F480826

General Info

Members Datasets Scaffolds Average Seq Length
787 333 787 322

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10095062|Ga0070717_100950622
Length 363
Sequence MWAIDAQQFTFYERQALFMRVLITGGAGFIGSHLADAYLTRGDTVFVLDDLSTGSISNVQHLKHHPNFHYAIESVQHEATVAEAIDDCDVIFHLAAAVGVRLIIESPVRTIETNVHGTEVVLTHANKKKKPVLIASTSEVYGLSTQVPFREDDPLVIGATNKGRWSYACSKALDEFLAFAYWREKKLPVIIARLFNTIGPRQTGQYGMVVPNFVKQALSGRPITVYGDGTQTRCFVDVLDVVQALMRLMDCGDAIGQVFNIGSTEEVTILALAHRIKELINSSSEIVMIPYDQAYEQGFEDMHRRIPDTTKIRETVGFQPQRTLDEVLERIVAHWAGRDPAGRPLPQPLGERLGPLPKRAGVG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
210 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
211 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
212 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 3.05
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1248874 2162886011 Bacteria 2429
2 MBSR1b_contig_6417879 2162886012 Unclassified 1523
3 JGI24034J26672_10012296 3300002239 Bacteria 1289
4 JGI24751J29686_10003915 3300002459 Unclassified 3007
5 Ga0065714_10015360 3300005288 Bacteria 1819
6 Ga0065714_10018882 3300005288 Bacteria 1235
7 Ga0065712_10001700 3300005290 Bacteria 5626
8 Ga0065712_10002413 3300005290 Bacteria 5026
9 Ga0065712_10079342 3300005290 Bacteria 3220
10 Ga0065712_10104939 3300005290 Bacteria 1950
11 Ga0065712_10129186 3300005290 Bacteria 1569
12 Ga0065715_10001036 3300005293 Bacteria 8463
13 Ga0065715_10029631 3300005293 Bacteria 1250
14 Ga0065715_10090431 3300005293 Bacteria 7025
15 Ga0065715_10094824 3300005293 Bacteria 4231
16 Ga0065715_10106654 3300005293 Bacteria 2816
17 Ga0065715_10108738 3300005293 Bacteria 2703
18 Ga0065715_10194301 3300005293 Bacteria 1397
19 Ga0065707_10095269 3300005295 Unclassified 3399
20 Ga0065707_10144105 3300005295 Bacteria 1735
21 Ga0065707_10181009 3300005295 Bacteria 1409
22 Ga0065707_10182545 3300005295 Bacteria 1409
23 Ga0070676_10003338 3300005328 Bacteria 8349
24 Ga0070676_10100165 3300005328 Bacteria 1789
25 Ga0070683_100009991 3300005329 Bacteria 8137
26 Ga0070670_100001016 3300005331 Bacteria 22144
27 Ga0070670_100001433 3300005331 Bacteria 19191
28 Ga0070670_100011278 3300005331 Bacteria 7642
29 Ga0070670_100022053 3300005331 Bacteria 5481
30 Ga0070670_100059070 3300005331 Bacteria 3292
31 Ga0070677_10047232 3300005333 Bacteria 1725
32 Ga0070666_10010821 3300005335 Bacteria 5714
33 Ga0070666_10165291 3300005335 Bacteria 1548
34 Ga0070680_100043713 3300005336 Bacteria 3639
35 Ga0070680_100116334 3300005336 Bacteria 2229
36 Ga0068868_100026828 3300005338 Bacteria 4392
37 Ga0068868_100235144 3300005338 Bacteria 1538
38 Ga0068868_100240922 3300005338 Bacteria 1519
39 Ga0070660_100001966 3300005339 Bacteria 14175
40 Ga0070660_100009277 3300005339 Bacteria 6916
41 Ga0070689_100000517 3300005340 Bacteria 22784
42 Ga0070689_100062388 3300005340 Bacteria 2900
43 Ga0070689_100065709 3300005340 Bacteria 2826
44 Ga0070687_100001265 3300005343 Bacteria 8803
45 Ga0070687_100075332 3300005343 Bacteria 1824
46 Ga0070687_100122766 3300005343 Bacteria 1488
47 Ga0070661_100058021 3300005344 Bacteria 2837
48 Ga0070661_100209931 3300005344 Bacteria 1490
49 Ga0070692_10003674 3300005345 Bacteria 6277
50 Ga0070668_100319143 3300005347 Bacteria 1307
51 Ga0070669_100095771 3300005353 Bacteria 2233
52 Ga0070675_100020053 3300005354 Bacteria 5333
53 Ga0070675_100076323 3300005354 Bacteria 2787
54 Ga0070675_100083193 3300005354 Unclassified 2671
55 Ga0070671_100014494 3300005355 Bacteria 6372
56 Ga0070671_100026525 3300005355 Bacteria 4762
57 Ga0070671_100044066 3300005355 Bacteria 3707
58 Ga0070671_100143471 3300005355 Bacteria 2015
59 Ga0070674_100042001 3300005356 Bacteria 3104
60 Ga0070674_100194499 3300005356 Bacteria 1562
61 Ga0070673_100016161 3300005364 Bacteria 5268
62 Ga0070673_100057615 3300005364 Bacteria 3070
63 Ga0070688_100001469 3300005365 Bacteria 11704
64 Ga0070688_100017491 3300005365 Bacteria 4115
65 Ga0070688_100045357 3300005365 Bacteria 2715
66 Ga0070688_100193177 3300005365 Bacteria 1419
67 Ga0070667_100009590 3300005367 Bacteria 8028
68 Ga0070667_100029291 3300005367 Bacteria 4587
69 Ga0070667_100367550 3300005367 Bacteria 1305
70 Ga0070714_100024329 3300005435 Unclassified 4984
71 Ga0070701_10006490 3300005438 Bacteria 4927
72 Ga0070701_10009060 3300005438 Bacteria 4344
73 Ga0070705_100004206 3300005440 Bacteria 7030
74 Ga0070705_100192408 3300005440 Bacteria 1392
75 Ga0070700_100122190 3300005441 Bacteria 1747
76 Ga0070700_100228863 3300005441 Bacteria 1322
77 Ga0070700_100250156 3300005441 Bacteria 1271
78 Ga0070694_100001421 3300005444 Bacteria 14035
79 Ga0070694_100037182 3300005444 Bacteria 3228
80 Ga0070694_100226098 3300005444 Bacteria 1406
81 Ga0070708_100109235 3300005445 Bacteria 2541
82 Ga0070708_100113454 3300005445 Bacteria 2493
83 Ga0070708_100119566 3300005445 Bacteria 2429
84 Ga0070678_100002591 3300005456 Bacteria 9937
85 Ga0070678_100165401 3300005456 Bacteria 1796
86 Ga0070662_100031607 3300005457 Bacteria 3716
87 Ga0070681_10023309 3300005458 Bacteria 6225
88 Ga0070681_10027541 3300005458 Bacteria 5714
89 Ga0070681_10094363 3300005458 Bacteria 2941
90 Ga0070681_10137645 3300005458 Bacteria 2372
91 Ga0068867_100034592 3300005459 Bacteria 3662
92 Ga0070685_10013390 3300005466 Bacteria 4324
93 Ga0070685_10025686 3300005466 Bacteria 3243
94 Ga0070706_100308399 3300005467 Bacteria 1476
95 Ga0070707_100010426 3300005468 Bacteria 8655
96 Ga0070707_100092942 3300005468 Bacteria 2920
97 Ga0070698_100013325 3300005471 Bacteria 8702
98 Ga0070698_100073888 3300005471 Bacteria 3415
99 Ga0070698_100202348 3300005471 Bacteria 1921
100 Ga0070699_100064656 3300005518 Bacteria 3173
101 Ga0070699_100250667 3300005518 Bacteria 1582
102 Ga0070679_100077372 3300005530 Bacteria 3316
103 Ga0070679_100120164 3300005530 Bacteria 2612
104 Ga0070684_100000477 3300005535 Bacteria 27392
105 Ga0070697_100018537 3300005536 Bacteria 5487
106 Ga0068853_100105264 3300005539 Unclassified 2499
107 Ga0070672_100284189 3300005543 Bacteria 1400
108 Ga0070695_100000155 3300005545 Bacteria 32258
109 Ga0070696_100000499 3300005546 Bacteria 24777
110 Ga0070696_100007757 3300005546 Bacteria 7161
111 Ga0070696_100012876 3300005546 Bacteria 5613
112 Ga0070696_100059283 3300005546 Bacteria 2675
113 Ga0070665_100005335 3300005548 Bacteria 13281
114 Ga0070665_100076339 3300005548 Bacteria 3358
115 Ga0070665_100084755 3300005548 Bacteria 3174
116 Ga0070704_100058749 3300005549 Bacteria 2740
117 Ga0070704_100130970 3300005549 Bacteria 1944
118 Ga0070704_100198539 3300005549 Bacteria 1618
119 Ga0070704_100385069 3300005549 Bacteria 1192
120 Ga0068855_100082652 3300005563 Bacteria 3722
121 Ga0070664_100003519 3300005564 Bacteria 12645
122 Ga0070664_100004562 3300005564 Bacteria 11113
123 Ga0070664_100115735 3300005564 Bacteria 2344
124 Ga0070664_100293883 3300005564 Bacteria 1467
125 Ga0068857_100011444 3300005577 Bacteria 7720
126 Ga0068857_100116300 3300005577 Bacteria 2406
127 Ga0068854_100006236 3300005578 Bacteria 7571
128 Ga0068856_100000849 3300005614 Bacteria 32891
129 Ga0070702_100041302 3300005615 Bacteria 2586
130 Ga0070702_100067530 3300005615 Bacteria 2101
131 Ga0070702_100082924 3300005615 Bacteria 1925
132 Ga0070702_100162598 3300005615 Bacteria 1444
133 Ga0068852_100095072 3300005616 Bacteria 2675
134 Ga0068852_100462422 3300005616 Bacteria 1258
135 Ga0068852_100609298 3300005616 Bacteria 1097
136 Ga0068859_100007974 3300005617 Bacteria 10742
137 Ga0068859_100008402 3300005617 Bacteria 10460
138 Ga0068859_100022365 3300005617 Bacteria 6339
139 Ga0068859_100054464 3300005617 Bacteria 4023
140 Ga0068859_100081521 3300005617 Archaea 3278
141 Ga0068859_100096157 3300005617 Bacteria 3015
142 Ga0068859_100317729 3300005617 Unclassified 1651
143 Ga0068864_100045012 3300005618 Bacteria 3785
144 Ga0068864_100066454 3300005618 Bacteria 3130
145 Ga0068864_100089558 3300005618 Unclassified 2711
146 Ga0068866_10034490 3300005718 Bacteria 2465
147 Ga0068866_10143182 3300005718 Bacteria 1375
148 Ga0068861_100005265 3300005719 Bacteria 8722
149 Ga0068861_100033397 3300005719 Bacteria 3795
150 Ga0068863_100017949 3300005841 Bacteria 6771
151 Ga0068863_100265420 3300005841 Bacteria 1660
152 Ga0068858_100006779 3300005842 Bacteria 11141
153 Ga0068858_100108860 3300005842 Bacteria 2587
154 Ga0068860_100106269 3300005843 Bacteria 2681
155 Ga0068862_100299647 3300005844 Bacteria 1479
156 Ga0081455_10062109 3300005937 Bacteria 3141
157 Ga0081455_10114382 3300005937 Bacteria 2138
158 Ga0081539_10052663 3300005985 Bacteria 2283
159 Ga0070717_10095062 3300006028 Bacteria 2522
160 Ga0075365_10000819 3300006038 Bacteria 12831
161 Ga0075365_10009693 3300006038 Bacteria 5558
162 Ga0075365_10035010 3300006038 Bacteria 3246
163 Ga0075364_10011460 3300006051 Bacteria 5385
164 Ga0075364_10027113 3300006051 Bacteria 3658
165 Ga0075364_10032801 3300006051 Bacteria 3339
166 Ga0075364_10112623 3300006051 Bacteria 1817
167 Ga0075364_10147977 3300006051 Bacteria 1582
168 Ga0070716_100098490 3300006173 Bacteria 1787
169 Ga0070716_100212329 3300006173 Bacteria 1294
170 Ga0075362_10000172 3300006177 Bacteria 17809
171 Ga0075367_10083955 3300006178 Bacteria 1930
172 Ga0075367_10123975 3300006178 Bacteria 1593
173 Ga0075367_10150941 3300006178 Bacteria 1442
174 Ga0075366_10002316 3300006195 Bacteria 9736
175 Ga0075366_10019756 3300006195 Bacteria 3904
176 Ga0075366_10031879 3300006195 Bacteria 3102
177 Ga0097621_100086294 3300006237 Bacteria 2619
178 Ga0097621_100092687 3300006237 Bacteria 2531
179 Ga0097621_100102856 3300006237 Bacteria 2405
180 Ga0097621_100132272 3300006237 Bacteria 2124
181 Ga0097621_100139441 3300006237 Unclassified 2071
182 Ga0075370_10049631 3300006353 Bacteria 2379
183 Ga0068871_100002675 3300006358 Bacteria 12162
184 Ga0068871_100033232 3300006358 Bacteria 4083
185 Ga0068871_100273587 3300006358 Bacteria 1476
186 Ga0075428_100001280 3300006844 Bacteria 26808
187 Ga0075428_100008474 3300006844 Bacteria 11405
188 Ga0075428_100013161 3300006844 Bacteria 9202
189 Ga0075428_100025568 3300006844 Bacteria 6536
190 Ga0075428_100112217 3300006844 Bacteria 2969
191 Ga0075428_100140015 3300006844 Bacteria 2631
192 Ga0075428_100265138 3300006844 Bacteria 1849
193 Ga0075428_100504032 3300006844 Bacteria 1295
194 Ga0075430_100003870 3300006846 Bacteria 12607
195 Ga0075430_100007243 3300006846 Bacteria 9369
196 Ga0075430_100026174 3300006846 Bacteria 4964
197 Ga0075430_100062016 3300006846 Bacteria 3141
198 Ga0075430_100268607 3300006846 Bacteria 1412
199 Ga0075430_100383035 3300006846 Bacteria 1161
200 Ga0075431_100002665 3300006847 Bacteria 17289
201 Ga0075431_100011674 3300006847 Bacteria 8863
202 Ga0075431_100016013 3300006847 Bacteria 7608
203 Ga0075431_100033574 3300006847 Bacteria 5288
204 Ga0075431_100197659 3300006847 Unclassified 2058
205 Ga0075433_10087172 3300006852 Bacteria 2757
206 Ga0075433_10104378 3300006852 Bacteria 2511
207 Ga0075433_10140086 3300006852 Unclassified 2150
208 Ga0075433_10165239 3300006852 Bacteria 1970
209 Ga0075434_100011984 3300006871 Bacteria 8204
210 Ga0075434_100029393 3300006871 Bacteria 5407
211 Ga0075434_100035952 3300006871 Bacteria 4898
212 Ga0075434_100219725 3300006871 Unclassified 1920
213 Ga0075429_100005224 3300006880 Bacteria 11168
214 Ga0075429_100033459 3300006880 Bacteria 4467
215 Ga0075429_100050459 3300006880 Bacteria 3619
216 Ga0075429_100214235 3300006880 Bacteria 1687
217 Ga0068865_100005146 3300006881 Bacteria 7915
218 Ga0068865_100115851 3300006881 Bacteria 1984
219 Ga0068865_100209929 3300006881 Bacteria 1517
220 Ga0075436_100001644 3300006914 Bacteria 15270
221 Ga0075436_100099307 3300006914 Bacteria 2026
222 Ga0097620_100007974 3300006931 Bacteria 10742
223 Ga0097620_100008402 3300006931 Bacteria 10460
224 Ga0097620_100022365 3300006931 Bacteria 6339
225 Ga0097620_100054464 3300006931 Bacteria 4023
226 Ga0097620_100081523 3300006931 Archaea 3278
227 Ga0097620_100096157 3300006931 Bacteria 3015
228 Ga0097620_100317735 3300006931 Unclassified 1651
229 Ga0075435_100000115 3300007076 Bacteria 44397
230 Ga0075435_100000404 3300007076 Bacteria 26487
231 Ga0105240_10009865 3300009093 Bacteria 13478
232 Ga0105240_10062219 3300009093 Bacteria 4647
233 Ga0105240_10068347 3300009093 Bacteria 4400
234 Ga0111539_10000156 3300009094 Bacteria 77946
235 Ga0111539_10001042 3300009094 Bacteria 36422
236 Ga0111539_10002555 3300009094 Bacteria 24100
237 Ga0111539_10015953 3300009094 Bacteria 9332
238 Ga0111539_10052174 3300009094 Bacteria 4868
239 Ga0111539_10055606 3300009094 Bacteria 4705
240 Ga0111539_10071541 3300009094 Bacteria 4092
241 Ga0111539_10480530 3300009094 Bacteria 1447
242 Ga0111539_10482665 3300009094 Bacteria 1443
243 Ga0105245_10015209 3300009098 Bacteria 6704
244 Ga0105245_10103996 3300009098 Bacteria 2632
245 Ga0105245_10229234 3300009098 Bacteria 1796
246 Ga0105247_10057544 3300009101 Bacteria 2404
247 Ga0114129_10000047 3300009147 Bacteria 104957
248 Ga0114129_10000295 3300009147 Bacteria 57637
249 Ga0114129_10000408 3300009147 Bacteria 50625
250 Ga0114129_10011033 3300009147 Bacteria 12874
251 Ga0114129_10020472 3300009147 Bacteria 9409
252 Ga0114129_10023607 3300009147 Bacteria 8716
253 Ga0114129_10035313 3300009147 Bacteria 7062
254 Ga0114129_10082780 3300009147 Bacteria 4458
255 Ga0114129_10098439 3300009147 Bacteria 4048
256 Ga0114129_10139810 3300009147 Bacteria 3320
257 Ga0105243_10281761 3300009148 Bacteria 1497
258 Ga0105241_10170650 3300009174 Bacteria 1797
259 Ga0105241_10261170 3300009174 Bacteria 1472
260 Ga0105242_10024360 3300009176 Bacteria 4779
261 Ga0105242_10027488 3300009176 Bacteria 4517
262 Ga0105242_10205517 3300009176 Bacteria 1751
263 Ga0105242_10277257 3300009176 Bacteria 1521
264 Ga0105242_10441554 3300009176 Bacteria 1224
265 Ga0105248_10030214 3300009177 Bacteria 6048
266 Ga0105248_10052999 3300009177 Bacteria 4552
267 Ga0105248_10132314 3300009177 Bacteria 2814
268 Ga0105248_10265753 3300009177 Bacteria 1931
269 Ga0105248_10442394 3300009177 Bacteria 1464
270 Ga0105248_10502317 3300009177 Bacteria 1367
271 Ga0105237_10123489 3300009545 Bacteria 2583
272 Ga0105249_10075780 3300009553 Unclassified 3116
273 Ga0105249_10139558 3300009553 Bacteria 2322
274 Ga0105249_10274107 3300009553 Bacteria 1682
275 Ga0157370_10037109 3300013104 Bacteria 4725
276 Ga0157374_10134859 3300013296 Bacteria 2392
277 Ga0157374_10153188 3300013296 Unclassified 2242
278 Ga0157374_10570705 3300013296 Bacteria 1140
279 Ga0163162_10232413 3300013306 Bacteria 1974
280 Ga0163162_10236525 3300013306 Bacteria 1957
281 Ga0163162_10788607 3300013306 Bacteria 1068
282 Ga0157372_10014369 3300013307 Bacteria 8466
283 Ga0157375_10044798 3300013308 Bacteria 4302
284 Ga0157375_10065779 3300013308 Bacteria 3615
285 Ga0163163_10000071 3300014325 Bacteria 112778
286 Ga0163163_10004809 3300014325 Bacteria 11600
287 Ga0163163_10051015 3300014325 Bacteria 4077
288 Ga0163163_10465932 3300014325 Bacteria 1324
289 Ga0157380_10000200 3300014326 Bacteria 35152
290 Ga0157380_10007044 3300014326 Bacteria 7958
291 Ga0157380_10022516 3300014326 Bacteria 4747
292 Ga0157380_10028264 3300014326 Bacteria 4273
293 Ga0157380_10142979 3300014326 Bacteria 2058
294 Ga0157380_10147610 3300014326 Bacteria 2028
295 Ga0157380_10438814 3300014326 Bacteria 1250
296 Ga0157377_10001507 3300014745 Bacteria 10096
297 Ga0157377_10083660 3300014745 Bacteria 1870
298 Ga0157377_10155643 3300014745 Bacteria 1417
299 Ga0157379_10024463 3300014968 Bacteria 5361
300 Ga0157379_10033243 3300014968 Bacteria 4600
301 Ga0157379_10040072 3300014968 Bacteria 4180
302 Ga0157379_10173402 3300014968 Bacteria 1947
303 Ga0157376_10009204 3300014969 Bacteria 7165
304 Ga0157376_10013838 3300014969 Bacteria 6033
305 Ga0157376_10017805 3300014969 Bacteria 5430
306 Ga0157376_10023360 3300014969 Bacteria 4838
307 Ga0157376_10137419 3300014969 Bacteria 2189
308 Ga0157376_10137953 3300014969 Bacteria 2185
309 Ga0163161_10194998 3300017792 Bacteria 1558
310 Ga0163161_10291034 3300017792 Bacteria 1284
311 Ga0213876_10018303 3300021384 Bacteria 3699
312 Ga0207682_10011562 3300025893 Bacteria 3447
313 Ga0207642_10008472 3300025899 Bacteria 3530
314 Ga0207642_10067033 3300025899 Bacteria 1693
315 Ga0207642_10086226 3300025899 Bacteria 1538
316 Ga0207647_10076704 3300025904 Bacteria 2010
317 Ga0207645_10007961 3300025907 Bacteria 7440
318 Ga0207645_10081824 3300025907 Bacteria 2070
319 Ga0207645_10107246 3300025907 Bacteria 1806
320 Ga0207645_10215734 3300025907 Bacteria 1264
321 Ga0207643_10004895 3300025908 Bacteria 7167
322 Ga0207643_10020153 3300025908 Bacteria 3659
323 Ga0207643_10027758 3300025908 Bacteria 3141
324 Ga0207684_10005792 3300025910 Bacteria 11333
325 Ga0207684_10346446 3300025910 Bacteria 1279
326 Ga0207654_10140749 3300025911 Bacteria 1538
327 Ga0207707_10016615 3300025912 Bacteria 6417
328 Ga0207707_10031377 3300025912 Bacteria 4650
329 Ga0207707_10111201 3300025912 Bacteria 2395
330 Ga0207695_10018579 3300025913 Bacteria 8032
331 Ga0207695_10067552 3300025913 Bacteria 3666
332 Ga0207695_10217391 3300025913 Bacteria 1819
333 Ga0207660_10097088 3300025917 Bacteria 2195
334 Ga0207662_10002744 3300025918 Bacteria 8887
335 Ga0207662_10006429 3300025918 Bacteria 6340
336 Ga0207662_10021057 3300025918 Bacteria 3722
337 Ga0207657_10006060 3300025919 Bacteria 12572
338 Ga0207649_10060700 3300025920 Bacteria 2377
339 Ga0207652_10050849 3300025921 Bacteria 3551
340 Ga0207646_10025062 3300025922 Bacteria 5459
341 Ga0207646_10028669 3300025922 Bacteria 5065
342 Ga0207681_10036698 3300025923 Bacteria 3235
343 Ga0207681_10085224 3300025923 Bacteria 2242
344 Ga0207650_10009640 3300025925 Bacteria 6602
345 Ga0207650_10015278 3300025925 Bacteria 5343
346 Ga0207650_10037895 3300025925 Bacteria 3516
347 Ga0207650_10050594 3300025925 Bacteria 3074
348 Ga0207659_10006571 3300025926 Bacteria 7136
349 Ga0207659_10129622 3300025926 Unclassified 1945
350 Ga0207659_10427046 3300025926 Bacteria 1112
351 Ga0207659_10437082 3300025926 Bacteria 1100
352 Ga0207687_10031315 3300025927 Bacteria 3593
353 Ga0207664_10044947 3300025929 Unclassified 3461
354 Ga0207664_10205958 3300025929 Unclassified 1700
355 Ga0207644_10164316 3300025931 Unclassified 1728
356 Ga0207690_10131335 3300025932 Bacteria 1833
357 Ga0207706_10040547 3300025933 Unclassified 4126
358 Ga0207706_10069925 3300025933 Bacteria 3087
359 Ga0207706_10105227 3300025933 Bacteria 2483
360 Ga0207686_10081713 3300025934 Bacteria 2110
361 Ga0207686_10138608 3300025934 Bacteria 1678
362 Ga0207686_10293253 3300025934 Bacteria 1205
363 Ga0207709_10101369 3300025935 Bacteria 1904
364 Ga0207709_10190281 3300025935 Bacteria 1457
365 Ga0207670_10016295 3300025936 Bacteria 4463
366 Ga0207670_10310761 3300025936 Bacteria 1237
367 Ga0207670_10380521 3300025936 Bacteria 1124
368 Ga0207669_10113005 3300025937 Bacteria 1825
369 Ga0207669_10158237 3300025937 Bacteria 1596
370 Ga0207669_10444309 3300025937 Bacteria 1026
371 Ga0207704_10008319 3300025938 Bacteria 4952
372 Ga0207704_10333189 3300025938 Bacteria 1175
373 Ga0207665_10159775 3300025939 Bacteria 1620
374 Ga0207665_10229979 3300025939 Bacteria 1362
375 Ga0207691_10045230 3300025940 Bacteria 4047
376 Ga0207691_10093145 3300025940 Bacteria 2698
377 Ga0207691_10240492 3300025940 Bacteria 1565
378 Ga0207691_10282649 3300025940 Bacteria 1428
379 Ga0207711_10021439 3300025941 Bacteria 5398
380 Ga0207711_10080642 3300025941 Bacteria 2843
381 Ga0207711_10244687 3300025941 Bacteria 1645
382 Ga0207711_10296307 3300025941 Bacteria 1491
383 Ga0207689_10006799 3300025942 Bacteria 10063
384 Ga0207689_10104723 3300025942 Bacteria 2324
385 Ga0207689_10131078 3300025942 Bacteria 2063
386 Ga0207689_10140194 3300025942 Bacteria 1992
387 Ga0207689_10329151 3300025942 Bacteria 1268
388 Ga0207689_10405372 3300025942 Bacteria 1137
389 Ga0207661_10003683 3300025944 Bacteria 10680
390 Ga0207661_10074090 3300025944 Bacteria 2790
391 Ga0207679_10006385 3300025945 Bacteria 7445
392 Ga0207679_10022084 3300025945 Bacteria 4327
393 Ga0207679_10069971 3300025945 Bacteria 2643
394 Ga0207679_10217729 3300025945 Bacteria 1605
395 Ga0207667_10129591 3300025949 Bacteria 2598
396 Ga0207651_10023871 3300025960 Bacteria 3771
397 Ga0207651_10275292 3300025960 Bacteria 1388
398 Ga0207712_10168648 3300025961 Bacteria 1709
399 Ga0207640_10044228 3300025981 Bacteria 2852
400 Ga0207640_10085408 3300025981 Bacteria 2170
401 Ga0207658_10041095 3300025986 Bacteria 3347
402 Ga0207677_10096400 3300026023 Bacteria 2164
403 Ga0207677_10142654 3300026023 Bacteria 1836
404 Ga0207703_10027280 3300026035 Bacteria 4497
405 Ga0207703_10103292 3300026035 Bacteria 2419
406 Ga0207639_10435338 3300026041 Bacteria 1188
407 Ga0207678_10006364 3300026067 Bacteria 10483
408 Ga0207678_10043339 3300026067 Bacteria 3894
409 Ga0207708_10020780 3300026075 Bacteria 4952
410 Ga0207708_10028204 3300026075 Bacteria 4251
411 Ga0207708_10180064 3300026075 Bacteria 1678
412 Ga0207702_10000535 3300026078 Bacteria 42526
413 Ga0207641_10058516 3300026088 Bacteria 3280
414 Ga0207641_10080796 3300026088 Bacteria 2821
415 Ga0207641_10387720 3300026088 Bacteria 1339
416 Ga0207648_10000455 3300026089 Bacteria 45441
417 Ga0207648_10096364 3300026089 Bacteria 2589
418 Ga0207676_10029836 3300026095 Bacteria 4087
419 Ga0207676_10087755 3300026095 Bacteria 2545
420 Ga0207676_10119895 3300026095 Bacteria 2216
421 Ga0207676_10273399 3300026095 Bacteria 1531
422 Ga0207676_10392299 3300026095 Bacteria 1295
423 Ga0207676_10395786 3300026095 Bacteria 1290
424 Ga0207674_10196858 3300026116 Bacteria 1965
425 Ga0207674_10414055 3300026116 Bacteria 1302
426 Ga0207675_100007007 3300026118 Bacteria 10660
427 Ga0207675_100010456 3300026118 Bacteria 8690
428 Ga0207675_100040529 3300026118 Bacteria 4349
429 Ga0207675_100256314 3300026118 Archaea 1694
430 Ga0207683_10008884 3300026121 Bacteria 8568
431 Ga0207683_10184148 3300026121 Bacteria 1894
432 Ga0207698_10439023 3300026142 Bacteria 1257
433 Ga0207698_10559043 3300026142 Bacteria 1123
434 Ga0209966_1008881 3300027695 Bacteria 1789
435 Ga0209813_10013534 3300027866 Bacteria 2180
436 Ga0207428_10000070 3300027907 Bacteria 147650
437 Ga0207428_10000234 3300027907 Bacteria 76592
438 Ga0207428_10000970 3300027907 Bacteria 31814
439 Ga0207428_10002771 3300027907 Bacteria 17425
440 Ga0207428_10006859 3300027907 Bacteria 10436
441 Ga0207428_10020464 3300027907 Bacteria 5620
442 Ga0207428_10031962 3300027907 Bacteria 4334
443 Ga0268266_10018204 3300028379 Bacteria 5989
444 Ga0268266_10062499 3300028379 Bacteria 3214
445 Ga0268266_10075456 3300028379 Bacteria 2929
446 Ga0268265_10113823 3300028380 Bacteria 2214
447 Ga0268264_10087383 3300028381 Bacteria 2681
448 Ga0268264_10115880 3300028381 Bacteria 2354
449 Ga0268264_10218660 3300028381 Bacteria 1753
450 Ga0265318_10010231 3300028577 Bacteria 4097
451 Ga0265336_10038354 3300028666 Bacteria 1471
452 Ga0265339_10041338 3300031249 Bacteria 2560
453 Ga0307408_100017907 3300031548 Bacteria 4749
454 Ga0307408_100086971 3300031548 Bacteria 2350
455 Ga0307408_100121889 3300031548 Bacteria 2021
456 Ga0265314_10017566 3300031711 Bacteria 5611
457 Ga0265342_10181843 3300031712 Bacteria 1151
458 Ga0307405_10000373 3300031731 Bacteria 16766
459 Ga0307413_10193462 3300031824 Bacteria 1462
460 Ga0307413_10305213 3300031824 Bacteria 1209
461 Ga0307410_10177339 3300031852 Bacteria 1611
462 Ga0307406_10073726 3300031901 Bacteria 2246
463 Ga0307412_10003351 3300031911 Bacteria 8902
464 Ga0307409_100001999 3300031995 Bacteria 10458
465 Ga0307416_100019475 3300032002 Bacteria 4812
466 Ga0307416_100026701 3300032002 Bacteria 4260
467 Ga0307416_100036043 3300032002 Bacteria 3788
468 Ga0307416_100094726 3300032002 Bacteria 2576
469 Ga0307416_100108004 3300032002 Bacteria 2444
470 Ga0307416_100133474 3300032002 Bacteria 2240
471 Ga0307416_100235465 3300032002 Bacteria 1769
472 Ga0307416_100487643 3300032002 Bacteria 1294
473 Ga0307416_100764915 3300032002 Archaea 1059
474 Ga0307411_10018425 3300032005 Bacteria 4004
475 Ga0307411_10086936 3300032005 Bacteria 2170
476 Ga0307415_100026945 3300032126 Bacteria 3634
477 Ga0307415_100098696 3300032126 Bacteria 2136
478 Ga0307415_100103932 3300032126 Bacteria 2091
479 Ga0373926_0002044 3300035083 Bacteria 6346
480 Ga0373929_0000969 3300035085 Bacteria 5568
481 Ga0373940_0009458 3300035088 Bacteria 2268
482 Ga0373949_0000541 3300035090 Bacteria 12469
483 Ga0373932_0001051 3300035112 Bacteria 7950
484 Ga0373941_0002913 3300035115 Bacteria 3816
485 Ga0373953_0071496 3300035117 Bacteria 1432
486 Ga0373954_0027171 3300035118 Unclassified 2625
487 Ga0373956_0062293 3300035119 Bacteria 1691
488 Ga0373960_0000470 3300035121 Bacteria 7983
489 Ga0373946_0078371 3300035171 Bacteria 1442
490 Ga0373955_0075899 3300035172 Bacteria 1890
491 Ga0373942_0061978 3300035207 Bacteria 1074
492 Ga0373961_0001177 3300035241 Bacteria 8144
493 Ga0373924_0168610 3300035410 Bacteria 962
494 Ga0373931_0000745 3300035691 Bacteria 13573
495 Ga0373935_0004143 3300035692 Bacteria 8485
496 Ga0373935_0143682 3300035692 Bacteria 1614
497 Ga0373927_0001983 3300035695 Bacteria 15085
498 Ga0373927_0153273 3300035695 Bacteria 1509
499 Ga0373933_0198626 3300035724 Bacteria 1283
500 Ga0373947_0002840 3300035725 Bacteria 10340
501 Ga0373947_0076803 3300035725 Bacteria 2059
502 Ga0373947_0196663 3300035725 Bacteria 1318
503 Ga0373937_0083282 3300036401 Bacteria 2959
504 Ga0373937_0119142 3300036401 Unclassified 2459
505 Ga0373937_0205946 3300036401 Bacteria 1850
506 Ga0373937_0499348 3300036401 Bacteria 1156
507 Ga0373925_0129982 3300037068 Bacteria 1963
508 Ga0373925_0198232 3300037068 Bacteria 1596
509 Ga0395905_0187182 3300037471 Unclassified 1943
510 Ga0400485_01916 3300038735 Bacteria 103745
511 Ga0400488_29914 3300038741 Bacteria 20404
512 Ga0400486_08682 3300038742 Bacteria 98233
513 Ga0400487_47850 3300039110 Bacteria 103119
514 Ga0436365_1745763 3300039437 Bacteria 5906
515 Ga0436362_0587869 3300039453 Bacteria 1125
516 Ga0451853_3907508 3300041512 Bacteria 1606
517 Ga0439441_018439 3300042001 Bacteria 1262
518 Ga0439462_0031464 3300042015 Bacteria 1405
519 Ga0439459_0030597 3300042438 Bacteria 1093
520 Ga0439460_0002387 3300042461 Bacteria 4524
521 Ga0451577_0003490 3300042876 Bacteria 17477
522 Ga0451577_0009672 3300042876 Bacteria 9251
523 Ga0451577_0073151 3300042876 Bacteria 3058
524 Ga0466969_0013532 3300044656 Bacteria 4296
525 Ga0466972_0117485 3300044658 Bacteria 1255
526 Ga0466966_0057668 3300044684 Bacteria 2455
527 Ga0466963_0031556 3300044694 Bacteria 3426
528 Ga0466963_0045795 3300044694 Unclassified 2882
529 Ga0466964_0085807 3300044706 Bacteria 1360
530 Ga0453684_0005717 3300044712 Bacteria 24352
531 Ga0453684_0023311 3300044712 Bacteria 9127
532 Ga0453684_0032388 3300044712 Bacteria 7317
533 Ga0466959_0067040 3300045049 Bacteria 2603
534 Ga0466959_0087948 3300045049 Bacteria 2234
535 Ga0451576_0008579 3300045051 Bacteria 11977
536 Ga0451576_0034669 3300045051 Bacteria 5359
537 Ga0451576_0061807 3300045051 Bacteria 3906
538 Ga0466967_0099140 3300045976 Bacteria 2661
539 Ga0495592_0077076 3300046454 Unclassified 2418
540 Ga0495603_0051162 3300046455 Bacteria 2455
541 Ga0495603_0052726 3300046455 Bacteria 2414
542 Ga0495629_0004349 3300046459 Bacteria 10622
543 Ga0495641_0103263 3300046461 Bacteria 1272
544 Ga0495651_0004511 3300046462 Bacteria 10655
545 Ga0495653_0003868 3300046463 Bacteria 12102
546 Ga0495580_0005665 3300046472 Bacteria 10275
547 Ga0495582_0168427 3300046473 Bacteria 1247
548 Ga0495639_0083547 3300046475 Bacteria 1490
549 Ga0495662_0004591 3300046476 Bacteria 6920
550 Ga0495664_0037686 3300046477 Bacteria 2854
551 Ga0495584_0012217 3300046491 Bacteria 4387
552 Ga0495594_0031275 3300046499 Bacteria 2885
553 Ga0495594_0033707 3300046499 Bacteria 2785
554 Ga0495594_0096868 3300046499 Bacteria 1658
555 Ga0495608_0007960 3300046511 Bacteria 7449
556 Ga0495630_0000002 3300046517 Bacteria 1277125
557 Ga0495630_0035279 3300046517 Bacteria 3737
558 Ga0495652_0004133 3300046529 Bacteria 14004
559 Ga0495665_0002476 3300046531 Bacteria 9985
560 Ga0495586_0014166 3300046535 Bacteria 4237
561 Ga0495586_0040346 3300046535 Bacteria 2511
562 Ga0495586_0130253 3300046535 Bacteria 1408
563 Ga0495621_0007186 3300046539 Bacteria 3287
564 Ga0495621_0007517 3300046539 Bacteria 3230
565 Ga0495645_0000493 3300046543 Bacteria 27347
566 Ga0495645_0091871 3300046543 Bacteria 2168
567 Ga0495656_0153842 3300046615 Bacteria 1113
568 Ga0495635_0001569 3300046663 Bacteria 15345
569 Ga0495635_0092678 3300046663 Bacteria 2066
570 Ga0495659_0142706 3300046664 Bacteria 957
571 Ga0495588_0070410 3300046674 Bacteria 1818
572 Ga0495657_0193262 3300046675 Bacteria 1243
573 Ga0495623_0000910 3300046679 Bacteria 20013
574 Ga0495646_0001633 3300046680 Bacteria 13371
575 Ga0495658_0042390 3300046683 Bacteria 2541
576 Ga0495658_0056860 3300046683 Bacteria 2233
577 Ga0495613_0134278 3300046689 Bacteria 1771
578 Ga0495613_0174915 3300046689 Unclassified 1522
579 Ga0495624_0001806 3300046690 Bacteria 16347
580 Ga0495604_0003449 3300047317 Bacteria 12606
581 Ga0495674_0139735 3300047319 Unclassified 2036
582 Ga0495672_0001087 3300047320 Bacteria 27603
583 Ga0495676_0043167 3300047321 Bacteria 3694
584 Ga0495676_0043501 3300047321 Bacteria 3674
585 Ga0495675_0002265 3300047444 Bacteria 11492
586 Ga0495677_0011201 3300047445 Bacteria 3282
587 Ga0495685_003103 3300047447 Bacteria 5271
588 Ga0495684_0180910 3300047471 Bacteria 1563
589 Ga0495684_0284286 3300047471 Unclassified 1192
590 Ga0495593_0000357 3300047673 Bacteria 25241
591 Ga0495602_0017549 3300048088 Bacteria 7171
592 Ga0495614_0000926 3300048089 Bacteria 12496
593 Ga0496100_0002378 3300048903 Bacteria 9518
594 Ga0496101_0183714 3300048904 Bacteria 1611
595 Ga0496102_0315418 3300048905 Bacteria 1473
596 Ga0496104_0001613 3300048907 Bacteria 19451
597 Ga0496104_0010994 3300048907 Bacteria 8098
598 Ga0496104_0136477 3300048907 Bacteria 2357
599 Ga0496105_0021967 3300048908 Bacteria 5166
600 Ga0496108_0025166 3300048911 Unclassified 4903
601 Ga0496109_0013940 3300048912 Bacteria 6990
602 Ga0496109_0056560 3300048912 Bacteria 3580
603 Ga0496109_0104658 3300048912 Bacteria 2628
604 Ga0496109_0481010 3300048912 Bacteria 1172
605 Ga0496110_0000816 3300048913 Bacteria 21833
606 Ga0496110_0064415 3300048913 Bacteria 3240
607 Ga0496111_0200262 3300048914 Bacteria 1484
608 Ga0496111_0262283 3300048914 Bacteria 1282
609 Ga0496111_0315112 3300048914 Bacteria 1159
610 Ga0496112_0000213 3300048915 Bacteria 37294
611 Ga0496112_0119322 3300048915 Bacteria 2607
612 Ga0496112_0219616 3300048915 Bacteria 1857
613 Ga0496112_0511584 3300048915 Bacteria 1136
614 Ga0496114_0011050 3300048917 Bacteria 7203
615 Ga0496114_0341808 3300048917 Bacteria 1323
616 Ga0496115_0000232 3300048918 Bacteria 50769
617 Ga0501031_0142114 3300049568 Bacteria 1569
618 Ga0501033_0042001 3300049570 Bacteria 3410
619 Ga0501033_0177726 3300049570 Bacteria 1527
620 Ga0501034_0078399 3300049571 Bacteria 3308
621 Ga0501034_0137754 3300049571 Bacteria 2421
622 Ga0501034_0412072 3300049571 Bacteria 1273
623 Ga0501036_0012231 3300049572 Bacteria 7109
624 Ga0501036_0039647 3300049572 Bacteria 3986
625 Ga0501036_0213533 3300049572 Bacteria 1621
626 Ga0501037_0016722 3300049573 Bacteria 5397
627 Ga0501038_0167771 3300049574 Bacteria 1779
628 Ga0501039_0009044 3300049575 Bacteria 7589
629 Ga0501039_0017921 3300049575 Bacteria 5432
630 Ga0501039_0058482 3300049575 Bacteria 2986
631 Ga0501039_0110966 3300049575 Bacteria 2144
632 Ga0501039_0201771 3300049575 Bacteria 1564
633 Ga0501040_0000223 3300049576 Bacteria 33236
634 Ga0501040_0018715 3300049576 Bacteria 4600
635 Ga0501040_0051999 3300049576 Bacteria 2804
636 Ga0501041_0105656 3300049577 Bacteria 1745
637 Ga0501042_0001934 3300049578 Bacteria 12467
638 Ga0501042_0182259 3300049578 Bacteria 1515
639 Ga0501043_0037724 3300049579 Bacteria 3800
640 Ga0501046_0009389 3300049580 Bacteria 8456
641 Ga0501046_0015196 3300049580 Bacteria 6473
642 Ga0501048_0027621 3300049582 Bacteria 4122
643 Ga0501048_0030431 3300049582 Bacteria 3906
644 Ga0501048_0076726 3300049582 Bacteria 2358
645 Ga0501048_0270955 3300049582 Bacteria 1207
646 Ga0501068_0007943 3300049584 Bacteria 5883
647 Ga0501071_0012597 3300049587 Bacteria 5742
648 Ga0501071_0026433 3300049587 Bacteria 4074
649 Ga0501071_0033937 3300049587 Bacteria 3628
650 Ga0501071_0055398 3300049587 Bacteria 2862
651 Ga0501071_0057473 3300049587 Bacteria 2812
652 Ga0501071_0082980 3300049587 Bacteria 2348
653 Ga0501071_0152458 3300049587 Bacteria 1725
654 Ga0501071_0229579 3300049587 Bacteria 1398
655 Ga0501072_0006486 3300049588 Bacteria 8912
656 Ga0501072_0012508 3300049588 Bacteria 6489
657 Ga0501072_0037511 3300049588 Bacteria 3801
658 Ga0501072_0097682 3300049588 Bacteria 2334
659 Ga0501073_0000657 3300049589 Bacteria 24264
660 Ga0501073_0009434 3300049589 Bacteria 7204
661 Ga0501075_0002433 3300049591 Bacteria 12395
662 Ga0501075_0033756 3300049591 Bacteria 3807
663 Ga0501075_0058585 3300049591 Bacteria 2901
664 Ga0501075_0060257 3300049591 Bacteria 2860
665 Ga0501075_0205558 3300049591 Bacteria 1502
666 Ga0501076_0000179 3300049592 Bacteria 37508
667 Ga0501076_0003878 3300049592 Bacteria 10532
668 Ga0501076_0022769 3300049592 Bacteria 4818
669 Ga0501076_0032946 3300049592 Bacteria 4046
670 Ga0501077_0018060 3300049593 Bacteria 4458
671 Ga0501077_0048296 3300049593 Unclassified 2704
672 Ga0501079_0019067 3300049741 Bacteria 5239
673 Ga0501079_0039458 3300049741 Bacteria 3642
674 Ga0501080_0001077 3300049742 Bacteria 22494
675 Ga0501080_0134657 3300049742 Bacteria 2287
676 Ga0501080_0203847 3300049742 Bacteria 1815
677 Ga0501081_0001559 3300049743 Bacteria 14096
678 Ga0501081_0055470 3300049743 Bacteria 2738
679 Ga0501083_0001968 3300049744 Bacteria 14119
680 Ga0501083_0203612 3300049744 Bacteria 1291
681 Ga0501083_0240186 3300049744 Bacteria 1179
682 Ga0501044_0322255 3300049823 Bacteria 1469
683 Ga0501045_0008879 3300049824 Bacteria 7017
684 Ga0501045_0011421 3300049824 Bacteria 6239
685 Ga0501045_0031327 3300049824 Bacteria 3852
686 Ga0501045_0200711 3300049824 Bacteria 1486
687 Ga0501045_0246846 3300049824 Unclassified 1329
688 Ga0501045_0349224 3300049824 Bacteria 1101
689 nmdc:mga03683_650_c1 3300050489 Bacteria 9969
690 nmdc:mga00v17_2930_c1 3300050491 Bacteria 8751
691 nmdc:mga00v17_42283_c1 3300050491 Bacteria 2740
692 nmdc:mga00v17_63758_c1 3300050491 Bacteria 2270
693 nmdc:mga00v17_70474_c1 3300050491 Unclassified 2165
694 nmdc:mga00v17_8387_c1 3300050491 Bacteria 5559
695 nmdc:mga00v17_95777_c1 3300050491 Bacteria 1869
696 nmdc:mga0yw44_15667_c1 3300050492 Bacteria 4069
697 nmdc:mga0yw44_25325_c1 3300050492 Bacteria 3372
698 nmdc:mga0k408_19295_c1 3300050493 Bacteria 3809
699 nmdc:mga0k408_23628_c1 3300050493 Bacteria 3470
700 nmdc:mga0k408_6257_c1 3300050493 Bacteria 6351
701 nmdc:mga0k408_87655_c1 3300050493 Bacteria 1828
702 nmdc:mga06z11_48012_c1 3300050494 Bacteria 2171
703 nmdc:mga06z11_57896_c1 3300050494 Bacteria 2009
704 nmdc:mga06z11_7392_c1 3300050494 Bacteria 4516
705 nmdc:mga06z11_8059_c1 3300050494 Bacteria 4369
706 nmdc:mga04h51_12935_c1 3300050495 Bacteria 2353
707 nmdc:mga05p37_112732_c1 3300050507 Bacteria 3344
708 nmdc:mga05p37_1136_c1 3300050507 Bacteria 30577
709 nmdc:mga05p37_180_c1 3300050507 Bacteria 61836
710 nmdc:mga05p37_18182_c1 3300050507 Bacteria 8494
711 nmdc:mga05p37_207921_c1 3300050507 Bacteria 2367
712 nmdc:mga05p37_219320_c1 3300050507 Bacteria 2296
713 nmdc:mga05p37_238171_c1 3300050507 Bacteria 2189
714 nmdc:mga05p37_369498_c1 3300050507 Bacteria 1684
715 nmdc:mga05p37_419496_c1 3300050507 Bacteria 1558
716 nmdc:mga05p37_470426_c1 3300050507 Bacteria 1450
717 nmdc:mga05p37_490045_c1 3300050507 Bacteria 1413
718 nmdc:mga05p37_597947_c1 3300050507 Bacteria 1246
719 nmdc:mga05p37_6052_c1 3300050507 Bacteria 14241
720 nmdc:mga05p37_625_c2 3300050507 Bacteria 19945
721 nmdc:mga09592_124772_c1 3300050508 Bacteria 2213
722 nmdc:mga09592_165126_c1 3300050508 Unclassified 1913
723 nmdc:mga09592_182135_c1 3300050508 Bacteria 1817
724 nmdc:mga09592_242448_c1 3300050508 Unclassified 1562
725 nmdc:mga09592_440699_c1 3300050508 Bacteria 1124
726 nmdc:mga09592_81117_c1 3300050508 Bacteria 2764
727 nmdc:mga0qj67_125829_c1 3300050509 Bacteria 2074
728 nmdc:mga0qj67_15214_c1 3300050509 Bacteria 5823
729 nmdc:mga0qj67_15800_c1 3300050509 Bacteria 5718
730 nmdc:mga0qj67_402_c1 3300050509 Bacteria 29827
731 nmdc:mga06r32_130789_c1 3300050510 Unclassified 2482
732 nmdc:mga06r32_21911_c1 3300050510 Bacteria 5900
733 nmdc:mga06r32_245275_c1 3300050510 Bacteria 1779
734 nmdc:mga06r32_4150_c1 3300050510 Bacteria 12974
735 nmdc:mga06r32_56700_c1 3300050510 Bacteria 3761
736 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
737 nmdc:mga08y16_11259_c1 3300050511 Bacteria 9394
738 nmdc:mga08y16_1646_c1 3300050511 Bacteria 22621
739 nmdc:mga08y16_18362_c1 3300050511 Bacteria 7372
740 nmdc:mga08y16_18614_c1 3300050511 Bacteria 7316
741 nmdc:mga08y16_21763_c1 3300050511 Bacteria 6766
742 nmdc:mga08y16_516485_c1 3300050511 Bacteria 1212
743 nmdc:mga08y16_536358_c1 3300050511 Bacteria 1185
744 nmdc:mga08y16_5423_c1 3300050511 Bacteria 13335
745 nmdc:mga08y16_59259_c1 3300050511 Bacteria 4000
746 nmdc:mga08y16_882_c1 3300050511 Bacteria 28902
747 nmdc:mga0n895_152868_c1 3300050512 Bacteria 2338
748 nmdc:mga0n895_157430_c1 3300050512 Bacteria 2303
749 nmdc:mga0rr50_119592_c1 3300050513 Bacteria 2095
750 nmdc:mga0rr50_228910_c1 3300050513 Bacteria 1537
751 nmdc:mga0rr50_394922_c1 3300050513 Bacteria 1168
752 nmdc:mga0rr50_49_c1 3300050513 Bacteria 71590
753 nmdc:mga08x19_125648_c1 3300050514 Bacteria 1722
754 nmdc:mga08x19_1341_c1 3300050514 Bacteria 15270
755 nmdc:mga08x19_32069_c1 3300050514 Bacteria 3309
756 nmdc:mga0a205_10903_c1 3300050515 Bacteria 8361
757 nmdc:mga0a205_125965_c1 3300050515 Bacteria 2461
758 nmdc:mga0a205_14986_c2 3300050515 Bacteria 6241
759 nmdc:mga0a205_159320_c1 3300050515 Unclassified 2154
760 nmdc:mga0a205_205943_c1 3300050515 Bacteria 1856
761 nmdc:mga0a205_239535_c1 3300050515 Bacteria 1695
762 nmdc:mga0a205_359560_c1 3300050515 Bacteria 1323
763 nmdc:mga0a205_359610_c1 3300050515 Bacteria 1322
764 nmdc:mga0a205_43183_c1 3300050515 Bacteria 4347
765 nmdc:mga0a205_432086_c1 3300050515 Bacteria 1178
766 nmdc:mga0a205_434074_c1 3300050515 Bacteria 1175
767 nmdc:mga0a205_88094_c1 3300050515 Bacteria 3000
768 Ga0495601_0041094 3300053077 Bacteria 2898
769 Ga0495601_0162706 3300053077 Bacteria 1459
770 Ga0495612_0044766 3300053078 Bacteria 1811
771 Ga0495619_0027824 3300053085 Bacteria 3646
772 Ga0495619_0088386 3300053085 Bacteria 2096
773 Ga0495619_0122483 3300053085 Bacteria 1783
774 Ga0500646_0012300 3300053090 Bacteria 2208
775 Ga0500641_0021822 3300053096 Bacteria 2445
776 Ga0500658_0080397 3300053134 Bacteria 1393
777 Ga0500568_0014832 3300053139 Bacteria 3504
778 Ga0501084_0000669 3300054114 Bacteria 26157
779 Ga0501084_0038000 3300054114 Bacteria 4024
780 Ga0501084_0058938 3300054114 Bacteria 3213
781 Ga0501084_0124312 3300054114 Bacteria 2170
782 Ga0501082_0018802 3300060353 Bacteria 5953
783 Ga0501082_0044682 3300060353 Bacteria 3821
784 Ga0501082_0088441 3300060353 Bacteria 2673
785 Ga0530510_0000198 3300061734 Bacteria 37256
786 Ga0530510_0014629 3300061734 Bacteria 5539
787 Ga0530510_0026738 3300061734 Bacteria 4132

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_165126_c1 nmdc:mga09592_165126_c1_1036_1887 283
2 3300013308 Ga0157375_10044798 Ga0157375_100447983 291
3 3300032002 Ga0307416_100764915 Ga0307416_1007649152 292
4 3300005355 Ga0070671_100014494 Ga0070671_1000144943 293
5 3300006844 Ga0075428_100265138 Ga0075428_1002651382 293
6 3300028381 Ga0268264_10218660 Ga0268264_102186602 293
7 3300046664 Ga0495659_0142706 Ga0495659_0142706_14_895 293
8 3300050514 nmdc:mga08x19_125648_c1 nmdc:mga08x19_125648_c1_719_1681 294
9 3300050515 nmdc:mga0a205_434074_c1 nmdc:mga0a205_434074_c1_234_1133 299
10 3300005536 Ga0070697_100018537 Ga0070697_1000185374 300
11 3300006914 Ga0075436_100099307 Ga0075436_1000993072 301
12 3300009176 Ga0105242_10024360 Ga0105242_100243603 301
13 3300014325 Ga0163163_10465932 Ga0163163_104659322 301
14 3300014969 Ga0157376_10017805 Ga0157376_100178054 301
15 3300025942 Ga0207689_10140194 Ga0207689_101401942 301
16 3300035117 Ga0373953_0071496 Ga0373953_0071496_220_1125 301
17 3300035172 Ga0373955_0075899 Ga0373955_0075899_173_1078 301
18 3300035410 Ga0373924_0168610 Ga0373924_0168610_31_936 301
19 3300036401 Ga0373937_0499348 Ga0373937_0499348_187_1092 301
20 3300046473 Ga0495582_0168427 Ga0495582_0168427_170_1075 301
21 3300046535 Ga0495586_0130253 Ga0495586_0130253_286_1191 301
22 3300046543 Ga0495645_0000493 Ga0495645_0000493_13568_14473 301
23 3300046663 Ga0495635_0092678 Ga0495635_0092678_572_1477 301
24 3300046683 Ga0495658_0042390 Ga0495658_0042390_1212_2117 301
25 3300048917 Ga0496114_0341808 Ga0496114_0341808_192_1097 301
26 3300053077 Ga0495601_0041094 Ga0495601_0041094_46_951 301
27 3300053085 Ga0495619_0027824 Ga0495619_0027824_141_1046 301
28 3300053085 Ga0495619_0122483 Ga0495619_0122483_818_1723 301
29 3300050507 nmdc:mga05p37_369498_c1 nmdc:mga05p37_369498_c1_656_1564 302
30 3300037471 Ga0395905_0187182 Ga0395905_0187182_12_941 309
31 3300035695 Ga0373927_0153273 Ga0373927_0153273_246_1199 310
32 3300006195 Ga0075366_10031879 Ga0075366_100318792 312
33 3300006844 Ga0075428_100112217 Ga0075428_1001122172 312
34 3300009147 Ga0114129_10020472 Ga0114129_100204725 312
35 3300014969 Ga0157376_10137419 Ga0157376_101374192 312
36 3300044694 Ga0466963_0031556 Ga0466963_0031556_1066_2028 312
37 3300050491 nmdc:mga00v17_95777_c1 nmdc:mga00v17_95777_c1_517_1479 312
38 3300050493 nmdc:mga0k408_6257_c1 nmdc:mga0k408_6257_c1_3805_4767 312
39 3300050493 nmdc:mga0k408_87655_c1 nmdc:mga0k408_87655_c1_708_1670 312
40 3300050494 nmdc:mga06z11_48012_c1 nmdc:mga06z11_48012_c1_1120_2082 312
41 3300050494 nmdc:mga06z11_7392_c1 nmdc:mga06z11_7392_c1_2685_3647 312
42 3300050507 nmdc:mga05p37_6052_c1 nmdc:mga05p37_6052_c1_2708_3670 312
43 3300053139 Ga0500568_0014832 Ga0500568_0014832_1939_2901 312
44 3300005295 Ga0065707_10095269 Ga0065707_100952692 313
45 3300005356 Ga0070674_100042001 Ga0070674_1000420013 313
46 3300031548 Ga0307408_100121889 Ga0307408_1001218892 313
47 3300031824 Ga0307413_10305213 Ga0307413_103052132 313
48 3300032002 Ga0307416_100036043 Ga0307416_1000360433 313
49 3300042876 Ga0451577_0003490 Ga0451577_0003490_10563_11564 313
50 3300044712 Ga0453684_0032388 Ga0453684_0032388_3829_4803 313
51 3300049571 Ga0501034_0078399 Ga0501034_0078399_653_1615 313
52 3300005290 Ga0065712_10129186 Ga0065712_101291862 314
53 3300009094 Ga0111539_10480530 Ga0111539_104805302 314
54 3300025940 Ga0207691_10282649 Ga0207691_102826492 314
55 3300035724 Ga0373933_0198626 Ga0373933_0198626_119_1063 314
56 3300049587 Ga0501071_0012597 Ga0501071_0012597_2227_3192 314
57 3300049588 Ga0501072_0012508 Ga0501072_0012508_3270_4235 314
58 3300049824 Ga0501045_0031327 Ga0501045_0031327_580_1545 314
59 3300050511 nmdc:mga08y16_516485_c1 nmdc:mga08y16_516485_c1_157_1119 314
60 3300047320 Ga0495672_0001087 Ga0495672_0001087_17726_18703 315
61 3300009101 Ga0105247_10057544 Ga0105247_100575442 317
62 3300009177 Ga0105248_10132314 Ga0105248_101323143 317
63 3300009177 Ga0105248_10442394 Ga0105248_104423942 317
64 3300014745 Ga0157377_10083660 Ga0157377_100836602 317
65 3300014968 Ga0157379_10024463 Ga0157379_100244634 317
66 3300014968 Ga0157379_10033243 Ga0157379_100332431 317
67 3300035692 Ga0373935_0143682 Ga0373935_0143682_271_1224 317
68 3300035725 Ga0373947_0196663 Ga0373947_0196663_224_1177 317
69 3300042876 Ga0451577_0073151 Ga0451577_0073151_11_964 317
70 3300046475 Ga0495639_0083547 Ga0495639_0083547_406_1359 317
71 3300046535 Ga0495586_0040346 Ga0495586_0040346_357_1310 317
72 3300047445 Ga0495677_0011201 Ga0495677_0011201_413_1366 317
73 3300053134 Ga0500658_0080397 Ga0500658_0080397_419_1372 317
74 3300009094 Ga0111539_10001042 Ga0111539_100010423 318
75 3300028380 Ga0268265_10113823 Ga0268265_101138232 318
76 3300035112 Ga0373932_0001051 Ga0373932_0001051_4755_5741 318
77 3300049575 Ga0501039_0110966 Ga0501039_0110966_1061_2035 318
78 3300049576 Ga0501040_0051999 Ga0501040_0051999_1091_2065 318
79 3300049578 Ga0501042_0182259 Ga0501042_0182259_40_1014 318
80 3300049582 Ga0501048_0076726 Ga0501048_0076726_212_1186 318
81 3300049587 Ga0501071_0055398 Ga0501071_0055398_592_1566 318
82 3300049588 Ga0501072_0006486 Ga0501072_0006486_2271_3245 318
83 3300049592 Ga0501076_0003878 Ga0501076_0003878_4262_5236 318
84 3300049742 Ga0501080_0134657 Ga0501080_0134657_1221_2195 318
85 3300049824 Ga0501045_0246846 Ga0501045_0246846_166_1185 318
86 3300049824 Ga0501045_0349224 Ga0501045_0349224_76_1032 318
87 3300050507 nmdc:mga05p37_419496_c1 nmdc:mga05p37_419496_c1_110_1066 318
88 3300050508 nmdc:mga09592_440699_c1 nmdc:mga09592_440699_c1_26_982 318
89 3300050509 nmdc:mga0qj67_125829_c1 nmdc:mga0qj67_125829_c1_872_1828 318
90 3300050515 nmdc:mga0a205_10903_c1 nmdc:mga0a205_10903_c1_434_1390 318
91 3300054114 Ga0501084_0038000 Ga0501084_0038000_169_1143 318
92 3300005293 Ga0065715_10106654 Ga0065715_101066542 319
93 3300006844 Ga0075428_100504032 Ga0075428_1005040322 319
94 3300009176 Ga0105242_10277257 Ga0105242_102772572 319
95 3300017792 Ga0163161_10291034 Ga0163161_102910342 319
96 3300025981 Ga0207640_10085408 Ga0207640_100854082 319
97 3300032002 Ga0307416_100487643 Ga0307416_1004876432 319
98 3300042015 Ga0439462_0031464 Ga0439462_0031464_431_1390 319
99 3300050515 nmdc:mga0a205_159320_c1 nmdc:mga0a205_159320_c1_535_1494 319
100 3300002239 JGI24034J26672_10012296 JGI24034J26672_100122962 320
101 3300002459 JGI24751J29686_10003915 JGI24751J29686_100039153 320
102 3300005288 Ga0065714_10015360 Ga0065714_100153602 320
103 3300005290 Ga0065712_10001700 Ga0065712_100017003 320
104 3300005290 Ga0065712_10002413 Ga0065712_100024133 320
105 3300005290 Ga0065712_10079342 Ga0065712_100793422 320
106 3300005290 Ga0065712_10104939 Ga0065712_101049391 320
107 3300005293 Ga0065715_10001036 Ga0065715_100010362 320
108 3300005293 Ga0065715_10029631 Ga0065715_100296312 320
109 3300005293 Ga0065715_10094824 Ga0065715_100948242 320
110 3300005293 Ga0065715_10108738 Ga0065715_101087382 320
111 3300005295 Ga0065707_10182545 Ga0065707_101825452 320
112 3300005328 Ga0070676_10003338 Ga0070676_100033387 320
113 3300005328 Ga0070676_10100165 Ga0070676_101001652 320
114 3300005329 Ga0070683_100009991 Ga0070683_1000099912 320
115 3300005331 Ga0070670_100001016 Ga0070670_10000101611 320
116 3300005331 Ga0070670_100001433 Ga0070670_1000014338 320
117 3300005331 Ga0070670_100011278 Ga0070670_1000112783 320
118 3300005331 Ga0070670_100022053 Ga0070670_1000220532 320
119 3300005331 Ga0070670_100059070 Ga0070670_1000590704 320
120 3300005333 Ga0070677_10047232 Ga0070677_100472321 320
121 3300005335 Ga0070666_10010821 Ga0070666_100108216 320
122 3300005335 Ga0070666_10165291 Ga0070666_101652912 320
123 3300005336 Ga0070680_100043713 Ga0070680_1000437134 320
124 3300005338 Ga0068868_100026828 Ga0068868_1000268284 320
125 3300005338 Ga0068868_100240922 Ga0068868_1002409221 320
126 3300005339 Ga0070660_100001966 Ga0070660_1000019663 320
127 3300005339 Ga0070660_100009277 Ga0070660_1000092774 320
128 3300005340 Ga0070689_100000517 Ga0070689_1000005174 320
129 3300005340 Ga0070689_100065709 Ga0070689_1000657092 320
130 3300005343 Ga0070687_100075332 Ga0070687_1000753322 320
131 3300005343 Ga0070687_100122766 Ga0070687_1001227662 320
132 3300005344 Ga0070661_100058021 Ga0070661_1000580211 320
133 3300005344 Ga0070661_100209931 Ga0070661_1002099312 320
134 3300005345 Ga0070692_10003674 Ga0070692_100036747 320
135 3300005347 Ga0070668_100319143 Ga0070668_1003191431 320
136 3300005354 Ga0070675_100076323 Ga0070675_1000763232 320
137 3300005354 Ga0070675_100083193 Ga0070675_1000831932 320
138 3300005355 Ga0070671_100026525 Ga0070671_1000265254 320
139 3300005355 Ga0070671_100044066 Ga0070671_1000440661 320
140 3300005355 Ga0070671_100143471 Ga0070671_1001434712 320
141 3300005364 Ga0070673_100016161 Ga0070673_1000161612 320
142 3300005365 Ga0070688_100001469 Ga0070688_1000014694 320
143 3300005365 Ga0070688_100017491 Ga0070688_1000174914 320
144 3300005367 Ga0070667_100029291 Ga0070667_1000292912 320
145 3300005438 Ga0070701_10009060 Ga0070701_100090602 320
146 3300005440 Ga0070705_100004206 Ga0070705_1000042065 320
147 3300005440 Ga0070705_100192408 Ga0070705_1001924082 320
148 3300005441 Ga0070700_100122190 Ga0070700_1001221902 320
149 3300005441 Ga0070700_100228863 Ga0070700_1002288631 320
150 3300005441 Ga0070700_100250156 Ga0070700_1002501562 320
151 3300005444 Ga0070694_100001421 Ga0070694_1000014212 320
152 3300005444 Ga0070694_100037182 Ga0070694_1000371823 320
153 3300005445 Ga0070708_100109235 Ga0070708_1001092351 320
154 3300005445 Ga0070708_100119566 Ga0070708_1001195663 320
155 3300005456 Ga0070678_100165401 Ga0070678_1001654012 320
156 3300005457 Ga0070662_100031607 Ga0070662_1000316074 320
157 3300005458 Ga0070681_10027541 Ga0070681_100275412 320
158 3300005458 Ga0070681_10094363 Ga0070681_100943633 320
159 3300005458 Ga0070681_10137645 Ga0070681_101376452 320
160 3300005466 Ga0070685_10013390 Ga0070685_100133905 320
161 3300005471 Ga0070698_100013325 Ga0070698_1000133253 320
162 3300005471 Ga0070698_100202348 Ga0070698_1002023482 320
163 3300005518 Ga0070699_100064656 Ga0070699_1000646562 320
164 3300005518 Ga0070699_100250667 Ga0070699_1002506672 320
165 3300005530 Ga0070679_100077372 Ga0070679_1000773723 320
166 3300005530 Ga0070679_100120164 Ga0070679_1001201642 320
167 3300005535 Ga0070684_100000477 Ga0070684_1000004773 320
168 3300005539 Ga0068853_100105264 Ga0068853_1001052642 320
169 3300005543 Ga0070672_100284189 Ga0070672_1002841892 320
170 3300005545 Ga0070695_100000155 Ga0070695_10000015523 320
171 3300005546 Ga0070696_100000499 Ga0070696_10000049911 320
172 3300005546 Ga0070696_100007757 Ga0070696_1000077572 320
173 3300005546 Ga0070696_100012876 Ga0070696_1000128762 320
174 3300005548 Ga0070665_100005335 Ga0070665_1000053354 320
175 3300005548 Ga0070665_100076339 Ga0070665_1000763392 320
176 3300005548 Ga0070665_100084755 Ga0070665_1000847552 320
177 3300005549 Ga0070704_100130970 Ga0070704_1001309702 320
178 3300005549 Ga0070704_100198539 Ga0070704_1001985392 320
179 3300005563 Ga0068855_100082652 Ga0068855_1000826523 320
180 3300005564 Ga0070664_100003519 Ga0070664_1000035199 320
181 3300005564 Ga0070664_100004562 Ga0070664_1000045625 320
182 3300005564 Ga0070664_100115735 Ga0070664_1001157352 320
183 3300005564 Ga0070664_100293883 Ga0070664_1002938832 320
184 3300005577 Ga0068857_100011444 Ga0068857_1000114444 320
185 3300005577 Ga0068857_100116300 Ga0068857_1001163002 320
186 3300005578 Ga0068854_100006236 Ga0068854_1000062368 320
187 3300005615 Ga0070702_100041302 Ga0070702_1000413022 320
188 3300005615 Ga0070702_100067530 Ga0070702_1000675301 320
189 3300005615 Ga0070702_100082924 Ga0070702_1000829242 320
190 3300005616 Ga0068852_100095072 Ga0068852_1000950722 320
191 3300005616 Ga0068852_100609298 Ga0068852_1006092981 320
192 3300005617 Ga0068859_100022365 Ga0068859_1000223656 320
193 3300005617 Ga0068859_100081521 Ga0068859_1000815212 320
194 3300005617 Ga0068859_100096157 Ga0068859_1000961572 320
195 3300005618 Ga0068864_100045012 Ga0068864_1000450123 320
196 3300005618 Ga0068864_100066454 Ga0068864_1000664541 320
197 3300005618 Ga0068864_100089558 Ga0068864_1000895582 320
198 3300005718 Ga0068866_10034490 Ga0068866_100344901 320
199 3300005841 Ga0068863_100017949 Ga0068863_1000179492 320
200 3300005841 Ga0068863_100265420 Ga0068863_1002654202 320
201 3300005843 Ga0068860_100106269 Ga0068860_1001062693 320
202 3300006038 Ga0075365_10000819 Ga0075365_100008197 320
203 3300006038 Ga0075365_10035010 Ga0075365_100350102 320
204 3300006051 Ga0075364_10011460 Ga0075364_100114603 320
205 3300006051 Ga0075364_10027113 Ga0075364_100271132 320
206 3300006051 Ga0075364_10032801 Ga0075364_100328012 320
207 3300006051 Ga0075364_10112623 Ga0075364_101126232 320
208 3300006051 Ga0075364_10147977 Ga0075364_101479772 320
209 3300006173 Ga0070716_100098490 Ga0070716_1000984902 320
210 3300006173 Ga0070716_100212329 Ga0070716_1002123292 320
211 3300006177 Ga0075362_10000172 Ga0075362_100001725 320
212 3300006178 Ga0075367_10083955 Ga0075367_100839552 320
213 3300006178 Ga0075367_10123975 Ga0075367_101239752 320
214 3300006178 Ga0075367_10150941 Ga0075367_101509412 320
215 3300006195 Ga0075366_10019756 Ga0075366_100197562 320
216 3300006237 Ga0097621_100092687 Ga0097621_1000926873 320
217 3300006237 Ga0097621_100102856 Ga0097621_1001028562 320
218 3300006353 Ga0075370_10049631 Ga0075370_100496312 320
219 3300006358 Ga0068871_100002675 Ga0068871_10000267510 320
220 3300006358 Ga0068871_100273587 Ga0068871_1002735871 320
221 3300006844 Ga0075428_100001280 Ga0075428_10000128013 320
222 3300006844 Ga0075428_100008474 Ga0075428_1000084748 320
223 3300006844 Ga0075428_100140015 Ga0075428_1001400152 320
224 3300006846 Ga0075430_100003870 Ga0075430_1000038705 320
225 3300006846 Ga0075430_100007243 Ga0075430_1000072435 320
226 3300006846 Ga0075430_100268607 Ga0075430_1002686072 320
227 3300006846 Ga0075430_100383035 Ga0075430_1003830351 320
228 3300006847 Ga0075431_100002665 Ga0075431_1000026653 320
229 3300006847 Ga0075431_100016013 Ga0075431_1000160134 320
230 3300006852 Ga0075433_10087172 Ga0075433_100871723 320
231 3300006852 Ga0075433_10104378 Ga0075433_101043782 320
232 3300006871 Ga0075434_100011984 Ga0075434_1000119844 320
233 3300006871 Ga0075434_100029393 Ga0075434_1000293934 320
234 3300006871 Ga0075434_100035952 Ga0075434_1000359524 320
235 3300006880 Ga0075429_100005224 Ga0075429_1000052249 320
236 3300006880 Ga0075429_100033459 Ga0075429_1000334592 320
237 3300006880 Ga0075429_100214235 Ga0075429_1002142352 320
238 3300006931 Ga0097620_100022365 Ga0097620_1000223656 320
239 3300006931 Ga0097620_100081523 Ga0097620_1000815233 320
240 3300006931 Ga0097620_100096157 Ga0097620_1000961572 320
241 3300007076 Ga0075435_100000404 Ga0075435_10000040424 320
242 3300009093 Ga0105240_10062219 Ga0105240_100622192 320
243 3300009093 Ga0105240_10068347 Ga0105240_100683472 320
244 3300009094 Ga0111539_10002555 Ga0111539_100025559 320
245 3300009094 Ga0111539_10015953 Ga0111539_1001595310 320
246 3300009094 Ga0111539_10055606 Ga0111539_100556064 320
247 3300009098 Ga0105245_10015209 Ga0105245_100152093 320
248 3300009098 Ga0105245_10103996 Ga0105245_101039962 320
249 3300009147 Ga0114129_10000408 Ga0114129_1000040837 320
250 3300009147 Ga0114129_10011033 Ga0114129_100110339 320
251 3300009147 Ga0114129_10023607 Ga0114129_100236076 320
252 3300009147 Ga0114129_10035313 Ga0114129_100353136 320
253 3300009147 Ga0114129_10082780 Ga0114129_100827805 320
254 3300009147 Ga0114129_10139810 Ga0114129_101398103 320
255 3300009148 Ga0105243_10281761 Ga0105243_102817612 320
256 3300009174 Ga0105241_10170650 Ga0105241_101706502 320
257 3300009174 Ga0105241_10261170 Ga0105241_102611701 320
258 3300009176 Ga0105242_10027488 Ga0105242_100274884 320
259 3300009176 Ga0105242_10441554 Ga0105242_104415541 320
260 3300009177 Ga0105248_10052999 Ga0105248_100529994 320
261 3300009177 Ga0105248_10265753 Ga0105248_102657532 320
262 3300009177 Ga0105248_10502317 Ga0105248_105023172 320
263 3300009545 Ga0105237_10123489 Ga0105237_101234892 320
264 3300009553 Ga0105249_10075780 Ga0105249_100757802 320
265 3300013296 Ga0157374_10153188 Ga0157374_101531882 320
266 3300013296 Ga0157374_10570705 Ga0157374_105707051 320
267 3300013306 Ga0163162_10232413 Ga0163162_102324132 320
268 3300013306 Ga0163162_10788607 Ga0163162_107886071 320
269 3300014325 Ga0163163_10004809 Ga0163163_100048096 320
270 3300014325 Ga0163163_10051015 Ga0163163_100510152 320
271 3300014326 Ga0157380_10007044 Ga0157380_100070447 320
272 3300014326 Ga0157380_10147610 Ga0157380_101476102 320
273 3300014326 Ga0157380_10438814 Ga0157380_104388141 320
274 3300014745 Ga0157377_10001507 Ga0157377_100015077 320
275 3300014968 Ga0157379_10040072 Ga0157379_100400724 320
276 3300014969 Ga0157376_10009204 Ga0157376_100092047 320
277 3300014969 Ga0157376_10023360 Ga0157376_100233604 320
278 3300017792 Ga0163161_10194998 Ga0163161_101949982 320
279 3300025893 Ga0207682_10011562 Ga0207682_100115623 320
280 3300025899 Ga0207642_10008472 Ga0207642_100084724 320
281 3300025899 Ga0207642_10067033 Ga0207642_100670331 320
282 3300025907 Ga0207645_10107246 Ga0207645_101072462 320
283 3300025907 Ga0207645_10215734 Ga0207645_102157342 320
284 3300025908 Ga0207643_10004895 Ga0207643_100048955 320
285 3300025908 Ga0207643_10027758 Ga0207643_100277582 320
286 3300025910 Ga0207684_10346446 Ga0207684_103464461 320
287 3300025911 Ga0207654_10140749 Ga0207654_101407492 320
288 3300025912 Ga0207707_10031377 Ga0207707_100313772 320
289 3300025912 Ga0207707_10111201 Ga0207707_101112012 320
290 3300025913 Ga0207695_10018579 Ga0207695_100185792 320
291 3300025918 Ga0207662_10021057 Ga0207662_100210573 320
292 3300025919 Ga0207657_10006060 Ga0207657_1000606012 320
293 3300025920 Ga0207649_10060700 Ga0207649_100607002 320
294 3300025921 Ga0207652_10050849 Ga0207652_100508492 320
295 3300025925 Ga0207650_10009640 Ga0207650_100096407 320
296 3300025925 Ga0207650_10015278 Ga0207650_100152782 320
297 3300025925 Ga0207650_10037895 Ga0207650_100378953 320
298 3300025925 Ga0207650_10050594 Ga0207650_100505944 320
299 3300025926 Ga0207659_10006571 Ga0207659_100065713 320
300 3300025926 Ga0207659_10129622 Ga0207659_101296222 320
301 3300025926 Ga0207659_10437082 Ga0207659_104370821 320
302 3300025927 Ga0207687_10031315 Ga0207687_100313153 320
303 3300025931 Ga0207644_10164316 Ga0207644_101643162 320
304 3300025932 Ga0207690_10131335 Ga0207690_101313352 320
305 3300025933 Ga0207706_10040547 Ga0207706_100405472 320
306 3300025933 Ga0207706_10105227 Ga0207706_101052272 320
307 3300025934 Ga0207686_10081713 Ga0207686_100817132 320
308 3300025934 Ga0207686_10293253 Ga0207686_102932532 320
309 3300025935 Ga0207709_10101369 Ga0207709_101013692 320
310 3300025935 Ga0207709_10190281 Ga0207709_101902812 320
311 3300025936 Ga0207670_10016295 Ga0207670_100162952 320
312 3300025936 Ga0207670_10310761 Ga0207670_103107612 320
313 3300025936 Ga0207670_10380521 Ga0207670_103805211 320
314 3300025937 Ga0207669_10113005 Ga0207669_101130052 320
315 3300025937 Ga0207669_10444309 Ga0207669_104443091 320
316 3300025938 Ga0207704_10008319 Ga0207704_100083194 320
317 3300025939 Ga0207665_10159775 Ga0207665_101597752 320
318 3300025940 Ga0207691_10093145 Ga0207691_100931452 320
319 3300025941 Ga0207711_10296307 Ga0207711_102963072 320
320 3300025942 Ga0207689_10329151 Ga0207689_103291512 320
321 3300025942 Ga0207689_10405372 Ga0207689_104053722 320
322 3300025944 Ga0207661_10003683 Ga0207661_100036838 320
323 3300025944 Ga0207661_10074090 Ga0207661_100740901 320
324 3300025945 Ga0207679_10006385 Ga0207679_100063853 320
325 3300025945 Ga0207679_10022084 Ga0207679_100220844 320
326 3300025945 Ga0207679_10069971 Ga0207679_100699712 320
327 3300025945 Ga0207679_10217729 Ga0207679_102177291 320
328 3300025949 Ga0207667_10129591 Ga0207667_101295912 320
329 3300025960 Ga0207651_10023871 Ga0207651_100238713 320
330 3300026023 Ga0207677_10096400 Ga0207677_100964002 320
331 3300026041 Ga0207639_10435338 Ga0207639_104353382 320
332 3300026067 Ga0207678_10043339 Ga0207678_100433393 320
333 3300026075 Ga0207708_10180064 Ga0207708_101800642 320
334 3300026088 Ga0207641_10058516 Ga0207641_100585163 320
335 3300026088 Ga0207641_10387720 Ga0207641_103877201 320
336 3300026095 Ga0207676_10029836 Ga0207676_100298362 320
337 3300026095 Ga0207676_10087755 Ga0207676_100877553 320
338 3300026095 Ga0207676_10119895 Ga0207676_101198952 320
339 3300026095 Ga0207676_10273399 Ga0207676_102733992 320
340 3300026095 Ga0207676_10392299 Ga0207676_103922991 320
341 3300026095 Ga0207676_10395786 Ga0207676_103957862 320
342 3300026116 Ga0207674_10196858 Ga0207674_101968582 320
343 3300026116 Ga0207674_10414055 Ga0207674_104140552 320
344 3300026118 Ga0207675_100256314 Ga0207675_1002563142 320
345 3300026121 Ga0207683_10184148 Ga0207683_101841482 320
346 3300026142 Ga0207698_10439023 Ga0207698_104390232 320
347 3300026142 Ga0207698_10559043 Ga0207698_105590431 320
348 3300027695 Ga0209966_1008881 Ga0209966_10088812 320
349 3300027866 Ga0209813_10013534 Ga0209813_100135342 320
350 3300027907 Ga0207428_10000970 Ga0207428_1000097016 320
351 3300027907 Ga0207428_10020464 Ga0207428_100204643 320
352 3300028379 Ga0268266_10018204 Ga0268266_100182045 320
353 3300028379 Ga0268266_10062499 Ga0268266_100624994 320
354 3300028379 Ga0268266_10075456 Ga0268266_100754563 320
355 3300028381 Ga0268264_10087383 Ga0268264_100873833 320
356 3300028666 Ga0265336_10038354 Ga0265336_100383542 320
357 3300031548 Ga0307408_100017907 Ga0307408_1000179075 320
358 3300031548 Ga0307408_100086971 Ga0307408_1000869712 320
359 3300031711 Ga0265314_10017566 Ga0265314_100175663 320
360 3300031712 Ga0265342_10181843 Ga0265342_101818432 320
361 3300031731 Ga0307405_10000373 Ga0307405_100003739 320
362 3300031824 Ga0307413_10193462 Ga0307413_101934622 320
363 3300031852 Ga0307410_10177339 Ga0307410_101773392 320
364 3300031911 Ga0307412_10003351 Ga0307412_100033516 320
365 3300031995 Ga0307409_100001999 Ga0307409_10000199910 320
366 3300032002 Ga0307416_100019475 Ga0307416_1000194754 320
367 3300032002 Ga0307416_100094726 Ga0307416_1000947261 320
368 3300032002 Ga0307416_100108004 Ga0307416_1001080042 320
369 3300032002 Ga0307416_100133474 Ga0307416_1001334742 320
370 3300032005 Ga0307411_10018425 Ga0307411_100184253 320
371 3300032005 Ga0307411_10086936 Ga0307411_100869361 320
372 3300032126 Ga0307415_100026945 Ga0307415_1000269452 320
373 3300032126 Ga0307415_100098696 Ga0307415_1000986962 320
374 3300032126 Ga0307415_100103932 Ga0307415_1001039321 320
375 3300035085 Ga0373929_0000969 Ga0373929_0000969_387_1349 320
376 3300035088 Ga0373940_0009458 Ga0373940_0009458_35_997 320
377 3300035090 Ga0373949_0000541 Ga0373949_0000541_2110_3072 320
378 3300035115 Ga0373941_0002913 Ga0373941_0002913_2659_3621 320
379 3300035121 Ga0373960_0000470 Ga0373960_0000470_3489_4451 320
380 3300035207 Ga0373942_0061978 Ga0373942_0061978_62_1027 320
381 3300035241 Ga0373961_0001177 Ga0373961_0001177_2296_3258 320
382 3300035691 Ga0373931_0000745 Ga0373931_0000745_10397_11359 320
383 3300036401 Ga0373937_0083282 Ga0373937_0083282_1435_2397 320
384 3300037068 Ga0373925_0129982 Ga0373925_0129982_844_1806 320
385 3300041512 Ga0451853_3907508 Ga0451853_3907508_71_1033 320
386 3300042001 Ga0439441_018439 Ga0439441_018439_162_1124 320
387 3300042461 Ga0439460_0002387 Ga0439460_0002387_1788_2750 320
388 3300042876 Ga0451577_0009672 Ga0451577_0009672_4426_5412 320
389 3300044712 Ga0453684_0005717 Ga0453684_0005717_16359_17345 320
390 3300044712 Ga0453684_0023311 Ga0453684_0023311_6939_7925 320
391 3300045051 Ga0451576_0008579 Ga0451576_0008579_5304_6266 320
392 3300045976 Ga0466967_0099140 Ga0466967_0099140_725_1687 320
393 3300046455 Ga0495603_0051162 Ga0495603_0051162_1428_2390 320
394 3300046459 Ga0495629_0004349 Ga0495629_0004349_2014_2976 320
395 3300046461 Ga0495641_0103263 Ga0495641_0103263_102_1064 320
396 3300046491 Ga0495584_0012217 Ga0495584_0012217_135_1097 320
397 3300046499 Ga0495594_0096868 Ga0495594_0096868_223_1185 320
398 3300046539 Ga0495621_0007517 Ga0495621_0007517_353_1315 320
399 3300046543 Ga0495645_0091871 Ga0495645_0091871_933_1895 320
400 3300046615 Ga0495656_0153842 Ga0495656_0153842_25_987 320
401 3300046683 Ga0495658_0056860 Ga0495658_0056860_1109_2071 320
402 3300047321 Ga0495676_0043167 Ga0495676_0043167_38_1000 320
403 3300047447 Ga0495685_003103 Ga0495685_003103_2493_3455 320
404 3300048904 Ga0496101_0183714 Ga0496101_0183714_408_1370 320
405 3300048905 Ga0496102_0315418 Ga0496102_0315418_238_1200 320
406 3300048907 Ga0496104_0010994 Ga0496104_0010994_1817_2779 320
407 3300048907 Ga0496104_0136477 Ga0496104_0136477_1008_1970 320
408 3300048908 Ga0496105_0021967 Ga0496105_0021967_925_1887 320
409 3300048911 Ga0496108_0025166 Ga0496108_0025166_1544_2506 320
410 3300048912 Ga0496109_0013940 Ga0496109_0013940_4207_5169 320
411 3300048912 Ga0496109_0056560 Ga0496109_0056560_2311_3273 320
412 3300048912 Ga0496109_0104658 Ga0496109_0104658_21_983 320
413 3300048912 Ga0496109_0481010 Ga0496109_0481010_146_1108 320
414 3300048913 Ga0496110_0000816 Ga0496110_0000816_6816_7778 320
415 3300048913 Ga0496110_0064415 Ga0496110_0064415_517_1479 320
416 3300048914 Ga0496111_0200262 Ga0496111_0200262_64_1026 320
417 3300048914 Ga0496111_0262283 Ga0496111_0262283_103_1065 320
418 3300048914 Ga0496111_0315112 Ga0496111_0315112_99_1061 320
419 3300048915 Ga0496112_0000213 Ga0496112_0000213_8570_9532 320
420 3300048915 Ga0496112_0219616 Ga0496112_0219616_848_1810 320
421 3300048915 Ga0496112_0511584 Ga0496112_0511584_81_1043 320
422 3300049568 Ga0501031_0142114 Ga0501031_0142114_263_1225 320
423 3300049570 Ga0501033_0177726 Ga0501033_0177726_474_1436 320
424 3300049572 Ga0501036_0012231 Ga0501036_0012231_2439_3401 320
425 3300049572 Ga0501036_0213533 Ga0501036_0213533_444_1406 320
426 3300049574 Ga0501038_0167771 Ga0501038_0167771_427_1389 320
427 3300049575 Ga0501039_0017921 Ga0501039_0017921_3828_4790 320
428 3300049575 Ga0501039_0058482 Ga0501039_0058482_40_1002 320
429 3300049576 Ga0501040_0000223 Ga0501040_0000223_24725_25687 320
430 3300049576 Ga0501040_0018715 Ga0501040_0018715_1073_2035 320
431 3300049578 Ga0501042_0001934 Ga0501042_0001934_3628_4590 320
432 3300049579 Ga0501043_0037724 Ga0501043_0037724_384_1346 320
433 3300049580 Ga0501046_0009389 Ga0501046_0009389_4100_5062 320
434 3300049582 Ga0501048_0027621 Ga0501048_0027621_1091_2053 320
435 3300049582 Ga0501048_0030431 Ga0501048_0030431_261_1223 320
436 3300049584 Ga0501068_0007943 Ga0501068_0007943_3463_4425 320
437 3300049587 Ga0501071_0026433 Ga0501071_0026433_2575_3537 320
438 3300049587 Ga0501071_0033937 Ga0501071_0033937_1362_2324 320
439 3300049587 Ga0501071_0229579 Ga0501071_0229579_190_1152 320
440 3300049588 Ga0501072_0037511 Ga0501072_0037511_2414_3376 320
441 3300049591 Ga0501075_0002433 Ga0501075_0002433_10905_11867 320
442 3300049591 Ga0501075_0033756 Ga0501075_0033756_1288_2250 320
443 3300049592 Ga0501076_0000179 Ga0501076_0000179_5245_6207 320
444 3300049592 Ga0501076_0022769 Ga0501076_0022769_3696_4658 320
445 3300049593 Ga0501077_0018060 Ga0501077_0018060_2404_3366 320
446 3300049593 Ga0501077_0048296 Ga0501077_0048296_1557_2519 320
447 3300049741 Ga0501079_0019067 Ga0501079_0019067_541_1503 320
448 3300049742 Ga0501080_0203847 Ga0501080_0203847_513_1475 320
449 3300049743 Ga0501081_0001559 Ga0501081_0001559_1689_2651 320
450 3300049744 Ga0501083_0203612 Ga0501083_0203612_69_1031 320
451 3300049744 Ga0501083_0240186 Ga0501083_0240186_40_1002 320
452 3300049824 Ga0501045_0008879 Ga0501045_0008879_1948_2910 320
453 3300049824 Ga0501045_0011421 Ga0501045_0011421_528_1490 320
454 3300050489 nmdc:mga03683_650_c1 nmdc:mga03683_650_c1_1020_1982 320
455 3300050491 nmdc:mga00v17_2930_c1 nmdc:mga00v17_2930_c1_334_1296 320
456 3300050491 nmdc:mga00v17_42283_c1 nmdc:mga00v17_42283_c1_647_1609 320
457 3300050491 nmdc:mga00v17_63758_c1 nmdc:mga00v17_63758_c1_636_1598 320
458 3300050491 nmdc:mga00v17_70474_c1 nmdc:mga00v17_70474_c1_143_1105 320
459 3300050491 nmdc:mga00v17_8387_c1 nmdc:mga00v17_8387_c1_2717_3679 320
460 3300050492 nmdc:mga0yw44_15667_c1 nmdc:mga0yw44_15667_c1_671_1633 320
461 3300050493 nmdc:mga0k408_19295_c1 nmdc:mga0k408_19295_c1_447_1409 320
462 3300050493 nmdc:mga0k408_23628_c1 nmdc:mga0k408_23628_c1_400_1362 320
463 3300050494 nmdc:mga06z11_8059_c1 nmdc:mga06z11_8059_c1_2124_3086 320
464 3300050495 nmdc:mga04h51_12935_c1 nmdc:mga04h51_12935_c1_932_1894 320
465 3300050507 nmdc:mga05p37_18182_c1 nmdc:mga05p37_18182_c1_1911_2873 320
466 3300050507 nmdc:mga05p37_207921_c1 nmdc:mga05p37_207921_c1_221_1183 320
467 3300050507 nmdc:mga05p37_219320_c1 nmdc:mga05p37_219320_c1_664_1626 320
468 3300050507 nmdc:mga05p37_470426_c1 nmdc:mga05p37_470426_c1_324_1286 320
469 3300050507 nmdc:mga05p37_597947_c1 nmdc:mga05p37_597947_c1_107_1069 320
470 3300050507 nmdc:mga05p37_625_c2 nmdc:mga05p37_625_c2_9606_10568 320
471 3300050508 nmdc:mga09592_124772_c1 nmdc:mga09592_124772_c1_832_1794 320
472 3300050509 nmdc:mga0qj67_15800_c1 nmdc:mga0qj67_15800_c1_3229_4191 320
473 3300050509 nmdc:mga0qj67_402_c1 nmdc:mga0qj67_402_c1_14806_15768 320
474 3300050510 nmdc:mga06r32_4150_c1 nmdc:mga06r32_4150_c1_1499_2461 320
475 3300050511 nmdc:mga08y16_11259_c1 nmdc:mga08y16_11259_c1_8072_9034 320
476 3300050511 nmdc:mga08y16_1646_c1 nmdc:mga08y16_1646_c1_11644_12606 320
477 3300050511 nmdc:mga08y16_5423_c1 nmdc:mga08y16_5423_c1_3985_4947 320
478 3300050512 nmdc:mga0n895_152868_c1 nmdc:mga0n895_152868_c1_150_1112 320
479 3300050512 nmdc:mga0n895_157430_c1 nmdc:mga0n895_157430_c1_313_1275 320
480 3300050513 nmdc:mga0rr50_119592_c1 nmdc:mga0rr50_119592_c1_298_1260 320
481 3300050513 nmdc:mga0rr50_228910_c1 nmdc:mga0rr50_228910_c1_52_1014 320
482 3300050514 nmdc:mga08x19_32069_c1 nmdc:mga08x19_32069_c1_341_1303 320
483 3300050515 nmdc:mga0a205_125965_c1 nmdc:mga0a205_125965_c1_567_1529 320
484 3300050515 nmdc:mga0a205_14986_c2 nmdc:mga0a205_14986_c2_3094_4056 320
485 3300050515 nmdc:mga0a205_205943_c1 nmdc:mga0a205_205943_c1_34_996 320
486 3300050515 nmdc:mga0a205_239535_c1 nmdc:mga0a205_239535_c1_464_1426 320
487 3300050515 nmdc:mga0a205_359560_c1 nmdc:mga0a205_359560_c1_26_988 320
488 3300050515 nmdc:mga0a205_359610_c1 nmdc:mga0a205_359610_c1_206_1168 320
489 3300050515 nmdc:mga0a205_432086_c1 nmdc:mga0a205_432086_c1_156_1118 320
490 3300050515 nmdc:mga0a205_88094_c1 nmdc:mga0a205_88094_c1_767_1729 320
491 3300053085 Ga0495619_0088386 Ga0495619_0088386_837_1799 320
492 3300053096 Ga0500641_0021822 Ga0500641_0021822_141_1103 320
493 3300054114 Ga0501084_0000669 Ga0501084_0000669_21215_22177 320
494 3300054114 Ga0501084_0058938 Ga0501084_0058938_1361_2323 320
495 3300060353 Ga0501082_0018802 Ga0501082_0018802_2573_3535 320
496 3300061734 Ga0530510_0000198 Ga0530510_0000198_30950_31912 320
497 3300061734 Ga0530510_0014629 Ga0530510_0014629_534_1496 320
498 3300005985 Ga0081539_10052663 Ga0081539_100526632 321
499 3300006237 Ga0097621_100086294 Ga0097621_1000862943 321
500 3300006358 Ga0068871_100033232 Ga0068871_1000332323 321
501 3300009147 Ga0114129_10000295 Ga0114129_100002955 321
502 3300025904 Ga0207647_10076704 Ga0207647_100767042 321
503 3300025907 Ga0207645_10081824 Ga0207645_100818242 321
504 3300025913 Ga0207695_10217391 Ga0207695_102173912 321
505 3300025918 Ga0207662_10006429 Ga0207662_100064294 321
506 3300025926 Ga0207659_10427046 Ga0207659_104270462 321
507 3300025940 Ga0207691_10045230 Ga0207691_100452302 321
508 3300025941 Ga0207711_10244687 Ga0207711_102446871 321
509 3300025981 Ga0207640_10044228 Ga0207640_100442282 321
510 3300026035 Ga0207703_10103292 Ga0207703_101032922 321
511 3300026075 Ga0207708_10028204 Ga0207708_100282042 321
512 3300035119 Ga0373956_0062293 Ga0373956_0062293_473_1438 321
513 3300037068 Ga0373925_0198232 Ga0373925_0198232_278_1243 321
514 3300045049 Ga0466959_0087948 Ga0466959_0087948_921_1910 321
515 3300045051 Ga0451576_0061807 Ga0451576_0061807_2201_3166 321
516 3300048903 Ga0496100_0002378 Ga0496100_0002378_8006_8971 321
517 3300048907 Ga0496104_0001613 Ga0496104_0001613_1751_2716 321
518 3300048917 Ga0496114_0011050 Ga0496114_0011050_3842_4807 321
519 3300050507 nmdc:mga05p37_1136_c1 nmdc:mga05p37_1136_c1_5083_6048 321
520 3300050508 nmdc:mga09592_242448_c1 nmdc:mga09592_242448_c1_423_1388 321
521 3300050511 nmdc:mga08y16_536358_c1 nmdc:mga08y16_536358_c1_156_1121 321
522 3300050515 nmdc:mga0a205_43183_c1 nmdc:mga0a205_43183_c1_1969_2934 321
523 3300005288 Ga0065714_10018882 Ga0065714_100188822 322
524 3300005293 Ga0065715_10090431 Ga0065715_100904315 322
525 3300005295 Ga0065707_10144105 Ga0065707_101441052 322
526 3300005338 Ga0068868_100235144 Ga0068868_1002351441 322
527 3300005468 Ga0070707_100010426 Ga0070707_1000104265 322
528 3300005546 Ga0070696_100059283 Ga0070696_1000592833 322
529 3300005549 Ga0070704_100058749 Ga0070704_1000587493 322
530 3300005617 Ga0068859_100054464 Ga0068859_1000544645 322
531 3300005719 Ga0068861_100033397 Ga0068861_1000333974 322
532 3300005844 Ga0068862_100299647 Ga0068862_1002996472 322
533 3300005937 Ga0081455_10114382 Ga0081455_101143822 322
534 3300006237 Ga0097621_100139441 Ga0097621_1001394412 322
535 3300006852 Ga0075433_10140086 Ga0075433_101400862 322
536 3300006931 Ga0097620_100054464 Ga0097620_1000544645 322
537 3300009553 Ga0105249_10274107 Ga0105249_102741072 322
538 3300013296 Ga0157374_10134859 Ga0157374_101348592 322
539 3300014969 Ga0157376_10013838 Ga0157376_100138382 322
540 3300025922 Ga0207646_10028669 Ga0207646_100286696 322
541 3300025939 Ga0207665_10229979 Ga0207665_102299791 322
542 3300025940 Ga0207691_10240492 Ga0207691_102404922 322
543 3300026118 Ga0207675_100040529 Ga0207675_1000405294 322
544 3300027907 Ga0207428_10000234 Ga0207428_1000023412 322
545 3300035083 Ga0373926_0002044 Ga0373926_0002044_3845_4894 322
546 3300035118 Ga0373954_0027171 Ga0373954_0027171_851_1900 322
547 3300035171 Ga0373946_0078371 Ga0373946_0078371_360_1328 322
548 3300035692 Ga0373935_0004143 Ga0373935_0004143_4454_5503 322
549 3300035695 Ga0373927_0001983 Ga0373927_0001983_5992_7041 322
550 3300035725 Ga0373947_0002840 Ga0373947_0002840_2713_3762 322
551 3300035725 Ga0373947_0076803 Ga0373947_0076803_999_1967 322
552 3300036401 Ga0373937_0119142 Ga0373937_0119142_612_1661 322
553 3300044656 Ga0466969_0013532 Ga0466969_0013532_2360_3328 322
554 3300044658 Ga0466972_0117485 Ga0466972_0117485_275_1243 322
555 3300044684 Ga0466966_0057668 Ga0466966_0057668_499_1467 322
556 3300045049 Ga0466959_0067040 Ga0466959_0067040_1177_2145 322
557 3300046454 Ga0495592_0077076 Ga0495592_0077076_191_1240 322
558 3300046462 Ga0495651_0004511 Ga0495651_0004511_3490_4539 322
559 3300046463 Ga0495653_0003868 Ga0495653_0003868_8782_9831 322
560 3300046472 Ga0495580_0005665 Ga0495580_0005665_4118_5167 322
561 3300046477 Ga0495664_0037686 Ga0495664_0037686_1178_2227 322
562 3300046511 Ga0495608_0007960 Ga0495608_0007960_197_1246 322
563 3300046517 Ga0495630_0035279 Ga0495630_0035279_1955_3004 322
564 3300046529 Ga0495652_0004133 Ga0495652_0004133_3158_4207 322
565 3300046531 Ga0495665_0002476 Ga0495665_0002476_3557_4606 322
566 3300046535 Ga0495586_0014166 Ga0495586_0014166_3075_4124 322
567 3300046663 Ga0495635_0001569 Ga0495635_0001569_4015_5064 322
568 3300046679 Ga0495623_0000910 Ga0495623_0000910_1083_2132 322
569 3300046680 Ga0495646_0001633 Ga0495646_0001633_5857_6906 322
570 3300046689 Ga0495613_0174915 Ga0495613_0174915_244_1293 322
571 3300046690 Ga0495624_0001806 Ga0495624_0001806_8940_9989 322
572 3300047317 Ga0495604_0003449 Ga0495604_0003449_2618_3667 322
573 3300047319 Ga0495674_0139735 Ga0495674_0139735_115_1164 322
574 3300047321 Ga0495676_0043501 Ga0495676_0043501_1214_2263 322
575 3300047444 Ga0495675_0002265 Ga0495675_0002265_6488_7537 322
576 3300047471 Ga0495684_0284286 Ga0495684_0284286_81_1130 322
577 3300047673 Ga0495593_0000357 Ga0495593_0000357_6583_7632 322
578 3300048088 Ga0495602_0017549 Ga0495602_0017549_3505_4554 322
579 3300048089 Ga0495614_0000926 Ga0495614_0000926_8080_9129 322
580 3300048915 Ga0496112_0119322 Ga0496112_0119322_113_1081 322
581 3300049571 Ga0501034_0412072 Ga0501034_0412072_189_1178 322
582 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_10074_11042 322
583 3300050513 nmdc:mga0rr50_394922_c1 nmdc:mga0rr50_394922_c1_107_1075 322
584 3300005365 Ga0070688_100045357 Ga0070688_1000453572 323
585 3300009094 Ga0111539_10071541 Ga0111539_100715412 323
586 3300013306 Ga0163162_10236525 Ga0163162_102365253 323
587 3300025923 Ga0207681_10085224 Ga0207681_100852242 323
588 3300027907 Ga0207428_10031962 Ga0207428_100319623 323
589 3300050511 nmdc:mga08y16_18614_c1 nmdc:mga08y16_18614_c1_2217_3191 323
590 3300005340 Ga0070689_100062388 Ga0070689_1000623882 324
591 3300005343 Ga0070687_100001265 Ga0070687_1000012653 324
592 3300005354 Ga0070675_100020053 Ga0070675_1000200534 324
593 3300005364 Ga0070673_100057615 Ga0070673_1000576153 324
594 3300005365 Ga0070688_100193177 Ga0070688_1001931772 324
595 3300005367 Ga0070667_100009590 Ga0070667_1000095906 324
596 3300005438 Ga0070701_10006490 Ga0070701_100064902 324
597 3300005456 Ga0070678_100002591 Ga0070678_1000025918 324
598 3300005466 Ga0070685_10025686 Ga0070685_100256863 324
599 3300005467 Ga0070706_100308399 Ga0070706_1003083991 324
600 3300005468 Ga0070707_100092942 Ga0070707_1000929422 324
601 3300005615 Ga0070702_100162598 Ga0070702_1001625982 324
602 3300005617 Ga0068859_100008402 Ga0068859_1000084027 324
603 3300005718 Ga0068866_10143182 Ga0068866_101431822 324
604 3300005719 Ga0068861_100005265 Ga0068861_1000052655 324
605 3300005842 Ga0068858_100006779 Ga0068858_1000067794 324
606 3300006038 Ga0075365_10009693 Ga0075365_100096935 324
607 3300006195 Ga0075366_10002316 Ga0075366_100023162 324
608 3300006880 Ga0075429_100050459 Ga0075429_1000504593 324
609 3300006881 Ga0068865_100005146 Ga0068865_1000051467 324
610 3300006931 Ga0097620_100008402 Ga0097620_1000084027 324
611 3300009094 Ga0111539_10000156 Ga0111539_1000015628 324
612 3300009176 Ga0105242_10205517 Ga0105242_102055171 324
613 3300013308 Ga0157375_10065779 Ga0157375_100657792 324
614 3300014326 Ga0157380_10142979 Ga0157380_101429792 324
615 3300014745 Ga0157377_10155643 Ga0157377_101556432 324
616 3300025899 Ga0207642_10086226 Ga0207642_100862262 324
617 3300025907 Ga0207645_10007961 Ga0207645_100079616 324
618 3300025908 Ga0207643_10020153 Ga0207643_100201532 324
619 3300025910 Ga0207684_10005792 Ga0207684_100057929 324
620 3300025918 Ga0207662_10002744 Ga0207662_100027446 324
621 3300025922 Ga0207646_10025062 Ga0207646_100250622 324
622 3300025933 Ga0207706_10069925 Ga0207706_100699253 324
623 3300025934 Ga0207686_10138608 Ga0207686_101386081 324
624 3300025938 Ga0207704_10333189 Ga0207704_103331892 324
625 3300025941 Ga0207711_10021439 Ga0207711_100214392 324
626 3300025942 Ga0207689_10006799 Ga0207689_100067993 324
627 3300025960 Ga0207651_10275292 Ga0207651_102752921 324
628 3300025986 Ga0207658_10041095 Ga0207658_100410952 324
629 3300026023 Ga0207677_10142654 Ga0207677_101426542 324
630 3300026035 Ga0207703_10027280 Ga0207703_100272802 324
631 3300026067 Ga0207678_10006364 Ga0207678_100063643 324
632 3300026088 Ga0207641_10080796 Ga0207641_100807962 324
633 3300026089 Ga0207648_10000455 Ga0207648_1000045511 324
634 3300026118 Ga0207675_100010456 Ga0207675_1000104564 324
635 3300026121 Ga0207683_10008884 Ga0207683_100088845 324
636 3300027907 Ga0207428_10000070 Ga0207428_1000007027 324
637 3300028381 Ga0268264_10115880 Ga0268264_101158802 324
638 3300042438 Ga0439459_0030597 Ga0439459_0030597_23_1000 324
639 3300049588 Ga0501072_0097682 Ga0501072_0097682_987_2006 324
640 3300049591 Ga0501075_0205558 Ga0501075_0205558_30_1007 324
641 3300050492 nmdc:mga0yw44_25325_c1 nmdc:mga0yw44_25325_c1_1887_2864 324
642 3300050494 nmdc:mga06z11_57896_c1 nmdc:mga06z11_57896_c1_756_1733 324
643 3300050507 nmdc:mga05p37_490045_c1 nmdc:mga05p37_490045_c1_342_1319 324
644 3300050508 nmdc:mga09592_81117_c1 nmdc:mga09592_81117_c1_1759_2736 324
645 3300050510 nmdc:mga06r32_56700_c1 nmdc:mga06r32_56700_c1_1621_2598 324
646 3300050511 nmdc:mga08y16_59259_c1 nmdc:mga08y16_59259_c1_1534_2511 324
647 3300006881 Ga0068865_100209929 Ga0068865_1002099292 325
648 3300025961 Ga0207712_10168648 Ga0207712_101686482 325
649 3300026118 Ga0207675_100007007 Ga0207675_1000070075 325
650 3300027907 Ga0207428_10006859 Ga0207428_100068592 325
651 3300032002 Ga0307416_100235465 Ga0307416_1002354652 325
652 3300046455 Ga0495603_0052726 Ga0495603_0052726_1188_2165 325
653 3300046499 Ga0495594_0031275 Ga0495594_0031275_1119_2096 325
654 3300046674 Ga0495588_0070410 Ga0495588_0070410_499_1476 325
655 3300046689 Ga0495613_0134278 Ga0495613_0134278_543_1520 325
656 3300047471 Ga0495684_0180910 Ga0495684_0180910_508_1485 325
657 3300049587 Ga0501071_0152458 Ga0501071_0152458_728_1705 325
658 3300050511 nmdc:mga08y16_882_c1 nmdc:mga08y16_882_c1_27014_27997 325
659 3300005295 Ga0065707_10181009 Ga0065707_101810092 326
660 3300005353 Ga0070669_100095771 Ga0070669_1000957712 326
661 3300005356 Ga0070674_100194499 Ga0070674_1001944992 326
662 3300005367 Ga0070667_100367550 Ga0070667_1003675501 326
663 3300005444 Ga0070694_100226098 Ga0070694_1002260981 326
664 3300005459 Ga0068867_100034592 Ga0068867_1000345923 326
665 3300005471 Ga0070698_100073888 Ga0070698_1000738883 326
666 3300005549 Ga0070704_100385069 Ga0070704_1003850691 326
667 3300005616 Ga0068852_100462422 Ga0068852_1004624221 326
668 3300005617 Ga0068859_100007974 Ga0068859_1000079743 326
669 3300005617 Ga0068859_100317729 Ga0068859_1003177292 326
670 3300005842 Ga0068858_100108860 Ga0068858_1001088602 326
671 3300006237 Ga0097621_100132272 Ga0097621_1001322722 326
672 3300006844 Ga0075428_100013161 Ga0075428_1000131614 326
673 3300006844 Ga0075428_100025568 Ga0075428_1000255683 326
674 3300006846 Ga0075430_100062016 Ga0075430_1000620162 326
675 3300006852 Ga0075433_10165239 Ga0075433_101652391 326
676 3300006881 Ga0068865_100115851 Ga0068865_1001158512 326
677 3300006931 Ga0097620_100007974 Ga0097620_1000079747 326
678 3300006931 Ga0097620_100317735 Ga0097620_1003177352 326
679 3300009094 Ga0111539_10052174 Ga0111539_100521745 326
680 3300009094 Ga0111539_10482665 Ga0111539_104826651 326
681 3300009098 Ga0105245_10229234 Ga0105245_102292342 326
682 3300009147 Ga0114129_10000047 Ga0114129_1000004752 326
683 3300009147 Ga0114129_10098439 Ga0114129_100984392 326
684 3300009177 Ga0105248_10030214 Ga0105248_100302144 326
685 3300009553 Ga0105249_10139558 Ga0105249_101395582 326
686 3300014325 Ga0163163_10000071 Ga0163163_1000007129 326
687 3300014326 Ga0157380_10000200 Ga0157380_1000020025 326
688 3300014326 Ga0157380_10022516 Ga0157380_100225165 326
689 3300014326 Ga0157380_10028264 Ga0157380_100282642 326
690 3300014968 Ga0157379_10173402 Ga0157379_101734022 326
691 3300014969 Ga0157376_10137953 Ga0157376_101379532 326
692 3300025923 Ga0207681_10036698 Ga0207681_100366982 326
693 3300025937 Ga0207669_10158237 Ga0207669_101582371 326
694 3300025941 Ga0207711_10080642 Ga0207711_100806424 326
695 3300025942 Ga0207689_10104723 Ga0207689_101047232 326
696 3300025942 Ga0207689_10131078 Ga0207689_101310782 326
697 3300026075 Ga0207708_10020780 Ga0207708_100207805 326
698 3300026089 Ga0207648_10096364 Ga0207648_100963642 326
699 3300027907 Ga0207428_10002771 Ga0207428_1000277111 326
700 3300031901 Ga0307406_10073726 Ga0307406_100737262 326
701 3300045051 Ga0451576_0034669 Ga0451576_0034669_2434_3417 326
702 3300046476 Ga0495662_0004591 Ga0495662_0004591_761_1741 326
703 3300046499 Ga0495594_0033707 Ga0495594_0033707_1133_2113 326
704 3300046517 Ga0495630_0000002 Ga0495630_0000002_409779_410759 326
705 3300046539 Ga0495621_0007186 Ga0495621_0007186_659_1645 326
706 3300046675 Ga0495657_0193262 Ga0495657_0193262_17_1000 326
707 3300049570 Ga0501033_0042001 Ga0501033_0042001_2182_3165 326
708 3300049571 Ga0501034_0137754 Ga0501034_0137754_241_1224 326
709 3300049572 Ga0501036_0039647 Ga0501036_0039647_1423_2409 326
710 3300049573 Ga0501037_0016722 Ga0501037_0016722_4298_5281 326
711 3300049575 Ga0501039_0009044 Ga0501039_0009044_2380_3363 326
712 3300049575 Ga0501039_0201771 Ga0501039_0201771_136_1119 326
713 3300049577 Ga0501041_0105656 Ga0501041_0105656_352_1335 326
714 3300049580 Ga0501046_0015196 Ga0501046_0015196_4766_5749 326
715 3300049582 Ga0501048_0270955 Ga0501048_0270955_166_1152 326
716 3300049587 Ga0501071_0057473 Ga0501071_0057473_1440_2423 326
717 3300049587 Ga0501071_0082980 Ga0501071_0082980_970_1956 326
718 3300049589 Ga0501073_0009434 Ga0501073_0009434_1931_2917 326
719 3300049591 Ga0501075_0058585 Ga0501075_0058585_954_1937 326
720 3300049591 Ga0501075_0060257 Ga0501075_0060257_902_1888 326
721 3300049592 Ga0501076_0032946 Ga0501076_0032946_1725_2711 326
722 3300049741 Ga0501079_0039458 Ga0501079_0039458_1486_2469 326
723 3300049743 Ga0501081_0055470 Ga0501081_0055470_1146_2129 326
724 3300049744 Ga0501083_0001968 Ga0501083_0001968_11878_12861 326
725 3300049823 Ga0501044_0322255 Ga0501044_0322255_218_1201 326
726 3300049824 Ga0501045_0200711 Ga0501045_0200711_219_1205 326
727 3300050507 nmdc:mga05p37_180_c1 nmdc:mga05p37_180_c1_58822_59826 326
728 3300050508 nmdc:mga09592_182135_c1 nmdc:mga09592_182135_c1_275_1261 326
729 3300050511 nmdc:mga08y16_18362_c1 nmdc:mga08y16_18362_c1_1670_2674 326
730 3300050511 nmdc:mga08y16_21763_c1 nmdc:mga08y16_21763_c1_2999_3985 326
731 3300053090 Ga0500646_0012300 Ga0500646_0012300_1168_2154 326
732 3300054114 Ga0501084_0124312 Ga0501084_0124312_1151_2137 326
733 3300060353 Ga0501082_0044682 Ga0501082_0044682_2627_3610 326
734 3300060353 Ga0501082_0088441 Ga0501082_0088441_1106_2092 326
735 3300061734 Ga0530510_0026738 Ga0530510_0026738_2211_3197 326
736 3300006871 Ga0075434_100219725 Ga0075434_1002197252 327
737 3300006914 Ga0075436_100001644 Ga0075436_1000016445 327
738 3300007076 Ga0075435_100000115 Ga0075435_10000011516 327
739 3300050513 nmdc:mga0rr50_49_c1 nmdc:mga0rr50_49_c1_54557_55540 327
740 3300050514 nmdc:mga08x19_1341_c1 nmdc:mga08x19_1341_c1_5395_6378 327
741 3300021384 Ga0213876_10018303 Ga0213876_100183033 328
742 3300039437 Ga0436365_1745763 Ga0436365_1745763_4572_5558 328
743 3300028577 Ga0265318_10010231 Ga0265318_100102314 329
744 3300031249 Ga0265339_10041338 Ga0265339_100413382 329
745 3300032002 Ga0307416_100026701 Ga0307416_1000267012 329
746 3300036401 Ga0373937_0205946 Ga0373937_0205946_801_1805 329
747 3300048918 Ga0496115_0000232 Ga0496115_0000232_36697_37710 329
748 3300039453 Ga0436362_0587869 Ga0436362_0587869_27_1067 330
749 3300049589 Ga0501073_0000657 Ga0501073_0000657_21583_22584 330
750 3300049742 Ga0501080_0001077 Ga0501080_0001077_16294_17295 330
751 3300053077 Ga0495601_0162706 Ga0495601_0162706_313_1311 330
752 3300053078 Ga0495612_0044766 Ga0495612_0044766_747_1745 330
753 3300005614 Ga0068856_100000849 Ga0068856_10000084920 331
754 3300026078 Ga0207702_10000535 Ga0207702_100005358 331
755 3300005336 Ga0070680_100116334 Ga0070680_1001163342 332
756 3300005435 Ga0070714_100024329 Ga0070714_1000243292 332
757 3300005458 Ga0070681_10023309 Ga0070681_100233092 332
758 3300009093 Ga0105240_10009865 Ga0105240_1000986510 332
759 3300013307 Ga0157372_10014369 Ga0157372_100143692 332
760 3300025912 Ga0207707_10016615 Ga0207707_100166153 332
761 3300025913 Ga0207695_10067552 Ga0207695_100675523 332
762 3300025917 Ga0207660_10097088 Ga0207660_100970881 332
763 3300025929 Ga0207664_10044947 Ga0207664_100449473 332
764 3300044694 Ga0466963_0045795 Ga0466963_0045795_1157_2161 332
765 3300005445 Ga0070708_100113454 Ga0070708_1001134542 333
766 3300006846 Ga0075430_100026174 Ga0075430_1000261744 333
767 3300006847 Ga0075431_100011674 Ga0075431_1000116741 333
768 3300044706 Ga0466964_0085807 Ga0466964_0085807_324_1328 333
769 3300050507 nmdc:mga05p37_112732_c1 nmdc:mga05p37_112732_c1_993_2018 333
770 3300050509 nmdc:mga0qj67_15214_c1 nmdc:mga0qj67_15214_c1_1485_2495 333
771 3300050510 nmdc:mga06r32_21911_c1 nmdc:mga06r32_21911_c1_1030_2040 333
772 3300005937 Ga0081455_10062109 Ga0081455_100621091 335
773 3300006847 Ga0075431_100197659 Ga0075431_1001976591 335
774 3300038735 Ga0400485_01916 Ga0400485_01916_69424_70449 335
775 3300038741 Ga0400488_29914 Ga0400488_29914_7161_8186 335
776 3300038742 Ga0400486_08682 Ga0400486_08682_35506_36531 335
777 3300039110 Ga0400487_47850 Ga0400487_47850_68912_69937 335
778 3300050510 nmdc:mga06r32_130789_c1 nmdc:mga06r32_130789_c1_1290_2318 335
779 2162886011 MRS1b_contig_1248874 MRS1b_0674.00003050 337
780 2162886012 MBSR1b_contig_6417879 MBSR1b_0367.00007700 337
781 3300005293 Ga0065715_10194301 Ga0065715_101943011 337
782 3300006028 Ga0070717_10095062 Ga0070717_100950622 337
783 3300006847 Ga0075431_100033574 Ga0075431_1000335744 337
784 3300013104 Ga0157370_10037109 Ga0157370_100371092 337
785 3300025929 Ga0207664_10205958 Ga0207664_102059582 337
786 3300050507 nmdc:mga05p37_238171_c1 nmdc:mga05p37_238171_c1_55_1068 337
787 3300050510 nmdc:mga06r32_245275_c1 nmdc:mga06r32_245275_c1_11_1024 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

21

262

0.91

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

22

331

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

21

144

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

161

299

0.85

PF07993

NAD_binding_4

Male sterility protein

76

241

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

22

179

0.8

PF04321

RmlD_sub_bind

RmlD substrate binding domain

19

335

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9599 2 320
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9546 2 325
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9456 2 325
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9456 2 320
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.9341 2 320
ID Description Score Start End Superfamily
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 1 322 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 91 322 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 1 322 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9397 126 321 3.40.50.720
2b69A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 2 304 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8FLA9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9919 2 319 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A5C6CPV4-F1-model_v4 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) 0.9886 1 319 GO:0033320
GO:0048040
AF-A0A7W0RGU4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9857 5 277 GO:0005737
GO:0042732
GO:0048040
GO:0070403
AF-A0A2E7G2R0-F1-model_v4 deleted 0.9834 2 319
AF-A0A7V4B043-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9811 2 319 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Feature Viewer

pLDDT pTM Quality
88.9 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map