacteria | 1262 |
| 518 | Ga0439462_0031464 | 3300042015 | Bacteria | 1405 |
| 519 | Ga0439459_0030597 | 3300042438 | Bacteria | 1093 |
| 520 | Ga0439460_0002387 | 3300042461 | Bacteria | 4524 |
| 521 | Ga0451577_0003490 | 3300042876 | Bacteria | 17477 |
| 522 | Ga0451577_0009672 | 3300042876 | Bacteria | 9251 |
| 523 | Ga0451577_0073151 | 3300042876 | Bacteria | 3058 |
| 524 | Ga0466969_0013532 | 3300044656 | Bacteria | 4296 |
| 525 | Ga0466972_0117485 | 3300044658 | Bacteria | 1255 |
| 526 | Ga0466966_0057668 | 3300044684 | Bacteria | 2455 |
| 527 | Ga0466963_0031556 | 3300044694 | Bacteria | 3426 |
| 528 | Ga0466963_0045795 | 3300044694 | Unclassified | 2882 |
| 529 | Ga0466964_0085807 | 3300044706 | Bacteria | 1360 |
| 530 | Ga0453684_0005717 | 3300044712 | Bacteria | 24352 |
| 531 | Ga0453684_0023311 | 3300044712 | Bacteria | 9127 |
| 532 | Ga0453684_0032388 | 3300044712 | Bacteria | 7317 |
| 533 | Ga0466959_0067040 | 3300045049 | Bacteria | 2603 |
| 534 | Ga0466959_0087948 | 3300045049 | Bacteria | 2234 |
| 535 | Ga0451576_0008579 | 3300045051 | Bacteria | 11977 |
| 536 | Ga0451576_0034669 | 3300045051 | Bacteria | 5359 |
| 537 | Ga0451576_0061807 | 3300045051 | Bacteria | 3906 |
| 538 | Ga0466967_0099140 | 3300045976 | Bacteria | 2661 |
| 539 | Ga0495592_0077076 | 3300046454 | Unclassified | 2418 |
| 540 | Ga0495603_0051162 | 3300046455 | Bacteria | 2455 |
| 541 | Ga0495603_0052726 | 3300046455 | Bacteria | 2414 |
| 542 | Ga0495629_0004349 | 3300046459 | Bacteria | 10622 |
| 543 | Ga0495641_0103263 | 3300046461 | Bacteria | 1272 |
| 544 | Ga0495651_0004511 | 3300046462 | Bacteria | 10655 |
| 545 | Ga0495653_0003868 | 3300046463 | Bacteria | 12102 |
| 546 | Ga0495580_0005665 | 3300046472 | Bacteria | 10275 |
| 547 | Ga0495582_0168427 | 3300046473 | Bacteria | 1247 |
| 548 | Ga0495639_0083547 | 3300046475 | Bacteria | 1490 |
| 549 | Ga0495662_0004591 | 3300046476 | Bacteria | 6920 |
| 550 | Ga0495664_0037686 | 3300046477 | Bacteria | 2854 |
| 551 | Ga0495584_0012217 | 3300046491 | Bacteria | 4387 |
| 552 | Ga0495594_0031275 | 3300046499 | Bacteria | 2885 |
| 553 | Ga0495594_0033707 | 3300046499 | Bacteria | 2785 |
| 554 | Ga0495594_0096868 | 3300046499 | Bacteria | 1658 |
| 555 | Ga0495608_0007960 | 3300046511 | Bacteria | 7449 |
| 556 | Ga0495630_0000002 | 3300046517 | Bacteria | 1277125 |
| 557 | Ga0495630_0035279 | 3300046517 | Bacteria | 3737 |
| 558 | Ga0495652_0004133 | 3300046529 | Bacteria | 14004 |
| 559 | Ga0495665_0002476 | 3300046531 | Bacteria | 9985 |
| 560 | Ga0495586_0014166 | 3300046535 | Bacteria | 4237 |
| 561 | Ga0495586_0040346 | 3300046535 | Bacteria | 2511 |
| 562 | Ga0495586_0130253 | 3300046535 | Bacteria | 1408 |
| 563 | Ga0495621_0007186 | 3300046539 | Bacteria | 3287 |
| 564 | Ga0495621_0007517 | 3300046539 | Bacteria | 3230 |
| 565 | Ga0495645_0000493 | 3300046543 | Bacteria | 27347 |
| 566 | Ga0495645_0091871 | 3300046543 | Bacteria | 2168 |
| 567 | Ga0495656_0153842 | 3300046615 | Bacteria | 1113 |
| 568 | Ga0495635_0001569 | 3300046663 | Bacteria | 15345 |
| 569 | Ga0495635_0092678 | 3300046663 | Bacteria | 2066 |
| 570 | Ga0495659_0142706 | 3300046664 | Bacteria | 957 |
| 571 | Ga0495588_0070410 | 3300046674 | Bacteria | 1818 |
| 572 | Ga0495657_0193262 | 3300046675 | Bacteria | 1243 |
| 573 | Ga0495623_0000910 | 3300046679 | Bacteria | 20013 |
| 574 | Ga0495646_0001633 | 3300046680 | Bacteria | 13371 |
| 575 | Ga0495658_0042390 | 3300046683 | Bacteria | 2541 |
| 576 | Ga0495658_0056860 | 3300046683 | Bacteria | 2233 |
| 577 | Ga0495613_0134278 | 3300046689 | Bacteria | 1771 |
| 578 | Ga0495613_0174915 | 3300046689 | Unclassified | 1522 |
| 579 | Ga0495624_0001806 | 3300046690 | Bacteria | 16347 |
| 580 | Ga0495604_0003449 | 3300047317 | Bacteria | 12606 |
| 581 | Ga0495674_0139735 | 3300047319 | Unclassified | 2036 |
| 582 | Ga0495672_0001087 | 3300047320 | Bacteria | 27603 |
| 583 | Ga0495676_0043167 | 3300047321 | Bacteria | 3694 |
| 584 | Ga0495676_0043501 | 3300047321 | Bacteria | 3674 |
| 585 | Ga0495675_0002265 | 3300047444 | Bacteria | 11492 |
| 586 | Ga0495677_0011201 | 3300047445 | Bacteria | 3282 |
| 587 | Ga0495685_003103 | 3300047447 | Bacteria | 5271 |
| 588 | Ga0495684_0180910 | 3300047471 | Bacteria | 1563 |
| 589 | Ga0495684_0284286 | 3300047471 | Unclassified | 1192 |
| 590 | Ga0495593_0000357 | 3300047673 | Bacteria | 25241 |
| 591 | Ga0495602_0017549 | 3300048088 | Bacteria | 7171 |
| 592 | Ga0495614_0000926 | 3300048089 | Bacteria | 12496 |
| 593 | Ga0496100_0002378 | 3300048903 | Bacteria | 9518 |
| 594 | Ga0496101_0183714 | 3300048904 | Bacteria | 1611 |
| 595 | Ga0496102_0315418 | 3300048905 | Bacteria | 1473 |
| 596 | Ga0496104_0001613 | 3300048907 | Bacteria | 19451 |
| 597 | Ga0496104_0010994 | 3300048907 | Bacteria | 8098 |
| 598 | Ga0496104_0136477 | 3300048907 | Bacteria | 2357 |
| 599 | Ga0496105_0021967 | 3300048908 | Bacteria | 5166 |
| 600 | Ga0496108_0025166 | 3300048911 | Unclassified | 4903 |
| 601 | Ga0496109_0013940 | 3300048912 | Bacteria | 6990 |
| 602 | Ga0496109_0056560 | 3300048912 | Bacteria | 3580 |
| 603 | Ga0496109_0104658 | 3300048912 | Bacteria | 2628 |
| 604 | Ga0496109_0481010 | 3300048912 | Bacteria | 1172 |
| 605 | Ga0496110_0000816 | 3300048913 | Bacteria | 21833 |
| 606 | Ga0496110_0064415 | 3300048913 | Bacteria | 3240 |
| 607 | Ga0496111_0200262 | 3300048914 | Bacteria | 1484 |
| 608 | Ga0496111_0262283 | 3300048914 | Bacteria | 1282 |
| 609 | Ga0496111_0315112 | 3300048914 | Bacteria | 1159 |
| 610 | Ga0496112_0000213 | 3300048915 | Bacteria | 37294 |
| 611 | Ga0496112_0119322 | 3300048915 | Bacteria | 2607 |
| 612 | Ga0496112_0219616 | 3300048915 | Bacteria | 1857 |
| 613 | Ga0496112_0511584 | 3300048915 | Bacteria | 1136 |
| 614 | Ga0496114_0011050 | 3300048917 | Bacteria | 7203 |
| 615 | Ga0496114_0341808 | 3300048917 | Bacteria | 1323 |
| 616 | Ga0496115_0000232 | 3300048918 | Bacteria | 50769 |
| 617 | Ga0501031_0142114 | 3300049568 | Bacteria | 1569 |
| 618 | Ga0501033_0042001 | 3300049570 | Bacteria | 3410 |
| 619 | Ga0501033_0177726 | 3300049570 | Bacteria | 1527 |
| 620 | Ga0501034_0078399 | 3300049571 | Bacteria | 3308 |
| 621 | Ga0501034_0137754 | 3300049571 | Bacteria | 2421 |
| 622 | Ga0501034_0412072 | 3300049571 | Bacteria | 1273 |
| 623 | Ga0501036_0012231 | 3300049572 | Bacteria | 7109 |
| 624 | Ga0501036_0039647 | 3300049572 | Bacteria | 3986 |
| 625 | Ga0501036_0213533 | 3300049572 | Bacteria | 1621 |
| 626 | Ga0501037_0016722 | 3300049573 | Bacteria | 5397 |
| 627 | Ga0501038_0167771 | 3300049574 | Bacteria | 1779 |
| 628 | Ga0501039_0009044 | 3300049575 | Bacteria | 7589 |
| 629 | Ga0501039_0017921 | 3300049575 | Bacteria | 5432 |
| 630 | Ga0501039_0058482 | 3300049575 | Bacteria | 2986 |
| 631 | Ga0501039_0110966 | 3300049575 | Bacteria | 2144 |
| 632 | Ga0501039_0201771 | 3300049575 | Bacteria | 1564 |
| 633 | Ga0501040_0000223 | 3300049576 | Bacteria | 33236 |
| 634 | Ga0501040_0018715 | 3300049576 | Bacteria | 4600 |
| 635 | Ga0501040_0051999 | 3300049576 | Bacteria | 2804 |
| 636 | Ga0501041_0105656 | 3300049577 | Bacteria | 1745 |
| 637 | Ga0501042_0001934 | 3300049578 | Bacteria | 12467 |
| 638 | Ga0501042_0182259 | 3300049578 | Bacteria | 1515 |
| 639 | Ga0501043_0037724 | 3300049579 | Bacteria | 3800 |
| 640 | Ga0501046_0009389 | 3300049580 | Bacteria | 8456 |
| 641 | Ga0501046_0015196 | 3300049580 | Bacteria | 6473 |
| 642 | Ga0501048_0027621 | 3300049582 | Bacteria | 4122 |
| 643 | Ga0501048_0030431 | 3300049582 | Bacteria | 3906 |
| 644 | Ga0501048_0076726 | 3300049582 | Bacteria | 2358 |
| 645 | Ga0501048_0270955 | 3300049582 | Bacteria | 1207 |
| 646 | Ga0501068_0007943 | 3300049584 | Bacteria | 5883 |
| 647 | Ga0501071_0012597 | 3300049587 | Bacteria | 5742 |
| 648 | Ga0501071_0026433 | 3300049587 | Bacteria | 4074 |
| 649 | Ga0501071_0033937 | 3300049587 | Bacteria | 3628 |
| 650 | Ga0501071_0055398 | 3300049587 | Bacteria | 2862 |
| 651 | Ga0501071_0057473 | 3300049587 | Bacteria | 2812 |
| 652 | Ga0501071_0082980 | 3300049587 | Bacteria | 2348 |
| 653 | Ga0501071_0152458 | 3300049587 | Bacteria | 1725 |
| 654 | Ga0501071_0229579 | 3300049587 | Bacteria | 1398 |
| 655 | Ga0501072_0006486 | 3300049588 | Bacteria | 8912 |
| 656 | Ga0501072_0012508 | 3300049588 | Bacteria | 6489 |
| 657 | Ga0501072_0037511 | 3300049588 | Bacteria | 3801 |
| 658 | Ga0501072_0097682 | 3300049588 | Bacteria | 2334 |
| 659 | Ga0501073_0000657 | 3300049589 | Bacteria | 24264 |
| 660 | Ga0501073_0009434 | 3300049589 | Bacteria | 7204 |
| 661 | Ga0501075_0002433 | 3300049591 | Bacteria | 12395 |
| 662 | Ga0501075_0033756 | 3300049591 | Bacteria | 3807 |
| 663 | Ga0501075_0058585 | 3300049591 | Bacteria | 2901 |
| 664 | Ga0501075_0060257 | 3300049591 | Bacteria | 2860 |
| 665 | Ga0501075_0205558 | 3300049591 | Bacteria | 1502 |
| 666 | Ga0501076_0000179 | 3300049592 | Bacteria | 37508 |
| 667 | Ga0501076_0003878 | 3300049592 | Bacteria | 10532 |
| 668 | Ga0501076_0022769 | 3300049592 | Bacteria | 4818 |
| 669 | Ga0501076_0032946 | 3300049592 | Bacteria | 4046 |
| 670 | Ga0501077_0018060 | 3300049593 | Bacteria | 4458 |
| 671 | Ga0501077_0048296 | 3300049593 | Unclassified | 2704 |
| 672 | Ga0501079_0019067 | 3300049741 | Bacteria | 5239 |
| 673 | Ga0501079_0039458 | 3300049741 | Bacteria | 3642 |
| 674 | Ga0501080_0001077 | 3300049742 | Bacteria | 22494 |
| 675 | Ga0501080_0134657 | 3300049742 | Bacteria | 2287 |
| 676 | Ga0501080_0203847 | 3300049742 | Bacteria | 1815 |
| 677 | Ga0501081_0001559 | 3300049743 | Bacteria | 14096 |
| 678 | Ga0501081_0055470 | 3300049743 | Bacteria | 2738 |
| 679 | Ga0501083_0001968 | 3300049744 | Bacteria | 14119 |
| 680 | Ga0501083_0203612 | 3300049744 | Bacteria | 1291 |
| 681 | Ga0501083_0240186 | 3300049744 | Bacteria | 1179 |
| 682 | Ga0501044_0322255 | 3300049823 | Bacteria | 1469 |
| 683 | Ga0501045_0008879 | 3300049824 | Bacteria | 7017 |
| 684 | Ga0501045_0011421 | 3300049824 | Bacteria | 6239 |
| 685 | Ga0501045_0031327 | 3300049824 | Bacteria | 3852 |
| 686 | Ga0501045_0200711 | 3300049824 | Bacteria | 1486 |
| 687 | Ga0501045_0246846 | 3300049824 | Unclassified | 1329 |
| 688 | Ga0501045_0349224 | 3300049824 | Bacteria | 1101 |
| 689 | nmdc:mga03683_650_c1 | 3300050489 | Bacteria | 9969 |
| 690 | nmdc:mga00v17_2930_c1 | 3300050491 | Bacteria | 8751 |
| 691 | nmdc:mga00v17_42283_c1 | 3300050491 | Bacteria | 2740 |
| 692 | nmdc:mga00v17_63758_c1 | 3300050491 | Bacteria | 2270 |
| 693 | nmdc:mga00v17_70474_c1 | 3300050491 | Unclassified | 2165 |
| 694 | nmdc:mga00v17_8387_c1 | 3300050491 | Bacteria | 5559 |
| 695 | nmdc:mga00v17_95777_c1 | 3300050491 | Bacteria | 1869 |
| 696 | nmdc:mga0yw44_15667_c1 | 3300050492 | Bacteria | 4069 |
| 697 | nmdc:mga0yw44_25325_c1 | 3300050492 | Bacteria | 3372 |
| 698 | nmdc:mga0k408_19295_c1 | 3300050493 | Bacteria | 3809 |
| 699 | nmdc:mga0k408_23628_c1 | 3300050493 | Bacteria | 3470 |
| 700 | nmdc:mga0k408_6257_c1 | 3300050493 | Bacteria | 6351 |
| 701 | nmdc:mga0k408_87655_c1 | 3300050493 | Bacteria | 1828 |
| 702 | nmdc:mga06z11_48012_c1 | 3300050494 | Bacteria | 2171 |
| 703 | nmdc:mga06z11_57896_c1 | 3300050494 | Bacteria | 2009 |
| 704 | nmdc:mga06z11_7392_c1 | 3300050494 | Bacteria | 4516 |
| 705 | nmdc:mga06z11_8059_c1 | 3300050494 | Bacteria | 4369 |
| 706 | nmdc:mga04h51_12935_c1 | 3300050495 | Bacteria | 2353 |
| 707 | nmdc:mga05p37_112732_c1 | 3300050507 | Bacteria | 3344 |
| 708 | nmdc:mga05p37_1136_c1 | 3300050507 | Bacteria | 30577 |
| 709 | nmdc:mga05p37_180_c1 | 3300050507 | Bacteria | 61836 |
| 710 | nmdc:mga05p37_18182_c1 | 3300050507 | Bacteria | 8494 |
| 711 | nmdc:mga05p37_207921_c1 | 3300050507 | Bacteria | 2367 |
| 712 | nmdc:mga05p37_219320_c1 | 3300050507 | Bacteria | 2296 |
| 713 | nmdc:mga05p37_238171_c1 | 3300050507 | Bacteria | 2189 |
| 714 | nmdc:mga05p37_369498_c1 | 3300050507 | Bacteria | 1684 |
| 715 | nmdc:mga05p37_419496_c1 | 3300050507 | Bacteria | 1558 |
| 716 | nmdc:mga05p37_470426_c1 | 3300050507 | Bacteria | 1450 |
| 717 | nmdc:mga05p37_490045_c1 | 3300050507 | Bacteria | 1413 |
| 718 | nmdc:mga05p37_597947_c1 | 3300050507 | Bacteria | 1246 |
| 719 | nmdc:mga05p37_6052_c1 | 3300050507 | Bacteria | 14241 |
| 720 | nmdc:mga05p37_625_c2 | 3300050507 | Bacteria | 19945 |
| 721 | nmdc:mga09592_124772_c1 | 3300050508 | Bacteria | 2213 |
| 722 | nmdc:mga09592_165126_c1 | 3300050508 | Unclassified | 1913 |
| 723 | nmdc:mga09592_182135_c1 | 3300050508 | Bacteria | 1817 |
| 724 | nmdc:mga09592_242448_c1 | 3300050508 | Unclassified | 1562 |
| 725 | nmdc:mga09592_440699_c1 | 3300050508 | Bacteria | 1124 |
| 726 | nmdc:mga09592_81117_c1 | 3300050508 | Bacteria | 2764 |
| 727 | nmdc:mga0qj67_125829_c1 | 3300050509 | Bacteria | 2074 |
| 728 | nmdc:mga0qj67_15214_c1 | 3300050509 | Bacteria | 5823 |
| 729 | nmdc:mga0qj67_15800_c1 | 3300050509 | Bacteria | 5718 |
| 730 | nmdc:mga0qj67_402_c1 | 3300050509 | Bacteria | 29827 |
| 731 | nmdc:mga06r32_130789_c1 | 3300050510 | Unclassified | 2482 |
| 732 | nmdc:mga06r32_21911_c1 | 3300050510 | Bacteria | 5900 |
| 733 | nmdc:mga06r32_245275_c1 | 3300050510 | Bacteria | 1779 |
| 734 | nmdc:mga06r32_4150_c1 | 3300050510 | Bacteria | 12974 |
| 735 | nmdc:mga06r32_56700_c1 | 3300050510 | Bacteria | 3761 |
| 736 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 737 | nmdc:mga08y16_11259_c1 | 3300050511 | Bacteria | 9394 |
| 738 | nmdc:mga08y16_1646_c1 | 3300050511 | Bacteria | 22621 |
| 739 | nmdc:mga08y16_18362_c1 | 3300050511 | Bacteria | 7372 |
| 740 | nmdc:mga08y16_18614_c1 | 3300050511 | Bacteria | 7316 |
| 741 | nmdc:mga08y16_21763_c1 | 3300050511 | Bacteria | 6766 |
| 742 | nmdc:mga08y16_516485_c1 | 3300050511 | Bacteria | 1212 |
| 743 | nmdc:mga08y16_536358_c1 | 3300050511 | Bacteria | 1185 |
| 744 | nmdc:mga08y16_5423_c1 | 3300050511 | Bacteria | 13335 |
| 745 | nmdc:mga08y16_59259_c1 | 3300050511 | Bacteria | 4000 |
| 746 | nmdc:mga08y16_882_c1 | 3300050511 | Bacteria | 28902 |
| 747 | nmdc:mga0n895_152868_c1 | 3300050512 | Bacteria | 2338 |
| 748 | nmdc:mga0n895_157430_c1 | 3300050512 | Bacteria | 2303 |
| 749 | nmdc:mga0rr50_119592_c1 | 3300050513 | Bacteria | 2095 |
| 750 | nmdc:mga0rr50_228910_c1 | 3300050513 | Bacteria | 1537 |
| 751 | nmdc:mga0rr50_394922_c1 | 3300050513 | Bacteria | 1168 |
| 752 | nmdc:mga0rr50_49_c1 | 3300050513 | Bacteria | 71590 |
| 753 | nmdc:mga08x19_125648_c1 | 3300050514 | Bacteria | 1722 |
| 754 | nmdc:mga08x19_1341_c1 | 3300050514 | Bacteria | 15270 |
| 755 | nmdc:mga08x19_32069_c1 | 3300050514 | Bacteria | 3309 |
| 756 | nmdc:mga0a205_10903_c1 | 3300050515 | Bacteria | 8361 |
| 757 | nmdc:mga0a205_125965_c1 | 3300050515 | Bacteria | 2461 |
| 758 | nmdc:mga0a205_14986_c2 | 3300050515 | Bacteria | 6241 |
| 759 | nmdc:mga0a205_159320_c1 | 3300050515 | Unclassified | 2154 |
| 760 | nmdc:mga0a205_205943_c1 | 3300050515 | Bacteria | 1856 |
| 761 | nmdc:mga0a205_239535_c1 | 3300050515 | Bacteria | 1695 |
| 762 | nmdc:mga0a205_359560_c1 | 3300050515 | Bacteria | 1323 |
| 763 | nmdc:mga0a205_359610_c1 | 3300050515 | Bacteria | 1322 |
| 764 | nmdc:mga0a205_43183_c1 | 3300050515 | Bacteria | 4347 |
| 765 | nmdc:mga0a205_432086_c1 | 3300050515 | Bacteria | 1178 |
| 766 | nmdc:mga0a205_434074_c1 | 3300050515 | Bacteria | 1175 |
| 767 | nmdc:mga0a205_88094_c1 | 3300050515 | Bacteria | 3000 |
| 768 | Ga0495601_0041094 | 3300053077 | Bacteria | 2898 |
| 769 | Ga0495601_0162706 | 3300053077 | Bacteria | 1459 |
| 770 | Ga0495612_0044766 | 3300053078 | Bacteria | 1811 |
| 771 | Ga0495619_0027824 | 3300053085 | Bacteria | 3646 |
| 772 | Ga0495619_0088386 | 3300053085 | Bacteria | 2096 |
| 773 | Ga0495619_0122483 | 3300053085 | Bacteria | 1783 |
| 774 | Ga0500646_0012300 | 3300053090 | Bacteria | 2208 |
| 775 | Ga0500641_0021822 | 3300053096 | Bacteria | 2445 |
| 776 | Ga0500658_0080397 | 3300053134 | Bacteria | 1393 |
| 777 | Ga0500568_0014832 | 3300053139 | Bacteria | 3504 |
| 778 | Ga0501084_0000669 | 3300054114 | Bacteria | 26157 |
| 779 | Ga0501084_0038000 | 3300054114 | Bacteria | 4024 |
| 780 | Ga0501084_0058938 | 3300054114 | Bacteria | 3213 |
| 781 | Ga0501084_0124312 | 3300054114 | Bacteria | 2170 |
| 782 | Ga0501082_0018802 | 3300060353 | Bacteria | 5953 |
| 783 | Ga0501082_0044682 | 3300060353 | Bacteria | 3821 |
| 784 | Ga0501082_0088441 | 3300060353 | Bacteria | 2673 |
| 785 | Ga0530510_0000198 | 3300061734 | Bacteria | 37256 |
| 786 | Ga0530510_0014629 | 3300061734 | Bacteria | 5539 |
| 787 | Ga0530510_0026738 | 3300061734 | Bacteria | 4132 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050508 | nmdc:mga09592_165126_c1 | nmdc:mga09592_165126_c1_1036_1887 | 283 |
| 2 | 3300013308 | Ga0157375_10044798 | Ga0157375_100447983 | 291 |
| 3 | 3300032002 | Ga0307416_100764915 | Ga0307416_1007649152 | 292 |
| 4 | 3300005355 | Ga0070671_100014494 | Ga0070671_1000144943 | 293 |
| 5 | 3300006844 | Ga0075428_100265138 | Ga0075428_1002651382 | 293 |
| 6 | 3300028381 | Ga0268264_10218660 | Ga0268264_102186602 | 293 |
| 7 | 3300046664 | Ga0495659_0142706 | Ga0495659_0142706_14_895 | 293 |
| 8 | 3300050514 | nmdc:mga08x19_125648_c1 | nmdc:mga08x19_125648_c1_719_1681 | 294 |
| 9 | 3300050515 | nmdc:mga0a205_434074_c1 | nmdc:mga0a205_434074_c1_234_1133 | 299 |
| 10 | 3300005536 | Ga0070697_100018537 | Ga0070697_1000185374 | 300 |
| 11 | 3300006914 | Ga0075436_100099307 | Ga0075436_1000993072 | 301 |
| 12 | 3300009176 | Ga0105242_10024360 | Ga0105242_100243603 | 301 |
| 13 | 3300014325 | Ga0163163_10465932 | Ga0163163_104659322 | 301 |
| 14 | 3300014969 | Ga0157376_10017805 | Ga0157376_100178054 | 301 |
| 15 | 3300025942 | Ga0207689_10140194 | Ga0207689_101401942 | 301 |
| 16 | 3300035117 | Ga0373953_0071496 | Ga0373953_0071496_220_1125 | 301 |
| 17 | 3300035172 | Ga0373955_0075899 | Ga0373955_0075899_173_1078 | 301 |
| 18 | 3300035410 | Ga0373924_0168610 | Ga0373924_0168610_31_936 | 301 |
| 19 | 3300036401 | Ga0373937_0499348 | Ga0373937_0499348_187_1092 | 301 |
| 20 | 3300046473 | Ga0495582_0168427 | Ga0495582_0168427_170_1075 | 301 |
| 21 | 3300046535 | Ga0495586_0130253 | Ga0495586_0130253_286_1191 | 301 |
| 22 | 3300046543 | Ga0495645_0000493 | Ga0495645_0000493_13568_14473 | 301 |
| 23 | 3300046663 | Ga0495635_0092678 | Ga0495635_0092678_572_1477 | 301 |
| 24 | 3300046683 | Ga0495658_0042390 | Ga0495658_0042390_1212_2117 | 301 |
| 25 | 3300048917 | Ga0496114_0341808 | Ga0496114_0341808_192_1097 | 301 |
| 26 | 3300053077 | Ga0495601_0041094 | Ga0495601_0041094_46_951 | 301 |
| 27 | 3300053085 | Ga0495619_0027824 | Ga0495619_0027824_141_1046 | 301 |
| 28 | 3300053085 | Ga0495619_0122483 | Ga0495619_0122483_818_1723 | 301 |
| 29 | 3300050507 | nmdc:mga05p37_369498_c1 | nmdc:mga05p37_369498_c1_656_1564 | 302 |
| 30 | 3300037471 | Ga0395905_0187182 | Ga0395905_0187182_12_941 | 309 |
| 31 | 3300035695 | Ga0373927_0153273 | Ga0373927_0153273_246_1199 | 310 |
| 32 | 3300006195 | Ga0075366_10031879 | Ga0075366_100318792 | 312 |
| 33 | 3300006844 | Ga0075428_100112217 | Ga0075428_1001122172 | 312 |
| 34 | 3300009147 | Ga0114129_10020472 | Ga0114129_100204725 | 312 |
| 35 | 3300014969 | Ga0157376_10137419 | Ga0157376_101374192 | 312 |
| 36 | 3300044694 | Ga0466963_0031556 | Ga0466963_0031556_1066_2028 | 312 |
| 37 | 3300050491 | nmdc:mga00v17_95777_c1 | nmdc:mga00v17_95777_c1_517_1479 | 312 |
| 38 | 3300050493 | nmdc:mga0k408_6257_c1 | nmdc:mga0k408_6257_c1_3805_4767 | 312 |
| 39 | 3300050493 | nmdc:mga0k408_87655_c1 | nmdc:mga0k408_87655_c1_708_1670 | 312 |
| 40 | 3300050494 | nmdc:mga06z11_48012_c1 | nmdc:mga06z11_48012_c1_1120_2082 | 312 |
| 41 | 3300050494 | nmdc:mga06z11_7392_c1 | nmdc:mga06z11_7392_c1_2685_3647 | 312 |
| 42 | 3300050507 | nmdc:mga05p37_6052_c1 | nmdc:mga05p37_6052_c1_2708_3670 | 312 |
| 43 | 3300053139 | Ga0500568_0014832 | Ga0500568_0014832_1939_2901 | 312 |
| 44 | 3300005295 | Ga0065707_10095269 | Ga0065707_100952692 | 313 |
| 45 | 3300005356 | Ga0070674_100042001 | Ga0070674_1000420013 | 313 |
| 46 | 3300031548 | Ga0307408_100121889 | Ga0307408_1001218892 | 313 |
| 47 | 3300031824 | Ga0307413_10305213 | Ga0307413_103052132 | 313 |
| 48 | 3300032002 | Ga0307416_100036043 | Ga0307416_1000360433 | 313 |
| 49 | 3300042876 | Ga0451577_0003490 | Ga0451577_0003490_10563_11564 | 313 |
| 50 | 3300044712 | Ga0453684_0032388 | Ga0453684_0032388_3829_4803 | 313 |
| 51 | 3300049571 | Ga0501034_0078399 | Ga0501034_0078399_653_1615 | 313 |
| 52 | 3300005290 | Ga0065712_10129186 | Ga0065712_101291862 | 314 |
| 53 | 3300009094 | Ga0111539_10480530 | Ga0111539_104805302 | 314 |
| 54 | 3300025940 | Ga0207691_10282649 | Ga0207691_102826492 | 314 |
| 55 | 3300035724 | Ga0373933_0198626 | Ga0373933_0198626_119_1063 | 314 |
| 56 | 3300049587 | Ga0501071_0012597 | Ga0501071_0012597_2227_3192 | 314 |
| 57 | 3300049588 | Ga0501072_0012508 | Ga0501072_0012508_3270_4235 | 314 |
| 58 | 3300049824 | Ga0501045_0031327 | Ga0501045_0031327_580_1545 | 314 |
| 59 | 3300050511 | nmdc:mga08y16_516485_c1 | nmdc:mga08y16_516485_c1_157_1119 | 314 |
| 60 | 3300047320 | Ga0495672_0001087 | Ga0495672_0001087_17726_18703 | 315 |
| 61 | 3300009101 | Ga0105247_10057544 | Ga0105247_100575442 | 317 |
| 62 | 3300009177 | Ga0105248_10132314 | Ga0105248_101323143 | 317 |
| 63 | 3300009177 | Ga0105248_10442394 | Ga0105248_104423942 | 317 |
| 64 | 3300014745 | Ga0157377_10083660 | Ga0157377_100836602 | 317 |
| 65 | 3300014968 | Ga0157379_10024463 | Ga0157379_100244634 | 317 |
| 66 | 3300014968 | Ga0157379_10033243 | Ga0157379_100332431 | 317 |
| 67 | 3300035692 | Ga0373935_0143682 | Ga0373935_0143682_271_1224 | 317 |
| 68 | 3300035725 | Ga0373947_0196663 | Ga0373947_0196663_224_1177 | 317 |
| 69 | 3300042876 | Ga0451577_0073151 | Ga0451577_0073151_11_964 | 317 |
| 70 | 3300046475 | Ga0495639_0083547 | Ga0495639_0083547_406_1359 | 317 |
| 71 | 3300046535 | Ga0495586_0040346 | Ga0495586_0040346_357_1310 | 317 |
| 72 | 3300047445 | Ga0495677_0011201 | Ga0495677_0011201_413_1366 | 317 |
| 73 | 3300053134 | Ga0500658_0080397 | Ga0500658_0080397_419_1372 | 317 |
| 74 | 3300009094 | Ga0111539_10001042 | Ga0111539_100010423 | 318 |
| 75 | 3300028380 | Ga0268265_10113823 | Ga0268265_101138232 | 318 |
| 76 | 3300035112 | Ga0373932_0001051 | Ga0373932_0001051_4755_5741 | 318 |
| 77 | 3300049575 | Ga0501039_0110966 | Ga0501039_0110966_1061_2035 | 318 |
| 78 | 3300049576 | Ga0501040_0051999 | Ga0501040_0051999_1091_2065 | 318 |
| 79 | 3300049578 | Ga0501042_0182259 | Ga0501042_0182259_40_1014 | 318 |
| 80 | 3300049582 | Ga0501048_0076726 | Ga0501048_0076726_212_1186 | 318 |
| 81 | 3300049587 | Ga0501071_0055398 | Ga0501071_0055398_592_1566 | 318 |
| 82 | 3300049588 | Ga0501072_0006486 | Ga0501072_0006486_2271_3245 | 318 |
| 83 | 3300049592 | Ga0501076_0003878 | Ga0501076_0003878_4262_5236 | 318 |
| 84 | 3300049742 | Ga0501080_0134657 | Ga0501080_0134657_1221_2195 | 318 |
| 85 | 3300049824 | Ga0501045_0246846 | Ga0501045_0246846_166_1185 | 318 |
| 86 | 3300049824 | Ga0501045_0349224 | Ga0501045_0349224_76_1032 | 318 |
| 87 | 3300050507 | nmdc:mga05p37_419496_c1 | nmdc:mga05p37_419496_c1_110_1066 | 318 |
| 88 | 3300050508 | nmdc:mga09592_440699_c1 | nmdc:mga09592_440699_c1_26_982 | 318 |
| 89 | 3300050509 | nmdc:mga0qj67_125829_c1 | nmdc:mga0qj67_125829_c1_872_1828 | 318 |
| 90 | 3300050515 | nmdc:mga0a205_10903_c1 | nmdc:mga0a205_10903_c1_434_1390 | 318 |
| 91 | 3300054114 | Ga0501084_0038000 | Ga0501084_0038000_169_1143 | 318 |
| 92 | 3300005293 | Ga0065715_10106654 | Ga0065715_101066542 | 319 |
| 93 | 3300006844 | Ga0075428_100504032 | Ga0075428_1005040322 | 319 |
| 94 | 3300009176 | Ga0105242_10277257 | Ga0105242_102772572 | 319 |
| 95 | 3300017792 | Ga0163161_10291034 | Ga0163161_102910342 | 319 |
| 96 | 3300025981 | Ga0207640_10085408 | Ga0207640_100854082 | 319 |
| 97 | 3300032002 | Ga0307416_100487643 | Ga0307416_1004876432 | 319 |
| 98 | 3300042015 | Ga0439462_0031464 | Ga0439462_0031464_431_1390 | 319 |
| 99 | 3300050515 | nmdc:mga0a205_159320_c1 | nmdc:mga0a205_159320_c1_535_1494 | 319 |
| 100 | 3300002239 | JGI24034J26672_10012296 | JGI24034J26672_100122962 | 320 |
| 101 | 3300002459 | JGI24751J29686_10003915 | JGI24751J29686_100039153 | 320 |
| 102 | 3300005288 | Ga0065714_10015360 | Ga0065714_100153602 | 320 |
| 103 | 3300005290 | Ga0065712_10001700 | Ga0065712_100017003 | 320 |
| 104 | 3300005290 | Ga0065712_10002413 | Ga0065712_100024133 | 320 |
| 105 | 3300005290 | Ga0065712_10079342 | Ga0065712_100793422 | 320 |
| 106 | 3300005290 | Ga0065712_10104939 | Ga0065712_101049391 | 320 |
| 107 | 3300005293 | Ga0065715_10001036 | Ga0065715_100010362 | 320 |
| 108 | 3300005293 | Ga0065715_10029631 | Ga0065715_100296312 | 320 |
| 109 | 3300005293 | Ga0065715_10094824 | Ga0065715_100948242 | 320 |
| 110 | 3300005293 | Ga0065715_10108738 | Ga0065715_101087382 | 320 |
| 111 | 3300005295 | Ga0065707_10182545 | Ga0065707_101825452 | 320 |
| 112 | 3300005328 | Ga0070676_10003338 | Ga0070676_100033387 | 320 |
| 113 | 3300005328 | Ga0070676_10100165 | Ga0070676_101001652 | 320 |
| 114 | 3300005329 | Ga0070683_100009991 | Ga0070683_1000099912 | 320 |
| 115 | 3300005331 | Ga0070670_100001016 | Ga0070670_10000101611 | 320 |
| 116 | 3300005331 | Ga0070670_100001433 | Ga0070670_1000014338 | 320 |
| 117 | 3300005331 | Ga0070670_100011278 | Ga0070670_1000112783 | 320 |
| 118 | 3300005331 | Ga0070670_100022053 | Ga0070670_1000220532 | 320 |
| 119 | 3300005331 | Ga0070670_100059070 | Ga0070670_1000590704 | 320 |
| 120 | 3300005333 | Ga0070677_10047232 | Ga0070677_100472321 | 320 |
| 121 | 3300005335 | Ga0070666_10010821 | Ga0070666_100108216 | 320 |
| 122 | 3300005335 | Ga0070666_10165291 | Ga0070666_101652912 | 320 |
| 123 | 3300005336 | Ga0070680_100043713 | Ga0070680_1000437134 | 320 |
| 124 | 3300005338 | Ga0068868_100026828 | Ga0068868_1000268284 | 320 |
| 125 | 3300005338 | Ga0068868_100240922 | Ga0068868_1002409221 | 320 |
| 126 | 3300005339 | Ga0070660_100001966 | Ga0070660_1000019663 | 320 |
| 127 | 3300005339 | Ga0070660_100009277 | Ga0070660_1000092774 | 320 |
| 128 | 3300005340 | Ga0070689_100000517 | Ga0070689_1000005174 | 320 |
| 129 | 3300005340 | Ga0070689_100065709 | Ga0070689_1000657092 | 320 |
| 130 | 3300005343 | Ga0070687_100075332 | Ga0070687_1000753322 | 320 |
| 131 | 3300005343 | Ga0070687_100122766 | Ga0070687_1001227662 | 320 |
| 132 | 3300005344 | Ga0070661_100058021 | Ga0070661_1000580211 | 320 |
| 133 | 3300005344 | Ga0070661_100209931 | Ga0070661_1002099312 | 320 |
| 134 | 3300005345 | Ga0070692_10003674 | Ga0070692_100036747 | 320 |
| 135 | 3300005347 | Ga0070668_100319143 | Ga0070668_1003191431 | 320 |
| 136 | 3300005354 | Ga0070675_100076323 | Ga0070675_1000763232 | 320 |
| 137 | 3300005354 | Ga0070675_100083193 | Ga0070675_1000831932 | 320 |
| 138 | 3300005355 | Ga0070671_100026525 | Ga0070671_1000265254 | 320 |
| 139 | 3300005355 | Ga0070671_100044066 | Ga0070671_1000440661 | 320 |
| 140 | 3300005355 | Ga0070671_100143471 | Ga0070671_1001434712 | 320 |
| 141 | 3300005364 | Ga0070673_100016161 | Ga0070673_1000161612 | 320 |
| 142 | 3300005365 | Ga0070688_100001469 | Ga0070688_1000014694 | 320 |
| 143 | 3300005365 | Ga0070688_100017491 | Ga0070688_1000174914 | 320 |
| 144 | 3300005367 | Ga0070667_100029291 | Ga0070667_1000292912 | 320 |
| 145 | 3300005438 | Ga0070701_10009060 | Ga0070701_100090602 | 320 |
| 146 | 3300005440 | Ga0070705_100004206 | Ga0070705_1000042065 | 320 |
| 147 | 3300005440 | Ga0070705_100192408 | Ga0070705_1001924082 | 320 |
| 148 | 3300005441 | Ga0070700_100122190 | Ga0070700_1001221902 | 320 |
| 149 | 3300005441 | Ga0070700_100228863 | Ga0070700_1002288631 | 320 |
| 150 | 3300005441 | Ga0070700_100250156 | Ga0070700_1002501562 | 320 |
| 151 | 3300005444 | Ga0070694_100001421 | Ga0070694_1000014212 | 320 |
| 152 | 3300005444 | Ga0070694_100037182 | Ga0070694_1000371823 | 320 |
| 153 | 3300005445 | Ga0070708_100109235 | Ga0070708_1001092351 | 320 |
| 154 | 3300005445 | Ga0070708_100119566 | Ga0070708_1001195663 | 320 |
| 155 | 3300005456 | Ga0070678_100165401 | Ga0070678_1001654012 | 320 |
| 156 | 3300005457 | Ga0070662_100031607 | Ga0070662_1000316074 | 320 |
| 157 | 3300005458 | Ga0070681_10027541 | Ga0070681_100275412 | 320 |
| 158 | 3300005458 | Ga0070681_10094363 | Ga0070681_100943633 | 320 |
| 159 | 3300005458 | Ga0070681_10137645 | Ga0070681_101376452 | 320 |
| 160 | 3300005466 | Ga0070685_10013390 | Ga0070685_100133905 | 320 |
| 161 | 3300005471 | Ga0070698_100013325 | Ga0070698_1000133253 | 320 |
| 162 | 3300005471 | Ga0070698_100202348 | Ga0070698_1002023482 | 320 |
| 163 | 3300005518 | Ga0070699_100064656 | Ga0070699_1000646562 | 320 |
| 164 | 3300005518 | Ga0070699_100250667 | Ga0070699_1002506672 | 320 |
| 165 | 3300005530 | Ga0070679_100077372 | Ga0070679_1000773723 | 320 |
| 166 | 3300005530 | Ga0070679_100120164 | Ga0070679_1001201642 | 320 |
| 167 | 3300005535 | Ga0070684_100000477 | Ga0070684_1000004773 | 320 |
| 168 | 3300005539 | Ga0068853_100105264 | Ga0068853_1001052642 | 320 |
| 169 | 3300005543 | Ga0070672_100284189 | Ga0070672_1002841892 | 320 |
| 170 | 3300005545 | Ga0070695_100000155 | Ga0070695_10000015523 | 320 |
| 171 | 3300005546 | Ga0070696_100000499 | Ga0070696_10000049911 | 320 |
| 172 | 3300005546 | Ga0070696_100007757 | Ga0070696_1000077572 | 320 |
| 173 | 3300005546 | Ga0070696_100012876 | Ga0070696_1000128762 | 320 |
| 174 | 3300005548 | Ga0070665_100005335 | Ga0070665_1000053354 | 320 |
| 175 | 3300005548 | Ga0070665_100076339 | Ga0070665_1000763392 | 320 |
| 176 | 3300005548 | Ga0070665_100084755 | Ga0070665_1000847552 | 320 |
| 177 | 3300005549 | Ga0070704_100130970 | Ga0070704_1001309702 | 320 |
| 178 | 3300005549 | Ga0070704_100198539 | Ga0070704_1001985392 | 320 |
| 179 | 3300005563 | Ga0068855_100082652 | Ga0068855_1000826523 | 320 |
| 180 | 3300005564 | Ga0070664_100003519 | Ga0070664_1000035199 | 320 |
| 181 | 3300005564 | Ga0070664_100004562 | Ga0070664_1000045625 | 320 |
| 182 | 3300005564 | Ga0070664_100115735 | Ga0070664_1001157352 | 320 |
| 183 | 3300005564 | Ga0070664_100293883 | Ga0070664_1002938832 | 320 |
| 184 | 3300005577 | Ga0068857_100011444 | Ga0068857_1000114444 | 320 |
| 185 | 3300005577 | Ga0068857_100116300 | Ga0068857_1001163002 | 320 |
| 186 | 3300005578 | Ga0068854_100006236 | Ga0068854_1000062368 | 320 |
| 187 | 3300005615 | Ga0070702_100041302 | Ga0070702_1000413022 | 320 |
| 188 | 3300005615 | Ga0070702_100067530 | Ga0070702_1000675301 | 320 |
| 189 | 3300005615 | Ga0070702_100082924 | Ga0070702_1000829242 | 320 |
| 190 | 3300005616 | Ga0068852_100095072 | Ga0068852_1000950722 | 320 |
| 191 | 3300005616 | Ga0068852_100609298 | Ga0068852_1006092981 | 320 |
| 192 | 3300005617 | Ga0068859_100022365 | Ga0068859_1000223656 | 320 |
| 193 | 3300005617 | Ga0068859_100081521 | Ga0068859_1000815212 | 320 |
| 194 | 3300005617 | Ga0068859_100096157 | Ga0068859_1000961572 | 320 |
| 195 | 3300005618 | Ga0068864_100045012 | Ga0068864_1000450123 | 320 |
| 196 | 3300005618 | Ga0068864_100066454 | Ga0068864_1000664541 | 320 |
| 197 | 3300005618 | Ga0068864_100089558 | Ga0068864_1000895582 | 320 |
| 198 | 3300005718 | Ga0068866_10034490 | Ga0068866_100344901 | 320 |
| 199 | 3300005841 | Ga0068863_100017949 | Ga0068863_1000179492 | 320 |
| 200 | 3300005841 | Ga0068863_100265420 | Ga0068863_1002654202 | 320 |
| 201 | 3300005843 | Ga0068860_100106269 | Ga0068860_1001062693 | 320 |
| 202 | 3300006038 | Ga0075365_10000819 | Ga0075365_100008197 | 320 |
| 203 | 3300006038 | Ga0075365_10035010 | Ga0075365_100350102 | 320 |
| 204 | 3300006051 | Ga0075364_10011460 | Ga0075364_100114603 | 320 |
| 205 | 3300006051 | Ga0075364_10027113 | Ga0075364_100271132 | 320 |
| 206 | 3300006051 | Ga0075364_10032801 | Ga0075364_100328012 | 320 |
| 207 | 3300006051 | Ga0075364_10112623 | Ga0075364_101126232 | 320 |
| 208 | 3300006051 | Ga0075364_10147977 | Ga0075364_101479772 | 320 |
| 209 | 3300006173 | Ga0070716_100098490 | Ga0070716_1000984902 | 320 |
| 210 | 3300006173 | Ga0070716_100212329 | Ga0070716_1002123292 | 320 |
| 211 | 3300006177 | Ga0075362_10000172 | Ga0075362_100001725 | 320 |
| 212 | 3300006178 | Ga0075367_10083955 | Ga0075367_100839552 | 320 |
| 213 | 3300006178 | Ga0075367_10123975 | Ga0075367_101239752 | 320 |
| 214 | 3300006178 | Ga0075367_10150941 | Ga0075367_101509412 | 320 |
| 215 | 3300006195 | Ga0075366_10019756 | Ga0075366_100197562 | 320 |
| 216 | 3300006237 | Ga0097621_100092687 | Ga0097621_1000926873 | 320 |
| 217 | 3300006237 | Ga0097621_100102856 | Ga0097621_1001028562 | 320 |
| 218 | 3300006353 | Ga0075370_10049631 | Ga0075370_100496312 | 320 |
| 219 | 3300006358 | Ga0068871_100002675 | Ga0068871_10000267510 | 320 |
| 220 | 3300006358 | Ga0068871_100273587 | Ga0068871_1002735871 | 320 |
| 221 | 3300006844 | Ga0075428_100001280 | Ga0075428_10000128013 | 320 |
| 222 | 3300006844 | Ga0075428_100008474 | Ga0075428_1000084748 | 320 |
| 223 | 3300006844 | Ga0075428_100140015 | Ga0075428_1001400152 | 320 |
| 224 | 3300006846 | Ga0075430_100003870 | Ga0075430_1000038705 | 320 |
| 225 | 3300006846 | Ga0075430_100007243 | Ga0075430_1000072435 | 320 |
| 226 | 3300006846 | Ga0075430_100268607 | Ga0075430_1002686072 | 320 |
| 227 | 3300006846 | Ga0075430_100383035 | Ga0075430_1003830351 | 320 |
| 228 | 3300006847 | Ga0075431_100002665 | Ga0075431_1000026653 | 320 |
| 229 | 3300006847 | Ga0075431_100016013 | Ga0075431_1000160134 | 320 |
| 230 | 3300006852 | Ga0075433_10087172 | Ga0075433_100871723 | 320 |
| 231 | 3300006852 | Ga0075433_10104378 | Ga0075433_101043782 | 320 |
| 232 | 3300006871 | Ga0075434_100011984 | Ga0075434_1000119844 | 320 |
| 233 | 3300006871 | Ga0075434_100029393 | Ga0075434_1000293934 | 320 |
| 234 | 3300006871 | Ga0075434_100035952 | Ga0075434_1000359524 | 320 |
| 235 | 3300006880 | Ga0075429_100005224 | Ga0075429_1000052249 | 320 |
| 236 | 3300006880 | Ga0075429_100033459 | Ga0075429_1000334592 | 320 |
| 237 | 3300006880 | Ga0075429_100214235 | Ga0075429_1002142352 | 320 |
| 238 | 3300006931 | Ga0097620_100022365 | Ga0097620_1000223656 | 320 |
| 239 | 3300006931 | Ga0097620_100081523 | Ga0097620_1000815233 | 320 |
| 240 | 3300006931 | Ga0097620_100096157 | Ga0097620_1000961572 | 320 |
| 241 | 3300007076 | Ga0075435_100000404 | Ga0075435_10000040424 | 320 |
| 242 | 3300009093 | Ga0105240_10062219 | Ga0105240_100622192 | 320 |
| 243 | 3300009093 | Ga0105240_10068347 | Ga0105240_100683472 | 320 |
| 244 | 3300009094 | Ga0111539_10002555 | Ga0111539_100025559 | 320 |
| 245 | 3300009094 | Ga0111539_10015953 | Ga0111539_1001595310 | 320 |
| 246 | 3300009094 | Ga0111539_10055606 | Ga0111539_100556064 | 320 |
| 247 | 3300009098 | Ga0105245_10015209 | Ga0105245_100152093 | 320 |
| 248 | 3300009098 | Ga0105245_10103996 | Ga0105245_101039962 | 320 |
| 249 | 3300009147 | Ga0114129_10000408 | Ga0114129_1000040837 | 320 |
| 250 | 3300009147 | Ga0114129_10011033 | Ga0114129_100110339 | 320 |
| 251 | 3300009147 | Ga0114129_10023607 | Ga0114129_100236076 | 320 |
| 252 | 3300009147 | Ga0114129_10035313 | Ga0114129_100353136 | 320 |
| 253 | 3300009147 | Ga0114129_10082780 | Ga0114129_100827805 | 320 |
| 254 | 3300009147 | Ga0114129_10139810 | Ga0114129_101398103 | 320 |
| 255 | 3300009148 | Ga0105243_10281761 | Ga0105243_102817612 | 320 |
| 256 | 3300009174 | Ga0105241_10170650 | Ga0105241_101706502 | 320 |
| 257 | 3300009174 | Ga0105241_10261170 | Ga0105241_102611701 | 320 |
| 258 | 3300009176 | Ga0105242_10027488 | Ga0105242_100274884 | 320 |
| 259 | 3300009176 | Ga0105242_10441554 | Ga0105242_104415541 | 320 |
| 260 | 3300009177 | Ga0105248_10052999 | Ga0105248_100529994 | 320 |
| 261 | 3300009177 | Ga0105248_10265753 | Ga0105248_102657532 | 320 |
| 262 | 3300009177 | Ga0105248_10502317 | Ga0105248_105023172 | 320 |
| 263 | 3300009545 | Ga0105237_10123489 | Ga0105237_101234892 | 320 |
| 264 | 3300009553 | Ga0105249_10075780 | Ga0105249_100757802 | 320 |
| 265 | 3300013296 | Ga0157374_10153188 | Ga0157374_101531882 | 320 |
| 266 | 3300013296 | Ga0157374_10570705 | Ga0157374_105707051 | 320 |
| 267 | 3300013306 | Ga0163162_10232413 | Ga0163162_102324132 | 320 |
| 268 | 3300013306 | Ga0163162_10788607 | Ga0163162_107886071 | 320 |
| 269 | 3300014325 | Ga0163163_10004809 | Ga0163163_100048096 | 320 |
| 270 | 3300014325 | Ga0163163_10051015 | Ga0163163_100510152 | 320 |
| 271 | 3300014326 | Ga0157380_10007044 | Ga0157380_100070447 | 320 |
| 272 | 3300014326 | Ga0157380_10147610 | Ga0157380_101476102 | 320 |
| 273 | 3300014326 | Ga0157380_10438814 | Ga0157380_104388141 | 320 |
| 274 | 3300014745 | Ga0157377_10001507 | Ga0157377_100015077 | 320 |
| 275 | 3300014968 | Ga0157379_10040072 | Ga0157379_100400724 | 320 |
| 276 | 3300014969 | Ga0157376_10009204 | Ga0157376_100092047 | 320 |
| 277 | 3300014969 | Ga0157376_10023360 | Ga0157376_100233604 | 320 |
| 278 | 3300017792 | Ga0163161_10194998 | Ga0163161_101949982 | 320 |
| 279 | 3300025893 | Ga0207682_10011562 | Ga0207682_100115623 | 320 |
| 280 | 3300025899 | Ga0207642_10008472 | Ga0207642_100084724 | 320 |
| 281 | 3300025899 | Ga0207642_10067033 | Ga0207642_100670331 | 320 |
| 282 | 3300025907 | Ga0207645_10107246 | Ga0207645_101072462 | 320 |
| 283 | 3300025907 | Ga0207645_10215734 | Ga0207645_102157342 | 320 |
| 284 | 3300025908 | Ga0207643_10004895 | Ga0207643_100048955 | 320 |
| 285 | 3300025908 | Ga0207643_10027758 | Ga0207643_100277582 | 320 |
| 286 | 3300025910 | Ga0207684_10346446 | Ga0207684_103464461 | 320 |
| 287 | 3300025911 | Ga0207654_10140749 | Ga0207654_101407492 | 320 |
| 288 | 3300025912 | Ga0207707_10031377 | Ga0207707_100313772 | 320 |
| 289 | 3300025912 | Ga0207707_10111201 | Ga0207707_101112012 | 320 |
| 290 | 3300025913 | Ga0207695_10018579 | Ga0207695_100185792 | 320 |
| 291 | 3300025918 | Ga0207662_10021057 | Ga0207662_100210573 | 320 |
| 292 | 3300025919 | Ga0207657_10006060 | Ga0207657_1000606012 | 320 |
| 293 | 3300025920 | Ga0207649_10060700 | Ga0207649_100607002 | 320 |
| 294 | 3300025921 | Ga0207652_10050849 | Ga0207652_100508492 | 320 |
| 295 | 3300025925 | Ga0207650_10009640 | Ga0207650_100096407 | 320 |
| 296 | 3300025925 | Ga0207650_10015278 | Ga0207650_100152782 | 320 |
| 297 | 3300025925 | Ga0207650_10037895 | Ga0207650_100378953 | 320 |
| 298 | 3300025925 | Ga0207650_10050594 | Ga0207650_100505944 | 320 |
| 299 | 3300025926 | Ga0207659_10006571 | Ga0207659_100065713 | 320 |
| 300 | 3300025926 | Ga0207659_10129622 | Ga0207659_101296222 | 320 |
| 301 | 3300025926 | Ga0207659_10437082 | Ga0207659_104370821 | 320 |
| 302 | 3300025927 | Ga0207687_10031315 | Ga0207687_100313153 | 320 |
| 303 | 3300025931 | Ga0207644_10164316 | Ga0207644_101643162 | 320 |
| 304 | 3300025932 | Ga0207690_10131335 | Ga0207690_101313352 | 320 |
| 305 | 3300025933 | Ga0207706_10040547 | Ga0207706_100405472 | 320 |
| 306 | 3300025933 | Ga0207706_10105227 | Ga0207706_101052272 | 320 |
| 307 | 3300025934 | Ga0207686_10081713 | Ga0207686_100817132 | 320 |
| 308 | 3300025934 | Ga0207686_10293253 | Ga0207686_102932532 | 320 |
| 309 | 3300025935 | Ga0207709_10101369 | Ga0207709_101013692 | 320 |
| 310 | 3300025935 | Ga0207709_10190281 | Ga0207709_101902812 | 320 |
| 311 | 3300025936 | Ga0207670_10016295 | Ga0207670_100162952 | 320 |
| 312 | 3300025936 | Ga0207670_10310761 | Ga0207670_103107612 | 320 |
| 313 | 3300025936 | Ga0207670_10380521 | Ga0207670_103805211 | 320 |
| 314 | 3300025937 | Ga0207669_10113005 | Ga0207669_101130052 | 320 |
| 315 | 3300025937 | Ga0207669_10444309 | Ga0207669_104443091 | 320 |
| 316 | 3300025938 | Ga0207704_10008319 | Ga0207704_100083194 | 320 |
| 317 | 3300025939 | Ga0207665_10159775 | Ga0207665_101597752 | 320 |
| 318 | 3300025940 | Ga0207691_10093145 | Ga0207691_100931452 | 320 |
| 319 | 3300025941 | Ga0207711_10296307 | Ga0207711_102963072 | 320 |
| 320 | 3300025942 | Ga0207689_10329151 | Ga0207689_103291512 | 320 |
| 321 | 3300025942 | Ga0207689_10405372 | Ga0207689_104053722 | 320 |
| 322 | 3300025944 | Ga0207661_10003683 | Ga0207661_100036838 | 320 |
| 323 | 3300025944 | Ga0207661_10074090 | Ga0207661_100740901 | 320 |
| 324 | 3300025945 | Ga0207679_10006385 | Ga0207679_100063853 | 320 |
| 325 | 3300025945 | Ga0207679_10022084 | Ga0207679_100220844 | 320 |
| 326 | 3300025945 | Ga0207679_10069971 | Ga0207679_100699712 | 320 |
| 327 | 3300025945 | Ga0207679_10217729 | Ga0207679_102177291 | 320 |
| 328 | 3300025949 | Ga0207667_10129591 | Ga0207667_101295912 | 320 |
| 329 | 3300025960 | Ga0207651_10023871 | Ga0207651_100238713 | 320 |
| 330 | 3300026023 | Ga0207677_10096400 | Ga0207677_100964002 | 320 |
| 331 | 3300026041 | Ga0207639_10435338 | Ga0207639_104353382 | 320 |
| 332 | 3300026067 | Ga0207678_10043339 | Ga0207678_100433393 | 320 |
| 333 | 3300026075 | Ga0207708_10180064 | Ga0207708_101800642 | 320 |
| 334 | 3300026088 | Ga0207641_10058516 | Ga0207641_100585163 | 320 |
| 335 | 3300026088 | Ga0207641_10387720 | Ga0207641_103877201 | 320 |
| 336 | 3300026095 | Ga0207676_10029836 | Ga0207676_100298362 | 320 |
| 337 | 3300026095 | Ga0207676_10087755 | Ga0207676_100877553 | 320 |
| 338 | 3300026095 | Ga0207676_10119895 | Ga0207676_101198952 | 320 |
| 339 | 3300026095 | Ga0207676_10273399 | Ga0207676_102733992 | 320 |
| 340 | 3300026095 | Ga0207676_10392299 | Ga0207676_103922991 | 320 |
| 341 | 3300026095 | Ga0207676_10395786 | Ga0207676_103957862 | 320 |
| 342 | 3300026116 | Ga0207674_10196858 | Ga0207674_101968582 | 320 |
| 343 | 3300026116 | Ga0207674_10414055 | Ga0207674_104140552 | 320 |
| 344 | 3300026118 | Ga0207675_100256314 | Ga0207675_1002563142 | 320 |
| 345 | 3300026121 | Ga0207683_10184148 | Ga0207683_101841482 | 320 |
| 346 | 3300026142 | Ga0207698_10439023 | Ga0207698_104390232 | 320 |
| 347 | 3300026142 | Ga0207698_10559043 | Ga0207698_105590431 | 320 |
| 348 | 3300027695 | Ga0209966_1008881 | Ga0209966_10088812 | 320 |
| 349 | 3300027866 | Ga0209813_10013534 | Ga0209813_100135342 | 320 |
| 350 | 3300027907 | Ga0207428_10000970 | Ga0207428_1000097016 | 320 |
| 351 | 3300027907 | Ga0207428_10020464 | Ga0207428_100204643 | 320 |
| 352 | 3300028379 | Ga0268266_10018204 | Ga0268266_100182045 | 320 |
| 353 | 3300028379 | Ga0268266_10062499 | Ga0268266_100624994 | 320 |
| 354 | 3300028379 | Ga0268266_10075456 | Ga0268266_100754563 | 320 |
| 355 | 3300028381 | Ga0268264_10087383 | Ga0268264_100873833 | 320 |
| 356 | 3300028666 | Ga0265336_10038354 | Ga0265336_100383542 | 320 |
| 357 | 3300031548 | Ga0307408_100017907 | Ga0307408_1000179075 | 320 |
| 358 | 3300031548 | Ga0307408_100086971 | Ga0307408_1000869712 | 320 |
| 359 | 3300031711 | Ga0265314_10017566 | Ga0265314_100175663 | 320 |
| 360 | 3300031712 | Ga0265342_10181843 | Ga0265342_101818432 | 320 |
| 361 | 3300031731 | Ga0307405_10000373 | Ga0307405_100003739 | 320 |
| 362 | 3300031824 | Ga0307413_10193462 | Ga0307413_101934622 | 320 |
| 363 | 3300031852 | Ga0307410_10177339 | Ga0307410_101773392 | 320 |
| 364 | 3300031911 | Ga0307412_10003351 | Ga0307412_100033516 | 320 |
| 365 | 3300031995 | Ga0307409_100001999 | Ga0307409_10000199910 | 320 |
| 366 | 3300032002 | Ga0307416_100019475 | Ga0307416_1000194754 | 320 |
| 367 | 3300032002 | Ga0307416_100094726 | Ga0307416_1000947261 | 320 |
| 368 | 3300032002 | Ga0307416_100108004 | Ga0307416_1001080042 | 320 |
| 369 | 3300032002 | Ga0307416_100133474 | Ga0307416_1001334742 | 320 |
| 370 | 3300032005 | Ga0307411_10018425 | Ga0307411_100184253 | 320 |
| 371 | 3300032005 | Ga0307411_10086936 | Ga0307411_100869361 | 320 |
| 372 | 3300032126 | Ga0307415_100026945 | Ga0307415_1000269452 | 320 |
| 373 | 3300032126 | Ga0307415_100098696 | Ga0307415_1000986962 | 320 |
| 374 | 3300032126 | Ga0307415_100103932 | Ga0307415_1001039321 | 320 |
| 375 | 3300035085 | Ga0373929_0000969 | Ga0373929_0000969_387_1349 | 320 |
| 376 | 3300035088 | Ga0373940_0009458 | Ga0373940_0009458_35_997 | 320 |
| 377 | 3300035090 | Ga0373949_0000541 | Ga0373949_0000541_2110_3072 | 320 |
| 378 | 3300035115 | Ga0373941_0002913 | Ga0373941_0002913_2659_3621 | 320 |
| 379 | 3300035121 | Ga0373960_0000470 | Ga0373960_0000470_3489_4451 | 320 |
| 380 | 3300035207 | Ga0373942_0061978 | Ga0373942_0061978_62_1027 | 320 |
| 381 | 3300035241 | Ga0373961_0001177 | Ga0373961_0001177_2296_3258 | 320 |
| 382 | 3300035691 | Ga0373931_0000745 | Ga0373931_0000745_10397_11359 | 320 |
| 383 | 3300036401 | Ga0373937_0083282 | Ga0373937_0083282_1435_2397 | 320 |
| 384 | 3300037068 | Ga0373925_0129982 | Ga0373925_0129982_844_1806 | 320 |
| 385 | 3300041512 | Ga0451853_3907508 | Ga0451853_3907508_71_1033 | 320 |
| 386 | 3300042001 | Ga0439441_018439 | Ga0439441_018439_162_1124 | 320 |
| 387 | 3300042461 | Ga0439460_0002387 | Ga0439460_0002387_1788_2750 | 320 |
| 388 | 3300042876 | Ga0451577_0009672 | Ga0451577_0009672_4426_5412 | 320 |
| 389 | 3300044712 | Ga0453684_0005717 | Ga0453684_0005717_16359_17345 | 320 |
| 390 | 3300044712 | Ga0453684_0023311 | Ga0453684_0023311_6939_7925 | 320 |
| 391 | 3300045051 | Ga0451576_0008579 | Ga0451576_0008579_5304_6266 | 320 |
| 392 | 3300045976 | Ga0466967_0099140 | Ga0466967_0099140_725_1687 | 320 |
| 393 | 3300046455 | Ga0495603_0051162 | Ga0495603_0051162_1428_2390 | 320 |
| 394 | 3300046459 | Ga0495629_0004349 | Ga0495629_0004349_2014_2976 | 320 |
| 395 | 3300046461 | Ga0495641_0103263 | Ga0495641_0103263_102_1064 | 320 |
| 396 | 3300046491 | Ga0495584_0012217 | Ga0495584_0012217_135_1097 | 320 |
| 397 | 3300046499 | Ga0495594_0096868 | Ga0495594_0096868_223_1185 | 320 |
| 398 | 3300046539 | Ga0495621_0007517 | Ga0495621_0007517_353_1315 | 320 |
| 399 | 3300046543 | Ga0495645_0091871 | Ga0495645_0091871_933_1895 | 320 |
| 400 | 3300046615 | Ga0495656_0153842 | Ga0495656_0153842_25_987 | 320 |
| 401 | 3300046683 | Ga0495658_0056860 | Ga0495658_0056860_1109_2071 | 320 |
| 402 | 3300047321 | Ga0495676_0043167 | Ga0495676_0043167_38_1000 | 320 |
| 403 | 3300047447 | Ga0495685_003103 | Ga0495685_003103_2493_3455 | 320 |
| 404 | 3300048904 | Ga0496101_0183714 | Ga0496101_0183714_408_1370 | 320 |
| 405 | 3300048905 | Ga0496102_0315418 | Ga0496102_0315418_238_1200 | 320 |
| 406 | 3300048907 | Ga0496104_0010994 | Ga0496104_0010994_1817_2779 | 320 |
| 407 | 3300048907 | Ga0496104_0136477 | Ga0496104_0136477_1008_1970 | 320 |
| 408 | 3300048908 | Ga0496105_0021967 | Ga0496105_0021967_925_1887 | 320 |
| 409 | 3300048911 | Ga0496108_0025166 | Ga0496108_0025166_1544_2506 | 320 |
| 410 | 3300048912 | Ga0496109_0013940 | Ga0496109_0013940_4207_5169 | 320 |
| 411 | 3300048912 | Ga0496109_0056560 | Ga0496109_0056560_2311_3273 | 320 |
| 412 | 3300048912 | Ga0496109_0104658 | Ga0496109_0104658_21_983 | 320 |
| 413 | 3300048912 | Ga0496109_0481010 | Ga0496109_0481010_146_1108 | 320 |
| 414 | 3300048913 | Ga0496110_0000816 | Ga0496110_0000816_6816_7778 | 320 |
| 415 | 3300048913 | Ga0496110_0064415 | Ga0496110_0064415_517_1479 | 320 |
| 416 | 3300048914 | Ga0496111_0200262 | Ga0496111_0200262_64_1026 | 320 |
| 417 | 3300048914 | Ga0496111_0262283 | Ga0496111_0262283_103_1065 | 320 |
| 418 | 3300048914 | Ga0496111_0315112 | Ga0496111_0315112_99_1061 | 320 |
| 419 | 3300048915 | Ga0496112_0000213 | Ga0496112_0000213_8570_9532 | 320 |
| 420 | 3300048915 | Ga0496112_0219616 | Ga0496112_0219616_848_1810 | 320 |
| 421 | 3300048915 | Ga0496112_0511584 | Ga0496112_0511584_81_1043 | 320 |
| 422 | 3300049568 | Ga0501031_0142114 | Ga0501031_0142114_263_1225 | 320 |
| 423 | 3300049570 | Ga0501033_0177726 | Ga0501033_0177726_474_1436 | 320 |
| 424 | 3300049572 | Ga0501036_0012231 | Ga0501036_0012231_2439_3401 | 320 |
| 425 | 3300049572 | Ga0501036_0213533 | Ga0501036_0213533_444_1406 | 320 |
| 426 | 3300049574 | Ga0501038_0167771 | Ga0501038_0167771_427_1389 | 320 |
| 427 | 3300049575 | Ga0501039_0017921 | Ga0501039_0017921_3828_4790 | 320 |
| 428 | 3300049575 | Ga0501039_0058482 | Ga0501039_0058482_40_1002 | 320 |
| 429 | 3300049576 | Ga0501040_0000223 | Ga0501040_0000223_24725_25687 | 320 |
| 430 | 3300049576 | Ga0501040_0018715 | Ga0501040_0018715_1073_2035 | 320 |
| 431 | 3300049578 | Ga0501042_0001934 | Ga0501042_0001934_3628_4590 | 320 |
| 432 | 3300049579 | Ga0501043_0037724 | Ga0501043_0037724_384_1346 | 320 |
| 433 | 3300049580 | Ga0501046_0009389 | Ga0501046_0009389_4100_5062 | 320 |
| 434 | 3300049582 | Ga0501048_0027621 | Ga0501048_0027621_1091_2053 | 320 |
| 435 | 3300049582 | Ga0501048_0030431 | Ga0501048_0030431_261_1223 | 320 |
| 436 | 3300049584 | Ga0501068_0007943 | Ga0501068_0007943_3463_4425 | 320 |
| 437 | 3300049587 | Ga0501071_0026433 | Ga0501071_0026433_2575_3537 | 320 |
| 438 | 3300049587 | Ga0501071_0033937 | Ga0501071_0033937_1362_2324 | 320 |
| 439 | 3300049587 | Ga0501071_0229579 | Ga0501071_0229579_190_1152 | 320 |
| 440 | 3300049588 | Ga0501072_0037511 | Ga0501072_0037511_2414_3376 | 320 |
| 441 | 3300049591 | Ga0501075_0002433 | Ga0501075_0002433_10905_11867 | 320 |
| 442 | 3300049591 | Ga0501075_0033756 | Ga0501075_0033756_1288_2250 | 320 |
| 443 | 3300049592 | Ga0501076_0000179 | Ga0501076_0000179_5245_6207 | 320 |
| 444 | 3300049592 | Ga0501076_0022769 | Ga0501076_0022769_3696_4658 | 320 |
| 445 | 3300049593 | Ga0501077_0018060 | Ga0501077_0018060_2404_3366 | 320 |
| 446 | 3300049593 | Ga0501077_0048296 | Ga0501077_0048296_1557_2519 | 320 |
| 447 | 3300049741 | Ga0501079_0019067 | Ga0501079_0019067_541_1503 | 320 |
| 448 | 3300049742 | Ga0501080_0203847 | Ga0501080_0203847_513_1475 | 320 |
| 449 | 3300049743 | Ga0501081_0001559 | Ga0501081_0001559_1689_2651 | 320 |
| 450 | 3300049744 | Ga0501083_0203612 | Ga0501083_0203612_69_1031 | 320 |
| 451 | 3300049744 | Ga0501083_0240186 | Ga0501083_0240186_40_1002 | 320 |
| 452 | 3300049824 | Ga0501045_0008879 | Ga0501045_0008879_1948_2910 | 320 |
| 453 | 3300049824 | Ga0501045_0011421 | Ga0501045_0011421_528_1490 | 320 |
| 454 | 3300050489 | nmdc:mga03683_650_c1 | nmdc:mga03683_650_c1_1020_1982 | 320 |
| 455 | 3300050491 | nmdc:mga00v17_2930_c1 | nmdc:mga00v17_2930_c1_334_1296 | 320 |
| 456 | 3300050491 | nmdc:mga00v17_42283_c1 | nmdc:mga00v17_42283_c1_647_1609 | 320 |
| 457 | 3300050491 | nmdc:mga00v17_63758_c1 | nmdc:mga00v17_63758_c1_636_1598 | 320 |
| 458 | 3300050491 | nmdc:mga00v17_70474_c1 | nmdc:mga00v17_70474_c1_143_1105 | 320 |
| 459 | 3300050491 | nmdc:mga00v17_8387_c1 | nmdc:mga00v17_8387_c1_2717_3679 | 320 |
| 460 | 3300050492 | nmdc:mga0yw44_15667_c1 | nmdc:mga0yw44_15667_c1_671_1633 | 320 |
| 461 | 3300050493 | nmdc:mga0k408_19295_c1 | nmdc:mga0k408_19295_c1_447_1409 | 320 |
| 462 | 3300050493 | nmdc:mga0k408_23628_c1 | nmdc:mga0k408_23628_c1_400_1362 | 320 |
| 463 | 3300050494 | nmdc:mga06z11_8059_c1 | nmdc:mga06z11_8059_c1_2124_3086 | 320 |
| 464 | 3300050495 | nmdc:mga04h51_12935_c1 | nmdc:mga04h51_12935_c1_932_1894 | 320 |
| 465 | 3300050507 | nmdc:mga05p37_18182_c1 | nmdc:mga05p37_18182_c1_1911_2873 | 320 |
| 466 | 3300050507 | nmdc:mga05p37_207921_c1 | nmdc:mga05p37_207921_c1_221_1183 | 320 |
| 467 | 3300050507 | nmdc:mga05p37_219320_c1 | nmdc:mga05p37_219320_c1_664_1626 | 320 |
| 468 | 3300050507 | nmdc:mga05p37_470426_c1 | nmdc:mga05p37_470426_c1_324_1286 | 320 |
| 469 | 3300050507 | nmdc:mga05p37_597947_c1 | nmdc:mga05p37_597947_c1_107_1069 | 320 |
| 470 | 3300050507 | nmdc:mga05p37_625_c2 | nmdc:mga05p37_625_c2_9606_10568 | 320 |
| 471 | 3300050508 | nmdc:mga09592_124772_c1 | nmdc:mga09592_124772_c1_832_1794 | 320 |
| 472 | 3300050509 | nmdc:mga0qj67_15800_c1 | nmdc:mga0qj67_15800_c1_3229_4191 | 320 |
| 473 | 3300050509 | nmdc:mga0qj67_402_c1 | nmdc:mga0qj67_402_c1_14806_15768 | 320 |
| 474 | 3300050510 | nmdc:mga06r32_4150_c1 | nmdc:mga06r32_4150_c1_1499_2461 | 320 |
| 475 | 3300050511 | nmdc:mga08y16_11259_c1 | nmdc:mga08y16_11259_c1_8072_9034 | 320 |
| 476 | 3300050511 | nmdc:mga08y16_1646_c1 | nmdc:mga08y16_1646_c1_11644_12606 | 320 |
| 477 | 3300050511 | nmdc:mga08y16_5423_c1 | nmdc:mga08y16_5423_c1_3985_4947 | 320 |
| 478 | 3300050512 | nmdc:mga0n895_152868_c1 | nmdc:mga0n895_152868_c1_150_1112 | 320 |
| 479 | 3300050512 | nmdc:mga0n895_157430_c1 | nmdc:mga0n895_157430_c1_313_1275 | 320 |
| 480 | 3300050513 | nmdc:mga0rr50_119592_c1 | nmdc:mga0rr50_119592_c1_298_1260 | 320 |
| 481 | 3300050513 | nmdc:mga0rr50_228910_c1 | nmdc:mga0rr50_228910_c1_52_1014 | 320 |
| 482 | 3300050514 | nmdc:mga08x19_32069_c1 | nmdc:mga08x19_32069_c1_341_1303 | 320 |
| 483 | 3300050515 | nmdc:mga0a205_125965_c1 | nmdc:mga0a205_125965_c1_567_1529 | 320 |
| 484 | 3300050515 | nmdc:mga0a205_14986_c2 | nmdc:mga0a205_14986_c2_3094_4056 | 320 |
| 485 | 3300050515 | nmdc:mga0a205_205943_c1 | nmdc:mga0a205_205943_c1_34_996 | 320 |
| 486 | 3300050515 | nmdc:mga0a205_239535_c1 | nmdc:mga0a205_239535_c1_464_1426 | 320 |
| 487 | 3300050515 | nmdc:mga0a205_359560_c1 | nmdc:mga0a205_359560_c1_26_988 | 320 |
| 488 | 3300050515 | nmdc:mga0a205_359610_c1 | nmdc:mga0a205_359610_c1_206_1168 | 320 |
| 489 | 3300050515 | nmdc:mga0a205_432086_c1 | nmdc:mga0a205_432086_c1_156_1118 | 320 |
| 490 | 3300050515 | nmdc:mga0a205_88094_c1 | nmdc:mga0a205_88094_c1_767_1729 | 320 |
| 491 | 3300053085 | Ga0495619_0088386 | Ga0495619_0088386_837_1799 | 320 |
| 492 | 3300053096 | Ga0500641_0021822 | Ga0500641_0021822_141_1103 | 320 |
| 493 | 3300054114 | Ga0501084_0000669 | Ga0501084_0000669_21215_22177 | 320 |
| 494 | 3300054114 | Ga0501084_0058938 | Ga0501084_0058938_1361_2323 | 320 |
| 495 | 3300060353 | Ga0501082_0018802 | Ga0501082_0018802_2573_3535 | 320 |
| 496 | 3300061734 | Ga0530510_0000198 | Ga0530510_0000198_30950_31912 | 320 |
| 497 | 3300061734 | Ga0530510_0014629 | Ga0530510_0014629_534_1496 | 320 |
| 498 | 3300005985 | Ga0081539_10052663 | Ga0081539_100526632 | 321 |
| 499 | 3300006237 | Ga0097621_100086294 | Ga0097621_1000862943 | 321 |
| 500 | 3300006358 | Ga0068871_100033232 | Ga0068871_1000332323 | 321 |
| 501 | 3300009147 | Ga0114129_10000295 | Ga0114129_100002955 | 321 |
| 502 | 3300025904 | Ga0207647_10076704 | Ga0207647_100767042 | 321 |
| 503 | 3300025907 | Ga0207645_10081824 | Ga0207645_100818242 | 321 |
| 504 | 3300025913 | Ga0207695_10217391 | Ga0207695_102173912 | 321 |
| 505 | 3300025918 | Ga0207662_10006429 | Ga0207662_100064294 | 321 |
| 506 | 3300025926 | Ga0207659_10427046 | Ga0207659_104270462 | 321 |
| 507 | 3300025940 | Ga0207691_10045230 | Ga0207691_100452302 | 321 |
| 508 | 3300025941 | Ga0207711_10244687 | Ga0207711_102446871 | 321 |
| 509 | 3300025981 | Ga0207640_10044228 | Ga0207640_100442282 | 321 |
| 510 | 3300026035 | Ga0207703_10103292 | Ga0207703_101032922 | 321 |
| 511 | 3300026075 | Ga0207708_10028204 | Ga0207708_100282042 | 321 |
| 512 | 3300035119 | Ga0373956_0062293 | Ga0373956_0062293_473_1438 | 321 |
| 513 | 3300037068 | Ga0373925_0198232 | Ga0373925_0198232_278_1243 | 321 |
| 514 | 3300045049 | Ga0466959_0087948 | Ga0466959_0087948_921_1910 | 321 |
| 515 | 3300045051 | Ga0451576_0061807 | Ga0451576_0061807_2201_3166 | 321 |
| 516 | 3300048903 | Ga0496100_0002378 | Ga0496100_0002378_8006_8971 | 321 |
| 517 | 3300048907 | Ga0496104_0001613 | Ga0496104_0001613_1751_2716 | 321 |
| 518 | 3300048917 | Ga0496114_0011050 | Ga0496114_0011050_3842_4807 | 321 |
| 519 | 3300050507 | nmdc:mga05p37_1136_c1 | nmdc:mga05p37_1136_c1_5083_6048 | 321 |
| 520 | 3300050508 | nmdc:mga09592_242448_c1 | nmdc:mga09592_242448_c1_423_1388 | 321 |
| 521 | 3300050511 | nmdc:mga08y16_536358_c1 | nmdc:mga08y16_536358_c1_156_1121 | 321 |
| 522 | 3300050515 | nmdc:mga0a205_43183_c1 | nmdc:mga0a205_43183_c1_1969_2934 | 321 |
| 523 | 3300005288 | Ga0065714_10018882 | Ga0065714_100188822 | 322 |
| 524 | 3300005293 | Ga0065715_10090431 | Ga0065715_100904315 | 322 |
| 525 | 3300005295 | Ga0065707_10144105 | Ga0065707_101441052 | 322 |
| 526 | 3300005338 | Ga0068868_100235144 | Ga0068868_1002351441 | 322 |
| 527 | 3300005468 | Ga0070707_100010426 | Ga0070707_1000104265 | 322 |
| 528 | 3300005546 | Ga0070696_100059283 | Ga0070696_1000592833 | 322 |
| 529 | 3300005549 | Ga0070704_100058749 | Ga0070704_1000587493 | 322 |
| 530 | 3300005617 | Ga0068859_100054464 | Ga0068859_1000544645 | 322 |
| 531 | 3300005719 | Ga0068861_100033397 | Ga0068861_1000333974 | 322 |
| 532 | 3300005844 | Ga0068862_100299647 | Ga0068862_1002996472 | 322 |
| 533 | 3300005937 | Ga0081455_10114382 | Ga0081455_101143822 | 322 |
| 534 | 3300006237 | Ga0097621_100139441 | Ga0097621_1001394412 | 322 |
| 535 | 3300006852 | Ga0075433_10140086 | Ga0075433_101400862 | 322 |
| 536 | 3300006931 | Ga0097620_100054464 | Ga0097620_1000544645 | 322 |
| 537 | 3300009553 | Ga0105249_10274107 | Ga0105249_102741072 | 322 |
| 538 | 3300013296 | Ga0157374_10134859 | Ga0157374_101348592 | 322 |
| 539 | 3300014969 | Ga0157376_10013838 | Ga0157376_100138382 | 322 |
| 540 | 3300025922 | Ga0207646_10028669 | Ga0207646_100286696 | 322 |
| 541 | 3300025939 | Ga0207665_10229979 | Ga0207665_102299791 | 322 |
| 542 | 3300025940 | Ga0207691_10240492 | Ga0207691_102404922 | 322 |
| 543 | 3300026118 | Ga0207675_100040529 | Ga0207675_1000405294 | 322 |
| 544 | 3300027907 | Ga0207428_10000234 | Ga0207428_1000023412 | 322 |
| 545 | 3300035083 | Ga0373926_0002044 | Ga0373926_0002044_3845_4894 | 322 |
| 546 | 3300035118 | Ga0373954_0027171 | Ga0373954_0027171_851_1900 | 322 |
| 547 | 3300035171 | Ga0373946_0078371 | Ga0373946_0078371_360_1328 | 322 |
| 548 | 3300035692 | Ga0373935_0004143 | Ga0373935_0004143_4454_5503 | 322 |
| 549 | 3300035695 | Ga0373927_0001983 | Ga0373927_0001983_5992_7041 | 322 |
| 550 | 3300035725 | Ga0373947_0002840 | Ga0373947_0002840_2713_3762 | 322 |
| 551 | 3300035725 | Ga0373947_0076803 | Ga0373947_0076803_999_1967 | 322 |
| 552 | 3300036401 | Ga0373937_0119142 | Ga0373937_0119142_612_1661 | 322 |
| 553 | 3300044656 | Ga0466969_0013532 | Ga0466969_0013532_2360_3328 | 322 |
| 554 | 3300044658 | Ga0466972_0117485 | Ga0466972_0117485_275_1243 | 322 |
| 555 | 3300044684 | Ga0466966_0057668 | Ga0466966_0057668_499_1467 | 322 |
| 556 | 3300045049 | Ga0466959_0067040 | Ga0466959_0067040_1177_2145 | 322 |
| 557 | 3300046454 | Ga0495592_0077076 | Ga0495592_0077076_191_1240 | 322 |
| 558 | 3300046462 | Ga0495651_0004511 | Ga0495651_0004511_3490_4539 | 322 |
| 559 | 3300046463 | Ga0495653_0003868 | Ga0495653_0003868_8782_9831 | 322 |
| 560 | 3300046472 | Ga0495580_0005665 | Ga0495580_0005665_4118_5167 | 322 |
| 561 | 3300046477 | Ga0495664_0037686 | Ga0495664_0037686_1178_2227 | 322 |
| 562 | 3300046511 | Ga0495608_0007960 | Ga0495608_0007960_197_1246 | 322 |
| 563 | 3300046517 | Ga0495630_0035279 | Ga0495630_0035279_1955_3004 | 322 |
| 564 | 3300046529 | Ga0495652_0004133 | Ga0495652_0004133_3158_4207 | 322 |
| 565 | 3300046531 | Ga0495665_0002476 | Ga0495665_0002476_3557_4606 | 322 |
| 566 | 3300046535 | Ga0495586_0014166 | Ga0495586_0014166_3075_4124 | 322 |
| 567 | 3300046663 | Ga0495635_0001569 | Ga0495635_0001569_4015_5064 | 322 |
| 568 | 3300046679 | Ga0495623_0000910 | Ga0495623_0000910_1083_2132 | 322 |
| 569 | 3300046680 | Ga0495646_0001633 | Ga0495646_0001633_5857_6906 | 322 |
| 570 | 3300046689 | Ga0495613_0174915 | Ga0495613_0174915_244_1293 | 322 |
| 571 | 3300046690 | Ga0495624_0001806 | Ga0495624_0001806_8940_9989 | 322 |
| 572 | 3300047317 | Ga0495604_0003449 | Ga0495604_0003449_2618_3667 | 322 |
| 573 | 3300047319 | Ga0495674_0139735 | Ga0495674_0139735_115_1164 | 322 |
| 574 | 3300047321 | Ga0495676_0043501 | Ga0495676_0043501_1214_2263 | 322 |
| 575 | 3300047444 | Ga0495675_0002265 | Ga0495675_0002265_6488_7537 | 322 |
| 576 | 3300047471 | Ga0495684_0284286 | Ga0495684_0284286_81_1130 | 322 |
| 577 | 3300047673 | Ga0495593_0000357 | Ga0495593_0000357_6583_7632 | 322 |
| 578 | 3300048088 | Ga0495602_0017549 | Ga0495602_0017549_3505_4554 | 322 |
| 579 | 3300048089 | Ga0495614_0000926 | Ga0495614_0000926_8080_9129 | 322 |
| 580 | 3300048915 | Ga0496112_0119322 | Ga0496112_0119322_113_1081 | 322 |
| 581 | 3300049571 | Ga0501034_0412072 | Ga0501034_0412072_189_1178 | 322 |
| 582 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_10074_11042 | 322 |
| 583 | 3300050513 | nmdc:mga0rr50_394922_c1 | nmdc:mga0rr50_394922_c1_107_1075 | 322 |
| 584 | 3300005365 | Ga0070688_100045357 | Ga0070688_1000453572 | 323 |
| 585 | 3300009094 | Ga0111539_10071541 | Ga0111539_100715412 | 323 |
| 586 | 3300013306 | Ga0163162_10236525 | Ga0163162_102365253 | 323 |
| 587 | 3300025923 | Ga0207681_10085224 | Ga0207681_100852242 | 323 |
| 588 | 3300027907 | Ga0207428_10031962 | Ga0207428_100319623 | 323 |
| 589 | 3300050511 | nmdc:mga08y16_18614_c1 | nmdc:mga08y16_18614_c1_2217_3191 | 323 |
| 590 | 3300005340 | Ga0070689_100062388 | Ga0070689_1000623882 | 324 |
| 591 | 3300005343 | Ga0070687_100001265 | Ga0070687_1000012653 | 324 |
| 592 | 3300005354 | Ga0070675_100020053 | Ga0070675_1000200534 | 324 |
| 593 | 3300005364 | Ga0070673_100057615 | Ga0070673_1000576153 | 324 |
| 594 | 3300005365 | Ga0070688_100193177 | Ga0070688_1001931772 | 324 |
| 595 | 3300005367 | Ga0070667_100009590 | Ga0070667_1000095906 | 324 |
| 596 | 3300005438 | Ga0070701_10006490 | Ga0070701_100064902 | 324 |
| 597 | 3300005456 | Ga0070678_100002591 | Ga0070678_1000025918 | 324 |
| 598 | 3300005466 | Ga0070685_10025686 | Ga0070685_100256863 | 324 |
| 599 | 3300005467 | Ga0070706_100308399 | Ga0070706_1003083991 | 324 |
| 600 | 3300005468 | Ga0070707_100092942 | Ga0070707_1000929422 | 324 |
| 601 | 3300005615 | Ga0070702_100162598 | Ga0070702_1001625982 | 324 |
| 602 | 3300005617 | Ga0068859_100008402 | Ga0068859_1000084027 | 324 |
| 603 | 3300005718 | Ga0068866_10143182 | Ga0068866_101431822 | 324 |
| 604 | 3300005719 | Ga0068861_100005265 | Ga0068861_1000052655 | 324 |
| 605 | 3300005842 | Ga0068858_100006779 | Ga0068858_1000067794 | 324 |
| 606 | 3300006038 | Ga0075365_10009693 | Ga0075365_100096935 | 324 |
| 607 | 3300006195 | Ga0075366_10002316 | Ga0075366_100023162 | 324 |
| 608 | 3300006880 | Ga0075429_100050459 | Ga0075429_1000504593 | 324 |
| 609 | 3300006881 | Ga0068865_100005146 | Ga0068865_1000051467 | 324 |
| 610 | 3300006931 | Ga0097620_100008402 | Ga0097620_1000084027 | 324 |
| 611 | 3300009094 | Ga0111539_10000156 | Ga0111539_1000015628 | 324 |
| 612 | 3300009176 | Ga0105242_10205517 | Ga0105242_102055171 | 324 |
| 613 | 3300013308 | Ga0157375_10065779 | Ga0157375_100657792 | 324 |
| 614 | 3300014326 | Ga0157380_10142979 | Ga0157380_101429792 | 324 |
| 615 | 3300014745 | Ga0157377_10155643 | Ga0157377_101556432 | 324 |
| 616 | 3300025899 | Ga0207642_10086226 | Ga0207642_100862262 | 324 |
| 617 | 3300025907 | Ga0207645_10007961 | Ga0207645_100079616 | 324 |
| 618 | 3300025908 | Ga0207643_10020153 | Ga0207643_100201532 | 324 |
| 619 | 3300025910 | Ga0207684_10005792 | Ga0207684_100057929 | 324 |
| 620 | 3300025918 | Ga0207662_10002744 | Ga0207662_100027446 | 324 |
| 621 | 3300025922 | Ga0207646_10025062 | Ga0207646_100250622 | 324 |
| 622 | 3300025933 | Ga0207706_10069925 | Ga0207706_100699253 | 324 |
| 623 | 3300025934 | Ga0207686_10138608 | Ga0207686_101386081 | 324 |
| 624 | 3300025938 | Ga0207704_10333189 | Ga0207704_103331892 | 324 |
| 625 | 3300025941 | Ga0207711_10021439 | Ga0207711_100214392 | 324 |
| 626 | 3300025942 | Ga0207689_10006799 | Ga0207689_100067993 | 324 |
| 627 | 3300025960 | Ga0207651_10275292 | Ga0207651_102752921 | 324 |
| 628 | 3300025986 | Ga0207658_10041095 | Ga0207658_100410952 | 324 |
| 629 | 3300026023 | Ga0207677_10142654 | Ga0207677_101426542 | 324 |
| 630 | 3300026035 | Ga0207703_10027280 | Ga0207703_100272802 | 324 |
| 631 | 3300026067 | Ga0207678_10006364 | Ga0207678_100063643 | 324 |
| 632 | 3300026088 | Ga0207641_10080796 | Ga0207641_100807962 | 324 |
| 633 | 3300026089 | Ga0207648_10000455 | Ga0207648_1000045511 | 324 |
| 634 | 3300026118 | Ga0207675_100010456 | Ga0207675_1000104564 | 324 |
| 635 | 3300026121 | Ga0207683_10008884 | Ga0207683_100088845 | 324 |
| 636 | 3300027907 | Ga0207428_10000070 | Ga0207428_1000007027 | 324 |
| 637 | 3300028381 | Ga0268264_10115880 | Ga0268264_101158802 | 324 |
| 638 | 3300042438 | Ga0439459_0030597 | Ga0439459_0030597_23_1000 | 324 |
| 639 | 3300049588 | Ga0501072_0097682 | Ga0501072_0097682_987_2006 | 324 |
| 640 | 3300049591 | Ga0501075_0205558 | Ga0501075_0205558_30_1007 | 324 |
| 641 | 3300050492 | nmdc:mga0yw44_25325_c1 | nmdc:mga0yw44_25325_c1_1887_2864 | 324 |
| 642 | 3300050494 | nmdc:mga06z11_57896_c1 | nmdc:mga06z11_57896_c1_756_1733 | 324 |
| 643 | 3300050507 | nmdc:mga05p37_490045_c1 | nmdc:mga05p37_490045_c1_342_1319 | 324 |
| 644 | 3300050508 | nmdc:mga09592_81117_c1 | nmdc:mga09592_81117_c1_1759_2736 | 324 |
| 645 | 3300050510 | nmdc:mga06r32_56700_c1 | nmdc:mga06r32_56700_c1_1621_2598 | 324 |
| 646 | 3300050511 | nmdc:mga08y16_59259_c1 | nmdc:mga08y16_59259_c1_1534_2511 | 324 |
| 647 | 3300006881 | Ga0068865_100209929 | Ga0068865_1002099292 | 325 |
| 648 | 3300025961 | Ga0207712_10168648 | Ga0207712_101686482 | 325 |
| 649 | 3300026118 | Ga0207675_100007007 | Ga0207675_1000070075 | 325 |
| 650 | 3300027907 | Ga0207428_10006859 | Ga0207428_100068592 | 325 |
| 651 | 3300032002 | Ga0307416_100235465 | Ga0307416_1002354652 | 325 |
| 652 | 3300046455 | Ga0495603_0052726 | Ga0495603_0052726_1188_2165 | 325 |
| 653 | 3300046499 | Ga0495594_0031275 | Ga0495594_0031275_1119_2096 | 325 |
| 654 | 3300046674 | Ga0495588_0070410 | Ga0495588_0070410_499_1476 | 325 |
| 655 | 3300046689 | Ga0495613_0134278 | Ga0495613_0134278_543_1520 | 325 |
| 656 | 3300047471 | Ga0495684_0180910 | Ga0495684_0180910_508_1485 | 325 |
| 657 | 3300049587 | Ga0501071_0152458 | Ga0501071_0152458_728_1705 | 325 |
| 658 | 3300050511 | nmdc:mga08y16_882_c1 | nmdc:mga08y16_882_c1_27014_27997 | 325 |
| 659 | 3300005295 | Ga0065707_10181009 | Ga0065707_101810092 | 326 |
| 660 | 3300005353 | Ga0070669_100095771 | Ga0070669_1000957712 | 326 |
| 661 | 3300005356 | Ga0070674_100194499 | Ga0070674_1001944992 | 326 |
| 662 | 3300005367 | Ga0070667_100367550 | Ga0070667_1003675501 | 326 |
| 663 | 3300005444 | Ga0070694_100226098 | Ga0070694_1002260981 | 326 |
| 664 | 3300005459 | Ga0068867_100034592 | Ga0068867_1000345923 | 326 |
| 665 | 3300005471 | Ga0070698_100073888 | Ga0070698_1000738883 | 326 |
| 666 | 3300005549 | Ga0070704_100385069 | Ga0070704_1003850691 | 326 |
| 667 | 3300005616 | Ga0068852_100462422 | Ga0068852_1004624221 | 326 |
| 668 | 3300005617 | Ga0068859_100007974 | Ga0068859_1000079743 | 326 |
| 669 | 3300005617 | Ga0068859_100317729 | Ga0068859_1003177292 | 326 |
| 670 | 3300005842 | Ga0068858_100108860 | Ga0068858_1001088602 | 326 |
| 671 | 3300006237 | Ga0097621_100132272 | Ga0097621_1001322722 | 326 |
| 672 | 3300006844 | Ga0075428_100013161 | Ga0075428_1000131614 | 326 |
| 673 | 3300006844 | Ga0075428_100025568 | Ga0075428_1000255683 | 326 |
| 674 | 3300006846 | Ga0075430_100062016 | Ga0075430_1000620162 | 326 |
| 675 | 3300006852 | Ga0075433_10165239 | Ga0075433_101652391 | 326 |
| 676 | 3300006881 | Ga0068865_100115851 | Ga0068865_1001158512 | 326 |
| 677 | 3300006931 | Ga0097620_100007974 | Ga0097620_1000079747 | 326 |
| 678 | 3300006931 | Ga0097620_100317735 | Ga0097620_1003177352 | 326 |
| 679 | 3300009094 | Ga0111539_10052174 | Ga0111539_100521745 | 326 |
| 680 | 3300009094 | Ga0111539_10482665 | Ga0111539_104826651 | 326 |
| 681 | 3300009098 | Ga0105245_10229234 | Ga0105245_102292342 | 326 |
| 682 | 3300009147 | Ga0114129_10000047 | Ga0114129_1000004752 | 326 |
| 683 | 3300009147 | Ga0114129_10098439 | Ga0114129_100984392 | 326 |
| 684 | 3300009177 | Ga0105248_10030214 | Ga0105248_100302144 | 326 |
| 685 | 3300009553 | Ga0105249_10139558 | Ga0105249_101395582 | 326 |
| 686 | 3300014325 | Ga0163163_10000071 | Ga0163163_1000007129 | 326 |
| 687 | 3300014326 | Ga0157380_10000200 | Ga0157380_1000020025 | 326 |
| 688 | 3300014326 | Ga0157380_10022516 | Ga0157380_100225165 | 326 |
| 689 | 3300014326 | Ga0157380_10028264 | Ga0157380_100282642 | 326 |
| 690 | 3300014968 | Ga0157379_10173402 | Ga0157379_101734022 | 326 |
| 691 | 3300014969 | Ga0157376_10137953 | Ga0157376_101379532 | 326 |
| 692 | 3300025923 | Ga0207681_10036698 | Ga0207681_100366982 | 326 |
| 693 | 3300025937 | Ga0207669_10158237 | Ga0207669_101582371 | 326 |
| 694 | 3300025941 | Ga0207711_10080642 | Ga0207711_100806424 | 326 |
| 695 | 3300025942 | Ga0207689_10104723 | Ga0207689_101047232 | 326 |
| 696 | 3300025942 | Ga0207689_10131078 | Ga0207689_101310782 | 326 |
| 697 | 3300026075 | Ga0207708_10020780 | Ga0207708_100207805 | 326 |
| 698 | 3300026089 | Ga0207648_10096364 | Ga0207648_100963642 | 326 |
| 699 | 3300027907 | Ga0207428_10002771 | Ga0207428_1000277111 | 326 |
| 700 | 3300031901 | Ga0307406_10073726 | Ga0307406_100737262 | 326 |
| 701 | 3300045051 | Ga0451576_0034669 | Ga0451576_0034669_2434_3417 | 326 |
| 702 | 3300046476 | Ga0495662_0004591 | Ga0495662_0004591_761_1741 | 326 |
| 703 | 3300046499 | Ga0495594_0033707 | Ga0495594_0033707_1133_2113 | 326 |
| 704 | 3300046517 | Ga0495630_0000002 | Ga0495630_0000002_409779_410759 | 326 |
| 705 | 3300046539 | Ga0495621_0007186 | Ga0495621_0007186_659_1645 | 326 |
| 706 | 3300046675 | Ga0495657_0193262 | Ga0495657_0193262_17_1000 | 326 |
| 707 | 3300049570 | Ga0501033_0042001 | Ga0501033_0042001_2182_3165 | 326 |
| 708 | 3300049571 | Ga0501034_0137754 | Ga0501034_0137754_241_1224 | 326 |
| 709 | 3300049572 | Ga0501036_0039647 | Ga0501036_0039647_1423_2409 | 326 |
| 710 | 3300049573 | Ga0501037_0016722 | Ga0501037_0016722_4298_5281 | 326 |
| 711 | 3300049575 | Ga0501039_0009044 | Ga0501039_0009044_2380_3363 | 326 |
| 712 | 3300049575 | Ga0501039_0201771 | Ga0501039_0201771_136_1119 | 326 |
| 713 | 3300049577 | Ga0501041_0105656 | Ga0501041_0105656_352_1335 | 326 |
| 714 | 3300049580 | Ga0501046_0015196 | Ga0501046_0015196_4766_5749 | 326 |
| 715 | 3300049582 | Ga0501048_0270955 | Ga0501048_0270955_166_1152 | 326 |
| 716 | 3300049587 | Ga0501071_0057473 | Ga0501071_0057473_1440_2423 | 326 |
| 717 | 3300049587 | Ga0501071_0082980 | Ga0501071_0082980_970_1956 | 326 |
| 718 | 3300049589 | Ga0501073_0009434 | Ga0501073_0009434_1931_2917 | 326 |
| 719 | 3300049591 | Ga0501075_0058585 | Ga0501075_0058585_954_1937 | 326 |
| 720 | 3300049591 | Ga0501075_0060257 | Ga0501075_0060257_902_1888 | 326 |
| 721 | 3300049592 | Ga0501076_0032946 | Ga0501076_0032946_1725_2711 | 326 |
| 722 | 3300049741 | Ga0501079_0039458 | Ga0501079_0039458_1486_2469 | 326 |
| 723 | 3300049743 | Ga0501081_0055470 | Ga0501081_0055470_1146_2129 | 326 |
| 724 | 3300049744 | Ga0501083_0001968 | Ga0501083_0001968_11878_12861 | 326 |
| 725 | 3300049823 | Ga0501044_0322255 | Ga0501044_0322255_218_1201 | 326 |
| 726 | 3300049824 | Ga0501045_0200711 | Ga0501045_0200711_219_1205 | 326 |
| 727 | 3300050507 | nmdc:mga05p37_180_c1 | nmdc:mga05p37_180_c1_58822_59826 | 326 |
| 728 | 3300050508 | nmdc:mga09592_182135_c1 | nmdc:mga09592_182135_c1_275_1261 | 326 |
| 729 | 3300050511 | nmdc:mga08y16_18362_c1 | nmdc:mga08y16_18362_c1_1670_2674 | 326 |
| 730 | 3300050511 | nmdc:mga08y16_21763_c1 | nmdc:mga08y16_21763_c1_2999_3985 | 326 |
| 731 | 3300053090 | Ga0500646_0012300 | Ga0500646_0012300_1168_2154 | 326 |
| 732 | 3300054114 | Ga0501084_0124312 | Ga0501084_0124312_1151_2137 | 326 |
| 733 | 3300060353 | Ga0501082_0044682 | Ga0501082_0044682_2627_3610 | 326 |
| 734 | 3300060353 | Ga0501082_0088441 | Ga0501082_0088441_1106_2092 | 326 |
| 735 | 3300061734 | Ga0530510_0026738 | Ga0530510_0026738_2211_3197 | 326 |
| 736 | 3300006871 | Ga0075434_100219725 | Ga0075434_1002197252 | 327 |
| 737 | 3300006914 | Ga0075436_100001644 | Ga0075436_1000016445 | 327 |
| 738 | 3300007076 | Ga0075435_100000115 | Ga0075435_10000011516 | 327 |
| 739 | 3300050513 | nmdc:mga0rr50_49_c1 | nmdc:mga0rr50_49_c1_54557_55540 | 327 |
| 740 | 3300050514 | nmdc:mga08x19_1341_c1 | nmdc:mga08x19_1341_c1_5395_6378 | 327 |
| 741 | 3300021384 | Ga0213876_10018303 | Ga0213876_100183033 | 328 |
| 742 | 3300039437 | Ga0436365_1745763 | Ga0436365_1745763_4572_5558 | 328 |
| 743 | 3300028577 | Ga0265318_10010231 | Ga0265318_100102314 | 329 |
| 744 | 3300031249 | Ga0265339_10041338 | Ga0265339_100413382 | 329 |
| 745 | 3300032002 | Ga0307416_100026701 | Ga0307416_1000267012 | 329 |
| 746 | 3300036401 | Ga0373937_0205946 | Ga0373937_0205946_801_1805 | 329 |
| 747 | 3300048918 | Ga0496115_0000232 | Ga0496115_0000232_36697_37710 | 329 |
| 748 | 3300039453 | Ga0436362_0587869 | Ga0436362_0587869_27_1067 | 330 |
| 749 | 3300049589 | Ga0501073_0000657 | Ga0501073_0000657_21583_22584 | 330 |
| 750 | 3300049742 | Ga0501080_0001077 | Ga0501080_0001077_16294_17295 | 330 |
| 751 | 3300053077 | Ga0495601_0162706 | Ga0495601_0162706_313_1311 | 330 |
| 752 | 3300053078 | Ga0495612_0044766 | Ga0495612_0044766_747_1745 | 330 |
| 753 | 3300005614 | Ga0068856_100000849 | Ga0068856_10000084920 | 331 |
| 754 | 3300026078 | Ga0207702_10000535 | Ga0207702_100005358 | 331 |
| 755 | 3300005336 | Ga0070680_100116334 | Ga0070680_1001163342 | 332 |
| 756 | 3300005435 | Ga0070714_100024329 | Ga0070714_1000243292 | 332 |
| 757 | 3300005458 | Ga0070681_10023309 | Ga0070681_100233092 | 332 |
| 758 | 3300009093 | Ga0105240_10009865 | Ga0105240_1000986510 | 332 |
| 759 | 3300013307 | Ga0157372_10014369 | Ga0157372_100143692 | 332 |
| 760 | 3300025912 | Ga0207707_10016615 | Ga0207707_100166153 | 332 |
| 761 | 3300025913 | Ga0207695_10067552 | Ga0207695_100675523 | 332 |
| 762 | 3300025917 | Ga0207660_10097088 | Ga0207660_100970881 | 332 |
| 763 | 3300025929 | Ga0207664_10044947 | Ga0207664_100449473 | 332 |
| 764 | 3300044694 | Ga0466963_0045795 | Ga0466963_0045795_1157_2161 | 332 |
| 765 | 3300005445 | Ga0070708_100113454 | Ga0070708_1001134542 | 333 |
| 766 | 3300006846 | Ga0075430_100026174 | Ga0075430_1000261744 | 333 |
| 767 | 3300006847 | Ga0075431_100011674 | Ga0075431_1000116741 | 333 |
| 768 | 3300044706 | Ga0466964_0085807 | Ga0466964_0085807_324_1328 | 333 |
| 769 | 3300050507 | nmdc:mga05p37_112732_c1 | nmdc:mga05p37_112732_c1_993_2018 | 333 |
| 770 | 3300050509 | nmdc:mga0qj67_15214_c1 | nmdc:mga0qj67_15214_c1_1485_2495 | 333 |
| 771 | 3300050510 | nmdc:mga06r32_21911_c1 | nmdc:mga06r32_21911_c1_1030_2040 | 333 |
| 772 | 3300005937 | Ga0081455_10062109 | Ga0081455_100621091 | 335 |
| 773 | 3300006847 | Ga0075431_100197659 | Ga0075431_1001976591 | 335 |
| 774 | 3300038735 | Ga0400485_01916 | Ga0400485_01916_69424_70449 | 335 |
| 775 | 3300038741 | Ga0400488_29914 | Ga0400488_29914_7161_8186 | 335 |
| 776 | 3300038742 | Ga0400486_08682 | Ga0400486_08682_35506_36531 | 335 |
| 777 | 3300039110 | Ga0400487_47850 | Ga0400487_47850_68912_69937 | 335 |
| 778 | 3300050510 | nmdc:mga06r32_130789_c1 | nmdc:mga06r32_130789_c1_1290_2318 | 335 |
| 779 | 2162886011 | MRS1b_contig_1248874 | MRS1b_0674.00003050 | 337 |
| 780 | 2162886012 | MBSR1b_contig_6417879 | MBSR1b_0367.00007700 | 337 |
| 781 | 3300005293 | Ga0065715_10194301 | Ga0065715_101943011 | 337 |
| 782 | 3300006028 | Ga0070717_10095062 | Ga0070717_100950622 | 337 |
| 783 | 3300006847 | Ga0075431_100033574 | Ga0075431_1000335744 | 337 |
| 784 | 3300013104 | Ga0157370_10037109 | Ga0157370_100371092 | 337 |
| 785 | 3300025929 | Ga0207664_10205958 | Ga0207664_102059582 | 337 |
| 786 | 3300050507 | nmdc:mga05p37_238171_c1 | nmdc:mga05p37_238171_c1_55_1068 | 337 |
| 787 | 3300050510 | nmdc:mga06r32_245275_c1 | nmdc:mga06r32_245275_c1_11_1024 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m55-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236h substitution | 0.9599 | 2 | 320 |
| 2b69-assembly1.cif.gz_A | crystal structure of human udp-glucoronic acid decarboxylase | 0.9546 | 2 | 325 |
| 2b69-assembly1.cif.gz_A | crystal structure of human udp-glucoronic acid decarboxylase | 0.9456 | 2 | 325 |
| 4m55-assembly1.cif.gz_D | crystal structure of human udp-xylose synthase r236h substitution | 0.9456 | 2 | 320 |
| 6dnt-assembly1.cif.gz_A-2 | udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid | 0.9341 | 2 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E0S3_8_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9517 | 1 | 322 | 3.40.50.720 |
| af_A0A1D6N7M5_279_504_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9481 | 91 | 322 | 3.40.50.720 |
| af_Q4E0S3_8_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9459 | 1 | 322 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9397 | 126 | 321 | 3.40.50.720 |
| 2b69A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9379 | 2 | 304 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8FLA9-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9919 | 2 | 319 |
GO:0005737
GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A5C6CPV4-F1-model_v4 | dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) | 0.9886 | 1 | 319 |
GO:0033320
GO:0048040 |
| AF-A0A7W0RGU4-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9857 | 5 | 277 |
GO:0005737
GO:0042732 GO:0048040 GO:0070403 |
| AF-A0A2E7G2R0-F1-model_v4 | deleted | 0.9834 | 2 | 319 |
|
| AF-A0A7V4B043-F1-model_v4 | UDP-glucuronate decarboxylase (EC 4.1.1.35) | 0.9811 | 2 | 319 |
GO:0005737
GO:0016020 GO:0033320 GO:0042732 GO:0048040 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar