F480812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 316 | 786 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300059421|Ga0590071_002007|Ga0590071_002007_3358_4098 |
| Length | 246 |
| Sequence | MPMPADGHACLATQRRRPTLQRLRRGRSFYTAGMQLYSYFRSSASFRVRIALALKGLDYEYLPIHLLKNEQSGADYGALSPSRLVPLLTDGDRVLSQSLAIMEYLDERHPQPPLLPPDAAGRARVRSLALDVACEIHPLNNLRVLRYLVHELKVPEEAKNGWYRHWVETGLDAIERQLAGHPATGSFCHGDLPTLADCVLVPQVFNAQRMHCRLDHVPTVMRIFAACMALEAFRRAQPSACPDAEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 221 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 225 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 304 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 305 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 313 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 314 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.2 |
| Nodule | 0 |
| Rhizoplane | 2.16 |
| Rhizosphere | 78.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10026344 | 3300002077 | Bacteria | 1129 |
| 2 | JGI25156J39149_1000229 | 3300002705 | Bacteria | 38688 |
| 3 | JGI25154J39366_1000931 | 3300002738 | Bacteria | 12213 |
| 4 | JGI25157J39369_1000235 | 3300002741 | Bacteria | 42844 |
| 5 | rootH1_10003054 | 3300003316 | Bacteria | 5923 |
| 6 | rootH1_10023119 | 3300003316 | Bacteria | 5381 |
| 7 | rootH1_10034201 | 3300003316 | Bacteria | 1912 |
| 8 | rootH1_10034201 | 3300003323 | Bacteria | 9076 |
| 9 | rootH2_10104343 | 3300003320 | Bacteria | 3262 |
| 10 | rootL2_10002813 | 3300003322 | Bacteria | 19046 |
| 11 | rootL2_10047266 | 3300003322 | Bacteria | 1687 |
| 12 | rootH1_10041586 | 3300003323 | Bacteria | 5524 |
| 13 | rootH1_10074880 | 3300003323 | Bacteria | 4408 |
| 14 | JGI26128J50194_1004221 | 3300003347 | Bacteria | 949 |
| 15 | JGI25161J50226_1014426 | 3300003374 | Bacteria | 885 |
| 16 | Ga0055539_1000428 | 3300003752 | Bacteria | 15085 |
| 17 | Ga0055539_1001832 | 3300003752 | Bacteria | 3610 |
| 18 | Ga0055533_1000221 | 3300003756 | Bacteria | 40020 |
| 19 | Ga0055525_1000026 | 3300003759 | Bacteria | 345798 |
| 20 | Ga0055525_1001640 | 3300003759 | Bacteria | 3469 |
| 21 | Ga0055524_1000755 | 3300003775 | Bacteria | 21925 |
| 22 | Ga0055531_10003254 | 3300003794 | Bacteria | 10424 |
| 23 | Ga0055543_1002246 | 3300004625 | Bacteria | 6546 |
| 24 | Ga0065165_1000431 | 3300005262 | Bacteria | 65970 |
| 25 | Ga0065707_10102460 | 3300005295 | Bacteria | 2804 |
| 26 | Ga0070658_10229733 | 3300005327 | Bacteria | 1571 |
| 27 | Ga0070676_10001637 | 3300005328 | Bacteria | 11383 |
| 28 | Ga0070676_10057916 | 3300005328 | Bacteria | 2294 |
| 29 | Ga0070676_10078624 | 3300005328 | Bacteria | 1996 |
| 30 | Ga0070676_10371765 | 3300005328 | Bacteria | 988 |
| 31 | Ga0070690_100024053 | 3300005330 | Bacteria | 3743 |
| 32 | Ga0070690_100040993 | 3300005330 | Bacteria | 2930 |
| 33 | Ga0070670_100000478 | 3300005331 | Bacteria | 32196 |
| 34 | Ga0070670_100084820 | 3300005331 | Bacteria | 2721 |
| 35 | Ga0070670_100314796 | 3300005331 | Bacteria | 1370 |
| 36 | Ga0070670_100658783 | 3300005331 | Bacteria | 939 |
| 37 | Ga0070677_10005408 | 3300005333 | Bacteria | 4207 |
| 38 | Ga0070677_10054323 | 3300005333 | Bacteria | 1631 |
| 39 | Ga0070677_10062364 | 3300005333 | Bacteria | 1542 |
| 40 | Ga0068869_100000634 | 3300005334 | Bacteria | 19860 |
| 41 | Ga0068869_100036853 | 3300005334 | Bacteria | 3474 |
| 42 | Ga0068869_100059355 | 3300005334 | Bacteria | 2800 |
| 43 | Ga0068869_100294646 | 3300005334 | Bacteria | 1308 |
| 44 | Ga0070666_10137532 | 3300005335 | Bacteria | 1700 |
| 45 | Ga0070680_100010188 | 3300005336 | Bacteria | 7248 |
| 46 | Ga0068868_100021554 | 3300005338 | Bacteria | 4853 |
| 47 | Ga0068868_100031391 | 3300005338 | Bacteria | 4080 |
| 48 | Ga0068868_100045362 | 3300005338 | Bacteria | 3438 |
| 49 | Ga0068868_100050237 | 3300005338 | Bacteria | 3274 |
| 50 | Ga0068868_100061100 | 3300005338 | Bacteria | 2985 |
| 51 | Ga0068868_100150905 | 3300005338 | Bacteria | 1914 |
| 52 | Ga0068868_100282754 | 3300005338 | Bacteria | 1405 |
| 53 | Ga0068868_100702040 | 3300005338 | Bacteria | 905 |
| 54 | Ga0070660_100023264 | 3300005339 | Bacteria | 4590 |
| 55 | Ga0070660_100024849 | 3300005339 | Bacteria | 4450 |
| 56 | Ga0070660_100028660 | 3300005339 | Bacteria | 4167 |
| 57 | Ga0070687_100167540 | 3300005343 | Bacteria | 1304 |
| 58 | Ga0070661_100015724 | 3300005344 | Bacteria | 5341 |
| 59 | Ga0070661_100035161 | 3300005344 | Bacteria | 3637 |
| 60 | Ga0070661_100151608 | 3300005344 | Bacteria | 1752 |
| 61 | Ga0070661_100180944 | 3300005344 | Bacteria | 1604 |
| 62 | Ga0070661_100275845 | 3300005344 | Bacteria | 1303 |
| 63 | Ga0070661_100285742 | 3300005344 | Bacteria | 1281 |
| 64 | Ga0070668_100015357 | 3300005347 | Bacteria | 5723 |
| 65 | Ga0070668_100100651 | 3300005347 | Bacteria | 2290 |
| 66 | Ga0070668_100104455 | 3300005347 | Bacteria | 2248 |
| 67 | Ga0070668_100231891 | 3300005347 | Bacteria | 1526 |
| 68 | Ga0070668_100438813 | 3300005347 | Bacteria | 1120 |
| 69 | Ga0070669_100008698 | 3300005353 | Bacteria | 7242 |
| 70 | Ga0070669_100019362 | 3300005353 | Bacteria | 4861 |
| 71 | Ga0070669_100019488 | 3300005353 | Bacteria | 4845 |
| 72 | Ga0070675_100008419 | 3300005354 | Bacteria | 8005 |
| 73 | Ga0070675_100008756 | 3300005354 | Bacteria | 7862 |
| 74 | Ga0070675_100018803 | 3300005354 | Bacteria | 5500 |
| 75 | Ga0070675_100062953 | 3300005354 | Bacteria | 3066 |
| 76 | Ga0070675_100066859 | 3300005354 | Bacteria | 2973 |
| 77 | Ga0070675_100072719 | 3300005354 | Bacteria | 2854 |
| 78 | Ga0070671_100001871 | 3300005355 | Bacteria | 16082 |
| 79 | Ga0070671_100022795 | 3300005355 | Bacteria | 5115 |
| 80 | Ga0070671_100023281 | 3300005355 | Bacteria | 5067 |
| 81 | Ga0070671_100081436 | 3300005355 | Bacteria | 2706 |
| 82 | Ga0070671_100115370 | 3300005355 | Bacteria | 2258 |
| 83 | Ga0070671_100146185 | 3300005355 | Bacteria | 1995 |
| 84 | Ga0070674_100002622 | 3300005356 | Bacteria | 9945 |
| 85 | Ga0070674_100052006 | 3300005356 | Bacteria | 2824 |
| 86 | Ga0070674_100240691 | 3300005356 | Bacteria | 1416 |
| 87 | Ga0070674_100418154 | 3300005356 | Bacteria | 1099 |
| 88 | Ga0070674_100757619 | 3300005356 | Bacteria | 835 |
| 89 | Ga0070673_100015622 | 3300005364 | Bacteria | 5339 |
| 90 | Ga0070673_100032060 | 3300005364 | Bacteria | 3951 |
| 91 | Ga0070673_100069782 | 3300005364 | Bacteria | 2818 |
| 92 | Ga0070673_100120597 | 3300005364 | Bacteria | 2187 |
| 93 | Ga0070673_100600895 | 3300005364 | Bacteria | 1003 |
| 94 | Ga0070673_100669018 | 3300005364 | Bacteria | 951 |
| 95 | Ga0070673_100693642 | 3300005364 | Bacteria | 935 |
| 96 | Ga0070659_100037361 | 3300005366 | Bacteria | 3785 |
| 97 | Ga0070659_100098873 | 3300005366 | Bacteria | 2346 |
| 98 | Ga0070659_100459730 | 3300005366 | Bacteria | 1081 |
| 99 | Ga0070667_100027101 | 3300005367 | Bacteria | 4768 |
| 100 | Ga0070667_100027115 | 3300005367 | Bacteria | 4767 |
| 101 | Ga0070667_100401941 | 3300005367 | Bacteria | 1247 |
| 102 | Ga0070667_100441293 | 3300005367 | Bacteria | 1189 |
| 103 | Ga0070667_100453833 | 3300005367 | Bacteria | 1171 |
| 104 | Ga0070663_100008101 | 3300005455 | Bacteria | 6445 |
| 105 | Ga0070663_100031838 | 3300005455 | Bacteria | 3629 |
| 106 | Ga0070663_100168412 | 3300005455 | Bacteria | 1691 |
| 107 | Ga0070663_100487599 | 3300005455 | Bacteria | 1021 |
| 108 | Ga0070678_100002166 | 3300005456 | Bacteria | 10662 |
| 109 | Ga0070678_100010391 | 3300005456 | Bacteria | 5683 |
| 110 | Ga0070678_100030242 | 3300005456 | Bacteria | 3721 |
| 111 | Ga0070678_100054351 | 3300005456 | Bacteria | 2917 |
| 112 | Ga0070678_100276857 | 3300005456 | Bacteria | 1417 |
| 113 | Ga0070662_100002819 | 3300005457 | Bacteria | 10782 |
| 114 | Ga0070662_100021597 | 3300005457 | Bacteria | 4397 |
| 115 | Ga0070662_100056699 | 3300005457 | Bacteria | 2845 |
| 116 | Ga0070662_100094061 | 3300005457 | Bacteria | 2256 |
| 117 | Ga0070662_100096724 | 3300005457 | Bacteria | 2227 |
| 118 | Ga0070681_11202621 | 3300005458 | Bacteria | 680 |
| 119 | Ga0068867_100001470 | 3300005459 | Bacteria | 16330 |
| 120 | Ga0068867_100002200 | 3300005459 | Bacteria | 13677 |
| 121 | Ga0068867_100003775 | 3300005459 | Bacteria | 10663 |
| 122 | Ga0068867_100049528 | 3300005459 | Bacteria | 3093 |
| 123 | Ga0068867_100140542 | 3300005459 | Bacteria | 1887 |
| 124 | Ga0068867_100384374 | 3300005459 | Bacteria | 1180 |
| 125 | Ga0068867_100579563 | 3300005459 | Bacteria | 976 |
| 126 | Ga0070685_10244394 | 3300005466 | Bacteria | 1186 |
| 127 | Ga0070706_100002689 | 3300005467 | Bacteria | 17802 |
| 128 | Ga0070707_100048312 | 3300005468 | Bacteria | 4077 |
| 129 | Ga0070699_100074494 | 3300005518 | Bacteria | 2954 |
| 130 | Ga0070679_100042692 | 3300005530 | Bacteria | 4516 |
| 131 | Ga0070684_100425217 | 3300005535 | Bacteria | 1226 |
| 132 | Ga0068853_100016063 | 3300005539 | Bacteria | 6156 |
| 133 | Ga0068853_100021509 | 3300005539 | Bacteria | 5381 |
| 134 | Ga0068853_100081187 | 3300005539 | Bacteria | 2838 |
| 135 | Ga0068853_100232642 | 3300005539 | Bacteria | 1686 |
| 136 | Ga0070672_100011507 | 3300005543 | Bacteria | 6172 |
| 137 | Ga0070672_100027376 | 3300005543 | Bacteria | 4251 |
| 138 | Ga0070672_100029940 | 3300005543 | Bacteria | 4086 |
| 139 | Ga0070672_100043972 | 3300005543 | Bacteria | 3448 |
| 140 | Ga0070672_100057372 | 3300005543 | Bacteria | 3056 |
| 141 | Ga0070672_100061536 | 3300005543 | Bacteria | 2960 |
| 142 | Ga0070672_100123380 | 3300005543 | Bacteria | 2123 |
| 143 | Ga0070672_100142144 | 3300005543 | Bacteria | 1980 |
| 144 | Ga0070672_100216190 | 3300005543 | Bacteria | 1607 |
| 145 | Ga0070672_100456144 | 3300005543 | Bacteria | 1101 |
| 146 | Ga0070686_100177666 | 3300005544 | Bacteria | 1510 |
| 147 | Ga0070693_100337299 | 3300005547 | Bacteria | 1028 |
| 148 | Ga0070665_100071804 | 3300005548 | Bacteria | 3468 |
| 149 | Ga0068855_100017005 | 3300005563 | Bacteria | 8746 |
| 150 | Ga0068855_100224045 | 3300005563 | Bacteria | 2108 |
| 151 | Ga0070664_100121906 | 3300005564 | Bacteria | 2284 |
| 152 | Ga0070664_100261449 | 3300005564 | Bacteria | 1557 |
| 153 | Ga0070664_100273003 | 3300005564 | Bacteria | 1523 |
| 154 | Ga0070664_100574884 | 3300005564 | Bacteria | 1044 |
| 155 | Ga0068857_100019168 | 3300005577 | Bacteria | 6005 |
| 156 | Ga0068857_100029410 | 3300005577 | Bacteria | 4848 |
| 157 | Ga0068857_100070843 | 3300005577 | Bacteria | 3106 |
| 158 | Ga0068857_100940600 | 3300005577 | Bacteria | 830 |
| 159 | Ga0068854_100064026 | 3300005578 | Bacteria | 2670 |
| 160 | Ga0068854_100075445 | 3300005578 | Bacteria | 2476 |
| 161 | Ga0068854_100851627 | 3300005578 | Bacteria | 798 |
| 162 | Ga0068856_100005428 | 3300005614 | Bacteria | 12566 |
| 163 | Ga0068856_100035104 | 3300005614 | Bacteria | 4913 |
| 164 | Ga0068856_100066292 | 3300005614 | Bacteria | 3568 |
| 165 | Ga0070702_100007031 | 3300005615 | Bacteria | 5367 |
| 166 | Ga0068852_100007345 | 3300005616 | Bacteria | 8039 |
| 167 | Ga0068852_100019874 | 3300005616 | Bacteria | 5327 |
| 168 | Ga0068852_100048007 | 3300005616 | Bacteria | 3646 |
| 169 | Ga0068852_100070412 | 3300005616 | Bacteria | 3068 |
| 170 | Ga0068852_100072637 | 3300005616 | Bacteria | 3024 |
| 171 | Ga0068852_100131954 | 3300005616 | Bacteria | 2301 |
| 172 | Ga0068852_100141402 | 3300005616 | Bacteria | 2228 |
| 173 | Ga0068852_100202546 | 3300005616 | Bacteria | 1879 |
| 174 | Ga0068852_100209998 | 3300005616 | Bacteria | 1846 |
| 175 | Ga0068852_100475216 | 3300005616 | Bacteria | 1241 |
| 176 | Ga0068859_100103529 | 3300005617 | Bacteria | 2905 |
| 177 | Ga0068859_100409930 | 3300005617 | Bacteria | 1451 |
| 178 | Ga0068859_100423449 | 3300005617 | Bacteria | 1427 |
| 179 | Ga0068859_100520157 | 3300005617 | Bacteria | 1285 |
| 180 | Ga0068864_100012808 | 3300005618 | Bacteria | 6934 |
| 181 | Ga0068864_100028203 | 3300005618 | Bacteria | 4743 |
| 182 | Ga0068864_100049705 | 3300005618 | Bacteria | 3608 |
| 183 | Ga0068864_100073504 | 3300005618 | Bacteria | 2981 |
| 184 | Ga0068864_100073529 | 3300005618 | Bacteria | 2981 |
| 185 | Ga0068864_100091527 | 3300005618 | Bacteria | 2683 |
| 186 | Ga0068866_10096372 | 3300005718 | Bacteria | 1622 |
| 187 | Ga0068861_100004781 | 3300005719 | Bacteria | 9099 |
| 188 | Ga0068861_100023310 | 3300005719 | Bacteria | 4464 |
| 189 | Ga0068851_10002615 | 3300005834 | Bacteria | 7940 |
| 190 | Ga0068851_10062217 | 3300005834 | Bacteria | 1915 |
| 191 | Ga0068870_10269817 | 3300005840 | Bacteria | 1062 |
| 192 | Ga0068863_100013409 | 3300005841 | Bacteria | 7902 |
| 193 | Ga0068863_100028725 | 3300005841 | Bacteria | 5310 |
| 194 | Ga0068863_100049664 | 3300005841 | Bacteria | 3977 |
| 195 | Ga0068863_100092225 | 3300005841 | Bacteria | 2873 |
| 196 | Ga0068863_100359569 | 3300005841 | Bacteria | 1419 |
| 197 | Ga0068863_100383229 | 3300005841 | Bacteria | 1373 |
| 198 | Ga0068863_100503523 | 3300005841 | Bacteria | 1193 |
| 199 | Ga0068858_100010595 | 3300005842 | Bacteria | 8726 |
| 200 | Ga0068858_100012601 | 3300005842 | Bacteria | 7970 |
| 201 | Ga0068858_100043397 | 3300005842 | Bacteria | 4169 |
| 202 | Ga0068858_100847395 | 3300005842 | Bacteria | 893 |
| 203 | Ga0068860_100010055 | 3300005843 | Bacteria | 9374 |
| 204 | Ga0068860_100018058 | 3300005843 | Bacteria | 6868 |
| 205 | Ga0068860_100088212 | 3300005843 | Bacteria | 2953 |
| 206 | Ga0068860_100218629 | 3300005843 | Bacteria | 1850 |
| 207 | Ga0068862_100009005 | 3300005844 | Bacteria | 8262 |
| 208 | Ga0068862_100090859 | 3300005844 | Bacteria | 2658 |
| 209 | Ga0075365_10007360 | 3300006038 | Bacteria | 6157 |
| 210 | Ga0075368_10016433 | 3300006042 | Bacteria | 2758 |
| 211 | Ga0075363_100029335 | 3300006048 | Bacteria | 2839 |
| 212 | Ga0075363_100371507 | 3300006048 | Bacteria | 837 |
| 213 | Ga0075364_10069251 | 3300006051 | Bacteria | 2321 |
| 214 | Ga0070715_10089594 | 3300006163 | Bacteria | 1413 |
| 215 | Ga0075362_10029489 | 3300006177 | Bacteria | 2364 |
| 216 | Ga0075362_10078577 | 3300006177 | Bacteria | 1518 |
| 217 | Ga0075367_10015422 | 3300006178 | Bacteria | 4153 |
| 218 | Ga0075367_10034354 | 3300006178 | Bacteria | 2929 |
| 219 | Ga0075367_10044180 | 3300006178 | Bacteria | 2611 |
| 220 | Ga0075367_10071327 | 3300006178 | Bacteria | 2089 |
| 221 | Ga0075366_10021476 | 3300006195 | Bacteria | 3752 |
| 222 | Ga0075366_10036496 | 3300006195 | Bacteria | 2898 |
| 223 | Ga0075366_10111760 | 3300006195 | Bacteria | 1644 |
| 224 | Ga0075366_10180353 | 3300006195 | Bacteria | 1283 |
| 225 | Ga0075366_10182494 | 3300006195 | Bacteria | 1275 |
| 226 | Ga0075366_10185650 | 3300006195 | Bacteria | 1263 |
| 227 | Ga0075366_10370037 | 3300006195 | Bacteria | 881 |
| 228 | Ga0097621_100008233 | 3300006237 | Bacteria | 7498 |
| 229 | Ga0097621_100111664 | 3300006237 | Bacteria | 2310 |
| 230 | Ga0097621_100674698 | 3300006237 | Bacteria | 950 |
| 231 | Ga0075370_10000458 | 3300006353 | Bacteria | 15179 |
| 232 | Ga0075370_10008466 | 3300006353 | Bacteria | 5294 |
| 233 | Ga0075370_10010753 | 3300006353 | Bacteria | 4796 |
| 234 | Ga0075370_10017335 | 3300006353 | Bacteria | 3891 |
| 235 | Ga0075370_10017842 | 3300006353 | Bacteria | 3840 |
| 236 | Ga0075370_10023514 | 3300006353 | Bacteria | 3394 |
| 237 | Ga0075370_10228548 | 3300006353 | Bacteria | 1101 |
| 238 | Ga0075370_10246120 | 3300006353 | Bacteria | 1059 |
| 239 | Ga0068871_100030930 | 3300006358 | Bacteria | 4218 |
| 240 | Ga0068871_100191154 | 3300006358 | Bacteria | 1763 |
| 241 | Ga0068871_100382984 | 3300006358 | Bacteria | 1250 |
| 242 | Ga0068871_100384613 | 3300006358 | Bacteria | 1247 |
| 243 | Ga0068871_100507279 | 3300006358 | Bacteria | 1088 |
| 244 | Ga0068865_100009609 | 3300006881 | Bacteria | 6003 |
| 245 | Ga0068865_100035934 | 3300006881 | Bacteria | 3336 |
| 246 | Ga0068865_100050251 | 3300006881 | Bacteria | 2879 |
| 247 | Ga0068865_100264158 | 3300006881 | Bacteria | 1364 |
| 248 | Ga0068865_100318483 | 3300006881 | Bacteria | 1250 |
| 249 | Ga0068865_100403086 | 3300006881 | Bacteria | 1121 |
| 250 | Ga0068865_100434981 | 3300006881 | Bacteria | 1081 |
| 251 | Ga0097620_100103528 | 3300006931 | Bacteria | 2905 |
| 252 | Ga0097620_100409949 | 3300006931 | Bacteria | 1451 |
| 253 | Ga0097620_100423454 | 3300006931 | Bacteria | 1427 |
| 254 | Ga0097620_100520154 | 3300006931 | Bacteria | 1285 |
| 255 | Ga0075435_100487563 | 3300007076 | Bacteria | 1065 |
| 256 | Ga0105240_10000805 | 3300009093 | Bacteria | 56899 |
| 257 | Ga0105240_10035322 | 3300009093 | Bacteria | 6442 |
| 258 | Ga0105240_10132016 | 3300009093 | Bacteria | 2995 |
| 259 | Ga0105240_10648100 | 3300009093 | Bacteria | 1158 |
| 260 | Ga0105240_10685837 | 3300009093 | Bacteria | 1120 |
| 261 | Ga0105240_10952085 | 3300009093 | Bacteria | 921 |
| 262 | Ga0105245_10036743 | 3300009098 | Bacteria | 4352 |
| 263 | Ga0105245_10116507 | 3300009098 | Bacteria | 2491 |
| 264 | Ga0105245_10353499 | 3300009098 | Bacteria | 1457 |
| 265 | Ga0105245_10602768 | 3300009098 | Bacteria | 1125 |
| 266 | Ga0105243_10019432 | 3300009148 | Bacteria | 5151 |
| 267 | Ga0105241_10090894 | 3300009174 | Bacteria | 2408 |
| 268 | Ga0105242_10172899 | 3300009176 | Bacteria | 1900 |
| 269 | Ga0105242_10223391 | 3300009176 | Bacteria | 1684 |
| 270 | Ga0105248_10042010 | 3300009177 | Bacteria | 5127 |
| 271 | Ga0105248_10072967 | 3300009177 | Bacteria | 3857 |
| 272 | Ga0105248_10107444 | 3300009177 | Bacteria | 3147 |
| 273 | Ga0105248_10237531 | 3300009177 | Bacteria | 2051 |
| 274 | Ga0105237_10004204 | 3300009545 | Bacteria | 16757 |
| 275 | Ga0105237_10142698 | 3300009545 | Bacteria | 2389 |
| 276 | Ga0105238_10004015 | 3300009551 | Bacteria | 14601 |
| 277 | Ga0105238_10073129 | 3300009551 | Bacteria | 3423 |
| 278 | Ga0105249_10066911 | 3300009553 | Bacteria | 3309 |
| 279 | Ga0105249_10148115 | 3300009553 | Bacteria | 2257 |
| 280 | Ga0105249_10882461 | 3300009553 | Bacteria | 961 |
| 281 | Ga0105239_10000952 | 3300010375 | Bacteria | 40803 |
| 282 | Ga0105239_10079253 | 3300010375 | Bacteria | 3614 |
| 283 | Ga0105239_10112198 | 3300010375 | Bacteria | 3023 |
| 284 | Ga0105239_10127813 | 3300010375 | Bacteria | 2825 |
| 285 | Ga0157319_1000017 | 3300012497 | Bacteria | 110340 |
| 286 | Ga0157371_10821537 | 3300013102 | Bacteria | 701 |
| 287 | Ga0157370_10704015 | 3300013104 | Bacteria | 922 |
| 288 | Ga0157369_10009904 | 3300013105 | Bacteria | 10891 |
| 289 | Ga0157374_10020489 | 3300013296 | Bacteria | 5867 |
| 290 | Ga0157374_10078210 | 3300013296 | Bacteria | 3132 |
| 291 | Ga0157374_10101087 | 3300013296 | Bacteria | 2764 |
| 292 | Ga0157374_10608683 | 3300013296 | Bacteria | 1103 |
| 293 | Ga0157378_10004202 | 3300013297 | Bacteria | 12713 |
| 294 | Ga0157378_10081708 | 3300013297 | Bacteria | 2921 |
| 295 | Ga0157378_10226365 | 3300013297 | Bacteria | 1780 |
| 296 | Ga0163162_10074541 | 3300013306 | Bacteria | 3452 |
| 297 | Ga0163162_10548411 | 3300013306 | Bacteria | 1284 |
| 298 | Ga0163162_10596273 | 3300013306 | Bacteria | 1231 |
| 299 | Ga0157372_10050406 | 3300013307 | Bacteria | 4631 |
| 300 | Ga0157372_10145075 | 3300013307 | Bacteria | 2737 |
| 301 | Ga0157375_10050831 | 3300013308 | Bacteria | 4067 |
| 302 | Ga0157375_10054470 | 3300013308 | Bacteria | 3939 |
| 303 | Ga0157375_10055271 | 3300013308 | Bacteria | 3914 |
| 304 | Ga0157375_10060927 | 3300013308 | Bacteria | 3745 |
| 305 | Ga0157375_10073139 | 3300013308 | Bacteria | 3447 |
| 306 | Ga0157375_10074306 | 3300013308 | Bacteria | 3421 |
| 307 | Ga0157375_10078179 | 3300013308 | Bacteria | 3341 |
| 308 | Ga0163163_10383691 | 3300014325 | Bacteria | 1463 |
| 309 | Ga0157380_10002952 | 3300014326 | Bacteria | 11572 |
| 310 | Ga0157380_10239707 | 3300014326 | Bacteria | 1634 |
| 311 | Ga0157380_10423719 | 3300014326 | Bacteria | 1270 |
| 312 | Ga0157380_10829052 | 3300014326 | Bacteria | 945 |
| 313 | Ga0157377_10014024 | 3300014745 | Bacteria | 4070 |
| 314 | Ga0157379_10010782 | 3300014968 | Bacteria | 7965 |
| 315 | Ga0157379_10014569 | 3300014968 | Bacteria | 6897 |
| 316 | Ga0157379_10049968 | 3300014968 | Bacteria | 3733 |
| 317 | Ga0157379_10167912 | 3300014968 | Bacteria | 1981 |
| 318 | Ga0157379_10203607 | 3300014968 | Bacteria | 1790 |
| 319 | Ga0157379_10240280 | 3300014968 | Bacteria | 1643 |
| 320 | Ga0157379_10336517 | 3300014968 | Bacteria | 1380 |
| 321 | Ga0157376_10008186 | 3300014969 | Bacteria | 7525 |
| 322 | Ga0157376_10031452 | 3300014969 | Bacteria | 4250 |
| 323 | Ga0157376_10045713 | 3300014969 | Bacteria | 3606 |
| 324 | Ga0157376_10355926 | 3300014969 | Bacteria | 1403 |
| 325 | Ga0157376_10407984 | 3300014969 | Bacteria | 1315 |
| 326 | Ga0157376_10586990 | 3300014969 | Bacteria | 1107 |
| 327 | Ga0163161_10021039 | 3300017792 | Bacteria | 4584 |
| 328 | Ga0163161_10164429 | 3300017792 | Bacteria | 1693 |
| 329 | Ga0163161_10183557 | 3300017792 | Bacteria | 1605 |
| 330 | Ga0163161_10300541 | 3300017792 | Bacteria | 1264 |
| 331 | Ga0163161_10508731 | 3300017792 | Bacteria | 982 |
| 332 | Ga0213872_10000099 | 3300021361 | Bacteria | 80083 |
| 333 | Ga0209674_100270 | 3300025226 | Bacteria | 39854 |
| 334 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 335 | Ga0209563_100178 | 3300025230 | Bacteria | 41597 |
| 336 | Ga0207427_102346 | 3300025231 | Bacteria | 5189 |
| 337 | Ga0209258_101449 | 3300025242 | Bacteria | 8301 |
| 338 | Ga0209646_1000625 | 3300025246 | Bacteria | 13479 |
| 339 | Ga0209026_1000328 | 3300025250 | Bacteria | 47719 |
| 340 | Ga0209677_100405 | 3300025253 | Bacteria | 25877 |
| 341 | Ga0209677_101001 | 3300025253 | Bacteria | 13635 |
| 342 | Ga0209759_1000448 | 3300025256 | Bacteria | 47719 |
| 343 | Ga0209759_1001400 | 3300025256 | Bacteria | 13808 |
| 344 | Ga0209759_1007453 | 3300025256 | Bacteria | 3516 |
| 345 | Ga0209673_1004161 | 3300025273 | Bacteria | 7912 |
| 346 | Ga0209256_1000249 | 3300025299 | Bacteria | 95279 |
| 347 | Ga0209256_1018429 | 3300025299 | Bacteria | 2269 |
| 348 | Ga0209051_1015479 | 3300025303 | Bacteria | 3505 |
| 349 | Ga0209257_1002034 | 3300025304 | Bacteria | 21566 |
| 350 | Ga0207656_10117867 | 3300025321 | Bacteria | 1233 |
| 351 | Ga0207656_10266704 | 3300025321 | Bacteria | 842 |
| 352 | Ga0207682_10002372 | 3300025893 | Bacteria | 8479 |
| 353 | Ga0207682_10027149 | 3300025893 | Bacteria | 2278 |
| 354 | Ga0207642_10080340 | 3300025899 | Bacteria | 1581 |
| 355 | Ga0207642_10131020 | 3300025899 | Bacteria | 1309 |
| 356 | Ga0207688_10215877 | 3300025901 | Bacteria | 1154 |
| 357 | Ga0207688_10373940 | 3300025901 | Bacteria | 881 |
| 358 | Ga0207680_10036656 | 3300025903 | Bacteria | 2825 |
| 359 | Ga0207680_10172534 | 3300025903 | Bacteria | 1457 |
| 360 | Ga0207645_10003150 | 3300025907 | Bacteria | 12634 |
| 361 | Ga0207645_10014078 | 3300025907 | Bacteria | 5360 |
| 362 | Ga0207645_10033581 | 3300025907 | Bacteria | 3297 |
| 363 | Ga0207645_10054125 | 3300025907 | Bacteria | 2563 |
| 364 | Ga0207645_10157636 | 3300025907 | Bacteria | 1484 |
| 365 | Ga0207645_10227986 | 3300025907 | Bacteria | 1229 |
| 366 | Ga0207643_10049299 | 3300025908 | Bacteria | 2386 |
| 367 | Ga0207705_10123308 | 3300025909 | Bacteria | 1924 |
| 368 | Ga0207705_10128701 | 3300025909 | Bacteria | 1883 |
| 369 | Ga0207684_10032813 | 3300025910 | Bacteria | 4415 |
| 370 | Ga0207695_10011633 | 3300025913 | Bacteria | 10639 |
| 371 | Ga0207695_10114027 | 3300025913 | Bacteria | 2678 |
| 372 | Ga0207695_10436998 | 3300025913 | Bacteria | 1192 |
| 373 | Ga0207671_10005118 | 3300025914 | Bacteria | 12217 |
| 374 | Ga0207671_10168257 | 3300025914 | Bacteria | 1701 |
| 375 | Ga0207662_10031228 | 3300025918 | Bacteria | 3094 |
| 376 | Ga0207657_10035144 | 3300025919 | Bacteria | 4497 |
| 377 | Ga0207657_10534877 | 3300025919 | Bacteria | 917 |
| 378 | Ga0207649_10038271 | 3300025920 | Bacteria | 2903 |
| 379 | Ga0207649_10232881 | 3300025920 | Bacteria | 1318 |
| 380 | Ga0207649_10376559 | 3300025920 | Bacteria | 1057 |
| 381 | Ga0207652_10011724 | 3300025921 | Bacteria | 7075 |
| 382 | Ga0207652_10410006 | 3300025921 | Bacteria | 1222 |
| 383 | Ga0207646_10434402 | 3300025922 | Bacteria | 1185 |
| 384 | Ga0207681_10028283 | 3300025923 | Bacteria | 3630 |
| 385 | Ga0207681_10066226 | 3300025923 | Bacteria | 2500 |
| 386 | Ga0207681_10306570 | 3300025923 | Bacteria | 1258 |
| 387 | Ga0207681_10459464 | 3300025923 | Bacteria | 1037 |
| 388 | Ga0207694_10025002 | 3300025924 | Bacteria | 4538 |
| 389 | Ga0207694_10113996 | 3300025924 | Bacteria | 2152 |
| 390 | Ga0207694_10405919 | 3300025924 | Bacteria | 1133 |
| 391 | Ga0207650_10004285 | 3300025925 | Bacteria | 9736 |
| 392 | Ga0207650_10006028 | 3300025925 | Bacteria | 8271 |
| 393 | Ga0207650_10052624 | 3300025925 | Bacteria | 3016 |
| 394 | Ga0207650_10270191 | 3300025925 | Bacteria | 1382 |
| 395 | Ga0207659_10001020 | 3300025926 | Bacteria | 16646 |
| 396 | Ga0207659_10081845 | 3300025926 | Bacteria | 2388 |
| 397 | Ga0207659_10101692 | 3300025926 | Bacteria | 2168 |
| 398 | Ga0207659_10524011 | 3300025926 | Bacteria | 1005 |
| 399 | Ga0207659_10764822 | 3300025926 | Bacteria | 829 |
| 400 | Ga0207659_10839196 | 3300025926 | Bacteria | 790 |
| 401 | Ga0207687_10041074 | 3300025927 | Bacteria | 3174 |
| 402 | Ga0207687_10370327 | 3300025927 | Bacteria | 1171 |
| 403 | Ga0207644_10002869 | 3300025931 | Bacteria | 11110 |
| 404 | Ga0207644_10054254 | 3300025931 | Bacteria | 2886 |
| 405 | Ga0207644_10133510 | 3300025931 | Bacteria | 1903 |
| 406 | Ga0207644_10140636 | 3300025931 | Bacteria | 1858 |
| 407 | Ga0207644_10211862 | 3300025931 | Bacteria | 1532 |
| 408 | Ga0207644_10653531 | 3300025931 | Bacteria | 875 |
| 409 | Ga0207690_10056681 | 3300025932 | Bacteria | 2644 |
| 410 | Ga0207706_10005697 | 3300025933 | Bacteria | 11606 |
| 411 | Ga0207706_10010641 | 3300025933 | Bacteria | 8401 |
| 412 | Ga0207706_10013190 | 3300025933 | Bacteria | 7519 |
| 413 | Ga0207706_10025074 | 3300025933 | Bacteria | 5345 |
| 414 | Ga0207706_10133424 | 3300025933 | Bacteria | 2184 |
| 415 | Ga0207706_10238601 | 3300025933 | Bacteria | 1589 |
| 416 | Ga0207706_10289177 | 3300025933 | Bacteria | 1429 |
| 417 | Ga0207706_10422615 | 3300025933 | Bacteria | 1155 |
| 418 | Ga0207686_10104859 | 3300025934 | Bacteria | 1895 |
| 419 | Ga0207709_10031682 | 3300025935 | Bacteria | 3090 |
| 420 | Ga0207709_10189072 | 3300025935 | Bacteria | 1461 |
| 421 | Ga0207670_10059890 | 3300025936 | Bacteria | 2592 |
| 422 | Ga0207669_10016651 | 3300025937 | Bacteria | 3742 |
| 423 | Ga0207669_10119817 | 3300025937 | Bacteria | 1783 |
| 424 | Ga0207669_10154774 | 3300025937 | Bacteria | 1611 |
| 425 | Ga0207669_10213210 | 3300025937 | Bacteria | 1411 |
| 426 | Ga0207669_10918738 | 3300025937 | Bacteria | 732 |
| 427 | Ga0207704_10031465 | 3300025938 | Bacteria | 2990 |
| 428 | Ga0207704_10080533 | 3300025938 | Bacteria | 2103 |
| 429 | Ga0207704_10090514 | 3300025938 | Bacteria | 2008 |
| 430 | Ga0207704_10155777 | 3300025938 | Bacteria | 1619 |
| 431 | Ga0207704_10198622 | 3300025938 | Bacteria | 1466 |
| 432 | Ga0207704_10406945 | 3300025938 | Bacteria | 1075 |
| 433 | Ga0207704_10620604 | 3300025938 | Bacteria | 887 |
| 434 | Ga0207691_10018937 | 3300025940 | Bacteria | 6522 |
| 435 | Ga0207691_10041148 | 3300025940 | Bacteria | 4268 |
| 436 | Ga0207691_10046734 | 3300025940 | Bacteria | 3976 |
| 437 | Ga0207691_10049285 | 3300025940 | Bacteria | 3858 |
| 438 | Ga0207691_10057157 | 3300025940 | Bacteria | 3552 |
| 439 | Ga0207691_10070461 | 3300025940 | Bacteria | 3157 |
| 440 | Ga0207691_10109338 | 3300025940 | Bacteria | 2459 |
| 441 | Ga0207691_10152760 | 3300025940 | Bacteria | 2029 |
| 442 | Ga0207691_10161234 | 3300025940 | Bacteria | 1967 |
| 443 | Ga0207691_10171931 | 3300025940 | Bacteria | 1897 |
| 444 | Ga0207691_10260652 | 3300025940 | Bacteria | 1494 |
| 445 | Ga0207711_10016105 | 3300025941 | Bacteria | 6206 |
| 446 | Ga0207711_10028530 | 3300025941 | Bacteria | 4697 |
| 447 | Ga0207711_10066785 | 3300025941 | Bacteria | 3111 |
| 448 | Ga0207711_10167208 | 3300025941 | Bacteria | 1994 |
| 449 | Ga0207711_10410966 | 3300025941 | Bacteria | 1258 |
| 450 | Ga0207689_10000343 | 3300025942 | Bacteria | 43547 |
| 451 | Ga0207689_10036619 | 3300025942 | Bacteria | 4073 |
| 452 | Ga0207689_10072103 | 3300025942 | Bacteria | 2837 |
| 453 | Ga0207689_10226775 | 3300025942 | Bacteria | 1544 |
| 454 | Ga0207661_10131420 | 3300025944 | Bacteria | 2145 |
| 455 | Ga0207661_10193401 | 3300025944 | Bacteria | 1785 |
| 456 | Ga0207679_10179276 | 3300025945 | Bacteria | 1751 |
| 457 | Ga0207667_10008525 | 3300025949 | Bacteria | 12170 |
| 458 | Ga0207667_10087092 | 3300025949 | Bacteria | 3231 |
| 459 | Ga0207667_10126130 | 3300025949 | Bacteria | 2636 |
| 460 | Ga0207651_10021440 | 3300025960 | Bacteria | 3927 |
| 461 | Ga0207651_10040657 | 3300025960 | Bacteria | 3079 |
| 462 | Ga0207651_10042473 | 3300025960 | Bacteria | 3026 |
| 463 | Ga0207651_10065414 | 3300025960 | Bacteria | 2550 |
| 464 | Ga0207651_10099298 | 3300025960 | Bacteria | 2155 |
| 465 | Ga0207651_10113733 | 3300025960 | Bacteria | 2037 |
| 466 | Ga0207651_10185827 | 3300025960 | Bacteria | 1653 |
| 467 | Ga0207712_10026038 | 3300025961 | Bacteria | 3893 |
| 468 | Ga0207668_10024199 | 3300025972 | Bacteria | 3915 |
| 469 | Ga0207668_10109831 | 3300025972 | Bacteria | 2067 |
| 470 | Ga0207668_10111433 | 3300025972 | Bacteria | 2054 |
| 471 | Ga0207668_10247932 | 3300025972 | Bacteria | 1445 |
| 472 | Ga0207668_10265382 | 3300025972 | Bacteria | 1401 |
| 473 | Ga0207640_10285872 | 3300025981 | Bacteria | 1298 |
| 474 | Ga0207640_10329642 | 3300025981 | Bacteria | 1219 |
| 475 | Ga0207640_10733264 | 3300025981 | Bacteria | 850 |
| 476 | Ga0207640_10848153 | 3300025981 | Bacteria | 795 |
| 477 | Ga0207658_10010730 | 3300025986 | Bacteria | 6228 |
| 478 | Ga0207658_10017106 | 3300025986 | Bacteria | 4993 |
| 479 | Ga0207658_10088920 | 3300025986 | Bacteria | 2390 |
| 480 | Ga0207658_10092939 | 3300025986 | Bacteria | 2344 |
| 481 | Ga0207658_10379874 | 3300025986 | Bacteria | 1237 |
| 482 | Ga0207677_10012138 | 3300026023 | Bacteria | 4939 |
| 483 | Ga0207677_10025612 | 3300026023 | Bacteria | 3683 |
| 484 | Ga0207677_10039592 | 3300026023 | Bacteria | 3101 |
| 485 | Ga0207677_10042753 | 3300026023 | Bacteria | 3007 |
| 486 | Ga0207677_10170697 | 3300026023 | Bacteria | 1700 |
| 487 | Ga0207677_10306067 | 3300026023 | Bacteria | 1315 |
| 488 | Ga0207703_10012605 | 3300026035 | Bacteria | 6591 |
| 489 | Ga0207703_10052512 | 3300026035 | Bacteria | 3310 |
| 490 | Ga0207703_10069221 | 3300026035 | Bacteria | 2910 |
| 491 | Ga0207639_10024945 | 3300026041 | Bacteria | 4332 |
| 492 | Ga0207639_10071971 | 3300026041 | Bacteria | 2706 |
| 493 | Ga0207639_10072618 | 3300026041 | Bacteria | 2695 |
| 494 | Ga0207639_10319221 | 3300026041 | Bacteria | 1379 |
| 495 | Ga0207639_10385519 | 3300026041 | Bacteria | 1259 |
| 496 | Ga0207678_10006858 | 3300026067 | Bacteria | 10099 |
| 497 | Ga0207678_10017049 | 3300026067 | Bacteria | 6378 |
| 498 | Ga0207678_10045799 | 3300026067 | Bacteria | 3782 |
| 499 | Ga0207678_10230991 | 3300026067 | Bacteria | 1584 |
| 500 | Ga0207678_10263660 | 3300026067 | Bacteria | 1477 |
| 501 | Ga0207708_10013215 | 3300026075 | Bacteria | 6164 |
| 502 | Ga0207708_10037030 | 3300026075 | Bacteria | 3716 |
| 503 | Ga0207702_10001082 | 3300026078 | Bacteria | 27904 |
| 504 | Ga0207702_10023275 | 3300026078 | Bacteria | 5136 |
| 505 | Ga0207702_10627028 | 3300026078 | Bacteria | 1056 |
| 506 | Ga0207641_10007434 | 3300026088 | Bacteria | 9114 |
| 507 | Ga0207641_10015971 | 3300026088 | Bacteria | 6147 |
| 508 | Ga0207641_10018421 | 3300026088 | Bacteria | 5725 |
| 509 | Ga0207641_10074815 | 3300026088 | Bacteria | 2923 |
| 510 | Ga0207641_10149902 | 3300026088 | Bacteria | 2111 |
| 511 | Ga0207641_10355625 | 3300026088 | Bacteria | 1397 |
| 512 | Ga0207641_11093883 | 3300026088 | Bacteria | 795 |
| 513 | Ga0207648_10002442 | 3300026089 | Bacteria | 19978 |
| 514 | Ga0207648_10007746 | 3300026089 | Bacteria | 10495 |
| 515 | Ga0207648_10015728 | 3300026089 | Bacteria | 6942 |
| 516 | Ga0207648_10033178 | 3300026089 | Bacteria | 4554 |
| 517 | Ga0207648_10057288 | 3300026089 | Bacteria | 3399 |
| 518 | Ga0207648_10091987 | 3300026089 | Bacteria | 2652 |
| 519 | Ga0207648_10270460 | 3300026089 | Bacteria | 1518 |
| 520 | Ga0207648_10325212 | 3300026089 | Bacteria | 1382 |
| 521 | Ga0207648_10407293 | 3300026089 | Bacteria | 1233 |
| 522 | Ga0207648_10633928 | 3300026089 | Bacteria | 987 |
| 523 | Ga0207648_10689681 | 3300026089 | Bacteria | 946 |
| 524 | Ga0207648_10794037 | 3300026089 | Bacteria | 881 |
| 525 | Ga0207676_10019060 | 3300026095 | Bacteria | 4999 |
| 526 | Ga0207676_10040116 | 3300026095 | Bacteria | 3586 |
| 527 | Ga0207676_10098344 | 3300026095 | Bacteria | 2419 |
| 528 | Ga0207676_10120794 | 3300026095 | Bacteria | 2209 |
| 529 | Ga0207676_10147254 | 3300026095 | Bacteria | 2023 |
| 530 | Ga0207676_10307872 | 3300026095 | Bacteria | 1449 |
| 531 | Ga0207674_10014024 | 3300026116 | Bacteria | 8858 |
| 532 | Ga0207674_10019423 | 3300026116 | Bacteria | 7358 |
| 533 | Ga0207674_10143532 | 3300026116 | Bacteria | 2346 |
| 534 | Ga0207674_10245600 | 3300026116 | Bacteria | 1737 |
| 535 | Ga0207674_10844564 | 3300026116 | Bacteria | 883 |
| 536 | Ga0207675_100000232 | 3300026118 | Bacteria | 52682 |
| 537 | Ga0207675_100007916 | 3300026118 | Bacteria | 10018 |
| 538 | Ga0207675_100053609 | 3300026118 | Bacteria | 3763 |
| 539 | Ga0207675_100722377 | 3300026118 | Bacteria | 1006 |
| 540 | Ga0207683_10003913 | 3300026121 | Bacteria | 12911 |
| 541 | Ga0207683_10029209 | 3300026121 | Bacteria | 4773 |
| 542 | Ga0207683_10046420 | 3300026121 | Bacteria | 3801 |
| 543 | Ga0207683_10107610 | 3300026121 | Bacteria | 2494 |
| 544 | Ga0207683_10172792 | 3300026121 | Bacteria | 1958 |
| 545 | Ga0207683_10597073 | 3300026121 | Bacteria | 1022 |
| 546 | Ga0207683_10970148 | 3300026121 | Bacteria | 789 |
| 547 | Ga0207698_10010596 | 3300026142 | Bacteria | 5936 |
| 548 | Ga0207698_10040003 | 3300026142 | Bacteria | 3478 |
| 549 | Ga0207698_10104453 | 3300026142 | Bacteria | 2357 |
| 550 | Ga0207698_10105156 | 3300026142 | Bacteria | 2351 |
| 551 | Ga0207698_10164476 | 3300026142 | Bacteria | 1945 |
| 552 | Ga0207698_10302496 | 3300026142 | Bacteria | 1489 |
| 553 | Ga0207698_11196430 | 3300026142 | Bacteria | 774 |
| 554 | Ga0209995_1043284 | 3300027471 | Bacteria | 761 |
| 555 | Ga0209999_1055400 | 3300027543 | Bacteria | 752 |
| 556 | Ga0209966_1000031 | 3300027695 | Bacteria | 63685 |
| 557 | Ga0268266_10061891 | 3300028379 | Bacteria | 3228 |
| 558 | Ga0268266_10125877 | 3300028379 | Bacteria | 2287 |
| 559 | Ga0268265_10253132 | 3300028380 | Bacteria | 1561 |
| 560 | Ga0268264_10010106 | 3300028381 | Bacteria | 7809 |
| 561 | Ga0268264_10034250 | 3300028381 | Bacteria | 4176 |
| 562 | Ga0268264_10081280 | 3300028381 | Bacteria | 2769 |
| 563 | Ga0268264_10435358 | 3300028381 | Bacteria | 1267 |
| 564 | Ga0268264_10448371 | 3300028381 | Bacteria | 1250 |
| 565 | Ga0307517_10000150 | 3300028786 | Bacteria | 110446 |
| 566 | Ga0307517_10058977 | 3300028786 | Bacteria | 3685 |
| 567 | Ga0307517_10087774 | 3300028786 | Bacteria | 2580 |
| 568 | Ga0307517_10170316 | 3300028786 | Bacteria | 1433 |
| 569 | Ga0307517_10220648 | 3300028786 | Bacteria | 1153 |
| 570 | Ga0307515_10000041 | 3300028794 | Bacteria | 319110 |
| 571 | Ga0307515_10000187 | 3300028794 | Bacteria | 151904 |
| 572 | Ga0307515_10005750 | 3300028794 | Bacteria | 25055 |
| 573 | Ga0307515_10011291 | 3300028794 | Bacteria | 16957 |
| 574 | Ga0307515_10034288 | 3300028794 | Bacteria | 8319 |
| 575 | Ga0307515_10132464 | 3300028794 | Bacteria | 2735 |
| 576 | Ga0307515_10145113 | 3300028794 | Bacteria | 2519 |
| 577 | Ga0307512_10078454 | 3300030522 | Bacteria | 2393 |
| 578 | Ga0307513_10012452 | 3300031456 | Bacteria | 10493 |
| 579 | Ga0307513_10193759 | 3300031456 | Bacteria | 1881 |
| 580 | Ga0307509_10000092 | 3300031507 | Bacteria | 124019 |
| 581 | Ga0307509_10028720 | 3300031507 | Bacteria | 6181 |
| 582 | Ga0307509_10039307 | 3300031507 | Bacteria | 5155 |
| 583 | Ga0307509_10070268 | 3300031507 | Bacteria | 3657 |
| 584 | Ga0307509_10120786 | 3300031507 | Bacteria | 2598 |
| 585 | Ga0307408_100164821 | 3300031548 | Bacteria | 1764 |
| 586 | Ga0307408_100484463 | 3300031548 | Bacteria | 1080 |
| 587 | Ga0307508_10052658 | 3300031616 | Bacteria | 3613 |
| 588 | Ga0307508_10078713 | 3300031616 | Bacteria | 2877 |
| 589 | Ga0307508_10433756 | 3300031616 | Bacteria | 906 |
| 590 | Ga0307514_10001419 | 3300031649 | Bacteria | 29520 |
| 591 | Ga0307514_10024537 | 3300031649 | Bacteria | 4880 |
| 592 | Ga0307514_10214223 | 3300031649 | Bacteria | 1191 |
| 593 | Ga0307516_10000181 | 3300031730 | Bacteria | 81531 |
| 594 | Ga0307516_10000720 | 3300031730 | Bacteria | 45106 |
| 595 | Ga0307516_10005702 | 3300031730 | Bacteria | 14762 |
| 596 | Ga0307516_10149379 | 3300031730 | Bacteria | 2099 |
| 597 | Ga0307516_10318104 | 3300031730 | Bacteria | 1228 |
| 598 | Ga0307412_11214833 | 3300031911 | Bacteria | 675 |
| 599 | Ga0307416_100448605 | 3300032002 | Bacteria | 1342 |
| 600 | Ga0307507_10055456 | 3300033179 | Bacteria | 3756 |
| 601 | Ga0307510_10001753 | 3300033180 | Bacteria | 24194 |
| 602 | Ga0307510_10010098 | 3300033180 | Bacteria | 11225 |
| 603 | Ga0307510_10058183 | 3300033180 | Bacteria | 4005 |
| 604 | Ga0307510_10223972 | 3300033180 | Bacteria | 1389 |
| 605 | Ga0373959_0043176 | 3300034820 | Bacteria | 953 |
| 606 | Ga0373938_0112521 | 3300034957 | Bacteria | 694 |
| 607 | Ga0373934_0010718 | 3300035086 | Bacteria | 3441 |
| 608 | Ga0373940_0053505 | 3300035088 | Bacteria | 1139 |
| 609 | Ga0373944_0079050 | 3300035089 | Bacteria | 1083 |
| 610 | Ga0373949_0055560 | 3300035090 | Bacteria | 1007 |
| 611 | Ga0373957_0078029 | 3300035120 | Bacteria | 1304 |
| 612 | Ga0373960_0086552 | 3300035121 | Bacteria | 996 |
| 613 | Ga0373943_0203775 | 3300035170 | Bacteria | 1096 |
| 614 | Ga0373943_0350208 | 3300035170 | Bacteria | 846 |
| 615 | Ga0373955_0110189 | 3300035172 | Bacteria | 1591 |
| 616 | Ga0373955_0122888 | 3300035172 | Bacteria | 1510 |
| 617 | Ga0373961_0123503 | 3300035241 | Bacteria | 860 |
| 618 | Ga0373931_0003424 | 3300035691 | Bacteria | 7122 |
| 619 | Ga0373931_0009919 | 3300035691 | Bacteria | 4564 |
| 620 | Ga0373931_0605889 | 3300035691 | Bacteria | 716 |
| 621 | Ga0373935_0571463 | 3300035692 | Bacteria | 825 |
| 622 | Ga0373927_0136149 | 3300035695 | Bacteria | 1605 |
| 623 | Ga0373937_0727323 | 3300036401 | Bacteria | 939 |
| 624 | Ga0373925_0021850 | 3300037068 | Bacteria | 4665 |
| 625 | Ga0395900_0000109 | 3300037418 | Bacteria | 146053 |
| 626 | Ga0395898_0001529 | 3300037466 | Bacteria | 31848 |
| 627 | Ga0395905_0007151 | 3300037471 | Bacteria | 11155 |
| 628 | Ga0395905_0019669 | 3300037471 | Bacteria | 6399 |
| 629 | Ga0395905_0027072 | 3300037471 | Bacteria | 5406 |
| 630 | Ga0395905_0042101 | 3300037471 | Bacteria | 4285 |
| 631 | Ga0395905_0045108 | 3300037471 | Bacteria | 4135 |
| 632 | Ga0436365_0276042 | 3300039437 | Bacteria | 1345 |
| 633 | Ga0436361_0048138 | 3300039447 | Bacteria | 5462 |
| 634 | Ga0436361_0720979 | 3300039447 | Bacteria | 74253 |
| 635 | Ga0436361_0831660 | 3300039447 | Bacteria | 731 |
| 636 | Ga0436363_0739873 | 3300039450 | Bacteria | 1773 |
| 637 | Ga0451804_0085032 | 3300041463 | Bacteria | 1134 |
| 638 | Ga0451833_0991326 | 3300041491 | Bacteria | 742 |
| 639 | Ga0451839_1168416 | 3300041496 | Bacteria | 1316 |
| 640 | Ga0451843_1080642 | 3300041509 | Bacteria | 1072 |
| 641 | Ga0451853_1508532 | 3300041512 | Bacteria | 680 |
| 642 | Ga0451853_3440584 | 3300041512 | Bacteria | 1254 |
| 643 | Ga0439449_0205659 | 3300042007 | Bacteria | 737 |
| 644 | Ga0439454_021318 | 3300042011 | Bacteria | 957 |
| 645 | Ga0439462_0110993 | 3300042015 | Bacteria | 759 |
| 646 | Ga0450890_001619 | 3300042127 | Bacteria | 3231 |
| 647 | Ga0439459_0000861 | 3300042438 | Bacteria | 4232 |
| 648 | Ga0451577_0000877 | 3300042876 | Bacteria | 44614 |
| 649 | Ga0451577_0031026 | 3300042876 | Bacteria | 4824 |
| 650 | Ga0451577_0079292 | 3300042876 | Bacteria | 2928 |
| 651 | Ga0451577_0288645 | 3300042876 | Bacteria | 1487 |
| 652 | Ga0466969_0000228 | 3300044656 | Bacteria | 30604 |
| 653 | Ga0466969_0002471 | 3300044656 | Bacteria | 9868 |
| 654 | Ga0466969_0101781 | 3300044656 | Bacteria | 1351 |
| 655 | Ga0466972_0000570 | 3300044658 | Bacteria | 17989 |
| 656 | Ga0466972_0021412 | 3300044658 | Bacteria | 3222 |
| 657 | Ga0466965_0048338 | 3300044683 | Bacteria | 2107 |
| 658 | Ga0466966_0002199 | 3300044684 | Bacteria | 12670 |
| 659 | Ga0466966_0046271 | 3300044684 | Bacteria | 2779 |
| 660 | Ga0466961_0007260 | 3300044693 | Bacteria | 7050 |
| 661 | Ga0466961_0095907 | 3300044693 | Bacteria | 1870 |
| 662 | Ga0466961_0114823 | 3300044693 | Bacteria | 1692 |
| 663 | Ga0466963_0001246 | 3300044694 | Bacteria | 13464 |
| 664 | Ga0466964_0000493 | 3300044706 | Bacteria | 12239 |
| 665 | Ga0453684_0011227 | 3300044712 | Bacteria | 15077 |
| 666 | Ga0453684_0515157 | 3300044712 | Bacteria | 1322 |
| 667 | Ga0466971_0005061 | 3300044719 | Bacteria | 5710 |
| 668 | Ga0466971_0283345 | 3300044719 | Bacteria | 793 |
| 669 | Ga0466968_0035334 | 3300044735 | Bacteria | 2091 |
| 670 | Ga0466970_0017512 | 3300044765 | Bacteria | 3702 |
| 671 | Ga0466957_0027573 | 3300044842 | Bacteria | 3376 |
| 672 | Ga0466960_0020740 | 3300044901 | Bacteria | 2916 |
| 673 | Ga0466960_0139588 | 3300044901 | Bacteria | 1286 |
| 674 | Ga0466959_0007627 | 3300045049 | Bacteria | 7605 |
| 675 | Ga0466959_0042147 | 3300045049 | Bacteria | 3367 |
| 676 | Ga0466959_0043963 | 3300045049 | Bacteria | 3291 |
| 677 | Ga0451576_0017247 | 3300045051 | Bacteria | 7943 |
| 678 | Ga0451576_0130115 | 3300045051 | Bacteria | 2623 |
| 679 | Ga0451576_0426833 | 3300045051 | Bacteria | 1391 |
| 680 | Ga0451576_1072218 | 3300045051 | Bacteria | 843 |
| 681 | Ga0451576_1222631 | 3300045051 | Bacteria | 784 |
| 682 | Ga0466958_0331521 | 3300045836 | Bacteria | 978 |
| 683 | Ga0466967_0066436 | 3300045976 | Bacteria | 3213 |
| 684 | Ga0495592_0005162 | 3300046454 | Bacteria | 9626 |
| 685 | Ga0495590_0012205 | 3300046457 | Bacteria | 3194 |
| 686 | Ga0495629_0080896 | 3300046459 | Bacteria | 2268 |
| 687 | Ga0495638_0054986 | 3300046460 | Bacteria | 2473 |
| 688 | Ga0495653_0439764 | 3300046463 | Bacteria | 822 |
| 689 | Ga0495580_0432022 | 3300046472 | Bacteria | 885 |
| 690 | Ga0495582_0058973 | 3300046473 | Bacteria | 2117 |
| 691 | Ga0495585_0014070 | 3300046492 | Bacteria | 4671 |
| 692 | Ga0495608_0337694 | 3300046511 | Bacteria | 929 |
| 693 | Ga0495610_0163277 | 3300046512 | Bacteria | 940 |
| 694 | Ga0495666_0071446 | 3300046526 | Bacteria | 1650 |
| 695 | Ga0495652_0628138 | 3300046529 | Bacteria | 730 |
| 696 | Ga0495586_0037906 | 3300046535 | Bacteria | 2588 |
| 697 | Ga0495598_0022882 | 3300046537 | Bacteria | 1677 |
| 698 | Ga0495598_0067240 | 3300046537 | Bacteria | 1120 |
| 699 | Ga0495668_0506913 | 3300046616 | Bacteria | 665 |
| 700 | Ga0495647_0046336 | 3300046681 | Bacteria | 1674 |
| 701 | Ga0495658_0041962 | 3300046683 | Bacteria | 2552 |
| 702 | Ga0495658_0088969 | 3300046683 | Bacteria | 1826 |
| 703 | Ga0495658_0118597 | 3300046683 | Bacteria | 1598 |
| 704 | Ga0495658_0419848 | 3300046683 | Bacteria | 853 |
| 705 | Ga0495670_0046274 | 3300046691 | Bacteria | 2173 |
| 706 | Ga0495671_0214410 | 3300046692 | Bacteria | 933 |
| 707 | Ga0495660_0037192 | 3300046810 | Bacteria | 2712 |
| 708 | Ga0495581_0135561 | 3300047315 | Bacteria | 1435 |
| 709 | Ga0495687_000799 | 3300047443 | Bacteria | 33916 |
| 710 | Ga0495602_0396162 | 3300048088 | Bacteria | 986 |
| 711 | Ga0496100_0286051 | 3300048903 | Bacteria | 1230 |
| 712 | Ga0496101_0023149 | 3300048904 | Bacteria | 4287 |
| 713 | Ga0496102_0089337 | 3300048905 | Bacteria | 2850 |
| 714 | Ga0496103_0060726 | 3300048906 | Bacteria | 2350 |
| 715 | Ga0496105_0283982 | 3300048908 | Bacteria | 1334 |
| 716 | Ga0496106_0041031 | 3300048909 | Bacteria | 3467 |
| 717 | Ga0496108_0030613 | 3300048911 | Bacteria | 4460 |
| 718 | Ga0496108_0159048 | 3300048911 | Bacteria | 1952 |
| 719 | Ga0496108_0186440 | 3300048911 | Bacteria | 1797 |
| 720 | Ga0496109_0285083 | 3300048912 | Bacteria | 1557 |
| 721 | Ga0496109_0482447 | 3300048912 | Bacteria | 1170 |
| 722 | Ga0496110_0030176 | 3300048913 | Bacteria | 4672 |
| 723 | Ga0496111_0051890 | 3300048914 | Bacteria | 2961 |
| 724 | Ga0496114_0142909 | 3300048917 | Bacteria | 2073 |
| 725 | Ga0496114_0275012 | 3300048917 | Bacteria | 1484 |
| 726 | Ga0496115_0083052 | 3300048918 | Bacteria | 2611 |
| 727 | Ga0496121_0007493 | 3300048924 | Bacteria | 13178 |
| 728 | Ga0496121_0502785 | 3300048924 | Bacteria | 769 |
| 729 | Ga0496124_0000125 | 3300048927 | Bacteria | 159942 |
| 730 | Ga0496125_0166524 | 3300048928 | Bacteria | 1488 |
| 731 | Ga0501032_0112919 | 3300049569 | Bacteria | 1797 |
| 732 | Ga0501043_0000027 | 3300049579 | Bacteria | 144685 |
| 733 | Ga0501046_0000034 | 3300049580 | Bacteria | 173742 |
| 734 | Ga0501047_0000042 | 3300049581 | Bacteria | 176603 |
| 735 | Ga0501048_0000019 | 3300049582 | Bacteria | 71064 |
| 736 | Ga0501198_000015 | 3300049649 | Bacteria | 102945 |
| 737 | Ga0501222_000045 | 3300049662 | Bacteria | 46767 |
| 738 | Ga0501080_0428265 | 3300049742 | Bacteria | 1188 |
| 739 | Ga0501080_0948902 | 3300049742 | Bacteria | 748 |
| 740 | Ga0501035_0161616 | 3300049822 | Bacteria | 1938 |
| 741 | Ga0501045_0002741 | 3300049824 | Bacteria | 12038 |
| 742 | nmdc:mga03683_156082_c1 | 3300050489 | Bacteria | 1032 |
| 743 | nmdc:mga03683_202589_c1 | 3300050489 | Bacteria | 911 |
| 744 | nmdc:mga03683_41971_c1 | 3300050489 | Bacteria | 1880 |
| 745 | nmdc:mga03n38_285837_c1 | 3300050490 | Bacteria | 882 |
| 746 | nmdc:mga03n38_72435_c1 | 3300050490 | Bacteria | 1597 |
| 747 | nmdc:mga0k408_22389_c1 | 3300050493 | Bacteria | 3558 |
| 748 | nmdc:mga0k408_287195_c1 | 3300050493 | Bacteria | 982 |
| 749 | nmdc:mga0k408_49852_c1 | 3300050493 | Bacteria | 2423 |
| 750 | nmdc:mga0k408_56713_c1 | 3300050493 | Bacteria | 2274 |
| 751 | nmdc:mga0k408_634553_c1 | 3300050493 | Bacteria | 629 |
| 752 | nmdc:mga0k408_78573_c1 | 3300050493 | Bacteria | 1930 |
| 753 | nmdc:mga0k408_835_c1 | 3300050493 | Bacteria | 16983 |
| 754 | nmdc:mga0k408_88534_c1 | 3300050493 | Bacteria | 1818 |
| 755 | nmdc:mga06z11_248018_c1 | 3300050494 | Bacteria | 1048 |
| 756 | nmdc:mga06z11_30425_c1 | 3300050494 | Bacteria | 2612 |
| 757 | nmdc:mga06z11_4334_c1 | 3300050494 | Bacteria | 5578 |
| 758 | nmdc:mga04h51_30817_c1 | 3300050495 | Bacteria | 1690 |
| 759 | nmdc:mga07m45_10920_c1 | 3300050496 | Bacteria | 4757 |
| 760 | nmdc:mga07m45_14822_c1 | 3300050496 | Bacteria | 4162 |
| 761 | nmdc:mga07m45_297112_c1 | 3300050496 | Bacteria | 939 |
| 762 | nmdc:mga07m45_33478_c1 | 3300050496 | Bacteria | 2854 |
| 763 | nmdc:mga07m45_34578_c1 | 3300050496 | Bacteria | 2809 |
| 764 | nmdc:mga07m45_56572_c1 | 3300050496 | Bacteria | 2217 |
| 765 | nmdc:mga07m45_62872_c1 | 3300050496 | Bacteria | 2105 |
| 766 | nmdc:mga07m45_692_c1 | 3300050496 | Bacteria | 14325 |
| 767 | nmdc:mga07m45_897_c1 | 3300050496 | Bacteria | 12986 |
| 768 | nmdc:mga0sz30_200958_c1 | 3300050516 | Bacteria | 885 |
| 769 | nmdc:mga0sz30_73910_c1 | 3300050516 | Bacteria | 1470 |
| 770 | Ga0495619_0402156 | 3300053085 | Bacteria | 946 |
| 771 | Ga0500583_0060084 | 3300053092 | Bacteria | 1792 |
| 772 | Ga0500651_0132415 | 3300053093 | Bacteria | 1507 |
| 773 | Ga0500607_163343 | 3300053121 | Bacteria | 1014 |
| 774 | Ga0500652_080354 | 3300053131 | Bacteria | 1357 |
| 775 | Ga0500559_0000017 | 3300053136 | Bacteria | 143646 |
| 776 | Ga0500559_0359982 | 3300053136 | Bacteria | 680 |
| 777 | Ga0500561_0038442 | 3300053137 | Bacteria | 1250 |
| 778 | Ga0500568_0055041 | 3300053139 | Bacteria | 1554 |
| 779 | Ga0500622_0001025 | 3300053156 | Bacteria | 23432 |
| 780 | Ga0500622_0014050 | 3300053156 | Bacteria | 4304 |
| 781 | Ga0500636_0035340 | 3300053177 | Bacteria | 2958 |
| 782 | Ga0500587_006191 | 3300053739 | Bacteria | 1594 |
| 783 | Ga0590071_002007 | 3300059421 | Bacteria | 5209 |
| 784 | Ga0590074_003679 | 3300059423 | Bacteria | 2535 |
| 785 | Ga0590075_076400 | 3300059424 | Bacteria | 866 |
| 786 | Ga0466962_0068448 | 3300061719 | Bacteria | 1695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046616 | Ga0495668_0506913 | Ga0495668_0506913_100_645 | 179 |
| 2 | 3300045051 | Ga0451576_0017247 | Ga0451576_0017247_2197_2850 | 182 |
| 3 | 3300005842 | Ga0068858_100847395 | Ga0068858_1008473952 | 191 |
| 4 | 3300003320 | rootH2_10104343 | rootH2_101043434 | 192 |
| 5 | 3300053136 | Ga0500559_0359982 | Ga0500559_0359982_32_625 | 195 |
| 6 | 3300035691 | Ga0373931_0605889 | Ga0373931_0605889_14_607 | 196 |
| 7 | 3300036401 | Ga0373937_0727323 | Ga0373937_0727323_18_632 | 196 |
| 8 | 3300041512 | Ga0451853_1508532 | Ga0451853_1508532_10_603 | 196 |
| 9 | 3300046529 | Ga0495652_0628138 | Ga0495652_0628138_99_713 | 196 |
| 10 | 3300050493 | nmdc:mga0k408_634553_c1 | nmdc:mga0k408_634553_c1_17_613 | 196 |
| 11 | 3300028794 | Ga0307515_10011291 | Ga0307515_100112913 | 202 |
| 12 | 3300031730 | Ga0307516_10000720 | Ga0307516_1000072018 | 202 |
| 13 | 3300005543 | Ga0070672_100216190 | Ga0070672_1002161902 | 205 |
| 14 | 3300025940 | Ga0207691_10171931 | Ga0207691_101719313 | 205 |
| 15 | 3300005366 | Ga0070659_100459730 | Ga0070659_1004597302 | 206 |
| 16 | iso_pu_bacteria | 2881714928 | 2881715311 | 207 |
| 17 | 3300041509 | Ga0451843_1080642 | Ga0451843_1080642_230_862 | 208 |
| 18 | 3300041512 | Ga0451853_3440584 | Ga0451853_3440584_474_1109 | 208 |
| 19 | 3300005331 | Ga0070670_100658783 | Ga0070670_1006587832 | 209 |
| 20 | 3300005334 | Ga0068869_100294646 | Ga0068869_1002946462 | 209 |
| 21 | 3300005336 | Ga0070680_100010188 | Ga0070680_1000101883 | 209 |
| 22 | 3300005338 | Ga0068868_100050237 | Ga0068868_1000502372 | 209 |
| 23 | 3300005338 | Ga0068868_100150905 | Ga0068868_1001509052 | 209 |
| 24 | 3300005344 | Ga0070661_100151608 | Ga0070661_1001516082 | 209 |
| 25 | 3300005355 | Ga0070671_100022795 | Ga0070671_1000227955 | 209 |
| 26 | 3300005355 | Ga0070671_100115370 | Ga0070671_1001153702 | 209 |
| 27 | 3300005364 | Ga0070673_100600895 | Ga0070673_1006008952 | 209 |
| 28 | 3300005367 | Ga0070667_100441293 | Ga0070667_1004412932 | 209 |
| 29 | 3300005367 | Ga0070667_100453833 | Ga0070667_1004538332 | 209 |
| 30 | 3300005455 | Ga0070663_100168412 | Ga0070663_1001684122 | 209 |
| 31 | 3300005456 | Ga0070678_100276857 | Ga0070678_1002768572 | 209 |
| 32 | 3300005459 | Ga0068867_100579563 | Ga0068867_1005795631 | 209 |
| 33 | 3300005530 | Ga0070679_100042692 | Ga0070679_1000426923 | 209 |
| 34 | 3300005539 | Ga0068853_100081187 | Ga0068853_1000811872 | 209 |
| 35 | 3300005548 | Ga0070665_100071804 | Ga0070665_1000718044 | 209 |
| 36 | 3300005617 | Ga0068859_100409930 | Ga0068859_1004099302 | 209 |
| 37 | 3300005618 | Ga0068864_100012808 | Ga0068864_1000128085 | 209 |
| 38 | 3300005618 | Ga0068864_100073504 | Ga0068864_1000735045 | 209 |
| 39 | 3300005841 | Ga0068863_100013409 | Ga0068863_1000134095 | 209 |
| 40 | 3300005841 | Ga0068863_100383229 | Ga0068863_1003832292 | 209 |
| 41 | 3300006195 | Ga0075366_10180353 | Ga0075366_101803532 | 209 |
| 42 | 3300006237 | Ga0097621_100674698 | Ga0097621_1006746982 | 209 |
| 43 | 3300006353 | Ga0075370_10010753 | Ga0075370_100107534 | 209 |
| 44 | 3300006353 | Ga0075370_10228548 | Ga0075370_102285482 | 209 |
| 45 | 3300006358 | Ga0068871_100384613 | Ga0068871_1003846132 | 209 |
| 46 | 3300006931 | Ga0097620_100409949 | Ga0097620_1004099492 | 209 |
| 47 | 3300009098 | Ga0105245_10116507 | Ga0105245_101165074 | 209 |
| 48 | 3300009174 | Ga0105241_10090894 | Ga0105241_100908942 | 209 |
| 49 | 3300013296 | Ga0157374_10101087 | Ga0157374_101010873 | 209 |
| 50 | 3300013296 | Ga0157374_10608683 | Ga0157374_106086832 | 209 |
| 51 | 3300013306 | Ga0163162_10596273 | Ga0163162_105962732 | 209 |
| 52 | 3300025909 | Ga0207705_10123308 | Ga0207705_101233082 | 209 |
| 53 | 3300025919 | Ga0207657_10534877 | Ga0207657_105348771 | 209 |
| 54 | 3300025921 | Ga0207652_10011724 | Ga0207652_100117245 | 209 |
| 55 | 3300025927 | Ga0207687_10041074 | Ga0207687_100410744 | 209 |
| 56 | 3300025931 | Ga0207644_10054254 | Ga0207644_100542542 | 209 |
| 57 | 3300025942 | Ga0207689_10226775 | Ga0207689_102267751 | 209 |
| 58 | 3300025960 | Ga0207651_10021440 | Ga0207651_100214404 | 209 |
| 59 | 3300025981 | Ga0207640_10733264 | Ga0207640_107332642 | 209 |
| 60 | 3300026023 | Ga0207677_10012138 | Ga0207677_100121383 | 209 |
| 61 | 3300026023 | Ga0207677_10042753 | Ga0207677_100427532 | 209 |
| 62 | 3300026067 | Ga0207678_10263660 | Ga0207678_102636602 | 209 |
| 63 | 3300026088 | Ga0207641_10015971 | Ga0207641_100159716 | 209 |
| 64 | 3300026088 | Ga0207641_10074815 | Ga0207641_100748152 | 209 |
| 65 | 3300026088 | Ga0207641_10355625 | Ga0207641_103556252 | 209 |
| 66 | 3300026089 | Ga0207648_10091987 | Ga0207648_100919872 | 209 |
| 67 | 3300026095 | Ga0207676_10040116 | Ga0207676_100401162 | 209 |
| 68 | 3300026095 | Ga0207676_10098344 | Ga0207676_100983443 | 209 |
| 69 | 3300026121 | Ga0207683_10029209 | Ga0207683_100292094 | 209 |
| 70 | 3300028379 | Ga0268266_10061891 | Ga0268266_100618912 | 209 |
| 71 | 3300028786 | Ga0307517_10000150 | Ga0307517_1000015027 | 209 |
| 72 | 3300028794 | Ga0307515_10005750 | Ga0307515_100057505 | 209 |
| 73 | 3300028794 | Ga0307515_10145113 | Ga0307515_101451133 | 209 |
| 74 | 3300030522 | Ga0307512_10078454 | Ga0307512_100784543 | 209 |
| 75 | 3300031507 | Ga0307509_10000092 | Ga0307509_10000092110 | 209 |
| 76 | 3300031507 | Ga0307509_10028720 | Ga0307509_100287204 | 209 |
| 77 | 3300031507 | Ga0307509_10039307 | Ga0307509_100393074 | 209 |
| 78 | 3300031507 | Ga0307509_10070268 | Ga0307509_100702682 | 209 |
| 79 | 3300031616 | Ga0307508_10052658 | Ga0307508_100526584 | 209 |
| 80 | 3300031616 | Ga0307508_10078713 | Ga0307508_100787134 | 209 |
| 81 | 3300031616 | Ga0307508_10433756 | Ga0307508_104337562 | 209 |
| 82 | 3300031649 | Ga0307514_10024537 | Ga0307514_100245374 | 209 |
| 83 | 3300031649 | Ga0307514_10214223 | Ga0307514_102142232 | 209 |
| 84 | 3300031730 | Ga0307516_10318104 | Ga0307516_103181042 | 209 |
| 85 | 3300033179 | Ga0307507_10055456 | Ga0307507_100554564 | 209 |
| 86 | 3300033180 | Ga0307510_10001753 | Ga0307510_100017533 | 209 |
| 87 | 3300033180 | Ga0307510_10010098 | Ga0307510_100100989 | 209 |
| 88 | 3300033180 | Ga0307510_10058183 | Ga0307510_100581832 | 209 |
| 89 | 3300033180 | Ga0307510_10223972 | Ga0307510_102239722 | 209 |
| 90 | 3300035121 | Ga0373960_0086552 | Ga0373960_0086552_257_907 | 209 |
| 91 | 3300046460 | Ga0495638_0054986 | Ga0495638_0054986_981_1616 | 209 |
| 92 | 3300046473 | Ga0495582_0058973 | Ga0495582_0058973_481_1116 | 209 |
| 93 | 3300046512 | Ga0495610_0163277 | Ga0495610_0163277_264_899 | 209 |
| 94 | 3300046526 | Ga0495666_0071446 | Ga0495666_0071446_774_1409 | 209 |
| 95 | 3300046683 | Ga0495658_0118597 | Ga0495658_0118597_268_903 | 209 |
| 96 | 3300047315 | Ga0495581_0135561 | Ga0495581_0135561_107_742 | 209 |
| 97 | 3300048911 | Ga0496108_0030613 | Ga0496108_0030613_1832_2464 | 209 |
| 98 | 3300048912 | Ga0496109_0285083 | Ga0496109_0285083_11_643 | 209 |
| 99 | 3300050493 | nmdc:mga0k408_78573_c1 | nmdc:mga0k408_78573_c1_221_856 | 209 |
| 100 | 3300050493 | nmdc:mga0k408_88534_c1 | nmdc:mga0k408_88534_c1_649_1284 | 209 |
| 101 | 3300050496 | nmdc:mga07m45_56572_c1 | nmdc:mga07m45_56572_c1_490_1125 | 209 |
| 102 | 3300053092 | Ga0500583_0060084 | Ga0500583_0060084_820_1455 | 209 |
| 103 | 3300053093 | Ga0500651_0132415 | Ga0500651_0132415_38_673 | 209 |
| 104 | 3300053121 | Ga0500607_163343 | Ga0500607_163343_147_782 | 209 |
| 105 | 3300053131 | Ga0500652_080354 | Ga0500652_080354_639_1274 | 209 |
| 106 | 3300053136 | Ga0500559_0000017 | Ga0500559_0000017_20874_21509 | 209 |
| 107 | 3300053139 | Ga0500568_0055041 | Ga0500568_0055041_571_1206 | 209 |
| 108 | 3300053156 | Ga0500622_0014050 | Ga0500622_0014050_30_665 | 209 |
| 109 | 3300053177 | Ga0500636_0035340 | Ga0500636_0035340_36_671 | 209 |
| 110 | 3300053739 | Ga0500587_006191 | Ga0500587_006191_38_673 | 209 |
| 111 | 3300002705 | JGI25156J39149_1000229 | JGI25156J39149_10002296 | 210 |
| 112 | 3300002738 | JGI25154J39366_1000931 | JGI25154J39366_10009312 | 210 |
| 113 | 3300002741 | JGI25157J39369_1000235 | JGI25157J39369_10002356 | 210 |
| 114 | 3300003316 | rootH1_10003054 | rootH1_100030545 | 210 |
| 115 | 3300003316 | rootH1_10034201 | rootH1_100342011 | 210 |
| 116 | 3300003322 | rootL2_10002813 | rootL2_100028137 | 210 |
| 117 | 3300003322 | rootL2_10047266 | rootL2_100472662 | 210 |
| 118 | 3300003323 | rootH1_10041586 | rootH1_100415866 | 210 |
| 119 | 3300003374 | JGI25161J50226_1014426 | JGI25161J50226_10144261 | 210 |
| 120 | 3300003752 | Ga0055539_1000428 | Ga0055539_10004284 | 210 |
| 121 | 3300003752 | Ga0055539_1001832 | Ga0055539_10018324 | 210 |
| 122 | 3300003756 | Ga0055533_1000221 | Ga0055533_10002216 | 210 |
| 123 | 3300003759 | Ga0055525_1001640 | Ga0055525_10016403 | 210 |
| 124 | 3300003775 | Ga0055524_1000755 | Ga0055524_100075513 | 210 |
| 125 | 3300003794 | Ga0055531_10003254 | Ga0055531_100032548 | 210 |
| 126 | 3300004625 | Ga0055543_1002246 | Ga0055543_10022464 | 210 |
| 127 | 3300005262 | Ga0065165_1000431 | Ga0065165_100043137 | 210 |
| 128 | 3300005295 | Ga0065707_10102460 | Ga0065707_101024601 | 210 |
| 129 | 3300005327 | Ga0070658_10229733 | Ga0070658_102297332 | 210 |
| 130 | 3300005328 | Ga0070676_10057916 | Ga0070676_100579162 | 210 |
| 131 | 3300005328 | Ga0070676_10078624 | Ga0070676_100786242 | 210 |
| 132 | 3300005328 | Ga0070676_10371765 | Ga0070676_103717652 | 210 |
| 133 | 3300005330 | Ga0070690_100024053 | Ga0070690_1000240534 | 210 |
| 134 | 3300005330 | Ga0070690_100040993 | Ga0070690_1000409932 | 210 |
| 135 | 3300005331 | Ga0070670_100000478 | Ga0070670_10000047823 | 210 |
| 136 | 3300005331 | Ga0070670_100084820 | Ga0070670_1000848202 | 210 |
| 137 | 3300005331 | Ga0070670_100314796 | Ga0070670_1003147962 | 210 |
| 138 | 3300005333 | Ga0070677_10005408 | Ga0070677_100054084 | 210 |
| 139 | 3300005333 | Ga0070677_10054323 | Ga0070677_100543232 | 210 |
| 140 | 3300005333 | Ga0070677_10062364 | Ga0070677_100623642 | 210 |
| 141 | 3300005334 | Ga0068869_100000634 | Ga0068869_10000063414 | 210 |
| 142 | 3300005334 | Ga0068869_100036853 | Ga0068869_1000368534 | 210 |
| 143 | 3300005335 | Ga0070666_10137532 | Ga0070666_101375322 | 210 |
| 144 | 3300005338 | Ga0068868_100031391 | Ga0068868_1000313914 | 210 |
| 145 | 3300005338 | Ga0068868_100045362 | Ga0068868_1000453624 | 210 |
| 146 | 3300005338 | Ga0068868_100061100 | Ga0068868_1000611004 | 210 |
| 147 | 3300005338 | Ga0068868_100282754 | Ga0068868_1002827542 | 210 |
| 148 | 3300005338 | Ga0068868_100702040 | Ga0068868_1007020401 | 210 |
| 149 | 3300005339 | Ga0070660_100023264 | Ga0070660_1000232644 | 210 |
| 150 | 3300005339 | Ga0070660_100024849 | Ga0070660_1000248494 | 210 |
| 151 | 3300005339 | Ga0070660_100028660 | Ga0070660_1000286604 | 210 |
| 152 | 3300005343 | Ga0070687_100167540 | Ga0070687_1001675402 | 210 |
| 153 | 3300005344 | Ga0070661_100015724 | Ga0070661_1000157245 | 210 |
| 154 | 3300005344 | Ga0070661_100035161 | Ga0070661_1000351612 | 210 |
| 155 | 3300005344 | Ga0070661_100180944 | Ga0070661_1001809442 | 210 |
| 156 | 3300005344 | Ga0070661_100285742 | Ga0070661_1002857422 | 210 |
| 157 | 3300005347 | Ga0070668_100015357 | Ga0070668_1000153575 | 210 |
| 158 | 3300005347 | Ga0070668_100100651 | Ga0070668_1001006513 | 210 |
| 159 | 3300005347 | Ga0070668_100104455 | Ga0070668_1001044553 | 210 |
| 160 | 3300005347 | Ga0070668_100231891 | Ga0070668_1002318912 | 210 |
| 161 | 3300005347 | Ga0070668_100438813 | Ga0070668_1004388132 | 210 |
| 162 | 3300005353 | Ga0070669_100008698 | Ga0070669_1000086984 | 210 |
| 163 | 3300005353 | Ga0070669_100019362 | Ga0070669_1000193624 | 210 |
| 164 | 3300005353 | Ga0070669_100019488 | Ga0070669_1000194882 | 210 |
| 165 | 3300005354 | Ga0070675_100008419 | Ga0070675_1000084195 | 210 |
| 166 | 3300005354 | Ga0070675_100008756 | Ga0070675_1000087568 | 210 |
| 167 | 3300005354 | Ga0070675_100018803 | Ga0070675_1000188034 | 210 |
| 168 | 3300005354 | Ga0070675_100066859 | Ga0070675_1000668592 | 210 |
| 169 | 3300005354 | Ga0070675_100072719 | Ga0070675_1000727193 | 210 |
| 170 | 3300005355 | Ga0070671_100001871 | Ga0070671_10000187111 | 210 |
| 171 | 3300005355 | Ga0070671_100023281 | Ga0070671_1000232813 | 210 |
| 172 | 3300005355 | Ga0070671_100081436 | Ga0070671_1000814363 | 210 |
| 173 | 3300005355 | Ga0070671_100146185 | Ga0070671_1001461853 | 210 |
| 174 | 3300005356 | Ga0070674_100002622 | Ga0070674_1000026229 | 210 |
| 175 | 3300005356 | Ga0070674_100052006 | Ga0070674_1000520064 | 210 |
| 176 | 3300005356 | Ga0070674_100240691 | Ga0070674_1002406912 | 210 |
| 177 | 3300005356 | Ga0070674_100418154 | Ga0070674_1004181541 | 210 |
| 178 | 3300005364 | Ga0070673_100032060 | Ga0070673_1000320604 | 210 |
| 179 | 3300005364 | Ga0070673_100120597 | Ga0070673_1001205973 | 210 |
| 180 | 3300005364 | Ga0070673_100669018 | Ga0070673_1006690182 | 210 |
| 181 | 3300005364 | Ga0070673_100693642 | Ga0070673_1006936422 | 210 |
| 182 | 3300005366 | Ga0070659_100037361 | Ga0070659_1000373613 | 210 |
| 183 | 3300005366 | Ga0070659_100098873 | Ga0070659_1000988733 | 210 |
| 184 | 3300005367 | Ga0070667_100027101 | Ga0070667_1000271014 | 210 |
| 185 | 3300005367 | Ga0070667_100027115 | Ga0070667_1000271153 | 210 |
| 186 | 3300005367 | Ga0070667_100401941 | Ga0070667_1004019412 | 210 |
| 187 | 3300005455 | Ga0070663_100008101 | Ga0070663_1000081014 | 210 |
| 188 | 3300005455 | Ga0070663_100031838 | Ga0070663_1000318381 | 210 |
| 189 | 3300005455 | Ga0070663_100487599 | Ga0070663_1004875992 | 210 |
| 190 | 3300005456 | Ga0070678_100002166 | Ga0070678_1000021664 | 210 |
| 191 | 3300005456 | Ga0070678_100010391 | Ga0070678_1000103915 | 210 |
| 192 | 3300005456 | Ga0070678_100054351 | Ga0070678_1000543512 | 210 |
| 193 | 3300005457 | Ga0070662_100002819 | Ga0070662_1000028193 | 210 |
| 194 | 3300005457 | Ga0070662_100021597 | Ga0070662_1000215972 | 210 |
| 195 | 3300005457 | Ga0070662_100094061 | Ga0070662_1000940614 | 210 |
| 196 | 3300005457 | Ga0070662_100096724 | Ga0070662_1000967243 | 210 |
| 197 | 3300005458 | Ga0070681_11202621 | Ga0070681_112026211 | 210 |
| 198 | 3300005459 | Ga0068867_100001470 | Ga0068867_1000014705 | 210 |
| 199 | 3300005459 | Ga0068867_100002200 | Ga0068867_10000220010 | 210 |
| 200 | 3300005459 | Ga0068867_100049528 | Ga0068867_1000495284 | 210 |
| 201 | 3300005459 | Ga0068867_100140542 | Ga0068867_1001405422 | 210 |
| 202 | 3300005466 | Ga0070685_10244394 | Ga0070685_102443942 | 210 |
| 203 | 3300005467 | Ga0070706_100002689 | Ga0070706_1000026897 | 210 |
| 204 | 3300005468 | Ga0070707_100048312 | Ga0070707_1000483122 | 210 |
| 205 | 3300005518 | Ga0070699_100074494 | Ga0070699_1000744943 | 210 |
| 206 | 3300005535 | Ga0070684_100425217 | Ga0070684_1004252172 | 210 |
| 207 | 3300005539 | Ga0068853_100016063 | Ga0068853_1000160634 | 210 |
| 208 | 3300005539 | Ga0068853_100021509 | Ga0068853_1000215093 | 210 |
| 209 | 3300005539 | Ga0068853_100232642 | Ga0068853_1002326422 | 210 |
| 210 | 3300005543 | Ga0070672_100029940 | Ga0070672_1000299404 | 210 |
| 211 | 3300005543 | Ga0070672_100043972 | Ga0070672_1000439724 | 210 |
| 212 | 3300005543 | Ga0070672_100057372 | Ga0070672_1000573724 | 210 |
| 213 | 3300005543 | Ga0070672_100061536 | Ga0070672_1000615363 | 210 |
| 214 | 3300005543 | Ga0070672_100123380 | Ga0070672_1001233803 | 210 |
| 215 | 3300005543 | Ga0070672_100142144 | Ga0070672_1001421442 | 210 |
| 216 | 3300005543 | Ga0070672_100456144 | Ga0070672_1004561442 | 210 |
| 217 | 3300005544 | Ga0070686_100177666 | Ga0070686_1001776662 | 210 |
| 218 | 3300005547 | Ga0070693_100337299 | Ga0070693_1003372992 | 210 |
| 219 | 3300005563 | Ga0068855_100017005 | Ga0068855_1000170054 | 210 |
| 220 | 3300005563 | Ga0068855_100224045 | Ga0068855_1002240452 | 210 |
| 221 | 3300005564 | Ga0070664_100121906 | Ga0070664_1001219063 | 210 |
| 222 | 3300005564 | Ga0070664_100261449 | Ga0070664_1002614492 | 210 |
| 223 | 3300005564 | Ga0070664_100273003 | Ga0070664_1002730032 | 210 |
| 224 | 3300005564 | Ga0070664_100574884 | Ga0070664_1005748842 | 210 |
| 225 | 3300005577 | Ga0068857_100019168 | Ga0068857_1000191682 | 210 |
| 226 | 3300005577 | Ga0068857_100029410 | Ga0068857_1000294103 | 210 |
| 227 | 3300005577 | Ga0068857_100070843 | Ga0068857_1000708434 | 210 |
| 228 | 3300005578 | Ga0068854_100064026 | Ga0068854_1000640264 | 210 |
| 229 | 3300005578 | Ga0068854_100075445 | Ga0068854_1000754452 | 210 |
| 230 | 3300005578 | Ga0068854_100851627 | Ga0068854_1008516272 | 210 |
| 231 | 3300005614 | Ga0068856_100005428 | Ga0068856_1000054281 | 210 |
| 232 | 3300005614 | Ga0068856_100035104 | Ga0068856_1000351043 | 210 |
| 233 | 3300005614 | Ga0068856_100066292 | Ga0068856_1000662925 | 210 |
| 234 | 3300005615 | Ga0070702_100007031 | Ga0070702_1000070315 | 210 |
| 235 | 3300005616 | Ga0068852_100007345 | Ga0068852_1000073456 | 210 |
| 236 | 3300005616 | Ga0068852_100019874 | Ga0068852_1000198743 | 210 |
| 237 | 3300005616 | Ga0068852_100048007 | Ga0068852_1000480073 | 210 |
| 238 | 3300005616 | Ga0068852_100070412 | Ga0068852_1000704122 | 210 |
| 239 | 3300005616 | Ga0068852_100072637 | Ga0068852_1000726374 | 210 |
| 240 | 3300005616 | Ga0068852_100131954 | Ga0068852_1001319542 | 210 |
| 241 | 3300005616 | Ga0068852_100141402 | Ga0068852_1001414024 | 210 |
| 242 | 3300005616 | Ga0068852_100202546 | Ga0068852_1002025462 | 210 |
| 243 | 3300005616 | Ga0068852_100209998 | Ga0068852_1002099982 | 210 |
| 244 | 3300005617 | Ga0068859_100103529 | Ga0068859_1001035294 | 210 |
| 245 | 3300005617 | Ga0068859_100423449 | Ga0068859_1004234492 | 210 |
| 246 | 3300005617 | Ga0068859_100520157 | Ga0068859_1005201572 | 210 |
| 247 | 3300005618 | Ga0068864_100028203 | Ga0068864_1000282033 | 210 |
| 248 | 3300005618 | Ga0068864_100049705 | Ga0068864_1000497052 | 210 |
| 249 | 3300005618 | Ga0068864_100073529 | Ga0068864_1000735293 | 210 |
| 250 | 3300005618 | Ga0068864_100091527 | Ga0068864_1000915273 | 210 |
| 251 | 3300005718 | Ga0068866_10096372 | Ga0068866_100963723 | 210 |
| 252 | 3300005719 | Ga0068861_100004781 | Ga0068861_1000047815 | 210 |
| 253 | 3300005719 | Ga0068861_100023310 | Ga0068861_1000233103 | 210 |
| 254 | 3300005834 | Ga0068851_10002615 | Ga0068851_100026155 | 210 |
| 255 | 3300005834 | Ga0068851_10062217 | Ga0068851_100622172 | 210 |
| 256 | 3300005841 | Ga0068863_100028725 | Ga0068863_1000287254 | 210 |
| 257 | 3300005841 | Ga0068863_100049664 | Ga0068863_1000496643 | 210 |
| 258 | 3300005841 | Ga0068863_100092225 | Ga0068863_1000922252 | 210 |
| 259 | 3300005841 | Ga0068863_100359569 | Ga0068863_1003595692 | 210 |
| 260 | 3300005841 | Ga0068863_100503523 | Ga0068863_1005035232 | 210 |
| 261 | 3300005842 | Ga0068858_100010595 | Ga0068858_1000105957 | 210 |
| 262 | 3300005842 | Ga0068858_100012601 | Ga0068858_1000126014 | 210 |
| 263 | 3300005842 | Ga0068858_100043397 | Ga0068858_1000433973 | 210 |
| 264 | 3300005843 | Ga0068860_100010055 | Ga0068860_1000100554 | 210 |
| 265 | 3300005843 | Ga0068860_100018058 | Ga0068860_1000180585 | 210 |
| 266 | 3300005843 | Ga0068860_100088212 | Ga0068860_1000882123 | 210 |
| 267 | 3300005844 | Ga0068862_100009005 | Ga0068862_1000090053 | 210 |
| 268 | 3300005844 | Ga0068862_100090859 | Ga0068862_1000908594 | 210 |
| 269 | 3300006038 | Ga0075365_10007360 | Ga0075365_100073605 | 210 |
| 270 | 3300006042 | Ga0075368_10016433 | Ga0075368_100164333 | 210 |
| 271 | 3300006048 | Ga0075363_100029335 | Ga0075363_1000293352 | 210 |
| 272 | 3300006051 | Ga0075364_10069251 | Ga0075364_100692512 | 210 |
| 273 | 3300006163 | Ga0070715_10089594 | Ga0070715_100895942 | 210 |
| 274 | 3300006177 | Ga0075362_10029489 | Ga0075362_100294892 | 210 |
| 275 | 3300006177 | Ga0075362_10078577 | Ga0075362_100785772 | 210 |
| 276 | 3300006178 | Ga0075367_10015422 | Ga0075367_100154225 | 210 |
| 277 | 3300006178 | Ga0075367_10034354 | Ga0075367_100343544 | 210 |
| 278 | 3300006178 | Ga0075367_10044180 | Ga0075367_100441802 | 210 |
| 279 | 3300006178 | Ga0075367_10071327 | Ga0075367_100713273 | 210 |
| 280 | 3300006195 | Ga0075366_10021476 | Ga0075366_100214764 | 210 |
| 281 | 3300006195 | Ga0075366_10036496 | Ga0075366_100364964 | 210 |
| 282 | 3300006195 | Ga0075366_10111760 | Ga0075366_101117602 | 210 |
| 283 | 3300006195 | Ga0075366_10185650 | Ga0075366_101856502 | 210 |
| 284 | 3300006195 | Ga0075366_10370037 | Ga0075366_103700372 | 210 |
| 285 | 3300006237 | Ga0097621_100008233 | Ga0097621_1000082338 | 210 |
| 286 | 3300006237 | Ga0097621_100111664 | Ga0097621_1001116643 | 210 |
| 287 | 3300006353 | Ga0075370_10000458 | Ga0075370_100004585 | 210 |
| 288 | 3300006353 | Ga0075370_10008466 | Ga0075370_100084664 | 210 |
| 289 | 3300006353 | Ga0075370_10017335 | Ga0075370_100173353 | 210 |
| 290 | 3300006353 | Ga0075370_10017842 | Ga0075370_100178422 | 210 |
| 291 | 3300006353 | Ga0075370_10023514 | Ga0075370_100235144 | 210 |
| 292 | 3300006353 | Ga0075370_10246120 | Ga0075370_102461202 | 210 |
| 293 | 3300006358 | Ga0068871_100030930 | Ga0068871_1000309303 | 210 |
| 294 | 3300006358 | Ga0068871_100191154 | Ga0068871_1001911543 | 210 |
| 295 | 3300006358 | Ga0068871_100382984 | Ga0068871_1003829842 | 210 |
| 296 | 3300006358 | Ga0068871_100507279 | Ga0068871_1005072792 | 210 |
| 297 | 3300006881 | Ga0068865_100009609 | Ga0068865_1000096094 | 210 |
| 298 | 3300006881 | Ga0068865_100035934 | Ga0068865_1000359344 | 210 |
| 299 | 3300006881 | Ga0068865_100050251 | Ga0068865_1000502514 | 210 |
| 300 | 3300006881 | Ga0068865_100264158 | Ga0068865_1002641582 | 210 |
| 301 | 3300006881 | Ga0068865_100403086 | Ga0068865_1004030862 | 210 |
| 302 | 3300006881 | Ga0068865_100434981 | Ga0068865_1004349811 | 210 |
| 303 | 3300006931 | Ga0097620_100103528 | Ga0097620_1001035282 | 210 |
| 304 | 3300006931 | Ga0097620_100423454 | Ga0097620_1004234542 | 210 |
| 305 | 3300006931 | Ga0097620_100520154 | Ga0097620_1005201542 | 210 |
| 306 | 3300007076 | Ga0075435_100487563 | Ga0075435_1004875631 | 210 |
| 307 | 3300009093 | Ga0105240_10000805 | Ga0105240_100008059 | 210 |
| 308 | 3300009093 | Ga0105240_10035322 | Ga0105240_100353225 | 210 |
| 309 | 3300009093 | Ga0105240_10132016 | Ga0105240_101320162 | 210 |
| 310 | 3300009093 | Ga0105240_10648100 | Ga0105240_106481002 | 210 |
| 311 | 3300009093 | Ga0105240_10685837 | Ga0105240_106858371 | 210 |
| 312 | 3300009093 | Ga0105240_10952085 | Ga0105240_109520852 | 210 |
| 313 | 3300009098 | Ga0105245_10036743 | Ga0105245_100367433 | 210 |
| 314 | 3300009098 | Ga0105245_10353499 | Ga0105245_103534992 | 210 |
| 315 | 3300009098 | Ga0105245_10602768 | Ga0105245_106027682 | 210 |
| 316 | 3300009148 | Ga0105243_10019432 | Ga0105243_100194323 | 210 |
| 317 | 3300009176 | Ga0105242_10172899 | Ga0105242_101728992 | 210 |
| 318 | 3300009176 | Ga0105242_10223391 | Ga0105242_102233912 | 210 |
| 319 | 3300009177 | Ga0105248_10042010 | Ga0105248_100420102 | 210 |
| 320 | 3300009177 | Ga0105248_10072967 | Ga0105248_100729675 | 210 |
| 321 | 3300009177 | Ga0105248_10107444 | Ga0105248_101074442 | 210 |
| 322 | 3300009177 | Ga0105248_10237531 | Ga0105248_102375312 | 210 |
| 323 | 3300009545 | Ga0105237_10004204 | Ga0105237_100042045 | 210 |
| 324 | 3300009545 | Ga0105237_10142698 | Ga0105237_101426982 | 210 |
| 325 | 3300009551 | Ga0105238_10004015 | Ga0105238_100040156 | 210 |
| 326 | 3300009551 | Ga0105238_10073129 | Ga0105238_100731292 | 210 |
| 327 | 3300009553 | Ga0105249_10066911 | Ga0105249_100669113 | 210 |
| 328 | 3300009553 | Ga0105249_10148115 | Ga0105249_101481152 | 210 |
| 329 | 3300010375 | Ga0105239_10000952 | Ga0105239_100009525 | 210 |
| 330 | 3300010375 | Ga0105239_10079253 | Ga0105239_100792534 | 210 |
| 331 | 3300010375 | Ga0105239_10112198 | Ga0105239_101121983 | 210 |
| 332 | 3300010375 | Ga0105239_10127813 | Ga0105239_101278133 | 210 |
| 333 | 3300012497 | Ga0157319_1000017 | Ga0157319_100001711 | 210 |
| 334 | 3300013102 | Ga0157371_10821537 | Ga0157371_108215371 | 210 |
| 335 | 3300013104 | Ga0157370_10704015 | Ga0157370_107040152 | 210 |
| 336 | 3300013105 | Ga0157369_10009904 | Ga0157369_100099046 | 210 |
| 337 | 3300013296 | Ga0157374_10020489 | Ga0157374_100204895 | 210 |
| 338 | 3300013296 | Ga0157374_10078210 | Ga0157374_100782102 | 210 |
| 339 | 3300013297 | Ga0157378_10004202 | Ga0157378_100042026 | 210 |
| 340 | 3300013297 | Ga0157378_10226365 | Ga0157378_102263652 | 210 |
| 341 | 3300013306 | Ga0163162_10074541 | Ga0163162_100745414 | 210 |
| 342 | 3300013306 | Ga0163162_10548411 | Ga0163162_105484112 | 210 |
| 343 | 3300013307 | Ga0157372_10050406 | Ga0157372_100504063 | 210 |
| 344 | 3300013307 | Ga0157372_10145075 | Ga0157372_101450753 | 210 |
| 345 | 3300013308 | Ga0157375_10050831 | Ga0157375_100508313 | 210 |
| 346 | 3300013308 | Ga0157375_10054470 | Ga0157375_100544703 | 210 |
| 347 | 3300013308 | Ga0157375_10055271 | Ga0157375_100552714 | 210 |
| 348 | 3300013308 | Ga0157375_10060927 | Ga0157375_100609272 | 210 |
| 349 | 3300013308 | Ga0157375_10074306 | Ga0157375_100743062 | 210 |
| 350 | 3300014325 | Ga0163163_10383691 | Ga0163163_103836912 | 210 |
| 351 | 3300014326 | Ga0157380_10002952 | Ga0157380_100029522 | 210 |
| 352 | 3300014326 | Ga0157380_10239707 | Ga0157380_102397072 | 210 |
| 353 | 3300014326 | Ga0157380_10829052 | Ga0157380_108290521 | 210 |
| 354 | 3300014745 | Ga0157377_10014024 | Ga0157377_100140244 | 210 |
| 355 | 3300014968 | Ga0157379_10010782 | Ga0157379_100107822 | 210 |
| 356 | 3300014968 | Ga0157379_10014569 | Ga0157379_100145695 | 210 |
| 357 | 3300014968 | Ga0157379_10049968 | Ga0157379_100499683 | 210 |
| 358 | 3300014968 | Ga0157379_10167912 | Ga0157379_101679122 | 210 |
| 359 | 3300014968 | Ga0157379_10240280 | Ga0157379_102402802 | 210 |
| 360 | 3300014968 | Ga0157379_10336517 | Ga0157379_103365172 | 210 |
| 361 | 3300014969 | Ga0157376_10008186 | Ga0157376_100081864 | 210 |
| 362 | 3300014969 | Ga0157376_10031452 | Ga0157376_100314524 | 210 |
| 363 | 3300014969 | Ga0157376_10045713 | Ga0157376_100457132 | 210 |
| 364 | 3300014969 | Ga0157376_10355926 | Ga0157376_103559262 | 210 |
| 365 | 3300014969 | Ga0157376_10407984 | Ga0157376_104079842 | 210 |
| 366 | 3300014969 | Ga0157376_10586990 | Ga0157376_105869902 | 210 |
| 367 | 3300017792 | Ga0163161_10021039 | Ga0163161_100210394 | 210 |
| 368 | 3300017792 | Ga0163161_10164429 | Ga0163161_101644292 | 210 |
| 369 | 3300017792 | Ga0163161_10183557 | Ga0163161_101835572 | 210 |
| 370 | 3300017792 | Ga0163161_10300541 | Ga0163161_103005412 | 210 |
| 371 | 3300017792 | Ga0163161_10508731 | Ga0163161_105087312 | 210 |
| 372 | 3300021361 | Ga0213872_10000099 | Ga0213872_1000009956 | 210 |
| 373 | 3300025226 | Ga0209674_100270 | Ga0209674_1002706 | 210 |
| 374 | 3300025230 | Ga0209563_100178 | Ga0209563_1001786 | 210 |
| 375 | 3300025231 | Ga0207427_102346 | Ga0207427_1023465 | 210 |
| 376 | 3300025242 | Ga0209258_101449 | Ga0209258_1014494 | 210 |
| 377 | 3300025246 | Ga0209646_1000625 | Ga0209646_100062511 | 210 |
| 378 | 3300025250 | Ga0209026_1000328 | Ga0209026_100032827 | 210 |
| 379 | 3300025253 | Ga0209677_100405 | Ga0209677_1004054 | 210 |
| 380 | 3300025253 | Ga0209677_101001 | Ga0209677_10100111 | 210 |
| 381 | 3300025256 | Ga0209759_1000448 | Ga0209759_10004486 | 210 |
| 382 | 3300025256 | Ga0209759_1001400 | Ga0209759_100140012 | 210 |
| 383 | 3300025273 | Ga0209673_1004161 | Ga0209673_10041618 | 210 |
| 384 | 3300025299 | Ga0209256_1000249 | Ga0209256_100024911 | 210 |
| 385 | 3300025299 | Ga0209256_1018429 | Ga0209256_10184294 | 210 |
| 386 | 3300025303 | Ga0209051_1015479 | Ga0209051_10154794 | 210 |
| 387 | 3300025304 | Ga0209257_1002034 | Ga0209257_100203416 | 210 |
| 388 | 3300025321 | Ga0207656_10117867 | Ga0207656_101178672 | 210 |
| 389 | 3300025321 | Ga0207656_10266704 | Ga0207656_102667041 | 210 |
| 390 | 3300025893 | Ga0207682_10002372 | Ga0207682_100023725 | 210 |
| 391 | 3300025893 | Ga0207682_10027149 | Ga0207682_100271492 | 210 |
| 392 | 3300025899 | Ga0207642_10080340 | Ga0207642_100803402 | 210 |
| 393 | 3300025899 | Ga0207642_10131020 | Ga0207642_101310202 | 210 |
| 394 | 3300025901 | Ga0207688_10215877 | Ga0207688_102158772 | 210 |
| 395 | 3300025901 | Ga0207688_10373940 | Ga0207688_103739401 | 210 |
| 396 | 3300025903 | Ga0207680_10036656 | Ga0207680_100366562 | 210 |
| 397 | 3300025903 | Ga0207680_10172534 | Ga0207680_101725342 | 210 |
| 398 | 3300025907 | Ga0207645_10014078 | Ga0207645_100140784 | 210 |
| 399 | 3300025907 | Ga0207645_10033581 | Ga0207645_100335813 | 210 |
| 400 | 3300025907 | Ga0207645_10054125 | Ga0207645_100541254 | 210 |
| 401 | 3300025907 | Ga0207645_10227986 | Ga0207645_102279862 | 210 |
| 402 | 3300025909 | Ga0207705_10128701 | Ga0207705_101287012 | 210 |
| 403 | 3300025910 | Ga0207684_10032813 | Ga0207684_100328132 | 210 |
| 404 | 3300025913 | Ga0207695_10011633 | Ga0207695_100116336 | 210 |
| 405 | 3300025913 | Ga0207695_10114027 | Ga0207695_101140272 | 210 |
| 406 | 3300025913 | Ga0207695_10436998 | Ga0207695_104369982 | 210 |
| 407 | 3300025914 | Ga0207671_10005118 | Ga0207671_100051185 | 210 |
| 408 | 3300025914 | Ga0207671_10168257 | Ga0207671_101682572 | 210 |
| 409 | 3300025918 | Ga0207662_10031228 | Ga0207662_100312284 | 210 |
| 410 | 3300025919 | Ga0207657_10035144 | Ga0207657_100351445 | 210 |
| 411 | 3300025920 | Ga0207649_10038271 | Ga0207649_100382712 | 210 |
| 412 | 3300025920 | Ga0207649_10232881 | Ga0207649_102328812 | 210 |
| 413 | 3300025920 | Ga0207649_10376559 | Ga0207649_103765592 | 210 |
| 414 | 3300025921 | Ga0207652_10410006 | Ga0207652_104100062 | 210 |
| 415 | 3300025922 | Ga0207646_10434402 | Ga0207646_104344022 | 210 |
| 416 | 3300025923 | Ga0207681_10028283 | Ga0207681_100282833 | 210 |
| 417 | 3300025923 | Ga0207681_10066226 | Ga0207681_100662262 | 210 |
| 418 | 3300025923 | Ga0207681_10306570 | Ga0207681_103065702 | 210 |
| 419 | 3300025923 | Ga0207681_10459464 | Ga0207681_104594642 | 210 |
| 420 | 3300025924 | Ga0207694_10025002 | Ga0207694_100250024 | 210 |
| 421 | 3300025924 | Ga0207694_10113996 | Ga0207694_101139963 | 210 |
| 422 | 3300025924 | Ga0207694_10405919 | Ga0207694_104059192 | 210 |
| 423 | 3300025925 | Ga0207650_10004285 | Ga0207650_100042853 | 210 |
| 424 | 3300025925 | Ga0207650_10006028 | Ga0207650_100060284 | 210 |
| 425 | 3300025925 | Ga0207650_10052624 | Ga0207650_100526244 | 210 |
| 426 | 3300025925 | Ga0207650_10270191 | Ga0207650_102701912 | 210 |
| 427 | 3300025926 | Ga0207659_10001020 | Ga0207659_100010205 | 210 |
| 428 | 3300025926 | Ga0207659_10081845 | Ga0207659_100818452 | 210 |
| 429 | 3300025926 | Ga0207659_10101692 | Ga0207659_101016923 | 210 |
| 430 | 3300025926 | Ga0207659_10524011 | Ga0207659_105240111 | 210 |
| 431 | 3300025927 | Ga0207687_10370327 | Ga0207687_103703272 | 210 |
| 432 | 3300025931 | Ga0207644_10002869 | Ga0207644_100028699 | 210 |
| 433 | 3300025931 | Ga0207644_10133510 | Ga0207644_101335103 | 210 |
| 434 | 3300025931 | Ga0207644_10140636 | Ga0207644_101406363 | 210 |
| 435 | 3300025931 | Ga0207644_10211862 | Ga0207644_102118622 | 210 |
| 436 | 3300025931 | Ga0207644_10653531 | Ga0207644_106535311 | 210 |
| 437 | 3300025932 | Ga0207690_10056681 | Ga0207690_100566812 | 210 |
| 438 | 3300025933 | Ga0207706_10005697 | Ga0207706_100056977 | 210 |
| 439 | 3300025933 | Ga0207706_10013190 | Ga0207706_100131904 | 210 |
| 440 | 3300025933 | Ga0207706_10025074 | Ga0207706_100250745 | 210 |
| 441 | 3300025933 | Ga0207706_10133424 | Ga0207706_101334243 | 210 |
| 442 | 3300025933 | Ga0207706_10238601 | Ga0207706_102386012 | 210 |
| 443 | 3300025933 | Ga0207706_10289177 | Ga0207706_102891772 | 210 |
| 444 | 3300025934 | Ga0207686_10104859 | Ga0207686_101048592 | 210 |
| 445 | 3300025935 | Ga0207709_10031682 | Ga0207709_100316824 | 210 |
| 446 | 3300025935 | Ga0207709_10189072 | Ga0207709_101890722 | 210 |
| 447 | 3300025936 | Ga0207670_10059890 | Ga0207670_100598904 | 210 |
| 448 | 3300025937 | Ga0207669_10016651 | Ga0207669_100166514 | 210 |
| 449 | 3300025937 | Ga0207669_10119817 | Ga0207669_101198172 | 210 |
| 450 | 3300025937 | Ga0207669_10154774 | Ga0207669_101547742 | 210 |
| 451 | 3300025937 | Ga0207669_10213210 | Ga0207669_102132101 | 210 |
| 452 | 3300025938 | Ga0207704_10031465 | Ga0207704_100314652 | 210 |
| 453 | 3300025938 | Ga0207704_10080533 | Ga0207704_100805332 | 210 |
| 454 | 3300025938 | Ga0207704_10090514 | Ga0207704_100905143 | 210 |
| 455 | 3300025938 | Ga0207704_10198622 | Ga0207704_101986222 | 210 |
| 456 | 3300025938 | Ga0207704_10406945 | Ga0207704_104069452 | 210 |
| 457 | 3300025938 | Ga0207704_10620604 | Ga0207704_106206041 | 210 |
| 458 | 3300025940 | Ga0207691_10018937 | Ga0207691_100189375 | 210 |
| 459 | 3300025940 | Ga0207691_10046734 | Ga0207691_100467344 | 210 |
| 460 | 3300025940 | Ga0207691_10057157 | Ga0207691_100571574 | 210 |
| 461 | 3300025940 | Ga0207691_10070461 | Ga0207691_100704614 | 210 |
| 462 | 3300025940 | Ga0207691_10109338 | Ga0207691_101093384 | 210 |
| 463 | 3300025940 | Ga0207691_10152760 | Ga0207691_101527602 | 210 |
| 464 | 3300025940 | Ga0207691_10161234 | Ga0207691_101612342 | 210 |
| 465 | 3300025940 | Ga0207691_10260652 | Ga0207691_102606522 | 210 |
| 466 | 3300025941 | Ga0207711_10016105 | Ga0207711_100161055 | 210 |
| 467 | 3300025941 | Ga0207711_10028530 | Ga0207711_100285302 | 210 |
| 468 | 3300025941 | Ga0207711_10066785 | Ga0207711_100667852 | 210 |
| 469 | 3300025941 | Ga0207711_10167208 | Ga0207711_101672082 | 210 |
| 470 | 3300025941 | Ga0207711_10410966 | Ga0207711_104109662 | 210 |
| 471 | 3300025942 | Ga0207689_10000343 | Ga0207689_1000034321 | 210 |
| 472 | 3300025942 | Ga0207689_10036619 | Ga0207689_100366194 | 210 |
| 473 | 3300025944 | Ga0207661_10131420 | Ga0207661_101314202 | 210 |
| 474 | 3300025944 | Ga0207661_10193401 | Ga0207661_101934012 | 210 |
| 475 | 3300025945 | Ga0207679_10179276 | Ga0207679_101792762 | 210 |
| 476 | 3300025949 | Ga0207667_10008525 | Ga0207667_100085254 | 210 |
| 477 | 3300025949 | Ga0207667_10087092 | Ga0207667_100870925 | 210 |
| 478 | 3300025949 | Ga0207667_10126130 | Ga0207667_101261303 | 210 |
| 479 | 3300025960 | Ga0207651_10040657 | Ga0207651_100406574 | 210 |
| 480 | 3300025960 | Ga0207651_10042473 | Ga0207651_100424734 | 210 |
| 481 | 3300025960 | Ga0207651_10099298 | Ga0207651_100992983 | 210 |
| 482 | 3300025960 | Ga0207651_10113733 | Ga0207651_101137334 | 210 |
| 483 | 3300025961 | Ga0207712_10026038 | Ga0207712_100260383 | 210 |
| 484 | 3300025972 | Ga0207668_10024199 | Ga0207668_100241994 | 210 |
| 485 | 3300025972 | Ga0207668_10111433 | Ga0207668_101114332 | 210 |
| 486 | 3300025972 | Ga0207668_10247932 | Ga0207668_102479322 | 210 |
| 487 | 3300025972 | Ga0207668_10265382 | Ga0207668_102653822 | 210 |
| 488 | 3300025981 | Ga0207640_10285872 | Ga0207640_102858722 | 210 |
| 489 | 3300025981 | Ga0207640_10329642 | Ga0207640_103296422 | 210 |
| 490 | 3300025981 | Ga0207640_10848153 | Ga0207640_108481531 | 210 |
| 491 | 3300025986 | Ga0207658_10010730 | Ga0207658_100107302 | 210 |
| 492 | 3300025986 | Ga0207658_10017106 | Ga0207658_100171064 | 210 |
| 493 | 3300025986 | Ga0207658_10088920 | Ga0207658_100889202 | 210 |
| 494 | 3300025986 | Ga0207658_10092939 | Ga0207658_100929392 | 210 |
| 495 | 3300025986 | Ga0207658_10379874 | Ga0207658_103798742 | 210 |
| 496 | 3300026023 | Ga0207677_10025612 | Ga0207677_100256122 | 210 |
| 497 | 3300026023 | Ga0207677_10039592 | Ga0207677_100395924 | 210 |
| 498 | 3300026023 | Ga0207677_10170697 | Ga0207677_101706972 | 210 |
| 499 | 3300026023 | Ga0207677_10306067 | Ga0207677_103060672 | 210 |
| 500 | 3300026035 | Ga0207703_10012605 | Ga0207703_100126055 | 210 |
| 501 | 3300026035 | Ga0207703_10052512 | Ga0207703_100525124 | 210 |
| 502 | 3300026035 | Ga0207703_10069221 | Ga0207703_100692212 | 210 |
| 503 | 3300026041 | Ga0207639_10024945 | Ga0207639_100249453 | 210 |
| 504 | 3300026041 | Ga0207639_10071971 | Ga0207639_100719713 | 210 |
| 505 | 3300026041 | Ga0207639_10072618 | Ga0207639_100726182 | 210 |
| 506 | 3300026041 | Ga0207639_10319221 | Ga0207639_103192212 | 210 |
| 507 | 3300026041 | Ga0207639_10385519 | Ga0207639_103855192 | 210 |
| 508 | 3300026067 | Ga0207678_10017049 | Ga0207678_100170496 | 210 |
| 509 | 3300026067 | Ga0207678_10045799 | Ga0207678_100457993 | 210 |
| 510 | 3300026067 | Ga0207678_10230991 | Ga0207678_102309912 | 210 |
| 511 | 3300026075 | Ga0207708_10013215 | Ga0207708_100132156 | 210 |
| 512 | 3300026075 | Ga0207708_10037030 | Ga0207708_100370304 | 210 |
| 513 | 3300026078 | Ga0207702_10001082 | Ga0207702_100010826 | 210 |
| 514 | 3300026078 | Ga0207702_10023275 | Ga0207702_100232752 | 210 |
| 515 | 3300026078 | Ga0207702_10627028 | Ga0207702_106270282 | 210 |
| 516 | 3300026088 | Ga0207641_10007434 | Ga0207641_100074347 | 210 |
| 517 | 3300026088 | Ga0207641_10018421 | Ga0207641_100184214 | 210 |
| 518 | 3300026088 | Ga0207641_10149902 | Ga0207641_101499023 | 210 |
| 519 | 3300026088 | Ga0207641_11093883 | Ga0207641_110938832 | 210 |
| 520 | 3300026089 | Ga0207648_10002442 | Ga0207648_100024425 | 210 |
| 521 | 3300026089 | Ga0207648_10015728 | Ga0207648_100157284 | 210 |
| 522 | 3300026089 | Ga0207648_10033178 | Ga0207648_100331782 | 210 |
| 523 | 3300026089 | Ga0207648_10057288 | Ga0207648_100572884 | 210 |
| 524 | 3300026089 | Ga0207648_10270460 | Ga0207648_102704602 | 210 |
| 525 | 3300026089 | Ga0207648_10407293 | Ga0207648_104072932 | 210 |
| 526 | 3300026089 | Ga0207648_10633928 | Ga0207648_106339282 | 210 |
| 527 | 3300026089 | Ga0207648_10689681 | Ga0207648_106896812 | 210 |
| 528 | 3300026089 | Ga0207648_10794037 | Ga0207648_107940372 | 210 |
| 529 | 3300026095 | Ga0207676_10019060 | Ga0207676_100190604 | 210 |
| 530 | 3300026095 | Ga0207676_10120794 | Ga0207676_101207941 | 210 |
| 531 | 3300026095 | Ga0207676_10147254 | Ga0207676_101472542 | 210 |
| 532 | 3300026095 | Ga0207676_10307872 | Ga0207676_103078722 | 210 |
| 533 | 3300026116 | Ga0207674_10019423 | Ga0207674_100194236 | 210 |
| 534 | 3300026116 | Ga0207674_10143532 | Ga0207674_101435322 | 210 |
| 535 | 3300026116 | Ga0207674_10245600 | Ga0207674_102456002 | 210 |
| 536 | 3300026116 | Ga0207674_10844564 | Ga0207674_108445641 | 210 |
| 537 | 3300026118 | Ga0207675_100000232 | Ga0207675_1000002327 | 210 |
| 538 | 3300026118 | Ga0207675_100007916 | Ga0207675_1000079167 | 210 |
| 539 | 3300026118 | Ga0207675_100053609 | Ga0207675_1000536094 | 210 |
| 540 | 3300026118 | Ga0207675_100722377 | Ga0207675_1007223772 | 210 |
| 541 | 3300026121 | Ga0207683_10003913 | Ga0207683_100039134 | 210 |
| 542 | 3300026121 | Ga0207683_10046420 | Ga0207683_100464202 | 210 |
| 543 | 3300026121 | Ga0207683_10107610 | Ga0207683_101076104 | 210 |
| 544 | 3300026121 | Ga0207683_10970148 | Ga0207683_109701482 | 210 |
| 545 | 3300026142 | Ga0207698_10010596 | Ga0207698_100105964 | 210 |
| 546 | 3300026142 | Ga0207698_10040003 | Ga0207698_100400033 | 210 |
| 547 | 3300026142 | Ga0207698_10105156 | Ga0207698_101051562 | 210 |
| 548 | 3300026142 | Ga0207698_10164476 | Ga0207698_101644762 | 210 |
| 549 | 3300026142 | Ga0207698_10302496 | Ga0207698_103024962 | 210 |
| 550 | 3300026142 | Ga0207698_11196430 | Ga0207698_111964301 | 210 |
| 551 | 3300028379 | Ga0268266_10125877 | Ga0268266_101258772 | 210 |
| 552 | 3300028380 | Ga0268265_10253132 | Ga0268265_102531322 | 210 |
| 553 | 3300028381 | Ga0268264_10010106 | Ga0268264_100101062 | 210 |
| 554 | 3300028381 | Ga0268264_10034250 | Ga0268264_100342505 | 210 |
| 555 | 3300028381 | Ga0268264_10081280 | Ga0268264_100812802 | 210 |
| 556 | 3300028381 | Ga0268264_10435358 | Ga0268264_104353582 | 210 |
| 557 | 3300028786 | Ga0307517_10087774 | Ga0307517_100877744 | 210 |
| 558 | 3300028786 | Ga0307517_10170316 | Ga0307517_101703162 | 210 |
| 559 | 3300028786 | Ga0307517_10220648 | Ga0307517_102206482 | 210 |
| 560 | 3300028794 | Ga0307515_10000041 | Ga0307515_1000004169 | 210 |
| 561 | 3300028794 | Ga0307515_10034288 | Ga0307515_100342883 | 210 |
| 562 | 3300028794 | Ga0307515_10132464 | Ga0307515_101324642 | 210 |
| 563 | 3300031456 | Ga0307513_10193759 | Ga0307513_101937592 | 210 |
| 564 | 3300031548 | Ga0307408_100484463 | Ga0307408_1004844632 | 210 |
| 565 | 3300031730 | Ga0307516_10005702 | Ga0307516_100057026 | 210 |
| 566 | 3300031730 | Ga0307516_10149379 | Ga0307516_101493792 | 210 |
| 567 | 3300031911 | Ga0307412_11214833 | Ga0307412_112148331 | 210 |
| 568 | 3300034820 | Ga0373959_0043176 | Ga0373959_0043176_213_857 | 210 |
| 569 | 3300034957 | Ga0373938_0112521 | Ga0373938_0112521_23_676 | 210 |
| 570 | 3300035086 | Ga0373934_0010718 | Ga0373934_0010718_711_1346 | 210 |
| 571 | 3300035088 | Ga0373940_0053505 | Ga0373940_0053505_302_955 | 210 |
| 572 | 3300035089 | Ga0373944_0079050 | Ga0373944_0079050_314_946 | 210 |
| 573 | 3300035090 | Ga0373949_0055560 | Ga0373949_0055560_171_824 | 210 |
| 574 | 3300035120 | Ga0373957_0078029 | Ga0373957_0078029_619_1275 | 210 |
| 575 | 3300035170 | Ga0373943_0203775 | Ga0373943_0203775_11_667 | 210 |
| 576 | 3300035170 | Ga0373943_0350208 | Ga0373943_0350208_142_774 | 210 |
| 577 | 3300035172 | Ga0373955_0110189 | Ga0373955_0110189_817_1473 | 210 |
| 578 | 3300035172 | Ga0373955_0122888 | Ga0373955_0122888_813_1469 | 210 |
| 579 | 3300035241 | Ga0373961_0123503 | Ga0373961_0123503_59_712 | 210 |
| 580 | 3300035691 | Ga0373931_0003424 | Ga0373931_0003424_3987_4640 | 210 |
| 581 | 3300035691 | Ga0373931_0009919 | Ga0373931_0009919_1077_1709 | 210 |
| 582 | 3300035692 | Ga0373935_0571463 | Ga0373935_0571463_49_705 | 210 |
| 583 | 3300035695 | Ga0373927_0136149 | Ga0373927_0136149_807_1439 | 210 |
| 584 | 3300037068 | Ga0373925_0021850 | Ga0373925_0021850_855_1493 | 210 |
| 585 | 3300037471 | Ga0395905_0042101 | Ga0395905_0042101_2949_3587 | 210 |
| 586 | 3300037471 | Ga0395905_0045108 | Ga0395905_0045108_264_896 | 210 |
| 587 | 3300039437 | Ga0436365_0276042 | Ga0436365_0276042_442_1095 | 210 |
| 588 | 3300039447 | Ga0436361_0048138 | Ga0436361_0048138_1443_2075 | 210 |
| 589 | 3300039450 | Ga0436363_0739873 | Ga0436363_0739873_107_760 | 210 |
| 590 | 3300041463 | Ga0451804_0085032 | Ga0451804_0085032_147_806 | 210 |
| 591 | 3300041491 | Ga0451833_0991326 | Ga0451833_0991326_12_653 | 210 |
| 592 | 3300041496 | Ga0451839_1168416 | Ga0451839_1168416_452_1090 | 210 |
| 593 | 3300042007 | Ga0439449_0205659 | Ga0439449_0205659_34_666 | 210 |
| 594 | 3300042011 | Ga0439454_021318 | Ga0439454_021318_114_752 | 210 |
| 595 | 3300042127 | Ga0450890_001619 | Ga0450890_001619_80_718 | 210 |
| 596 | 3300042438 | Ga0439459_0000861 | Ga0439459_0000861_116_754 | 210 |
| 597 | 3300042876 | Ga0451577_0079292 | Ga0451577_0079292_417_1049 | 210 |
| 598 | 3300044901 | Ga0466960_0139588 | Ga0466960_0139588_247_879 | 210 |
| 599 | 3300045051 | Ga0451576_0426833 | Ga0451576_0426833_452_1084 | 210 |
| 600 | 3300045051 | Ga0451576_1072218 | Ga0451576_1072218_165_818 | 210 |
| 601 | 3300045051 | Ga0451576_1222631 | Ga0451576_1222631_72_725 | 210 |
| 602 | 3300046457 | Ga0495590_0012205 | Ga0495590_0012205_2157_2795 | 210 |
| 603 | 3300046459 | Ga0495629_0080896 | Ga0495629_0080896_34_690 | 210 |
| 604 | 3300046463 | Ga0495653_0439764 | Ga0495653_0439764_76_732 | 210 |
| 605 | 3300046472 | Ga0495580_0432022 | Ga0495580_0432022_149_805 | 210 |
| 606 | 3300046492 | Ga0495585_0014070 | Ga0495585_0014070_3304_3936 | 210 |
| 607 | 3300046511 | Ga0495608_0337694 | Ga0495608_0337694_32_688 | 210 |
| 608 | 3300046535 | Ga0495586_0037906 | Ga0495586_0037906_1813_2445 | 210 |
| 609 | 3300046537 | Ga0495598_0022882 | Ga0495598_0022882_661_1311 | 210 |
| 610 | 3300046681 | Ga0495647_0046336 | Ga0495647_0046336_543_1199 | 210 |
| 611 | 3300046683 | Ga0495658_0041962 | Ga0495658_0041962_1482_2138 | 210 |
| 612 | 3300046683 | Ga0495658_0088969 | Ga0495658_0088969_812_1468 | 210 |
| 613 | 3300046683 | Ga0495658_0419848 | Ga0495658_0419848_81_737 | 210 |
| 614 | 3300046691 | Ga0495670_0046274 | Ga0495670_0046274_736_1374 | 210 |
| 615 | 3300046692 | Ga0495671_0214410 | Ga0495671_0214410_116_754 | 210 |
| 616 | 3300046810 | Ga0495660_0037192 | Ga0495660_0037192_1671_2309 | 210 |
| 617 | 3300047443 | Ga0495687_000799 | Ga0495687_000799_4378_5016 | 210 |
| 618 | 3300048088 | Ga0495602_0396162 | Ga0495602_0396162_282_938 | 210 |
| 619 | 3300048903 | Ga0496100_0286051 | Ga0496100_0286051_470_1123 | 210 |
| 620 | 3300048904 | Ga0496101_0023149 | Ga0496101_0023149_424_1077 | 210 |
| 621 | 3300048905 | Ga0496102_0089337 | Ga0496102_0089337_2077_2730 | 210 |
| 622 | 3300048906 | Ga0496103_0060726 | Ga0496103_0060726_1593_2246 | 210 |
| 623 | 3300048908 | Ga0496105_0283982 | Ga0496105_0283982_373_1008 | 210 |
| 624 | 3300048909 | Ga0496106_0041031 | Ga0496106_0041031_2669_3322 | 210 |
| 625 | 3300048911 | Ga0496108_0159048 | Ga0496108_0159048_465_1121 | 210 |
| 626 | 3300048911 | Ga0496108_0186440 | Ga0496108_0186440_407_1063 | 210 |
| 627 | 3300048912 | Ga0496109_0482447 | Ga0496109_0482447_201_854 | 210 |
| 628 | 3300048913 | Ga0496110_0030176 | Ga0496110_0030176_3774_4427 | 210 |
| 629 | 3300048914 | Ga0496111_0051890 | Ga0496111_0051890_1763_2416 | 210 |
| 630 | 3300048917 | Ga0496114_0142909 | Ga0496114_0142909_957_1613 | 210 |
| 631 | 3300048917 | Ga0496114_0275012 | Ga0496114_0275012_211_864 | 210 |
| 632 | 3300048918 | Ga0496115_0083052 | Ga0496115_0083052_1561_2214 | 210 |
| 633 | 3300048927 | Ga0496124_0000125 | Ga0496124_0000125_19944_20576 | 210 |
| 634 | 3300048928 | Ga0496125_0166524 | Ga0496125_0166524_201_839 | 210 |
| 635 | 3300049649 | Ga0501198_000015 | Ga0501198_000015_91846_92484 | 210 |
| 636 | 3300049662 | Ga0501222_000045 | Ga0501222_000045_36119_36757 | 210 |
| 637 | 3300049822 | Ga0501035_0161616 | Ga0501035_0161616_807_1439 | 210 |
| 638 | 3300050489 | nmdc:mga03683_156082_c1 | nmdc:mga03683_156082_c1_137_775 | 210 |
| 639 | 3300050489 | nmdc:mga03683_202589_c1 | nmdc:mga03683_202589_c1_73_711 | 210 |
| 640 | 3300050489 | nmdc:mga03683_41971_c1 | nmdc:mga03683_41971_c1_985_1617 | 210 |
| 641 | 3300050490 | nmdc:mga03n38_285837_c1 | nmdc:mga03n38_285837_c1_113_751 | 210 |
| 642 | 3300050490 | nmdc:mga03n38_72435_c1 | nmdc:mga03n38_72435_c1_440_1078 | 210 |
| 643 | 3300050493 | nmdc:mga0k408_22389_c1 | nmdc:mga0k408_22389_c1_2812_3447 | 210 |
| 644 | 3300050493 | nmdc:mga0k408_49852_c1 | nmdc:mga0k408_49852_c1_639_1271 | 210 |
| 645 | 3300050493 | nmdc:mga0k408_56713_c1 | nmdc:mga0k408_56713_c1_196_834 | 210 |
| 646 | 3300050493 | nmdc:mga0k408_835_c1 | nmdc:mga0k408_835_c1_10324_10962 | 210 |
| 647 | 3300050494 | nmdc:mga06z11_248018_c1 | nmdc:mga06z11_248018_c1_240_881 | 210 |
| 648 | 3300050494 | nmdc:mga06z11_30425_c1 | nmdc:mga06z11_30425_c1_1709_2347 | 210 |
| 649 | 3300050494 | nmdc:mga06z11_4334_c1 | nmdc:mga06z11_4334_c1_2978_3616 | 210 |
| 650 | 3300050495 | nmdc:mga04h51_30817_c1 | nmdc:mga04h51_30817_c1_523_1155 | 210 |
| 651 | 3300050496 | nmdc:mga07m45_10920_c1 | nmdc:mga07m45_10920_c1_3857_4492 | 210 |
| 652 | 3300050496 | nmdc:mga07m45_14822_c1 | nmdc:mga07m45_14822_c1_264_902 | 210 |
| 653 | 3300050496 | nmdc:mga07m45_33478_c1 | nmdc:mga07m45_33478_c1_1734_2366 | 210 |
| 654 | 3300050496 | nmdc:mga07m45_34578_c1 | nmdc:mga07m45_34578_c1_2077_2715 | 210 |
| 655 | 3300050496 | nmdc:mga07m45_62872_c1 | nmdc:mga07m45_62872_c1_327_968 | 210 |
| 656 | 3300050496 | nmdc:mga07m45_692_c1 | nmdc:mga07m45_692_c1_10325_10963 | 210 |
| 657 | 3300050496 | nmdc:mga07m45_897_c1 | nmdc:mga07m45_897_c1_4859_5497 | 210 |
| 658 | 3300050516 | nmdc:mga0sz30_200958_c1 | nmdc:mga0sz30_200958_c1_199_837 | 210 |
| 659 | 3300050516 | nmdc:mga0sz30_73910_c1 | nmdc:mga0sz30_73910_c1_403_1041 | 210 |
| 660 | 3300053085 | Ga0495619_0402156 | Ga0495619_0402156_99_755 | 210 |
| 661 | 3300053156 | Ga0500622_0001025 | Ga0500622_0001025_5655_6293 | 210 |
| 662 | 3300003316 | rootH1_10023119 | rootH1_100231194 | 211 |
| 663 | 3300003323 | rootH1_10074880 | rootH1_100748803 | 211 |
| 664 | 3300003347 | JGI26128J50194_1004221 | JGI26128J50194_10042211 | 211 |
| 665 | 3300005328 | Ga0070676_10001637 | Ga0070676_100016375 | 211 |
| 666 | 3300005334 | Ga0068869_100059355 | Ga0068869_1000593552 | 211 |
| 667 | 3300005338 | Ga0068868_100021554 | Ga0068868_1000215542 | 211 |
| 668 | 3300005344 | Ga0070661_100275845 | Ga0070661_1002758451 | 211 |
| 669 | 3300005354 | Ga0070675_100062953 | Ga0070675_1000629532 | 211 |
| 670 | 3300005356 | Ga0070674_100757619 | Ga0070674_1007576191 | 211 |
| 671 | 3300005364 | Ga0070673_100015622 | Ga0070673_1000156221 | 211 |
| 672 | 3300005364 | Ga0070673_100069782 | Ga0070673_1000697824 | 211 |
| 673 | 3300005456 | Ga0070678_100030242 | Ga0070678_1000302424 | 211 |
| 674 | 3300005457 | Ga0070662_100056699 | Ga0070662_1000566992 | 211 |
| 675 | 3300005459 | Ga0068867_100003775 | Ga0068867_1000037755 | 211 |
| 676 | 3300005459 | Ga0068867_100384374 | Ga0068867_1003843741 | 211 |
| 677 | 3300005543 | Ga0070672_100011507 | Ga0070672_1000115075 | 211 |
| 678 | 3300005543 | Ga0070672_100027376 | Ga0070672_1000273764 | 211 |
| 679 | 3300005577 | Ga0068857_100940600 | Ga0068857_1009406001 | 211 |
| 680 | 3300005616 | Ga0068852_100475216 | Ga0068852_1004752161 | 211 |
| 681 | 3300005840 | Ga0068870_10269817 | Ga0068870_102698172 | 211 |
| 682 | 3300005843 | Ga0068860_100218629 | Ga0068860_1002186292 | 211 |
| 683 | 3300006048 | Ga0075363_100371507 | Ga0075363_1003715071 | 211 |
| 684 | 3300006195 | Ga0075366_10182494 | Ga0075366_101824941 | 211 |
| 685 | 3300006881 | Ga0068865_100318483 | Ga0068865_1003184832 | 211 |
| 686 | 3300009553 | Ga0105249_10882461 | Ga0105249_108824612 | 211 |
| 687 | 3300013308 | Ga0157375_10073139 | Ga0157375_100731394 | 211 |
| 688 | 3300014326 | Ga0157380_10423719 | Ga0157380_104237192 | 211 |
| 689 | 3300025907 | Ga0207645_10003150 | Ga0207645_100031507 | 211 |
| 690 | 3300025907 | Ga0207645_10157636 | Ga0207645_101576362 | 211 |
| 691 | 3300025908 | Ga0207643_10049299 | Ga0207643_100492993 | 211 |
| 692 | 3300025926 | Ga0207659_10764822 | Ga0207659_107648221 | 211 |
| 693 | 3300025926 | Ga0207659_10839196 | Ga0207659_108391962 | 211 |
| 694 | 3300025933 | Ga0207706_10010641 | Ga0207706_100106412 | 211 |
| 695 | 3300025933 | Ga0207706_10422615 | Ga0207706_104226151 | 211 |
| 696 | 3300025937 | Ga0207669_10918738 | Ga0207669_109187381 | 211 |
| 697 | 3300025938 | Ga0207704_10155777 | Ga0207704_101557772 | 211 |
| 698 | 3300025940 | Ga0207691_10041148 | Ga0207691_100411484 | 211 |
| 699 | 3300025940 | Ga0207691_10049285 | Ga0207691_100492852 | 211 |
| 700 | 3300025942 | Ga0207689_10072103 | Ga0207689_100721034 | 211 |
| 701 | 3300025960 | Ga0207651_10065414 | Ga0207651_100654142 | 211 |
| 702 | 3300025960 | Ga0207651_10185827 | Ga0207651_101858272 | 211 |
| 703 | 3300025972 | Ga0207668_10109831 | Ga0207668_101098312 | 211 |
| 704 | 3300026089 | Ga0207648_10007746 | Ga0207648_100077464 | 211 |
| 705 | 3300026089 | Ga0207648_10325212 | Ga0207648_103252122 | 211 |
| 706 | 3300026116 | Ga0207674_10014024 | Ga0207674_100140246 | 211 |
| 707 | 3300026121 | Ga0207683_10172792 | Ga0207683_101727922 | 211 |
| 708 | 3300026121 | Ga0207683_10597073 | Ga0207683_105970732 | 211 |
| 709 | 3300026142 | Ga0207698_10104453 | Ga0207698_101044533 | 211 |
| 710 | 3300027471 | Ga0209995_1043284 | Ga0209995_10432841 | 211 |
| 711 | 3300027543 | Ga0209999_1055400 | Ga0209999_10554001 | 211 |
| 712 | 3300027695 | Ga0209966_1000031 | Ga0209966_100003122 | 211 |
| 713 | 3300028381 | Ga0268264_10448371 | Ga0268264_104483712 | 211 |
| 714 | 3300028786 | Ga0307517_10058977 | Ga0307517_100589774 | 211 |
| 715 | 3300031456 | Ga0307513_10012452 | Ga0307513_100124524 | 211 |
| 716 | 3300031730 | Ga0307516_10000181 | Ga0307516_100001812 | 211 |
| 717 | 3300037418 | Ga0395900_0000109 | Ga0395900_0000109_69297_69932 | 211 |
| 718 | 3300037466 | Ga0395898_0001529 | Ga0395898_0001529_5177_5812 | 211 |
| 719 | 3300037471 | Ga0395905_0007151 | Ga0395905_0007151_5330_5965 | 211 |
| 720 | 3300037471 | Ga0395905_0019669 | Ga0395905_0019669_680_1315 | 211 |
| 721 | 3300042876 | Ga0451577_0031026 | Ga0451577_0031026_1991_2626 | 211 |
| 722 | 3300044656 | Ga0466969_0000228 | Ga0466969_0000228_14896_15531 | 211 |
| 723 | 3300044656 | Ga0466969_0002471 | Ga0466969_0002471_7410_8045 | 211 |
| 724 | 3300044656 | Ga0466969_0101781 | Ga0466969_0101781_343_978 | 211 |
| 725 | 3300044658 | Ga0466972_0000570 | Ga0466972_0000570_1930_2565 | 211 |
| 726 | 3300044658 | Ga0466972_0021412 | Ga0466972_0021412_354_989 | 211 |
| 727 | 3300044683 | Ga0466965_0048338 | Ga0466965_0048338_1052_1687 | 211 |
| 728 | 3300044684 | Ga0466966_0002199 | Ga0466966_0002199_7937_8572 | 211 |
| 729 | 3300044684 | Ga0466966_0046271 | Ga0466966_0046271_1378_2013 | 211 |
| 730 | 3300044693 | Ga0466961_0007260 | Ga0466961_0007260_1963_2598 | 211 |
| 731 | 3300044693 | Ga0466961_0095907 | Ga0466961_0095907_685_1320 | 211 |
| 732 | 3300044693 | Ga0466961_0114823 | Ga0466961_0114823_260_895 | 211 |
| 733 | 3300044694 | Ga0466963_0001246 | Ga0466963_0001246_445_1080 | 211 |
| 734 | 3300044706 | Ga0466964_0000493 | Ga0466964_0000493_8357_8992 | 211 |
| 735 | 3300044719 | Ga0466971_0005061 | Ga0466971_0005061_2810_3445 | 211 |
| 736 | 3300044719 | Ga0466971_0283345 | Ga0466971_0283345_30_665 | 211 |
| 737 | 3300044735 | Ga0466968_0035334 | Ga0466968_0035334_1266_1913 | 211 |
| 738 | 3300044765 | Ga0466970_0017512 | Ga0466970_0017512_807_1442 | 211 |
| 739 | 3300044842 | Ga0466957_0027573 | Ga0466957_0027573_1773_2408 | 211 |
| 740 | 3300044901 | Ga0466960_0020740 | Ga0466960_0020740_1659_2294 | 211 |
| 741 | 3300045049 | Ga0466959_0007627 | Ga0466959_0007627_1963_2598 | 211 |
| 742 | 3300045049 | Ga0466959_0042147 | Ga0466959_0042147_2521_3156 | 211 |
| 743 | 3300045049 | Ga0466959_0043963 | Ga0466959_0043963_2589_3224 | 211 |
| 744 | 3300045836 | Ga0466958_0331521 | Ga0466958_0331521_317_952 | 211 |
| 745 | 3300045976 | Ga0466967_0066436 | Ga0466967_0066436_1989_2624 | 211 |
| 746 | 3300046537 | Ga0495598_0067240 | Ga0495598_0067240_262_903 | 211 |
| 747 | 3300048924 | Ga0496121_0502785 | Ga0496121_0502785_57_698 | 211 |
| 748 | 3300049742 | Ga0501080_0428265 | Ga0501080_0428265_375_1046 | 211 |
| 749 | 3300049742 | Ga0501080_0948902 | Ga0501080_0948902_44_715 | 211 |
| 750 | 3300050493 | nmdc:mga0k408_287195_c1 | nmdc:mga0k408_287195_c1_300_935 | 211 |
| 751 | 3300050496 | nmdc:mga07m45_297112_c1 | nmdc:mga07m45_297112_c1_258_893 | 211 |
| 752 | 3300053137 | Ga0500561_0038442 | Ga0500561_0038442_336_977 | 211 |
| 753 | 3300061719 | Ga0466962_0068448 | Ga0466962_0068448_669_1304 | 211 |
| 754 | 3300013297 | Ga0157378_10081708 | Ga0157378_100817085 | 212 |
| 755 | 3300026067 | Ga0207678_10006858 | Ga0207678_100068585 | 212 |
| 756 | 3300031507 | Ga0307509_10120786 | Ga0307509_101207864 | 212 |
| 757 | 3300031548 | Ga0307408_100164821 | Ga0307408_1001648212 | 212 |
| 758 | 3300032002 | Ga0307416_100448605 | Ga0307416_1004486052 | 212 |
| 759 | 3300042876 | Ga0451577_0288645 | Ga0451577_0288645_579_1223 | 212 |
| 760 | 3300044712 | Ga0453684_0515157 | Ga0453684_0515157_383_1027 | 212 |
| 761 | 3300049569 | Ga0501032_0112919 | Ga0501032_0112919_169_813 | 212 |
| 762 | 3300049579 | Ga0501043_0000027 | Ga0501043_0000027_47275_47919 | 212 |
| 763 | 3300049580 | Ga0501046_0000034 | Ga0501046_0000034_47271_47915 | 212 |
| 764 | 3300049581 | Ga0501047_0000042 | Ga0501047_0000042_128685_129329 | 212 |
| 765 | 3300049582 | Ga0501048_0000019 | Ga0501048_0000019_61607_62251 | 212 |
| 766 | 3300049824 | Ga0501045_0002741 | Ga0501045_0002741_11348_11992 | 212 |
| 767 | 3300003759 | Ga0055525_1000026 | Ga0055525_100002620 | 213 |
| 768 | 3300013308 | Ga0157375_10078179 | Ga0157375_100781794 | 213 |
| 769 | 3300014968 | Ga0157379_10203607 | Ga0157379_102036073 | 213 |
| 770 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051574 | 213 |
| 771 | 3300025256 | Ga0209759_1007453 | Ga0209759_10074532 | 213 |
| 772 | 3300028794 | Ga0307515_10000187 | Ga0307515_10000187106 | 213 |
| 773 | 3300031649 | Ga0307514_10001419 | Ga0307514_1000141918 | 213 |
| 774 | 3300037471 | Ga0395905_0027072 | Ga0395905_0027072_4202_4846 | 213 |
| 775 | 3300039447 | Ga0436361_0831660 | Ga0436361_0831660_63_707 | 213 |
| 776 | 3300045051 | Ga0451576_0130115 | Ga0451576_0130115_1213_1854 | 213 |
| 777 | 3300048924 | Ga0496121_0007493 | Ga0496121_0007493_2535_3194 | 213 |
| 778 | 3300039447 | Ga0436361_0720979 | Ga0436361_0720979_11447_12121 | 214 |
| 779 | 3300042876 | Ga0451577_0000877 | Ga0451577_0000877_32305_32958 | 214 |
| 780 | 3300044712 | Ga0453684_0011227 | Ga0453684_0011227_2389_3042 | 214 |
| 781 | 3300059424 | Ga0590075_076400 | Ga0590075_076400_14_664 | 214 |
| 782 | 3300046454 | Ga0495592_0005162 | Ga0495592_0005162_8586_9242 | 216 |
| 783 | 3300042015 | Ga0439462_0110993 | Ga0439462_0110993_34_687 | 217 |
| 784 | 3300002077 | JGI24744J21845_10026344 | JGI24744J21845_100263441 | 225 |
| 785 | 3300059421 | Ga0590071_002007 | Ga0590071_002007_3358_4098 | 225 |
| 786 | 3300059423 | Ga0590074_003679 | Ga0590074_003679_449_1189 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9767 | 16 | 224 |
| 2cz3-assembly1.cif.gz_A | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) | 0.9656 | 14 | 224 |
| 4pxo-assembly1.cif.gz_B | crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) | 0.9596 | 16 | 225 |
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9586 | 16 | 224 |
| 2cz2-assembly1.cif.gz_A-2 | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) | 0.9496 | 14 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7TUZ4_3_77_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9728 | 15 | 76 | 3.40.30.10 |
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9678 | 15 | 97 | 3.40.30.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9672 | 97 | 224 | 1.20.1050.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9669 | 15 | 90 | 3.40.30.10 |
| af_A0A1D6HAW8_13_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9668 | 18 | 83 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A429MKP1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9835 | 16 | 110 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A1AYE6-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9823 | 15 | 225 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A519JGG1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9821 | 16 | 129 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A5N7S147-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9816 | 15 | 225 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A2W5DZC1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9792 | 16 | 224 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar