F480812

General Info

Members Datasets Scaffolds Average Seq Length
786 316 786 214

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_002007|Ga0590071_002007_3358_4098
Length 246
Sequence MPMPADGHACLATQRRRPTLQRLRRGRSFYTAGMQLYSYFRSSASFRVRIALALKGLDYEYLPIHLLKNEQSGADYGALSPSRLVPLLTDGDRVLSQSLAIMEYLDERHPQPPLLPPDAAGRARVRSLALDVACEIHPLNNLRVLRYLVHELKVPEEAKNGWYRHWVETGLDAIERQLAGHPATGSFCHGDLPTLADCVLVPQVFNAQRMHCRLDHVPTVMRIFAACMALEAFRRAQPSACPDAEP

Samples

Sample ID Description Type Environment
1 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 0
Rhizoplane 2.16
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10026344 3300002077 Bacteria 1129
2 JGI25156J39149_1000229 3300002705 Bacteria 38688
3 JGI25154J39366_1000931 3300002738 Bacteria 12213
4 JGI25157J39369_1000235 3300002741 Bacteria 42844
5 rootH1_10003054 3300003316 Bacteria 5923
6 rootH1_10023119 3300003316 Bacteria 5381
7 rootH1_10034201 3300003316 Bacteria 1912
8 rootH1_10034201 3300003323 Bacteria 9076
9 rootH2_10104343 3300003320 Bacteria 3262
10 rootL2_10002813 3300003322 Bacteria 19046
11 rootL2_10047266 3300003322 Bacteria 1687
12 rootH1_10041586 3300003323 Bacteria 5524
13 rootH1_10074880 3300003323 Bacteria 4408
14 JGI26128J50194_1004221 3300003347 Bacteria 949
15 JGI25161J50226_1014426 3300003374 Bacteria 885
16 Ga0055539_1000428 3300003752 Bacteria 15085
17 Ga0055539_1001832 3300003752 Bacteria 3610
18 Ga0055533_1000221 3300003756 Bacteria 40020
19 Ga0055525_1000026 3300003759 Bacteria 345798
20 Ga0055525_1001640 3300003759 Bacteria 3469
21 Ga0055524_1000755 3300003775 Bacteria 21925
22 Ga0055531_10003254 3300003794 Bacteria 10424
23 Ga0055543_1002246 3300004625 Bacteria 6546
24 Ga0065165_1000431 3300005262 Bacteria 65970
25 Ga0065707_10102460 3300005295 Bacteria 2804
26 Ga0070658_10229733 3300005327 Bacteria 1571
27 Ga0070676_10001637 3300005328 Bacteria 11383
28 Ga0070676_10057916 3300005328 Bacteria 2294
29 Ga0070676_10078624 3300005328 Bacteria 1996
30 Ga0070676_10371765 3300005328 Bacteria 988
31 Ga0070690_100024053 3300005330 Bacteria 3743
32 Ga0070690_100040993 3300005330 Bacteria 2930
33 Ga0070670_100000478 3300005331 Bacteria 32196
34 Ga0070670_100084820 3300005331 Bacteria 2721
35 Ga0070670_100314796 3300005331 Bacteria 1370
36 Ga0070670_100658783 3300005331 Bacteria 939
37 Ga0070677_10005408 3300005333 Bacteria 4207
38 Ga0070677_10054323 3300005333 Bacteria 1631
39 Ga0070677_10062364 3300005333 Bacteria 1542
40 Ga0068869_100000634 3300005334 Bacteria 19860
41 Ga0068869_100036853 3300005334 Bacteria 3474
42 Ga0068869_100059355 3300005334 Bacteria 2800
43 Ga0068869_100294646 3300005334 Bacteria 1308
44 Ga0070666_10137532 3300005335 Bacteria 1700
45 Ga0070680_100010188 3300005336 Bacteria 7248
46 Ga0068868_100021554 3300005338 Bacteria 4853
47 Ga0068868_100031391 3300005338 Bacteria 4080
48 Ga0068868_100045362 3300005338 Bacteria 3438
49 Ga0068868_100050237 3300005338 Bacteria 3274
50 Ga0068868_100061100 3300005338 Bacteria 2985
51 Ga0068868_100150905 3300005338 Bacteria 1914
52 Ga0068868_100282754 3300005338 Bacteria 1405
53 Ga0068868_100702040 3300005338 Bacteria 905
54 Ga0070660_100023264 3300005339 Bacteria 4590
55 Ga0070660_100024849 3300005339 Bacteria 4450
56 Ga0070660_100028660 3300005339 Bacteria 4167
57 Ga0070687_100167540 3300005343 Bacteria 1304
58 Ga0070661_100015724 3300005344 Bacteria 5341
59 Ga0070661_100035161 3300005344 Bacteria 3637
60 Ga0070661_100151608 3300005344 Bacteria 1752
61 Ga0070661_100180944 3300005344 Bacteria 1604
62 Ga0070661_100275845 3300005344 Bacteria 1303
63 Ga0070661_100285742 3300005344 Bacteria 1281
64 Ga0070668_100015357 3300005347 Bacteria 5723
65 Ga0070668_100100651 3300005347 Bacteria 2290
66 Ga0070668_100104455 3300005347 Bacteria 2248
67 Ga0070668_100231891 3300005347 Bacteria 1526
68 Ga0070668_100438813 3300005347 Bacteria 1120
69 Ga0070669_100008698 3300005353 Bacteria 7242
70 Ga0070669_100019362 3300005353 Bacteria 4861
71 Ga0070669_100019488 3300005353 Bacteria 4845
72 Ga0070675_100008419 3300005354 Bacteria 8005
73 Ga0070675_100008756 3300005354 Bacteria 7862
74 Ga0070675_100018803 3300005354 Bacteria 5500
75 Ga0070675_100062953 3300005354 Bacteria 3066
76 Ga0070675_100066859 3300005354 Bacteria 2973
77 Ga0070675_100072719 3300005354 Bacteria 2854
78 Ga0070671_100001871 3300005355 Bacteria 16082
79 Ga0070671_100022795 3300005355 Bacteria 5115
80 Ga0070671_100023281 3300005355 Bacteria 5067
81 Ga0070671_100081436 3300005355 Bacteria 2706
82 Ga0070671_100115370 3300005355 Bacteria 2258
83 Ga0070671_100146185 3300005355 Bacteria 1995
84 Ga0070674_100002622 3300005356 Bacteria 9945
85 Ga0070674_100052006 3300005356 Bacteria 2824
86 Ga0070674_100240691 3300005356 Bacteria 1416
87 Ga0070674_100418154 3300005356 Bacteria 1099
88 Ga0070674_100757619 3300005356 Bacteria 835
89 Ga0070673_100015622 3300005364 Bacteria 5339
90 Ga0070673_100032060 3300005364 Bacteria 3951
91 Ga0070673_100069782 3300005364 Bacteria 2818
92 Ga0070673_100120597 3300005364 Bacteria 2187
93 Ga0070673_100600895 3300005364 Bacteria 1003
94 Ga0070673_100669018 3300005364 Bacteria 951
95 Ga0070673_100693642 3300005364 Bacteria 935
96 Ga0070659_100037361 3300005366 Bacteria 3785
97 Ga0070659_100098873 3300005366 Bacteria 2346
98 Ga0070659_100459730 3300005366 Bacteria 1081
99 Ga0070667_100027101 3300005367 Bacteria 4768
100 Ga0070667_100027115 3300005367 Bacteria 4767
101 Ga0070667_100401941 3300005367 Bacteria 1247
102 Ga0070667_100441293 3300005367 Bacteria 1189
103 Ga0070667_100453833 3300005367 Bacteria 1171
104 Ga0070663_100008101 3300005455 Bacteria 6445
105 Ga0070663_100031838 3300005455 Bacteria 3629
106 Ga0070663_100168412 3300005455 Bacteria 1691
107 Ga0070663_100487599 3300005455 Bacteria 1021
108 Ga0070678_100002166 3300005456 Bacteria 10662
109 Ga0070678_100010391 3300005456 Bacteria 5683
110 Ga0070678_100030242 3300005456 Bacteria 3721
111 Ga0070678_100054351 3300005456 Bacteria 2917
112 Ga0070678_100276857 3300005456 Bacteria 1417
113 Ga0070662_100002819 3300005457 Bacteria 10782
114 Ga0070662_100021597 3300005457 Bacteria 4397
115 Ga0070662_100056699 3300005457 Bacteria 2845
116 Ga0070662_100094061 3300005457 Bacteria 2256
117 Ga0070662_100096724 3300005457 Bacteria 2227
118 Ga0070681_11202621 3300005458 Bacteria 680
119 Ga0068867_100001470 3300005459 Bacteria 16330
120 Ga0068867_100002200 3300005459 Bacteria 13677
121 Ga0068867_100003775 3300005459 Bacteria 10663
122 Ga0068867_100049528 3300005459 Bacteria 3093
123 Ga0068867_100140542 3300005459 Bacteria 1887
124 Ga0068867_100384374 3300005459 Bacteria 1180
125 Ga0068867_100579563 3300005459 Bacteria 976
126 Ga0070685_10244394 3300005466 Bacteria 1186
127 Ga0070706_100002689 3300005467 Bacteria 17802
128 Ga0070707_100048312 3300005468 Bacteria 4077
129 Ga0070699_100074494 3300005518 Bacteria 2954
130 Ga0070679_100042692 3300005530 Bacteria 4516
131 Ga0070684_100425217 3300005535 Bacteria 1226
132 Ga0068853_100016063 3300005539 Bacteria 6156
133 Ga0068853_100021509 3300005539 Bacteria 5381
134 Ga0068853_100081187 3300005539 Bacteria 2838
135 Ga0068853_100232642 3300005539 Bacteria 1686
136 Ga0070672_100011507 3300005543 Bacteria 6172
137 Ga0070672_100027376 3300005543 Bacteria 4251
138 Ga0070672_100029940 3300005543 Bacteria 4086
139 Ga0070672_100043972 3300005543 Bacteria 3448
140 Ga0070672_100057372 3300005543 Bacteria 3056
141 Ga0070672_100061536 3300005543 Bacteria 2960
142 Ga0070672_100123380 3300005543 Bacteria 2123
143 Ga0070672_100142144 3300005543 Bacteria 1980
144 Ga0070672_100216190 3300005543 Bacteria 1607
145 Ga0070672_100456144 3300005543 Bacteria 1101
146 Ga0070686_100177666 3300005544 Bacteria 1510
147 Ga0070693_100337299 3300005547 Bacteria 1028
148 Ga0070665_100071804 3300005548 Bacteria 3468
149 Ga0068855_100017005 3300005563 Bacteria 8746
150 Ga0068855_100224045 3300005563 Bacteria 2108
151 Ga0070664_100121906 3300005564 Bacteria 2284
152 Ga0070664_100261449 3300005564 Bacteria 1557
153 Ga0070664_100273003 3300005564 Bacteria 1523
154 Ga0070664_100574884 3300005564 Bacteria 1044
155 Ga0068857_100019168 3300005577 Bacteria 6005
156 Ga0068857_100029410 3300005577 Bacteria 4848
157 Ga0068857_100070843 3300005577 Bacteria 3106
158 Ga0068857_100940600 3300005577 Bacteria 830
159 Ga0068854_100064026 3300005578 Bacteria 2670
160 Ga0068854_100075445 3300005578 Bacteria 2476
161 Ga0068854_100851627 3300005578 Bacteria 798
162 Ga0068856_100005428 3300005614 Bacteria 12566
163 Ga0068856_100035104 3300005614 Bacteria 4913
164 Ga0068856_100066292 3300005614 Bacteria 3568
165 Ga0070702_100007031 3300005615 Bacteria 5367
166 Ga0068852_100007345 3300005616 Bacteria 8039
167 Ga0068852_100019874 3300005616 Bacteria 5327
168 Ga0068852_100048007 3300005616 Bacteria 3646
169 Ga0068852_100070412 3300005616 Bacteria 3068
170 Ga0068852_100072637 3300005616 Bacteria 3024
171 Ga0068852_100131954 3300005616 Bacteria 2301
172 Ga0068852_100141402 3300005616 Bacteria 2228
173 Ga0068852_100202546 3300005616 Bacteria 1879
174 Ga0068852_100209998 3300005616 Bacteria 1846
175 Ga0068852_100475216 3300005616 Bacteria 1241
176 Ga0068859_100103529 3300005617 Bacteria 2905
177 Ga0068859_100409930 3300005617 Bacteria 1451
178 Ga0068859_100423449 3300005617 Bacteria 1427
179 Ga0068859_100520157 3300005617 Bacteria 1285
180 Ga0068864_100012808 3300005618 Bacteria 6934
181 Ga0068864_100028203 3300005618 Bacteria 4743
182 Ga0068864_100049705 3300005618 Bacteria 3608
183 Ga0068864_100073504 3300005618 Bacteria 2981
184 Ga0068864_100073529 3300005618 Bacteria 2981
185 Ga0068864_100091527 3300005618 Bacteria 2683
186 Ga0068866_10096372 3300005718 Bacteria 1622
187 Ga0068861_100004781 3300005719 Bacteria 9099
188 Ga0068861_100023310 3300005719 Bacteria 4464
189 Ga0068851_10002615 3300005834 Bacteria 7940
190 Ga0068851_10062217 3300005834 Bacteria 1915
191 Ga0068870_10269817 3300005840 Bacteria 1062
192 Ga0068863_100013409 3300005841 Bacteria 7902
193 Ga0068863_100028725 3300005841 Bacteria 5310
194 Ga0068863_100049664 3300005841 Bacteria 3977
195 Ga0068863_100092225 3300005841 Bacteria 2873
196 Ga0068863_100359569 3300005841 Bacteria 1419
197 Ga0068863_100383229 3300005841 Bacteria 1373
198 Ga0068863_100503523 3300005841 Bacteria 1193
199 Ga0068858_100010595 3300005842 Bacteria 8726
200 Ga0068858_100012601 3300005842 Bacteria 7970
201 Ga0068858_100043397 3300005842 Bacteria 4169
202 Ga0068858_100847395 3300005842 Bacteria 893
203 Ga0068860_100010055 3300005843 Bacteria 9374
204 Ga0068860_100018058 3300005843 Bacteria 6868
205 Ga0068860_100088212 3300005843 Bacteria 2953
206 Ga0068860_100218629 3300005843 Bacteria 1850
207 Ga0068862_100009005 3300005844 Bacteria 8262
208 Ga0068862_100090859 3300005844 Bacteria 2658
209 Ga0075365_10007360 3300006038 Bacteria 6157
210 Ga0075368_10016433 3300006042 Bacteria 2758
211 Ga0075363_100029335 3300006048 Bacteria 2839
212 Ga0075363_100371507 3300006048 Bacteria 837
213 Ga0075364_10069251 3300006051 Bacteria 2321
214 Ga0070715_10089594 3300006163 Bacteria 1413
215 Ga0075362_10029489 3300006177 Bacteria 2364
216 Ga0075362_10078577 3300006177 Bacteria 1518
217 Ga0075367_10015422 3300006178 Bacteria 4153
218 Ga0075367_10034354 3300006178 Bacteria 2929
219 Ga0075367_10044180 3300006178 Bacteria 2611
220 Ga0075367_10071327 3300006178 Bacteria 2089
221 Ga0075366_10021476 3300006195 Bacteria 3752
222 Ga0075366_10036496 3300006195 Bacteria 2898
223 Ga0075366_10111760 3300006195 Bacteria 1644
224 Ga0075366_10180353 3300006195 Bacteria 1283
225 Ga0075366_10182494 3300006195 Bacteria 1275
226 Ga0075366_10185650 3300006195 Bacteria 1263
227 Ga0075366_10370037 3300006195 Bacteria 881
228 Ga0097621_100008233 3300006237 Bacteria 7498
229 Ga0097621_100111664 3300006237 Bacteria 2310
230 Ga0097621_100674698 3300006237 Bacteria 950
231 Ga0075370_10000458 3300006353 Bacteria 15179
232 Ga0075370_10008466 3300006353 Bacteria 5294
233 Ga0075370_10010753 3300006353 Bacteria 4796
234 Ga0075370_10017335 3300006353 Bacteria 3891
235 Ga0075370_10017842 3300006353 Bacteria 3840
236 Ga0075370_10023514 3300006353 Bacteria 3394
237 Ga0075370_10228548 3300006353 Bacteria 1101
238 Ga0075370_10246120 3300006353 Bacteria 1059
239 Ga0068871_100030930 3300006358 Bacteria 4218
240 Ga0068871_100191154 3300006358 Bacteria 1763
241 Ga0068871_100382984 3300006358 Bacteria 1250
242 Ga0068871_100384613 3300006358 Bacteria 1247
243 Ga0068871_100507279 3300006358 Bacteria 1088
244 Ga0068865_100009609 3300006881 Bacteria 6003
245 Ga0068865_100035934 3300006881 Bacteria 3336
246 Ga0068865_100050251 3300006881 Bacteria 2879
247 Ga0068865_100264158 3300006881 Bacteria 1364
248 Ga0068865_100318483 3300006881 Bacteria 1250
249 Ga0068865_100403086 3300006881 Bacteria 1121
250 Ga0068865_100434981 3300006881 Bacteria 1081
251 Ga0097620_100103528 3300006931 Bacteria 2905
252 Ga0097620_100409949 3300006931 Bacteria 1451
253 Ga0097620_100423454 3300006931 Bacteria 1427
254 Ga0097620_100520154 3300006931 Bacteria 1285
255 Ga0075435_100487563 3300007076 Bacteria 1065
256 Ga0105240_10000805 3300009093 Bacteria 56899
257 Ga0105240_10035322 3300009093 Bacteria 6442
258 Ga0105240_10132016 3300009093 Bacteria 2995
259 Ga0105240_10648100 3300009093 Bacteria 1158
260 Ga0105240_10685837 3300009093 Bacteria 1120
261 Ga0105240_10952085 3300009093 Bacteria 921
262 Ga0105245_10036743 3300009098 Bacteria 4352
263 Ga0105245_10116507 3300009098 Bacteria 2491
264 Ga0105245_10353499 3300009098 Bacteria 1457
265 Ga0105245_10602768 3300009098 Bacteria 1125
266 Ga0105243_10019432 3300009148 Bacteria 5151
267 Ga0105241_10090894 3300009174 Bacteria 2408
268 Ga0105242_10172899 3300009176 Bacteria 1900
269 Ga0105242_10223391 3300009176 Bacteria 1684
270 Ga0105248_10042010 3300009177 Bacteria 5127
271 Ga0105248_10072967 3300009177 Bacteria 3857
272 Ga0105248_10107444 3300009177 Bacteria 3147
273 Ga0105248_10237531 3300009177 Bacteria 2051
274 Ga0105237_10004204 3300009545 Bacteria 16757
275 Ga0105237_10142698 3300009545 Bacteria 2389
276 Ga0105238_10004015 3300009551 Bacteria 14601
277 Ga0105238_10073129 3300009551 Bacteria 3423
278 Ga0105249_10066911 3300009553 Bacteria 3309
279 Ga0105249_10148115 3300009553 Bacteria 2257
280 Ga0105249_10882461 3300009553 Bacteria 961
281 Ga0105239_10000952 3300010375 Bacteria 40803
282 Ga0105239_10079253 3300010375 Bacteria 3614
283 Ga0105239_10112198 3300010375 Bacteria 3023
284 Ga0105239_10127813 3300010375 Bacteria 2825
285 Ga0157319_1000017 3300012497 Bacteria 110340
286 Ga0157371_10821537 3300013102 Bacteria 701
287 Ga0157370_10704015 3300013104 Bacteria 922
288 Ga0157369_10009904 3300013105 Bacteria 10891
289 Ga0157374_10020489 3300013296 Bacteria 5867
290 Ga0157374_10078210 3300013296 Bacteria 3132
291 Ga0157374_10101087 3300013296 Bacteria 2764
292 Ga0157374_10608683 3300013296 Bacteria 1103
293 Ga0157378_10004202 3300013297 Bacteria 12713
294 Ga0157378_10081708 3300013297 Bacteria 2921
295 Ga0157378_10226365 3300013297 Bacteria 1780
296 Ga0163162_10074541 3300013306 Bacteria 3452
297 Ga0163162_10548411 3300013306 Bacteria 1284
298 Ga0163162_10596273 3300013306 Bacteria 1231
299 Ga0157372_10050406 3300013307 Bacteria 4631
300 Ga0157372_10145075 3300013307 Bacteria 2737
301 Ga0157375_10050831 3300013308 Bacteria 4067
302 Ga0157375_10054470 3300013308 Bacteria 3939
303 Ga0157375_10055271 3300013308 Bacteria 3914
304 Ga0157375_10060927 3300013308 Bacteria 3745
305 Ga0157375_10073139 3300013308 Bacteria 3447
306 Ga0157375_10074306 3300013308 Bacteria 3421
307 Ga0157375_10078179 3300013308 Bacteria 3341
308 Ga0163163_10383691 3300014325 Bacteria 1463
309 Ga0157380_10002952 3300014326 Bacteria 11572
310 Ga0157380_10239707 3300014326 Bacteria 1634
311 Ga0157380_10423719 3300014326 Bacteria 1270
312 Ga0157380_10829052 3300014326 Bacteria 945
313 Ga0157377_10014024 3300014745 Bacteria 4070
314 Ga0157379_10010782 3300014968 Bacteria 7965
315 Ga0157379_10014569 3300014968 Bacteria 6897
316 Ga0157379_10049968 3300014968 Bacteria 3733
317 Ga0157379_10167912 3300014968 Bacteria 1981
318 Ga0157379_10203607 3300014968 Bacteria 1790
319 Ga0157379_10240280 3300014968 Bacteria 1643
320 Ga0157379_10336517 3300014968 Bacteria 1380
321 Ga0157376_10008186 3300014969 Bacteria 7525
322 Ga0157376_10031452 3300014969 Bacteria 4250
323 Ga0157376_10045713 3300014969 Bacteria 3606
324 Ga0157376_10355926 3300014969 Bacteria 1403
325 Ga0157376_10407984 3300014969 Bacteria 1315
326 Ga0157376_10586990 3300014969 Bacteria 1107
327 Ga0163161_10021039 3300017792 Bacteria 4584
328 Ga0163161_10164429 3300017792 Bacteria 1693
329 Ga0163161_10183557 3300017792 Bacteria 1605
330 Ga0163161_10300541 3300017792 Bacteria 1264
331 Ga0163161_10508731 3300017792 Bacteria 982
332 Ga0213872_10000099 3300021361 Bacteria 80083
333 Ga0209674_100270 3300025226 Bacteria 39854
334 Ga0209563_100005 3300025230 Bacteria 1774893
335 Ga0209563_100178 3300025230 Bacteria 41597
336 Ga0207427_102346 3300025231 Bacteria 5189
337 Ga0209258_101449 3300025242 Bacteria 8301
338 Ga0209646_1000625 3300025246 Bacteria 13479
339 Ga0209026_1000328 3300025250 Bacteria 47719
340 Ga0209677_100405 3300025253 Bacteria 25877
341 Ga0209677_101001 3300025253 Bacteria 13635
342 Ga0209759_1000448 3300025256 Bacteria 47719
343 Ga0209759_1001400 3300025256 Bacteria 13808
344 Ga0209759_1007453 3300025256 Bacteria 3516
345 Ga0209673_1004161 3300025273 Bacteria 7912
346 Ga0209256_1000249 3300025299 Bacteria 95279
347 Ga0209256_1018429 3300025299 Bacteria 2269
348 Ga0209051_1015479 3300025303 Bacteria 3505
349 Ga0209257_1002034 3300025304 Bacteria 21566
350 Ga0207656_10117867 3300025321 Bacteria 1233
351 Ga0207656_10266704 3300025321 Bacteria 842
352 Ga0207682_10002372 3300025893 Bacteria 8479
353 Ga0207682_10027149 3300025893 Bacteria 2278
354 Ga0207642_10080340 3300025899 Bacteria 1581
355 Ga0207642_10131020 3300025899 Bacteria 1309
356 Ga0207688_10215877 3300025901 Bacteria 1154
357 Ga0207688_10373940 3300025901 Bacteria 881
358 Ga0207680_10036656 3300025903 Bacteria 2825
359 Ga0207680_10172534 3300025903 Bacteria 1457
360 Ga0207645_10003150 3300025907 Bacteria 12634
361 Ga0207645_10014078 3300025907 Bacteria 5360
362 Ga0207645_10033581 3300025907 Bacteria 3297
363 Ga0207645_10054125 3300025907 Bacteria 2563
364 Ga0207645_10157636 3300025907 Bacteria 1484
365 Ga0207645_10227986 3300025907 Bacteria 1229
366 Ga0207643_10049299 3300025908 Bacteria 2386
367 Ga0207705_10123308 3300025909 Bacteria 1924
368 Ga0207705_10128701 3300025909 Bacteria 1883
369 Ga0207684_10032813 3300025910 Bacteria 4415
370 Ga0207695_10011633 3300025913 Bacteria 10639
371 Ga0207695_10114027 3300025913 Bacteria 2678
372 Ga0207695_10436998 3300025913 Bacteria 1192
373 Ga0207671_10005118 3300025914 Bacteria 12217
374 Ga0207671_10168257 3300025914 Bacteria 1701
375 Ga0207662_10031228 3300025918 Bacteria 3094
376 Ga0207657_10035144 3300025919 Bacteria 4497
377 Ga0207657_10534877 3300025919 Bacteria 917
378 Ga0207649_10038271 3300025920 Bacteria 2903
379 Ga0207649_10232881 3300025920 Bacteria 1318
380 Ga0207649_10376559 3300025920 Bacteria 1057
381 Ga0207652_10011724 3300025921 Bacteria 7075
382 Ga0207652_10410006 3300025921 Bacteria 1222
383 Ga0207646_10434402 3300025922 Bacteria 1185
384 Ga0207681_10028283 3300025923 Bacteria 3630
385 Ga0207681_10066226 3300025923 Bacteria 2500
386 Ga0207681_10306570 3300025923 Bacteria 1258
387 Ga0207681_10459464 3300025923 Bacteria 1037
388 Ga0207694_10025002 3300025924 Bacteria 4538
389 Ga0207694_10113996 3300025924 Bacteria 2152
390 Ga0207694_10405919 3300025924 Bacteria 1133
391 Ga0207650_10004285 3300025925 Bacteria 9736
392 Ga0207650_10006028 3300025925 Bacteria 8271
393 Ga0207650_10052624 3300025925 Bacteria 3016
394 Ga0207650_10270191 3300025925 Bacteria 1382
395 Ga0207659_10001020 3300025926 Bacteria 16646
396 Ga0207659_10081845 3300025926 Bacteria 2388
397 Ga0207659_10101692 3300025926 Bacteria 2168
398 Ga0207659_10524011 3300025926 Bacteria 1005
399 Ga0207659_10764822 3300025926 Bacteria 829
400 Ga0207659_10839196 3300025926 Bacteria 790
401 Ga0207687_10041074 3300025927 Bacteria 3174
402 Ga0207687_10370327 3300025927 Bacteria 1171
403 Ga0207644_10002869 3300025931 Bacteria 11110
404 Ga0207644_10054254 3300025931 Bacteria 2886
405 Ga0207644_10133510 3300025931 Bacteria 1903
406 Ga0207644_10140636 3300025931 Bacteria 1858
407 Ga0207644_10211862 3300025931 Bacteria 1532
408 Ga0207644_10653531 3300025931 Bacteria 875
409 Ga0207690_10056681 3300025932 Bacteria 2644
410 Ga0207706_10005697 3300025933 Bacteria 11606
411 Ga0207706_10010641 3300025933 Bacteria 8401
412 Ga0207706_10013190 3300025933 Bacteria 7519
413 Ga0207706_10025074 3300025933 Bacteria 5345
414 Ga0207706_10133424 3300025933 Bacteria 2184
415 Ga0207706_10238601 3300025933 Bacteria 1589
416 Ga0207706_10289177 3300025933 Bacteria 1429
417 Ga0207706_10422615 3300025933 Bacteria 1155
418 Ga0207686_10104859 3300025934 Bacteria 1895
419 Ga0207709_10031682 3300025935 Bacteria 3090
420 Ga0207709_10189072 3300025935 Bacteria 1461
421 Ga0207670_10059890 3300025936 Bacteria 2592
422 Ga0207669_10016651 3300025937 Bacteria 3742
423 Ga0207669_10119817 3300025937 Bacteria 1783
424 Ga0207669_10154774 3300025937 Bacteria 1611
425 Ga0207669_10213210 3300025937 Bacteria 1411
426 Ga0207669_10918738 3300025937 Bacteria 732
427 Ga0207704_10031465 3300025938 Bacteria 2990
428 Ga0207704_10080533 3300025938 Bacteria 2103
429 Ga0207704_10090514 3300025938 Bacteria 2008
430 Ga0207704_10155777 3300025938 Bacteria 1619
431 Ga0207704_10198622 3300025938 Bacteria 1466
432 Ga0207704_10406945 3300025938 Bacteria 1075
433 Ga0207704_10620604 3300025938 Bacteria 887
434 Ga0207691_10018937 3300025940 Bacteria 6522
435 Ga0207691_10041148 3300025940 Bacteria 4268
436 Ga0207691_10046734 3300025940 Bacteria 3976
437 Ga0207691_10049285 3300025940 Bacteria 3858
438 Ga0207691_10057157 3300025940 Bacteria 3552
439 Ga0207691_10070461 3300025940 Bacteria 3157
440 Ga0207691_10109338 3300025940 Bacteria 2459
441 Ga0207691_10152760 3300025940 Bacteria 2029
442 Ga0207691_10161234 3300025940 Bacteria 1967
443 Ga0207691_10171931 3300025940 Bacteria 1897
444 Ga0207691_10260652 3300025940 Bacteria 1494
445 Ga0207711_10016105 3300025941 Bacteria 6206
446 Ga0207711_10028530 3300025941 Bacteria 4697
447 Ga0207711_10066785 3300025941 Bacteria 3111
448 Ga0207711_10167208 3300025941 Bacteria 1994
449 Ga0207711_10410966 3300025941 Bacteria 1258
450 Ga0207689_10000343 3300025942 Bacteria 43547
451 Ga0207689_10036619 3300025942 Bacteria 4073
452 Ga0207689_10072103 3300025942 Bacteria 2837
453 Ga0207689_10226775 3300025942 Bacteria 1544
454 Ga0207661_10131420 3300025944 Bacteria 2145
455 Ga0207661_10193401 3300025944 Bacteria 1785
456 Ga0207679_10179276 3300025945 Bacteria 1751
457 Ga0207667_10008525 3300025949 Bacteria 12170
458 Ga0207667_10087092 3300025949 Bacteria 3231
459 Ga0207667_10126130 3300025949 Bacteria 2636
460 Ga0207651_10021440 3300025960 Bacteria 3927
461 Ga0207651_10040657 3300025960 Bacteria 3079
462 Ga0207651_10042473 3300025960 Bacteria 3026
463 Ga0207651_10065414 3300025960 Bacteria 2550
464 Ga0207651_10099298 3300025960 Bacteria 2155
465 Ga0207651_10113733 3300025960 Bacteria 2037
466 Ga0207651_10185827 3300025960 Bacteria 1653
467 Ga0207712_10026038 3300025961 Bacteria 3893
468 Ga0207668_10024199 3300025972 Bacteria 3915
469 Ga0207668_10109831 3300025972 Bacteria 2067
470 Ga0207668_10111433 3300025972 Bacteria 2054
471 Ga0207668_10247932 3300025972 Bacteria 1445
472 Ga0207668_10265382 3300025972 Bacteria 1401
473 Ga0207640_10285872 3300025981 Bacteria 1298
474 Ga0207640_10329642 3300025981 Bacteria 1219
475 Ga0207640_10733264 3300025981 Bacteria 850
476 Ga0207640_10848153 3300025981 Bacteria 795
477 Ga0207658_10010730 3300025986 Bacteria 6228
478 Ga0207658_10017106 3300025986 Bacteria 4993
479 Ga0207658_10088920 3300025986 Bacteria 2390
480 Ga0207658_10092939 3300025986 Bacteria 2344
481 Ga0207658_10379874 3300025986 Bacteria 1237
482 Ga0207677_10012138 3300026023 Bacteria 4939
483 Ga0207677_10025612 3300026023 Bacteria 3683
484 Ga0207677_10039592 3300026023 Bacteria 3101
485 Ga0207677_10042753 3300026023 Bacteria 3007
486 Ga0207677_10170697 3300026023 Bacteria 1700
487 Ga0207677_10306067 3300026023 Bacteria 1315
488 Ga0207703_10012605 3300026035 Bacteria 6591
489 Ga0207703_10052512 3300026035 Bacteria 3310
490 Ga0207703_10069221 3300026035 Bacteria 2910
491 Ga0207639_10024945 3300026041 Bacteria 4332
492 Ga0207639_10071971 3300026041 Bacteria 2706
493 Ga0207639_10072618 3300026041 Bacteria 2695
494 Ga0207639_10319221 3300026041 Bacteria 1379
495 Ga0207639_10385519 3300026041 Bacteria 1259
496 Ga0207678_10006858 3300026067 Bacteria 10099
497 Ga0207678_10017049 3300026067 Bacteria 6378
498 Ga0207678_10045799 3300026067 Bacteria 3782
499 Ga0207678_10230991 3300026067 Bacteria 1584
500 Ga0207678_10263660 3300026067 Bacteria 1477
501 Ga0207708_10013215 3300026075 Bacteria 6164
502 Ga0207708_10037030 3300026075 Bacteria 3716
503 Ga0207702_10001082 3300026078 Bacteria 27904
504 Ga0207702_10023275 3300026078 Bacteria 5136
505 Ga0207702_10627028 3300026078 Bacteria 1056
506 Ga0207641_10007434 3300026088 Bacteria 9114
507 Ga0207641_10015971 3300026088 Bacteria 6147
508 Ga0207641_10018421 3300026088 Bacteria 5725
509 Ga0207641_10074815 3300026088 Bacteria 2923
510 Ga0207641_10149902 3300026088 Bacteria 2111
511 Ga0207641_10355625 3300026088 Bacteria 1397
512 Ga0207641_11093883 3300026088 Bacteria 795
513 Ga0207648_10002442 3300026089 Bacteria 19978
514 Ga0207648_10007746 3300026089 Bacteria 10495
515 Ga0207648_10015728 3300026089 Bacteria 6942
516 Ga0207648_10033178 3300026089 Bacteria 4554
517 Ga0207648_10057288 3300026089 Bacteria 3399
518 Ga0207648_10091987 3300026089 Bacteria 2652
519 Ga0207648_10270460 3300026089 Bacteria 1518
520 Ga0207648_10325212 3300026089 Bacteria 1382
521 Ga0207648_10407293 3300026089 Bacteria 1233
522 Ga0207648_10633928 3300026089 Bacteria 987
523 Ga0207648_10689681 3300026089 Bacteria 946
524 Ga0207648_10794037 3300026089 Bacteria 881
525 Ga0207676_10019060 3300026095 Bacteria 4999
526 Ga0207676_10040116 3300026095 Bacteria 3586
527 Ga0207676_10098344 3300026095 Bacteria 2419
528 Ga0207676_10120794 3300026095 Bacteria 2209
529 Ga0207676_10147254 3300026095 Bacteria 2023
530 Ga0207676_10307872 3300026095 Bacteria 1449
531 Ga0207674_10014024 3300026116 Bacteria 8858
532 Ga0207674_10019423 3300026116 Bacteria 7358
533 Ga0207674_10143532 3300026116 Bacteria 2346
534 Ga0207674_10245600 3300026116 Bacteria 1737
535 Ga0207674_10844564 3300026116 Bacteria 883
536 Ga0207675_100000232 3300026118 Bacteria 52682
537 Ga0207675_100007916 3300026118 Bacteria 10018
538 Ga0207675_100053609 3300026118 Bacteria 3763
539 Ga0207675_100722377 3300026118 Bacteria 1006
540 Ga0207683_10003913 3300026121 Bacteria 12911
541 Ga0207683_10029209 3300026121 Bacteria 4773
542 Ga0207683_10046420 3300026121 Bacteria 3801
543 Ga0207683_10107610 3300026121 Bacteria 2494
544 Ga0207683_10172792 3300026121 Bacteria 1958
545 Ga0207683_10597073 3300026121 Bacteria 1022
546 Ga0207683_10970148 3300026121 Bacteria 789
547 Ga0207698_10010596 3300026142 Bacteria 5936
548 Ga0207698_10040003 3300026142 Bacteria 3478
549 Ga0207698_10104453 3300026142 Bacteria 2357
550 Ga0207698_10105156 3300026142 Bacteria 2351
551 Ga0207698_10164476 3300026142 Bacteria 1945
552 Ga0207698_10302496 3300026142 Bacteria 1489
553 Ga0207698_11196430 3300026142 Bacteria 774
554 Ga0209995_1043284 3300027471 Bacteria 761
555 Ga0209999_1055400 3300027543 Bacteria 752
556 Ga0209966_1000031 3300027695 Bacteria 63685
557 Ga0268266_10061891 3300028379 Bacteria 3228
558 Ga0268266_10125877 3300028379 Bacteria 2287
559 Ga0268265_10253132 3300028380 Bacteria 1561
560 Ga0268264_10010106 3300028381 Bacteria 7809
561 Ga0268264_10034250 3300028381 Bacteria 4176
562 Ga0268264_10081280 3300028381 Bacteria 2769
563 Ga0268264_10435358 3300028381 Bacteria 1267
564 Ga0268264_10448371 3300028381 Bacteria 1250
565 Ga0307517_10000150 3300028786 Bacteria 110446
566 Ga0307517_10058977 3300028786 Bacteria 3685
567 Ga0307517_10087774 3300028786 Bacteria 2580
568 Ga0307517_10170316 3300028786 Bacteria 1433
569 Ga0307517_10220648 3300028786 Bacteria 1153
570 Ga0307515_10000041 3300028794 Bacteria 319110
571 Ga0307515_10000187 3300028794 Bacteria 151904
572 Ga0307515_10005750 3300028794 Bacteria 25055
573 Ga0307515_10011291 3300028794 Bacteria 16957
574 Ga0307515_10034288 3300028794 Bacteria 8319
575 Ga0307515_10132464 3300028794 Bacteria 2735
576 Ga0307515_10145113 3300028794 Bacteria 2519
577 Ga0307512_10078454 3300030522 Bacteria 2393
578 Ga0307513_10012452 3300031456 Bacteria 10493
579 Ga0307513_10193759 3300031456 Bacteria 1881
580 Ga0307509_10000092 3300031507 Bacteria 124019
581 Ga0307509_10028720 3300031507 Bacteria 6181
582 Ga0307509_10039307 3300031507 Bacteria 5155
583 Ga0307509_10070268 3300031507 Bacteria 3657
584 Ga0307509_10120786 3300031507 Bacteria 2598
585 Ga0307408_100164821 3300031548 Bacteria 1764
586 Ga0307408_100484463 3300031548 Bacteria 1080
587 Ga0307508_10052658 3300031616 Bacteria 3613
588 Ga0307508_10078713 3300031616 Bacteria 2877
589 Ga0307508_10433756 3300031616 Bacteria 906
590 Ga0307514_10001419 3300031649 Bacteria 29520
591 Ga0307514_10024537 3300031649 Bacteria 4880
592 Ga0307514_10214223 3300031649 Bacteria 1191
593 Ga0307516_10000181 3300031730 Bacteria 81531
594 Ga0307516_10000720 3300031730 Bacteria 45106
595 Ga0307516_10005702 3300031730 Bacteria 14762
596 Ga0307516_10149379 3300031730 Bacteria 2099
597 Ga0307516_10318104 3300031730 Bacteria 1228
598 Ga0307412_11214833 3300031911 Bacteria 675
599 Ga0307416_100448605 3300032002 Bacteria 1342
600 Ga0307507_10055456 3300033179 Bacteria 3756
601 Ga0307510_10001753 3300033180 Bacteria 24194
602 Ga0307510_10010098 3300033180 Bacteria 11225
603 Ga0307510_10058183 3300033180 Bacteria 4005
604 Ga0307510_10223972 3300033180 Bacteria 1389
605 Ga0373959_0043176 3300034820 Bacteria 953
606 Ga0373938_0112521 3300034957 Bacteria 694
607 Ga0373934_0010718 3300035086 Bacteria 3441
608 Ga0373940_0053505 3300035088 Bacteria 1139
609 Ga0373944_0079050 3300035089 Bacteria 1083
610 Ga0373949_0055560 3300035090 Bacteria 1007
611 Ga0373957_0078029 3300035120 Bacteria 1304
612 Ga0373960_0086552 3300035121 Bacteria 996
613 Ga0373943_0203775 3300035170 Bacteria 1096
614 Ga0373943_0350208 3300035170 Bacteria 846
615 Ga0373955_0110189 3300035172 Bacteria 1591
616 Ga0373955_0122888 3300035172 Bacteria 1510
617 Ga0373961_0123503 3300035241 Bacteria 860
618 Ga0373931_0003424 3300035691 Bacteria 7122
619 Ga0373931_0009919 3300035691 Bacteria 4564
620 Ga0373931_0605889 3300035691 Bacteria 716
621 Ga0373935_0571463 3300035692 Bacteria 825
622 Ga0373927_0136149 3300035695 Bacteria 1605
623 Ga0373937_0727323 3300036401 Bacteria 939
624 Ga0373925_0021850 3300037068 Bacteria 4665
625 Ga0395900_0000109 3300037418 Bacteria 146053
626 Ga0395898_0001529 3300037466 Bacteria 31848
627 Ga0395905_0007151 3300037471 Bacteria 11155
628 Ga0395905_0019669 3300037471 Bacteria 6399
629 Ga0395905_0027072 3300037471 Bacteria 5406
630 Ga0395905_0042101 3300037471 Bacteria 4285
631 Ga0395905_0045108 3300037471 Bacteria 4135
632 Ga0436365_0276042 3300039437 Bacteria 1345
633 Ga0436361_0048138 3300039447 Bacteria 5462
634 Ga0436361_0720979 3300039447 Bacteria 74253
635 Ga0436361_0831660 3300039447 Bacteria 731
636 Ga0436363_0739873 3300039450 Bacteria 1773
637 Ga0451804_0085032 3300041463 Bacteria 1134
638 Ga0451833_0991326 3300041491 Bacteria 742
639 Ga0451839_1168416 3300041496 Bacteria 1316
640 Ga0451843_1080642 3300041509 Bacteria 1072
641 Ga0451853_1508532 3300041512 Bacteria 680
642 Ga0451853_3440584 3300041512 Bacteria 1254
643 Ga0439449_0205659 3300042007 Bacteria 737
644 Ga0439454_021318 3300042011 Bacteria 957
645 Ga0439462_0110993 3300042015 Bacteria 759
646 Ga0450890_001619 3300042127 Bacteria 3231
647 Ga0439459_0000861 3300042438 Bacteria 4232
648 Ga0451577_0000877 3300042876 Bacteria 44614
649 Ga0451577_0031026 3300042876 Bacteria 4824
650 Ga0451577_0079292 3300042876 Bacteria 2928
651 Ga0451577_0288645 3300042876 Bacteria 1487
652 Ga0466969_0000228 3300044656 Bacteria 30604
653 Ga0466969_0002471 3300044656 Bacteria 9868
654 Ga0466969_0101781 3300044656 Bacteria 1351
655 Ga0466972_0000570 3300044658 Bacteria 17989
656 Ga0466972_0021412 3300044658 Bacteria 3222
657 Ga0466965_0048338 3300044683 Bacteria 2107
658 Ga0466966_0002199 3300044684 Bacteria 12670
659 Ga0466966_0046271 3300044684 Bacteria 2779
660 Ga0466961_0007260 3300044693 Bacteria 7050
661 Ga0466961_0095907 3300044693 Bacteria 1870
662 Ga0466961_0114823 3300044693 Bacteria 1692
663 Ga0466963_0001246 3300044694 Bacteria 13464
664 Ga0466964_0000493 3300044706 Bacteria 12239
665 Ga0453684_0011227 3300044712 Bacteria 15077
666 Ga0453684_0515157 3300044712 Bacteria 1322
667 Ga0466971_0005061 3300044719 Bacteria 5710
668 Ga0466971_0283345 3300044719 Bacteria 793
669 Ga0466968_0035334 3300044735 Bacteria 2091
670 Ga0466970_0017512 3300044765 Bacteria 3702
671 Ga0466957_0027573 3300044842 Bacteria 3376
672 Ga0466960_0020740 3300044901 Bacteria 2916
673 Ga0466960_0139588 3300044901 Bacteria 1286
674 Ga0466959_0007627 3300045049 Bacteria 7605
675 Ga0466959_0042147 3300045049 Bacteria 3367
676 Ga0466959_0043963 3300045049 Bacteria 3291
677 Ga0451576_0017247 3300045051 Bacteria 7943
678 Ga0451576_0130115 3300045051 Bacteria 2623
679 Ga0451576_0426833 3300045051 Bacteria 1391
680 Ga0451576_1072218 3300045051 Bacteria 843
681 Ga0451576_1222631 3300045051 Bacteria 784
682 Ga0466958_0331521 3300045836 Bacteria 978
683 Ga0466967_0066436 3300045976 Bacteria 3213
684 Ga0495592_0005162 3300046454 Bacteria 9626
685 Ga0495590_0012205 3300046457 Bacteria 3194
686 Ga0495629_0080896 3300046459 Bacteria 2268
687 Ga0495638_0054986 3300046460 Bacteria 2473
688 Ga0495653_0439764 3300046463 Bacteria 822
689 Ga0495580_0432022 3300046472 Bacteria 885
690 Ga0495582_0058973 3300046473 Bacteria 2117
691 Ga0495585_0014070 3300046492 Bacteria 4671
692 Ga0495608_0337694 3300046511 Bacteria 929
693 Ga0495610_0163277 3300046512 Bacteria 940
694 Ga0495666_0071446 3300046526 Bacteria 1650
695 Ga0495652_0628138 3300046529 Bacteria 730
696 Ga0495586_0037906 3300046535 Bacteria 2588
697 Ga0495598_0022882 3300046537 Bacteria 1677
698 Ga0495598_0067240 3300046537 Bacteria 1120
699 Ga0495668_0506913 3300046616 Bacteria 665
700 Ga0495647_0046336 3300046681 Bacteria 1674
701 Ga0495658_0041962 3300046683 Bacteria 2552
702 Ga0495658_0088969 3300046683 Bacteria 1826
703 Ga0495658_0118597 3300046683 Bacteria 1598
704 Ga0495658_0419848 3300046683 Bacteria 853
705 Ga0495670_0046274 3300046691 Bacteria 2173
706 Ga0495671_0214410 3300046692 Bacteria 933
707 Ga0495660_0037192 3300046810 Bacteria 2712
708 Ga0495581_0135561 3300047315 Bacteria 1435
709 Ga0495687_000799 3300047443 Bacteria 33916
710 Ga0495602_0396162 3300048088 Bacteria 986
711 Ga0496100_0286051 3300048903 Bacteria 1230
712 Ga0496101_0023149 3300048904 Bacteria 4287
713 Ga0496102_0089337 3300048905 Bacteria 2850
714 Ga0496103_0060726 3300048906 Bacteria 2350
715 Ga0496105_0283982 3300048908 Bacteria 1334
716 Ga0496106_0041031 3300048909 Bacteria 3467
717 Ga0496108_0030613 3300048911 Bacteria 4460
718 Ga0496108_0159048 3300048911 Bacteria 1952
719 Ga0496108_0186440 3300048911 Bacteria 1797
720 Ga0496109_0285083 3300048912 Bacteria 1557
721 Ga0496109_0482447 3300048912 Bacteria 1170
722 Ga0496110_0030176 3300048913 Bacteria 4672
723 Ga0496111_0051890 3300048914 Bacteria 2961
724 Ga0496114_0142909 3300048917 Bacteria 2073
725 Ga0496114_0275012 3300048917 Bacteria 1484
726 Ga0496115_0083052 3300048918 Bacteria 2611
727 Ga0496121_0007493 3300048924 Bacteria 13178
728 Ga0496121_0502785 3300048924 Bacteria 769
729 Ga0496124_0000125 3300048927 Bacteria 159942
730 Ga0496125_0166524 3300048928 Bacteria 1488
731 Ga0501032_0112919 3300049569 Bacteria 1797
732 Ga0501043_0000027 3300049579 Bacteria 144685
733 Ga0501046_0000034 3300049580 Bacteria 173742
734 Ga0501047_0000042 3300049581 Bacteria 176603
735 Ga0501048_0000019 3300049582 Bacteria 71064
736 Ga0501198_000015 3300049649 Bacteria 102945
737 Ga0501222_000045 3300049662 Bacteria 46767
738 Ga0501080_0428265 3300049742 Bacteria 1188
739 Ga0501080_0948902 3300049742 Bacteria 748
740 Ga0501035_0161616 3300049822 Bacteria 1938
741 Ga0501045_0002741 3300049824 Bacteria 12038
742 nmdc:mga03683_156082_c1 3300050489 Bacteria 1032
743 nmdc:mga03683_202589_c1 3300050489 Bacteria 911
744 nmdc:mga03683_41971_c1 3300050489 Bacteria 1880
745 nmdc:mga03n38_285837_c1 3300050490 Bacteria 882
746 nmdc:mga03n38_72435_c1 3300050490 Bacteria 1597
747 nmdc:mga0k408_22389_c1 3300050493 Bacteria 3558
748 nmdc:mga0k408_287195_c1 3300050493 Bacteria 982
749 nmdc:mga0k408_49852_c1 3300050493 Bacteria 2423
750 nmdc:mga0k408_56713_c1 3300050493 Bacteria 2274
751 nmdc:mga0k408_634553_c1 3300050493 Bacteria 629
752 nmdc:mga0k408_78573_c1 3300050493 Bacteria 1930
753 nmdc:mga0k408_835_c1 3300050493 Bacteria 16983
754 nmdc:mga0k408_88534_c1 3300050493 Bacteria 1818
755 nmdc:mga06z11_248018_c1 3300050494 Bacteria 1048
756 nmdc:mga06z11_30425_c1 3300050494 Bacteria 2612
757 nmdc:mga06z11_4334_c1 3300050494 Bacteria 5578
758 nmdc:mga04h51_30817_c1 3300050495 Bacteria 1690
759 nmdc:mga07m45_10920_c1 3300050496 Bacteria 4757
760 nmdc:mga07m45_14822_c1 3300050496 Bacteria 4162
761 nmdc:mga07m45_297112_c1 3300050496 Bacteria 939
762 nmdc:mga07m45_33478_c1 3300050496 Bacteria 2854
763 nmdc:mga07m45_34578_c1 3300050496 Bacteria 2809
764 nmdc:mga07m45_56572_c1 3300050496 Bacteria 2217
765 nmdc:mga07m45_62872_c1 3300050496 Bacteria 2105
766 nmdc:mga07m45_692_c1 3300050496 Bacteria 14325
767 nmdc:mga07m45_897_c1 3300050496 Bacteria 12986
768 nmdc:mga0sz30_200958_c1 3300050516 Bacteria 885
769 nmdc:mga0sz30_73910_c1 3300050516 Bacteria 1470
770 Ga0495619_0402156 3300053085 Bacteria 946
771 Ga0500583_0060084 3300053092 Bacteria 1792
772 Ga0500651_0132415 3300053093 Bacteria 1507
773 Ga0500607_163343 3300053121 Bacteria 1014
774 Ga0500652_080354 3300053131 Bacteria 1357
775 Ga0500559_0000017 3300053136 Bacteria 143646
776 Ga0500559_0359982 3300053136 Bacteria 680
777 Ga0500561_0038442 3300053137 Bacteria 1250
778 Ga0500568_0055041 3300053139 Bacteria 1554
779 Ga0500622_0001025 3300053156 Bacteria 23432
780 Ga0500622_0014050 3300053156 Bacteria 4304
781 Ga0500636_0035340 3300053177 Bacteria 2958
782 Ga0500587_006191 3300053739 Bacteria 1594
783 Ga0590071_002007 3300059421 Bacteria 5209
784 Ga0590074_003679 3300059423 Bacteria 2535
785 Ga0590075_076400 3300059424 Bacteria 866
786 Ga0466962_0068448 3300061719 Bacteria 1695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0506913 Ga0495668_0506913_100_645 179
2 3300045051 Ga0451576_0017247 Ga0451576_0017247_2197_2850 182
3 3300005842 Ga0068858_100847395 Ga0068858_1008473952 191
4 3300003320 rootH2_10104343 rootH2_101043434 192
5 3300053136 Ga0500559_0359982 Ga0500559_0359982_32_625 195
6 3300035691 Ga0373931_0605889 Ga0373931_0605889_14_607 196
7 3300036401 Ga0373937_0727323 Ga0373937_0727323_18_632 196
8 3300041512 Ga0451853_1508532 Ga0451853_1508532_10_603 196
9 3300046529 Ga0495652_0628138 Ga0495652_0628138_99_713 196
10 3300050493 nmdc:mga0k408_634553_c1 nmdc:mga0k408_634553_c1_17_613 196
11 3300028794 Ga0307515_10011291 Ga0307515_100112913 202
12 3300031730 Ga0307516_10000720 Ga0307516_1000072018 202
13 3300005543 Ga0070672_100216190 Ga0070672_1002161902 205
14 3300025940 Ga0207691_10171931 Ga0207691_101719313 205
15 3300005366 Ga0070659_100459730 Ga0070659_1004597302 206
16 iso_pu_bacteria 2881714928 2881715311 207
17 3300041509 Ga0451843_1080642 Ga0451843_1080642_230_862 208
18 3300041512 Ga0451853_3440584 Ga0451853_3440584_474_1109 208
19 3300005331 Ga0070670_100658783 Ga0070670_1006587832 209
20 3300005334 Ga0068869_100294646 Ga0068869_1002946462 209
21 3300005336 Ga0070680_100010188 Ga0070680_1000101883 209
22 3300005338 Ga0068868_100050237 Ga0068868_1000502372 209
23 3300005338 Ga0068868_100150905 Ga0068868_1001509052 209
24 3300005344 Ga0070661_100151608 Ga0070661_1001516082 209
25 3300005355 Ga0070671_100022795 Ga0070671_1000227955 209
26 3300005355 Ga0070671_100115370 Ga0070671_1001153702 209
27 3300005364 Ga0070673_100600895 Ga0070673_1006008952 209
28 3300005367 Ga0070667_100441293 Ga0070667_1004412932 209
29 3300005367 Ga0070667_100453833 Ga0070667_1004538332 209
30 3300005455 Ga0070663_100168412 Ga0070663_1001684122 209
31 3300005456 Ga0070678_100276857 Ga0070678_1002768572 209
32 3300005459 Ga0068867_100579563 Ga0068867_1005795631 209
33 3300005530 Ga0070679_100042692 Ga0070679_1000426923 209
34 3300005539 Ga0068853_100081187 Ga0068853_1000811872 209
35 3300005548 Ga0070665_100071804 Ga0070665_1000718044 209
36 3300005617 Ga0068859_100409930 Ga0068859_1004099302 209
37 3300005618 Ga0068864_100012808 Ga0068864_1000128085 209
38 3300005618 Ga0068864_100073504 Ga0068864_1000735045 209
39 3300005841 Ga0068863_100013409 Ga0068863_1000134095 209
40 3300005841 Ga0068863_100383229 Ga0068863_1003832292 209
41 3300006195 Ga0075366_10180353 Ga0075366_101803532 209
42 3300006237 Ga0097621_100674698 Ga0097621_1006746982 209
43 3300006353 Ga0075370_10010753 Ga0075370_100107534 209
44 3300006353 Ga0075370_10228548 Ga0075370_102285482 209
45 3300006358 Ga0068871_100384613 Ga0068871_1003846132 209
46 3300006931 Ga0097620_100409949 Ga0097620_1004099492 209
47 3300009098 Ga0105245_10116507 Ga0105245_101165074 209
48 3300009174 Ga0105241_10090894 Ga0105241_100908942 209
49 3300013296 Ga0157374_10101087 Ga0157374_101010873 209
50 3300013296 Ga0157374_10608683 Ga0157374_106086832 209
51 3300013306 Ga0163162_10596273 Ga0163162_105962732 209
52 3300025909 Ga0207705_10123308 Ga0207705_101233082 209
53 3300025919 Ga0207657_10534877 Ga0207657_105348771 209
54 3300025921 Ga0207652_10011724 Ga0207652_100117245 209
55 3300025927 Ga0207687_10041074 Ga0207687_100410744 209
56 3300025931 Ga0207644_10054254 Ga0207644_100542542 209
57 3300025942 Ga0207689_10226775 Ga0207689_102267751 209
58 3300025960 Ga0207651_10021440 Ga0207651_100214404 209
59 3300025981 Ga0207640_10733264 Ga0207640_107332642 209
60 3300026023 Ga0207677_10012138 Ga0207677_100121383 209
61 3300026023 Ga0207677_10042753 Ga0207677_100427532 209
62 3300026067 Ga0207678_10263660 Ga0207678_102636602 209
63 3300026088 Ga0207641_10015971 Ga0207641_100159716 209
64 3300026088 Ga0207641_10074815 Ga0207641_100748152 209
65 3300026088 Ga0207641_10355625 Ga0207641_103556252 209
66 3300026089 Ga0207648_10091987 Ga0207648_100919872 209
67 3300026095 Ga0207676_10040116 Ga0207676_100401162 209
68 3300026095 Ga0207676_10098344 Ga0207676_100983443 209
69 3300026121 Ga0207683_10029209 Ga0207683_100292094 209
70 3300028379 Ga0268266_10061891 Ga0268266_100618912 209
71 3300028786 Ga0307517_10000150 Ga0307517_1000015027 209
72 3300028794 Ga0307515_10005750 Ga0307515_100057505 209
73 3300028794 Ga0307515_10145113 Ga0307515_101451133 209
74 3300030522 Ga0307512_10078454 Ga0307512_100784543 209
75 3300031507 Ga0307509_10000092 Ga0307509_10000092110 209
76 3300031507 Ga0307509_10028720 Ga0307509_100287204 209
77 3300031507 Ga0307509_10039307 Ga0307509_100393074 209
78 3300031507 Ga0307509_10070268 Ga0307509_100702682 209
79 3300031616 Ga0307508_10052658 Ga0307508_100526584 209
80 3300031616 Ga0307508_10078713 Ga0307508_100787134 209
81 3300031616 Ga0307508_10433756 Ga0307508_104337562 209
82 3300031649 Ga0307514_10024537 Ga0307514_100245374 209
83 3300031649 Ga0307514_10214223 Ga0307514_102142232 209
84 3300031730 Ga0307516_10318104 Ga0307516_103181042 209
85 3300033179 Ga0307507_10055456 Ga0307507_100554564 209
86 3300033180 Ga0307510_10001753 Ga0307510_100017533 209
87 3300033180 Ga0307510_10010098 Ga0307510_100100989 209
88 3300033180 Ga0307510_10058183 Ga0307510_100581832 209
89 3300033180 Ga0307510_10223972 Ga0307510_102239722 209
90 3300035121 Ga0373960_0086552 Ga0373960_0086552_257_907 209
91 3300046460 Ga0495638_0054986 Ga0495638_0054986_981_1616 209
92 3300046473 Ga0495582_0058973 Ga0495582_0058973_481_1116 209
93 3300046512 Ga0495610_0163277 Ga0495610_0163277_264_899 209
94 3300046526 Ga0495666_0071446 Ga0495666_0071446_774_1409 209
95 3300046683 Ga0495658_0118597 Ga0495658_0118597_268_903 209
96 3300047315 Ga0495581_0135561 Ga0495581_0135561_107_742 209
97 3300048911 Ga0496108_0030613 Ga0496108_0030613_1832_2464 209
98 3300048912 Ga0496109_0285083 Ga0496109_0285083_11_643 209
99 3300050493 nmdc:mga0k408_78573_c1 nmdc:mga0k408_78573_c1_221_856 209
100 3300050493 nmdc:mga0k408_88534_c1 nmdc:mga0k408_88534_c1_649_1284 209
101 3300050496 nmdc:mga07m45_56572_c1 nmdc:mga07m45_56572_c1_490_1125 209
102 3300053092 Ga0500583_0060084 Ga0500583_0060084_820_1455 209
103 3300053093 Ga0500651_0132415 Ga0500651_0132415_38_673 209
104 3300053121 Ga0500607_163343 Ga0500607_163343_147_782 209
105 3300053131 Ga0500652_080354 Ga0500652_080354_639_1274 209
106 3300053136 Ga0500559_0000017 Ga0500559_0000017_20874_21509 209
107 3300053139 Ga0500568_0055041 Ga0500568_0055041_571_1206 209
108 3300053156 Ga0500622_0014050 Ga0500622_0014050_30_665 209
109 3300053177 Ga0500636_0035340 Ga0500636_0035340_36_671 209
110 3300053739 Ga0500587_006191 Ga0500587_006191_38_673 209
111 3300002705 JGI25156J39149_1000229 JGI25156J39149_10002296 210
112 3300002738 JGI25154J39366_1000931 JGI25154J39366_10009312 210
113 3300002741 JGI25157J39369_1000235 JGI25157J39369_10002356 210
114 3300003316 rootH1_10003054 rootH1_100030545 210
115 3300003316 rootH1_10034201 rootH1_100342011 210
116 3300003322 rootL2_10002813 rootL2_100028137 210
117 3300003322 rootL2_10047266 rootL2_100472662 210
118 3300003323 rootH1_10041586 rootH1_100415866 210
119 3300003374 JGI25161J50226_1014426 JGI25161J50226_10144261 210
120 3300003752 Ga0055539_1000428 Ga0055539_10004284 210
121 3300003752 Ga0055539_1001832 Ga0055539_10018324 210
122 3300003756 Ga0055533_1000221 Ga0055533_10002216 210
123 3300003759 Ga0055525_1001640 Ga0055525_10016403 210
124 3300003775 Ga0055524_1000755 Ga0055524_100075513 210
125 3300003794 Ga0055531_10003254 Ga0055531_100032548 210
126 3300004625 Ga0055543_1002246 Ga0055543_10022464 210
127 3300005262 Ga0065165_1000431 Ga0065165_100043137 210
128 3300005295 Ga0065707_10102460 Ga0065707_101024601 210
129 3300005327 Ga0070658_10229733 Ga0070658_102297332 210
130 3300005328 Ga0070676_10057916 Ga0070676_100579162 210
131 3300005328 Ga0070676_10078624 Ga0070676_100786242 210
132 3300005328 Ga0070676_10371765 Ga0070676_103717652 210
133 3300005330 Ga0070690_100024053 Ga0070690_1000240534 210
134 3300005330 Ga0070690_100040993 Ga0070690_1000409932 210
135 3300005331 Ga0070670_100000478 Ga0070670_10000047823 210
136 3300005331 Ga0070670_100084820 Ga0070670_1000848202 210
137 3300005331 Ga0070670_100314796 Ga0070670_1003147962 210
138 3300005333 Ga0070677_10005408 Ga0070677_100054084 210
139 3300005333 Ga0070677_10054323 Ga0070677_100543232 210
140 3300005333 Ga0070677_10062364 Ga0070677_100623642 210
141 3300005334 Ga0068869_100000634 Ga0068869_10000063414 210
142 3300005334 Ga0068869_100036853 Ga0068869_1000368534 210
143 3300005335 Ga0070666_10137532 Ga0070666_101375322 210
144 3300005338 Ga0068868_100031391 Ga0068868_1000313914 210
145 3300005338 Ga0068868_100045362 Ga0068868_1000453624 210
146 3300005338 Ga0068868_100061100 Ga0068868_1000611004 210
147 3300005338 Ga0068868_100282754 Ga0068868_1002827542 210
148 3300005338 Ga0068868_100702040 Ga0068868_1007020401 210
149 3300005339 Ga0070660_100023264 Ga0070660_1000232644 210
150 3300005339 Ga0070660_100024849 Ga0070660_1000248494 210
151 3300005339 Ga0070660_100028660 Ga0070660_1000286604 210
152 3300005343 Ga0070687_100167540 Ga0070687_1001675402 210
153 3300005344 Ga0070661_100015724 Ga0070661_1000157245 210
154 3300005344 Ga0070661_100035161 Ga0070661_1000351612 210
155 3300005344 Ga0070661_100180944 Ga0070661_1001809442 210
156 3300005344 Ga0070661_100285742 Ga0070661_1002857422 210
157 3300005347 Ga0070668_100015357 Ga0070668_1000153575 210
158 3300005347 Ga0070668_100100651 Ga0070668_1001006513 210
159 3300005347 Ga0070668_100104455 Ga0070668_1001044553 210
160 3300005347 Ga0070668_100231891 Ga0070668_1002318912 210
161 3300005347 Ga0070668_100438813 Ga0070668_1004388132 210
162 3300005353 Ga0070669_100008698 Ga0070669_1000086984 210
163 3300005353 Ga0070669_100019362 Ga0070669_1000193624 210
164 3300005353 Ga0070669_100019488 Ga0070669_1000194882 210
165 3300005354 Ga0070675_100008419 Ga0070675_1000084195 210
166 3300005354 Ga0070675_100008756 Ga0070675_1000087568 210
167 3300005354 Ga0070675_100018803 Ga0070675_1000188034 210
168 3300005354 Ga0070675_100066859 Ga0070675_1000668592 210
169 3300005354 Ga0070675_100072719 Ga0070675_1000727193 210
170 3300005355 Ga0070671_100001871 Ga0070671_10000187111 210
171 3300005355 Ga0070671_100023281 Ga0070671_1000232813 210
172 3300005355 Ga0070671_100081436 Ga0070671_1000814363 210
173 3300005355 Ga0070671_100146185 Ga0070671_1001461853 210
174 3300005356 Ga0070674_100002622 Ga0070674_1000026229 210
175 3300005356 Ga0070674_100052006 Ga0070674_1000520064 210
176 3300005356 Ga0070674_100240691 Ga0070674_1002406912 210
177 3300005356 Ga0070674_100418154 Ga0070674_1004181541 210
178 3300005364 Ga0070673_100032060 Ga0070673_1000320604 210
179 3300005364 Ga0070673_100120597 Ga0070673_1001205973 210
180 3300005364 Ga0070673_100669018 Ga0070673_1006690182 210
181 3300005364 Ga0070673_100693642 Ga0070673_1006936422 210
182 3300005366 Ga0070659_100037361 Ga0070659_1000373613 210
183 3300005366 Ga0070659_100098873 Ga0070659_1000988733 210
184 3300005367 Ga0070667_100027101 Ga0070667_1000271014 210
185 3300005367 Ga0070667_100027115 Ga0070667_1000271153 210
186 3300005367 Ga0070667_100401941 Ga0070667_1004019412 210
187 3300005455 Ga0070663_100008101 Ga0070663_1000081014 210
188 3300005455 Ga0070663_100031838 Ga0070663_1000318381 210
189 3300005455 Ga0070663_100487599 Ga0070663_1004875992 210
190 3300005456 Ga0070678_100002166 Ga0070678_1000021664 210
191 3300005456 Ga0070678_100010391 Ga0070678_1000103915 210
192 3300005456 Ga0070678_100054351 Ga0070678_1000543512 210
193 3300005457 Ga0070662_100002819 Ga0070662_1000028193 210
194 3300005457 Ga0070662_100021597 Ga0070662_1000215972 210
195 3300005457 Ga0070662_100094061 Ga0070662_1000940614 210
196 3300005457 Ga0070662_100096724 Ga0070662_1000967243 210
197 3300005458 Ga0070681_11202621 Ga0070681_112026211 210
198 3300005459 Ga0068867_100001470 Ga0068867_1000014705 210
199 3300005459 Ga0068867_100002200 Ga0068867_10000220010 210
200 3300005459 Ga0068867_100049528 Ga0068867_1000495284 210
201 3300005459 Ga0068867_100140542 Ga0068867_1001405422 210
202 3300005466 Ga0070685_10244394 Ga0070685_102443942 210
203 3300005467 Ga0070706_100002689 Ga0070706_1000026897 210
204 3300005468 Ga0070707_100048312 Ga0070707_1000483122 210
205 3300005518 Ga0070699_100074494 Ga0070699_1000744943 210
206 3300005535 Ga0070684_100425217 Ga0070684_1004252172 210
207 3300005539 Ga0068853_100016063 Ga0068853_1000160634 210
208 3300005539 Ga0068853_100021509 Ga0068853_1000215093 210
209 3300005539 Ga0068853_100232642 Ga0068853_1002326422 210
210 3300005543 Ga0070672_100029940 Ga0070672_1000299404 210
211 3300005543 Ga0070672_100043972 Ga0070672_1000439724 210
212 3300005543 Ga0070672_100057372 Ga0070672_1000573724 210
213 3300005543 Ga0070672_100061536 Ga0070672_1000615363 210
214 3300005543 Ga0070672_100123380 Ga0070672_1001233803 210
215 3300005543 Ga0070672_100142144 Ga0070672_1001421442 210
216 3300005543 Ga0070672_100456144 Ga0070672_1004561442 210
217 3300005544 Ga0070686_100177666 Ga0070686_1001776662 210
218 3300005547 Ga0070693_100337299 Ga0070693_1003372992 210
219 3300005563 Ga0068855_100017005 Ga0068855_1000170054 210
220 3300005563 Ga0068855_100224045 Ga0068855_1002240452 210
221 3300005564 Ga0070664_100121906 Ga0070664_1001219063 210
222 3300005564 Ga0070664_100261449 Ga0070664_1002614492 210
223 3300005564 Ga0070664_100273003 Ga0070664_1002730032 210
224 3300005564 Ga0070664_100574884 Ga0070664_1005748842 210
225 3300005577 Ga0068857_100019168 Ga0068857_1000191682 210
226 3300005577 Ga0068857_100029410 Ga0068857_1000294103 210
227 3300005577 Ga0068857_100070843 Ga0068857_1000708434 210
228 3300005578 Ga0068854_100064026 Ga0068854_1000640264 210
229 3300005578 Ga0068854_100075445 Ga0068854_1000754452 210
230 3300005578 Ga0068854_100851627 Ga0068854_1008516272 210
231 3300005614 Ga0068856_100005428 Ga0068856_1000054281 210
232 3300005614 Ga0068856_100035104 Ga0068856_1000351043 210
233 3300005614 Ga0068856_100066292 Ga0068856_1000662925 210
234 3300005615 Ga0070702_100007031 Ga0070702_1000070315 210
235 3300005616 Ga0068852_100007345 Ga0068852_1000073456 210
236 3300005616 Ga0068852_100019874 Ga0068852_1000198743 210
237 3300005616 Ga0068852_100048007 Ga0068852_1000480073 210
238 3300005616 Ga0068852_100070412 Ga0068852_1000704122 210
239 3300005616 Ga0068852_100072637 Ga0068852_1000726374 210
240 3300005616 Ga0068852_100131954 Ga0068852_1001319542 210
241 3300005616 Ga0068852_100141402 Ga0068852_1001414024 210
242 3300005616 Ga0068852_100202546 Ga0068852_1002025462 210
243 3300005616 Ga0068852_100209998 Ga0068852_1002099982 210
244 3300005617 Ga0068859_100103529 Ga0068859_1001035294 210
245 3300005617 Ga0068859_100423449 Ga0068859_1004234492 210
246 3300005617 Ga0068859_100520157 Ga0068859_1005201572 210
247 3300005618 Ga0068864_100028203 Ga0068864_1000282033 210
248 3300005618 Ga0068864_100049705 Ga0068864_1000497052 210
249 3300005618 Ga0068864_100073529 Ga0068864_1000735293 210
250 3300005618 Ga0068864_100091527 Ga0068864_1000915273 210
251 3300005718 Ga0068866_10096372 Ga0068866_100963723 210
252 3300005719 Ga0068861_100004781 Ga0068861_1000047815 210
253 3300005719 Ga0068861_100023310 Ga0068861_1000233103 210
254 3300005834 Ga0068851_10002615 Ga0068851_100026155 210
255 3300005834 Ga0068851_10062217 Ga0068851_100622172 210
256 3300005841 Ga0068863_100028725 Ga0068863_1000287254 210
257 3300005841 Ga0068863_100049664 Ga0068863_1000496643 210
258 3300005841 Ga0068863_100092225 Ga0068863_1000922252 210
259 3300005841 Ga0068863_100359569 Ga0068863_1003595692 210
260 3300005841 Ga0068863_100503523 Ga0068863_1005035232 210
261 3300005842 Ga0068858_100010595 Ga0068858_1000105957 210
262 3300005842 Ga0068858_100012601 Ga0068858_1000126014 210
263 3300005842 Ga0068858_100043397 Ga0068858_1000433973 210
264 3300005843 Ga0068860_100010055 Ga0068860_1000100554 210
265 3300005843 Ga0068860_100018058 Ga0068860_1000180585 210
266 3300005843 Ga0068860_100088212 Ga0068860_1000882123 210
267 3300005844 Ga0068862_100009005 Ga0068862_1000090053 210
268 3300005844 Ga0068862_100090859 Ga0068862_1000908594 210
269 3300006038 Ga0075365_10007360 Ga0075365_100073605 210
270 3300006042 Ga0075368_10016433 Ga0075368_100164333 210
271 3300006048 Ga0075363_100029335 Ga0075363_1000293352 210
272 3300006051 Ga0075364_10069251 Ga0075364_100692512 210
273 3300006163 Ga0070715_10089594 Ga0070715_100895942 210
274 3300006177 Ga0075362_10029489 Ga0075362_100294892 210
275 3300006177 Ga0075362_10078577 Ga0075362_100785772 210
276 3300006178 Ga0075367_10015422 Ga0075367_100154225 210
277 3300006178 Ga0075367_10034354 Ga0075367_100343544 210
278 3300006178 Ga0075367_10044180 Ga0075367_100441802 210
279 3300006178 Ga0075367_10071327 Ga0075367_100713273 210
280 3300006195 Ga0075366_10021476 Ga0075366_100214764 210
281 3300006195 Ga0075366_10036496 Ga0075366_100364964 210
282 3300006195 Ga0075366_10111760 Ga0075366_101117602 210
283 3300006195 Ga0075366_10185650 Ga0075366_101856502 210
284 3300006195 Ga0075366_10370037 Ga0075366_103700372 210
285 3300006237 Ga0097621_100008233 Ga0097621_1000082338 210
286 3300006237 Ga0097621_100111664 Ga0097621_1001116643 210
287 3300006353 Ga0075370_10000458 Ga0075370_100004585 210
288 3300006353 Ga0075370_10008466 Ga0075370_100084664 210
289 3300006353 Ga0075370_10017335 Ga0075370_100173353 210
290 3300006353 Ga0075370_10017842 Ga0075370_100178422 210
291 3300006353 Ga0075370_10023514 Ga0075370_100235144 210
292 3300006353 Ga0075370_10246120 Ga0075370_102461202 210
293 3300006358 Ga0068871_100030930 Ga0068871_1000309303 210
294 3300006358 Ga0068871_100191154 Ga0068871_1001911543 210
295 3300006358 Ga0068871_100382984 Ga0068871_1003829842 210
296 3300006358 Ga0068871_100507279 Ga0068871_1005072792 210
297 3300006881 Ga0068865_100009609 Ga0068865_1000096094 210
298 3300006881 Ga0068865_100035934 Ga0068865_1000359344 210
299 3300006881 Ga0068865_100050251 Ga0068865_1000502514 210
300 3300006881 Ga0068865_100264158 Ga0068865_1002641582 210
301 3300006881 Ga0068865_100403086 Ga0068865_1004030862 210
302 3300006881 Ga0068865_100434981 Ga0068865_1004349811 210
303 3300006931 Ga0097620_100103528 Ga0097620_1001035282 210
304 3300006931 Ga0097620_100423454 Ga0097620_1004234542 210
305 3300006931 Ga0097620_100520154 Ga0097620_1005201542 210
306 3300007076 Ga0075435_100487563 Ga0075435_1004875631 210
307 3300009093 Ga0105240_10000805 Ga0105240_100008059 210
308 3300009093 Ga0105240_10035322 Ga0105240_100353225 210
309 3300009093 Ga0105240_10132016 Ga0105240_101320162 210
310 3300009093 Ga0105240_10648100 Ga0105240_106481002 210
311 3300009093 Ga0105240_10685837 Ga0105240_106858371 210
312 3300009093 Ga0105240_10952085 Ga0105240_109520852 210
313 3300009098 Ga0105245_10036743 Ga0105245_100367433 210
314 3300009098 Ga0105245_10353499 Ga0105245_103534992 210
315 3300009098 Ga0105245_10602768 Ga0105245_106027682 210
316 3300009148 Ga0105243_10019432 Ga0105243_100194323 210
317 3300009176 Ga0105242_10172899 Ga0105242_101728992 210
318 3300009176 Ga0105242_10223391 Ga0105242_102233912 210
319 3300009177 Ga0105248_10042010 Ga0105248_100420102 210
320 3300009177 Ga0105248_10072967 Ga0105248_100729675 210
321 3300009177 Ga0105248_10107444 Ga0105248_101074442 210
322 3300009177 Ga0105248_10237531 Ga0105248_102375312 210
323 3300009545 Ga0105237_10004204 Ga0105237_100042045 210
324 3300009545 Ga0105237_10142698 Ga0105237_101426982 210
325 3300009551 Ga0105238_10004015 Ga0105238_100040156 210
326 3300009551 Ga0105238_10073129 Ga0105238_100731292 210
327 3300009553 Ga0105249_10066911 Ga0105249_100669113 210
328 3300009553 Ga0105249_10148115 Ga0105249_101481152 210
329 3300010375 Ga0105239_10000952 Ga0105239_100009525 210
330 3300010375 Ga0105239_10079253 Ga0105239_100792534 210
331 3300010375 Ga0105239_10112198 Ga0105239_101121983 210
332 3300010375 Ga0105239_10127813 Ga0105239_101278133 210
333 3300012497 Ga0157319_1000017 Ga0157319_100001711 210
334 3300013102 Ga0157371_10821537 Ga0157371_108215371 210
335 3300013104 Ga0157370_10704015 Ga0157370_107040152 210
336 3300013105 Ga0157369_10009904 Ga0157369_100099046 210
337 3300013296 Ga0157374_10020489 Ga0157374_100204895 210
338 3300013296 Ga0157374_10078210 Ga0157374_100782102 210
339 3300013297 Ga0157378_10004202 Ga0157378_100042026 210
340 3300013297 Ga0157378_10226365 Ga0157378_102263652 210
341 3300013306 Ga0163162_10074541 Ga0163162_100745414 210
342 3300013306 Ga0163162_10548411 Ga0163162_105484112 210
343 3300013307 Ga0157372_10050406 Ga0157372_100504063 210
344 3300013307 Ga0157372_10145075 Ga0157372_101450753 210
345 3300013308 Ga0157375_10050831 Ga0157375_100508313 210
346 3300013308 Ga0157375_10054470 Ga0157375_100544703 210
347 3300013308 Ga0157375_10055271 Ga0157375_100552714 210
348 3300013308 Ga0157375_10060927 Ga0157375_100609272 210
349 3300013308 Ga0157375_10074306 Ga0157375_100743062 210
350 3300014325 Ga0163163_10383691 Ga0163163_103836912 210
351 3300014326 Ga0157380_10002952 Ga0157380_100029522 210
352 3300014326 Ga0157380_10239707 Ga0157380_102397072 210
353 3300014326 Ga0157380_10829052 Ga0157380_108290521 210
354 3300014745 Ga0157377_10014024 Ga0157377_100140244 210
355 3300014968 Ga0157379_10010782 Ga0157379_100107822 210
356 3300014968 Ga0157379_10014569 Ga0157379_100145695 210
357 3300014968 Ga0157379_10049968 Ga0157379_100499683 210
358 3300014968 Ga0157379_10167912 Ga0157379_101679122 210
359 3300014968 Ga0157379_10240280 Ga0157379_102402802 210
360 3300014968 Ga0157379_10336517 Ga0157379_103365172 210
361 3300014969 Ga0157376_10008186 Ga0157376_100081864 210
362 3300014969 Ga0157376_10031452 Ga0157376_100314524 210
363 3300014969 Ga0157376_10045713 Ga0157376_100457132 210
364 3300014969 Ga0157376_10355926 Ga0157376_103559262 210
365 3300014969 Ga0157376_10407984 Ga0157376_104079842 210
366 3300014969 Ga0157376_10586990 Ga0157376_105869902 210
367 3300017792 Ga0163161_10021039 Ga0163161_100210394 210
368 3300017792 Ga0163161_10164429 Ga0163161_101644292 210
369 3300017792 Ga0163161_10183557 Ga0163161_101835572 210
370 3300017792 Ga0163161_10300541 Ga0163161_103005412 210
371 3300017792 Ga0163161_10508731 Ga0163161_105087312 210
372 3300021361 Ga0213872_10000099 Ga0213872_1000009956 210
373 3300025226 Ga0209674_100270 Ga0209674_1002706 210
374 3300025230 Ga0209563_100178 Ga0209563_1001786 210
375 3300025231 Ga0207427_102346 Ga0207427_1023465 210
376 3300025242 Ga0209258_101449 Ga0209258_1014494 210
377 3300025246 Ga0209646_1000625 Ga0209646_100062511 210
378 3300025250 Ga0209026_1000328 Ga0209026_100032827 210
379 3300025253 Ga0209677_100405 Ga0209677_1004054 210
380 3300025253 Ga0209677_101001 Ga0209677_10100111 210
381 3300025256 Ga0209759_1000448 Ga0209759_10004486 210
382 3300025256 Ga0209759_1001400 Ga0209759_100140012 210
383 3300025273 Ga0209673_1004161 Ga0209673_10041618 210
384 3300025299 Ga0209256_1000249 Ga0209256_100024911 210
385 3300025299 Ga0209256_1018429 Ga0209256_10184294 210
386 3300025303 Ga0209051_1015479 Ga0209051_10154794 210
387 3300025304 Ga0209257_1002034 Ga0209257_100203416 210
388 3300025321 Ga0207656_10117867 Ga0207656_101178672 210
389 3300025321 Ga0207656_10266704 Ga0207656_102667041 210
390 3300025893 Ga0207682_10002372 Ga0207682_100023725 210
391 3300025893 Ga0207682_10027149 Ga0207682_100271492 210
392 3300025899 Ga0207642_10080340 Ga0207642_100803402 210
393 3300025899 Ga0207642_10131020 Ga0207642_101310202 210
394 3300025901 Ga0207688_10215877 Ga0207688_102158772 210
395 3300025901 Ga0207688_10373940 Ga0207688_103739401 210
396 3300025903 Ga0207680_10036656 Ga0207680_100366562 210
397 3300025903 Ga0207680_10172534 Ga0207680_101725342 210
398 3300025907 Ga0207645_10014078 Ga0207645_100140784 210
399 3300025907 Ga0207645_10033581 Ga0207645_100335813 210
400 3300025907 Ga0207645_10054125 Ga0207645_100541254 210
401 3300025907 Ga0207645_10227986 Ga0207645_102279862 210
402 3300025909 Ga0207705_10128701 Ga0207705_101287012 210
403 3300025910 Ga0207684_10032813 Ga0207684_100328132 210
404 3300025913 Ga0207695_10011633 Ga0207695_100116336 210
405 3300025913 Ga0207695_10114027 Ga0207695_101140272 210
406 3300025913 Ga0207695_10436998 Ga0207695_104369982 210
407 3300025914 Ga0207671_10005118 Ga0207671_100051185 210
408 3300025914 Ga0207671_10168257 Ga0207671_101682572 210
409 3300025918 Ga0207662_10031228 Ga0207662_100312284 210
410 3300025919 Ga0207657_10035144 Ga0207657_100351445 210
411 3300025920 Ga0207649_10038271 Ga0207649_100382712 210
412 3300025920 Ga0207649_10232881 Ga0207649_102328812 210
413 3300025920 Ga0207649_10376559 Ga0207649_103765592 210
414 3300025921 Ga0207652_10410006 Ga0207652_104100062 210
415 3300025922 Ga0207646_10434402 Ga0207646_104344022 210
416 3300025923 Ga0207681_10028283 Ga0207681_100282833 210
417 3300025923 Ga0207681_10066226 Ga0207681_100662262 210
418 3300025923 Ga0207681_10306570 Ga0207681_103065702 210
419 3300025923 Ga0207681_10459464 Ga0207681_104594642 210
420 3300025924 Ga0207694_10025002 Ga0207694_100250024 210
421 3300025924 Ga0207694_10113996 Ga0207694_101139963 210
422 3300025924 Ga0207694_10405919 Ga0207694_104059192 210
423 3300025925 Ga0207650_10004285 Ga0207650_100042853 210
424 3300025925 Ga0207650_10006028 Ga0207650_100060284 210
425 3300025925 Ga0207650_10052624 Ga0207650_100526244 210
426 3300025925 Ga0207650_10270191 Ga0207650_102701912 210
427 3300025926 Ga0207659_10001020 Ga0207659_100010205 210
428 3300025926 Ga0207659_10081845 Ga0207659_100818452 210
429 3300025926 Ga0207659_10101692 Ga0207659_101016923 210
430 3300025926 Ga0207659_10524011 Ga0207659_105240111 210
431 3300025927 Ga0207687_10370327 Ga0207687_103703272 210
432 3300025931 Ga0207644_10002869 Ga0207644_100028699 210
433 3300025931 Ga0207644_10133510 Ga0207644_101335103 210
434 3300025931 Ga0207644_10140636 Ga0207644_101406363 210
435 3300025931 Ga0207644_10211862 Ga0207644_102118622 210
436 3300025931 Ga0207644_10653531 Ga0207644_106535311 210
437 3300025932 Ga0207690_10056681 Ga0207690_100566812 210
438 3300025933 Ga0207706_10005697 Ga0207706_100056977 210
439 3300025933 Ga0207706_10013190 Ga0207706_100131904 210
440 3300025933 Ga0207706_10025074 Ga0207706_100250745 210
441 3300025933 Ga0207706_10133424 Ga0207706_101334243 210
442 3300025933 Ga0207706_10238601 Ga0207706_102386012 210
443 3300025933 Ga0207706_10289177 Ga0207706_102891772 210
444 3300025934 Ga0207686_10104859 Ga0207686_101048592 210
445 3300025935 Ga0207709_10031682 Ga0207709_100316824 210
446 3300025935 Ga0207709_10189072 Ga0207709_101890722 210
447 3300025936 Ga0207670_10059890 Ga0207670_100598904 210
448 3300025937 Ga0207669_10016651 Ga0207669_100166514 210
449 3300025937 Ga0207669_10119817 Ga0207669_101198172 210
450 3300025937 Ga0207669_10154774 Ga0207669_101547742 210
451 3300025937 Ga0207669_10213210 Ga0207669_102132101 210
452 3300025938 Ga0207704_10031465 Ga0207704_100314652 210
453 3300025938 Ga0207704_10080533 Ga0207704_100805332 210
454 3300025938 Ga0207704_10090514 Ga0207704_100905143 210
455 3300025938 Ga0207704_10198622 Ga0207704_101986222 210
456 3300025938 Ga0207704_10406945 Ga0207704_104069452 210
457 3300025938 Ga0207704_10620604 Ga0207704_106206041 210
458 3300025940 Ga0207691_10018937 Ga0207691_100189375 210
459 3300025940 Ga0207691_10046734 Ga0207691_100467344 210
460 3300025940 Ga0207691_10057157 Ga0207691_100571574 210
461 3300025940 Ga0207691_10070461 Ga0207691_100704614 210
462 3300025940 Ga0207691_10109338 Ga0207691_101093384 210
463 3300025940 Ga0207691_10152760 Ga0207691_101527602 210
464 3300025940 Ga0207691_10161234 Ga0207691_101612342 210
465 3300025940 Ga0207691_10260652 Ga0207691_102606522 210
466 3300025941 Ga0207711_10016105 Ga0207711_100161055 210
467 3300025941 Ga0207711_10028530 Ga0207711_100285302 210
468 3300025941 Ga0207711_10066785 Ga0207711_100667852 210
469 3300025941 Ga0207711_10167208 Ga0207711_101672082 210
470 3300025941 Ga0207711_10410966 Ga0207711_104109662 210
471 3300025942 Ga0207689_10000343 Ga0207689_1000034321 210
472 3300025942 Ga0207689_10036619 Ga0207689_100366194 210
473 3300025944 Ga0207661_10131420 Ga0207661_101314202 210
474 3300025944 Ga0207661_10193401 Ga0207661_101934012 210
475 3300025945 Ga0207679_10179276 Ga0207679_101792762 210
476 3300025949 Ga0207667_10008525 Ga0207667_100085254 210
477 3300025949 Ga0207667_10087092 Ga0207667_100870925 210
478 3300025949 Ga0207667_10126130 Ga0207667_101261303 210
479 3300025960 Ga0207651_10040657 Ga0207651_100406574 210
480 3300025960 Ga0207651_10042473 Ga0207651_100424734 210
481 3300025960 Ga0207651_10099298 Ga0207651_100992983 210
482 3300025960 Ga0207651_10113733 Ga0207651_101137334 210
483 3300025961 Ga0207712_10026038 Ga0207712_100260383 210
484 3300025972 Ga0207668_10024199 Ga0207668_100241994 210
485 3300025972 Ga0207668_10111433 Ga0207668_101114332 210
486 3300025972 Ga0207668_10247932 Ga0207668_102479322 210
487 3300025972 Ga0207668_10265382 Ga0207668_102653822 210
488 3300025981 Ga0207640_10285872 Ga0207640_102858722 210
489 3300025981 Ga0207640_10329642 Ga0207640_103296422 210
490 3300025981 Ga0207640_10848153 Ga0207640_108481531 210
491 3300025986 Ga0207658_10010730 Ga0207658_100107302 210
492 3300025986 Ga0207658_10017106 Ga0207658_100171064 210
493 3300025986 Ga0207658_10088920 Ga0207658_100889202 210
494 3300025986 Ga0207658_10092939 Ga0207658_100929392 210
495 3300025986 Ga0207658_10379874 Ga0207658_103798742 210
496 3300026023 Ga0207677_10025612 Ga0207677_100256122 210
497 3300026023 Ga0207677_10039592 Ga0207677_100395924 210
498 3300026023 Ga0207677_10170697 Ga0207677_101706972 210
499 3300026023 Ga0207677_10306067 Ga0207677_103060672 210
500 3300026035 Ga0207703_10012605 Ga0207703_100126055 210
501 3300026035 Ga0207703_10052512 Ga0207703_100525124 210
502 3300026035 Ga0207703_10069221 Ga0207703_100692212 210
503 3300026041 Ga0207639_10024945 Ga0207639_100249453 210
504 3300026041 Ga0207639_10071971 Ga0207639_100719713 210
505 3300026041 Ga0207639_10072618 Ga0207639_100726182 210
506 3300026041 Ga0207639_10319221 Ga0207639_103192212 210
507 3300026041 Ga0207639_10385519 Ga0207639_103855192 210
508 3300026067 Ga0207678_10017049 Ga0207678_100170496 210
509 3300026067 Ga0207678_10045799 Ga0207678_100457993 210
510 3300026067 Ga0207678_10230991 Ga0207678_102309912 210
511 3300026075 Ga0207708_10013215 Ga0207708_100132156 210
512 3300026075 Ga0207708_10037030 Ga0207708_100370304 210
513 3300026078 Ga0207702_10001082 Ga0207702_100010826 210
514 3300026078 Ga0207702_10023275 Ga0207702_100232752 210
515 3300026078 Ga0207702_10627028 Ga0207702_106270282 210
516 3300026088 Ga0207641_10007434 Ga0207641_100074347 210
517 3300026088 Ga0207641_10018421 Ga0207641_100184214 210
518 3300026088 Ga0207641_10149902 Ga0207641_101499023 210
519 3300026088 Ga0207641_11093883 Ga0207641_110938832 210
520 3300026089 Ga0207648_10002442 Ga0207648_100024425 210
521 3300026089 Ga0207648_10015728 Ga0207648_100157284 210
522 3300026089 Ga0207648_10033178 Ga0207648_100331782 210
523 3300026089 Ga0207648_10057288 Ga0207648_100572884 210
524 3300026089 Ga0207648_10270460 Ga0207648_102704602 210
525 3300026089 Ga0207648_10407293 Ga0207648_104072932 210
526 3300026089 Ga0207648_10633928 Ga0207648_106339282 210
527 3300026089 Ga0207648_10689681 Ga0207648_106896812 210
528 3300026089 Ga0207648_10794037 Ga0207648_107940372 210
529 3300026095 Ga0207676_10019060 Ga0207676_100190604 210
530 3300026095 Ga0207676_10120794 Ga0207676_101207941 210
531 3300026095 Ga0207676_10147254 Ga0207676_101472542 210
532 3300026095 Ga0207676_10307872 Ga0207676_103078722 210
533 3300026116 Ga0207674_10019423 Ga0207674_100194236 210
534 3300026116 Ga0207674_10143532 Ga0207674_101435322 210
535 3300026116 Ga0207674_10245600 Ga0207674_102456002 210
536 3300026116 Ga0207674_10844564 Ga0207674_108445641 210
537 3300026118 Ga0207675_100000232 Ga0207675_1000002327 210
538 3300026118 Ga0207675_100007916 Ga0207675_1000079167 210
539 3300026118 Ga0207675_100053609 Ga0207675_1000536094 210
540 3300026118 Ga0207675_100722377 Ga0207675_1007223772 210
541 3300026121 Ga0207683_10003913 Ga0207683_100039134 210
542 3300026121 Ga0207683_10046420 Ga0207683_100464202 210
543 3300026121 Ga0207683_10107610 Ga0207683_101076104 210
544 3300026121 Ga0207683_10970148 Ga0207683_109701482 210
545 3300026142 Ga0207698_10010596 Ga0207698_100105964 210
546 3300026142 Ga0207698_10040003 Ga0207698_100400033 210
547 3300026142 Ga0207698_10105156 Ga0207698_101051562 210
548 3300026142 Ga0207698_10164476 Ga0207698_101644762 210
549 3300026142 Ga0207698_10302496 Ga0207698_103024962 210
550 3300026142 Ga0207698_11196430 Ga0207698_111964301 210
551 3300028379 Ga0268266_10125877 Ga0268266_101258772 210
552 3300028380 Ga0268265_10253132 Ga0268265_102531322 210
553 3300028381 Ga0268264_10010106 Ga0268264_100101062 210
554 3300028381 Ga0268264_10034250 Ga0268264_100342505 210
555 3300028381 Ga0268264_10081280 Ga0268264_100812802 210
556 3300028381 Ga0268264_10435358 Ga0268264_104353582 210
557 3300028786 Ga0307517_10087774 Ga0307517_100877744 210
558 3300028786 Ga0307517_10170316 Ga0307517_101703162 210
559 3300028786 Ga0307517_10220648 Ga0307517_102206482 210
560 3300028794 Ga0307515_10000041 Ga0307515_1000004169 210
561 3300028794 Ga0307515_10034288 Ga0307515_100342883 210
562 3300028794 Ga0307515_10132464 Ga0307515_101324642 210
563 3300031456 Ga0307513_10193759 Ga0307513_101937592 210
564 3300031548 Ga0307408_100484463 Ga0307408_1004844632 210
565 3300031730 Ga0307516_10005702 Ga0307516_100057026 210
566 3300031730 Ga0307516_10149379 Ga0307516_101493792 210
567 3300031911 Ga0307412_11214833 Ga0307412_112148331 210
568 3300034820 Ga0373959_0043176 Ga0373959_0043176_213_857 210
569 3300034957 Ga0373938_0112521 Ga0373938_0112521_23_676 210
570 3300035086 Ga0373934_0010718 Ga0373934_0010718_711_1346 210
571 3300035088 Ga0373940_0053505 Ga0373940_0053505_302_955 210
572 3300035089 Ga0373944_0079050 Ga0373944_0079050_314_946 210
573 3300035090 Ga0373949_0055560 Ga0373949_0055560_171_824 210
574 3300035120 Ga0373957_0078029 Ga0373957_0078029_619_1275 210
575 3300035170 Ga0373943_0203775 Ga0373943_0203775_11_667 210
576 3300035170 Ga0373943_0350208 Ga0373943_0350208_142_774 210
577 3300035172 Ga0373955_0110189 Ga0373955_0110189_817_1473 210
578 3300035172 Ga0373955_0122888 Ga0373955_0122888_813_1469 210
579 3300035241 Ga0373961_0123503 Ga0373961_0123503_59_712 210
580 3300035691 Ga0373931_0003424 Ga0373931_0003424_3987_4640 210
581 3300035691 Ga0373931_0009919 Ga0373931_0009919_1077_1709 210
582 3300035692 Ga0373935_0571463 Ga0373935_0571463_49_705 210
583 3300035695 Ga0373927_0136149 Ga0373927_0136149_807_1439 210
584 3300037068 Ga0373925_0021850 Ga0373925_0021850_855_1493 210
585 3300037471 Ga0395905_0042101 Ga0395905_0042101_2949_3587 210
586 3300037471 Ga0395905_0045108 Ga0395905_0045108_264_896 210
587 3300039437 Ga0436365_0276042 Ga0436365_0276042_442_1095 210
588 3300039447 Ga0436361_0048138 Ga0436361_0048138_1443_2075 210
589 3300039450 Ga0436363_0739873 Ga0436363_0739873_107_760 210
590 3300041463 Ga0451804_0085032 Ga0451804_0085032_147_806 210
591 3300041491 Ga0451833_0991326 Ga0451833_0991326_12_653 210
592 3300041496 Ga0451839_1168416 Ga0451839_1168416_452_1090 210
593 3300042007 Ga0439449_0205659 Ga0439449_0205659_34_666 210
594 3300042011 Ga0439454_021318 Ga0439454_021318_114_752 210
595 3300042127 Ga0450890_001619 Ga0450890_001619_80_718 210
596 3300042438 Ga0439459_0000861 Ga0439459_0000861_116_754 210
597 3300042876 Ga0451577_0079292 Ga0451577_0079292_417_1049 210
598 3300044901 Ga0466960_0139588 Ga0466960_0139588_247_879 210
599 3300045051 Ga0451576_0426833 Ga0451576_0426833_452_1084 210
600 3300045051 Ga0451576_1072218 Ga0451576_1072218_165_818 210
601 3300045051 Ga0451576_1222631 Ga0451576_1222631_72_725 210
602 3300046457 Ga0495590_0012205 Ga0495590_0012205_2157_2795 210
603 3300046459 Ga0495629_0080896 Ga0495629_0080896_34_690 210
604 3300046463 Ga0495653_0439764 Ga0495653_0439764_76_732 210
605 3300046472 Ga0495580_0432022 Ga0495580_0432022_149_805 210
606 3300046492 Ga0495585_0014070 Ga0495585_0014070_3304_3936 210
607 3300046511 Ga0495608_0337694 Ga0495608_0337694_32_688 210
608 3300046535 Ga0495586_0037906 Ga0495586_0037906_1813_2445 210
609 3300046537 Ga0495598_0022882 Ga0495598_0022882_661_1311 210
610 3300046681 Ga0495647_0046336 Ga0495647_0046336_543_1199 210
611 3300046683 Ga0495658_0041962 Ga0495658_0041962_1482_2138 210
612 3300046683 Ga0495658_0088969 Ga0495658_0088969_812_1468 210
613 3300046683 Ga0495658_0419848 Ga0495658_0419848_81_737 210
614 3300046691 Ga0495670_0046274 Ga0495670_0046274_736_1374 210
615 3300046692 Ga0495671_0214410 Ga0495671_0214410_116_754 210
616 3300046810 Ga0495660_0037192 Ga0495660_0037192_1671_2309 210
617 3300047443 Ga0495687_000799 Ga0495687_000799_4378_5016 210
618 3300048088 Ga0495602_0396162 Ga0495602_0396162_282_938 210
619 3300048903 Ga0496100_0286051 Ga0496100_0286051_470_1123 210
620 3300048904 Ga0496101_0023149 Ga0496101_0023149_424_1077 210
621 3300048905 Ga0496102_0089337 Ga0496102_0089337_2077_2730 210
622 3300048906 Ga0496103_0060726 Ga0496103_0060726_1593_2246 210
623 3300048908 Ga0496105_0283982 Ga0496105_0283982_373_1008 210
624 3300048909 Ga0496106_0041031 Ga0496106_0041031_2669_3322 210
625 3300048911 Ga0496108_0159048 Ga0496108_0159048_465_1121 210
626 3300048911 Ga0496108_0186440 Ga0496108_0186440_407_1063 210
627 3300048912 Ga0496109_0482447 Ga0496109_0482447_201_854 210
628 3300048913 Ga0496110_0030176 Ga0496110_0030176_3774_4427 210
629 3300048914 Ga0496111_0051890 Ga0496111_0051890_1763_2416 210
630 3300048917 Ga0496114_0142909 Ga0496114_0142909_957_1613 210
631 3300048917 Ga0496114_0275012 Ga0496114_0275012_211_864 210
632 3300048918 Ga0496115_0083052 Ga0496115_0083052_1561_2214 210
633 3300048927 Ga0496124_0000125 Ga0496124_0000125_19944_20576 210
634 3300048928 Ga0496125_0166524 Ga0496125_0166524_201_839 210
635 3300049649 Ga0501198_000015 Ga0501198_000015_91846_92484 210
636 3300049662 Ga0501222_000045 Ga0501222_000045_36119_36757 210
637 3300049822 Ga0501035_0161616 Ga0501035_0161616_807_1439 210
638 3300050489 nmdc:mga03683_156082_c1 nmdc:mga03683_156082_c1_137_775 210
639 3300050489 nmdc:mga03683_202589_c1 nmdc:mga03683_202589_c1_73_711 210
640 3300050489 nmdc:mga03683_41971_c1 nmdc:mga03683_41971_c1_985_1617 210
641 3300050490 nmdc:mga03n38_285837_c1 nmdc:mga03n38_285837_c1_113_751 210
642 3300050490 nmdc:mga03n38_72435_c1 nmdc:mga03n38_72435_c1_440_1078 210
643 3300050493 nmdc:mga0k408_22389_c1 nmdc:mga0k408_22389_c1_2812_3447 210
644 3300050493 nmdc:mga0k408_49852_c1 nmdc:mga0k408_49852_c1_639_1271 210
645 3300050493 nmdc:mga0k408_56713_c1 nmdc:mga0k408_56713_c1_196_834 210
646 3300050493 nmdc:mga0k408_835_c1 nmdc:mga0k408_835_c1_10324_10962 210
647 3300050494 nmdc:mga06z11_248018_c1 nmdc:mga06z11_248018_c1_240_881 210
648 3300050494 nmdc:mga06z11_30425_c1 nmdc:mga06z11_30425_c1_1709_2347 210
649 3300050494 nmdc:mga06z11_4334_c1 nmdc:mga06z11_4334_c1_2978_3616 210
650 3300050495 nmdc:mga04h51_30817_c1 nmdc:mga04h51_30817_c1_523_1155 210
651 3300050496 nmdc:mga07m45_10920_c1 nmdc:mga07m45_10920_c1_3857_4492 210
652 3300050496 nmdc:mga07m45_14822_c1 nmdc:mga07m45_14822_c1_264_902 210
653 3300050496 nmdc:mga07m45_33478_c1 nmdc:mga07m45_33478_c1_1734_2366 210
654 3300050496 nmdc:mga07m45_34578_c1 nmdc:mga07m45_34578_c1_2077_2715 210
655 3300050496 nmdc:mga07m45_62872_c1 nmdc:mga07m45_62872_c1_327_968 210
656 3300050496 nmdc:mga07m45_692_c1 nmdc:mga07m45_692_c1_10325_10963 210
657 3300050496 nmdc:mga07m45_897_c1 nmdc:mga07m45_897_c1_4859_5497 210
658 3300050516 nmdc:mga0sz30_200958_c1 nmdc:mga0sz30_200958_c1_199_837 210
659 3300050516 nmdc:mga0sz30_73910_c1 nmdc:mga0sz30_73910_c1_403_1041 210
660 3300053085 Ga0495619_0402156 Ga0495619_0402156_99_755 210
661 3300053156 Ga0500622_0001025 Ga0500622_0001025_5655_6293 210
662 3300003316 rootH1_10023119 rootH1_100231194 211
663 3300003323 rootH1_10074880 rootH1_100748803 211
664 3300003347 JGI26128J50194_1004221 JGI26128J50194_10042211 211
665 3300005328 Ga0070676_10001637 Ga0070676_100016375 211
666 3300005334 Ga0068869_100059355 Ga0068869_1000593552 211
667 3300005338 Ga0068868_100021554 Ga0068868_1000215542 211
668 3300005344 Ga0070661_100275845 Ga0070661_1002758451 211
669 3300005354 Ga0070675_100062953 Ga0070675_1000629532 211
670 3300005356 Ga0070674_100757619 Ga0070674_1007576191 211
671 3300005364 Ga0070673_100015622 Ga0070673_1000156221 211
672 3300005364 Ga0070673_100069782 Ga0070673_1000697824 211
673 3300005456 Ga0070678_100030242 Ga0070678_1000302424 211
674 3300005457 Ga0070662_100056699 Ga0070662_1000566992 211
675 3300005459 Ga0068867_100003775 Ga0068867_1000037755 211
676 3300005459 Ga0068867_100384374 Ga0068867_1003843741 211
677 3300005543 Ga0070672_100011507 Ga0070672_1000115075 211
678 3300005543 Ga0070672_100027376 Ga0070672_1000273764 211
679 3300005577 Ga0068857_100940600 Ga0068857_1009406001 211
680 3300005616 Ga0068852_100475216 Ga0068852_1004752161 211
681 3300005840 Ga0068870_10269817 Ga0068870_102698172 211
682 3300005843 Ga0068860_100218629 Ga0068860_1002186292 211
683 3300006048 Ga0075363_100371507 Ga0075363_1003715071 211
684 3300006195 Ga0075366_10182494 Ga0075366_101824941 211
685 3300006881 Ga0068865_100318483 Ga0068865_1003184832 211
686 3300009553 Ga0105249_10882461 Ga0105249_108824612 211
687 3300013308 Ga0157375_10073139 Ga0157375_100731394 211
688 3300014326 Ga0157380_10423719 Ga0157380_104237192 211
689 3300025907 Ga0207645_10003150 Ga0207645_100031507 211
690 3300025907 Ga0207645_10157636 Ga0207645_101576362 211
691 3300025908 Ga0207643_10049299 Ga0207643_100492993 211
692 3300025926 Ga0207659_10764822 Ga0207659_107648221 211
693 3300025926 Ga0207659_10839196 Ga0207659_108391962 211
694 3300025933 Ga0207706_10010641 Ga0207706_100106412 211
695 3300025933 Ga0207706_10422615 Ga0207706_104226151 211
696 3300025937 Ga0207669_10918738 Ga0207669_109187381 211
697 3300025938 Ga0207704_10155777 Ga0207704_101557772 211
698 3300025940 Ga0207691_10041148 Ga0207691_100411484 211
699 3300025940 Ga0207691_10049285 Ga0207691_100492852 211
700 3300025942 Ga0207689_10072103 Ga0207689_100721034 211
701 3300025960 Ga0207651_10065414 Ga0207651_100654142 211
702 3300025960 Ga0207651_10185827 Ga0207651_101858272 211
703 3300025972 Ga0207668_10109831 Ga0207668_101098312 211
704 3300026089 Ga0207648_10007746 Ga0207648_100077464 211
705 3300026089 Ga0207648_10325212 Ga0207648_103252122 211
706 3300026116 Ga0207674_10014024 Ga0207674_100140246 211
707 3300026121 Ga0207683_10172792 Ga0207683_101727922 211
708 3300026121 Ga0207683_10597073 Ga0207683_105970732 211
709 3300026142 Ga0207698_10104453 Ga0207698_101044533 211
710 3300027471 Ga0209995_1043284 Ga0209995_10432841 211
711 3300027543 Ga0209999_1055400 Ga0209999_10554001 211
712 3300027695 Ga0209966_1000031 Ga0209966_100003122 211
713 3300028381 Ga0268264_10448371 Ga0268264_104483712 211
714 3300028786 Ga0307517_10058977 Ga0307517_100589774 211
715 3300031456 Ga0307513_10012452 Ga0307513_100124524 211
716 3300031730 Ga0307516_10000181 Ga0307516_100001812 211
717 3300037418 Ga0395900_0000109 Ga0395900_0000109_69297_69932 211
718 3300037466 Ga0395898_0001529 Ga0395898_0001529_5177_5812 211
719 3300037471 Ga0395905_0007151 Ga0395905_0007151_5330_5965 211
720 3300037471 Ga0395905_0019669 Ga0395905_0019669_680_1315 211
721 3300042876 Ga0451577_0031026 Ga0451577_0031026_1991_2626 211
722 3300044656 Ga0466969_0000228 Ga0466969_0000228_14896_15531 211
723 3300044656 Ga0466969_0002471 Ga0466969_0002471_7410_8045 211
724 3300044656 Ga0466969_0101781 Ga0466969_0101781_343_978 211
725 3300044658 Ga0466972_0000570 Ga0466972_0000570_1930_2565 211
726 3300044658 Ga0466972_0021412 Ga0466972_0021412_354_989 211
727 3300044683 Ga0466965_0048338 Ga0466965_0048338_1052_1687 211
728 3300044684 Ga0466966_0002199 Ga0466966_0002199_7937_8572 211
729 3300044684 Ga0466966_0046271 Ga0466966_0046271_1378_2013 211
730 3300044693 Ga0466961_0007260 Ga0466961_0007260_1963_2598 211
731 3300044693 Ga0466961_0095907 Ga0466961_0095907_685_1320 211
732 3300044693 Ga0466961_0114823 Ga0466961_0114823_260_895 211
733 3300044694 Ga0466963_0001246 Ga0466963_0001246_445_1080 211
734 3300044706 Ga0466964_0000493 Ga0466964_0000493_8357_8992 211
735 3300044719 Ga0466971_0005061 Ga0466971_0005061_2810_3445 211
736 3300044719 Ga0466971_0283345 Ga0466971_0283345_30_665 211
737 3300044735 Ga0466968_0035334 Ga0466968_0035334_1266_1913 211
738 3300044765 Ga0466970_0017512 Ga0466970_0017512_807_1442 211
739 3300044842 Ga0466957_0027573 Ga0466957_0027573_1773_2408 211
740 3300044901 Ga0466960_0020740 Ga0466960_0020740_1659_2294 211
741 3300045049 Ga0466959_0007627 Ga0466959_0007627_1963_2598 211
742 3300045049 Ga0466959_0042147 Ga0466959_0042147_2521_3156 211
743 3300045049 Ga0466959_0043963 Ga0466959_0043963_2589_3224 211
744 3300045836 Ga0466958_0331521 Ga0466958_0331521_317_952 211
745 3300045976 Ga0466967_0066436 Ga0466967_0066436_1989_2624 211
746 3300046537 Ga0495598_0067240 Ga0495598_0067240_262_903 211
747 3300048924 Ga0496121_0502785 Ga0496121_0502785_57_698 211
748 3300049742 Ga0501080_0428265 Ga0501080_0428265_375_1046 211
749 3300049742 Ga0501080_0948902 Ga0501080_0948902_44_715 211
750 3300050493 nmdc:mga0k408_287195_c1 nmdc:mga0k408_287195_c1_300_935 211
751 3300050496 nmdc:mga07m45_297112_c1 nmdc:mga07m45_297112_c1_258_893 211
752 3300053137 Ga0500561_0038442 Ga0500561_0038442_336_977 211
753 3300061719 Ga0466962_0068448 Ga0466962_0068448_669_1304 211
754 3300013297 Ga0157378_10081708 Ga0157378_100817085 212
755 3300026067 Ga0207678_10006858 Ga0207678_100068585 212
756 3300031507 Ga0307509_10120786 Ga0307509_101207864 212
757 3300031548 Ga0307408_100164821 Ga0307408_1001648212 212
758 3300032002 Ga0307416_100448605 Ga0307416_1004486052 212
759 3300042876 Ga0451577_0288645 Ga0451577_0288645_579_1223 212
760 3300044712 Ga0453684_0515157 Ga0453684_0515157_383_1027 212
761 3300049569 Ga0501032_0112919 Ga0501032_0112919_169_813 212
762 3300049579 Ga0501043_0000027 Ga0501043_0000027_47275_47919 212
763 3300049580 Ga0501046_0000034 Ga0501046_0000034_47271_47915 212
764 3300049581 Ga0501047_0000042 Ga0501047_0000042_128685_129329 212
765 3300049582 Ga0501048_0000019 Ga0501048_0000019_61607_62251 212
766 3300049824 Ga0501045_0002741 Ga0501045_0002741_11348_11992 212
767 3300003759 Ga0055525_1000026 Ga0055525_100002620 213
768 3300013308 Ga0157375_10078179 Ga0157375_100781794 213
769 3300014968 Ga0157379_10203607 Ga0157379_102036073 213
770 3300025230 Ga0209563_100005 Ga0209563_1000051574 213
771 3300025256 Ga0209759_1007453 Ga0209759_10074532 213
772 3300028794 Ga0307515_10000187 Ga0307515_10000187106 213
773 3300031649 Ga0307514_10001419 Ga0307514_1000141918 213
774 3300037471 Ga0395905_0027072 Ga0395905_0027072_4202_4846 213
775 3300039447 Ga0436361_0831660 Ga0436361_0831660_63_707 213
776 3300045051 Ga0451576_0130115 Ga0451576_0130115_1213_1854 213
777 3300048924 Ga0496121_0007493 Ga0496121_0007493_2535_3194 213
778 3300039447 Ga0436361_0720979 Ga0436361_0720979_11447_12121 214
779 3300042876 Ga0451577_0000877 Ga0451577_0000877_32305_32958 214
780 3300044712 Ga0453684_0011227 Ga0453684_0011227_2389_3042 214
781 3300059424 Ga0590075_076400 Ga0590075_076400_14_664 214
782 3300046454 Ga0495592_0005162 Ga0495592_0005162_8586_9242 216
783 3300042015 Ga0439462_0110993 Ga0439462_0110993_34_687 217
784 3300002077 JGI24744J21845_10026344 JGI24744J21845_100263441 225
785 3300059421 Ga0590071_002007 Ga0590071_002007_3358_4098 225
786 3300059423 Ga0590074_003679 Ga0590074_003679_449_1189 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

32

107

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

164

218

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

41

108

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

36

113

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9767 16 224
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9656 14 224
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9596 16 225
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9586 16 224
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.9496 14 224
ID Description Score Start End Superfamily
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9728 15 76 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9678 15 97 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9672 97 224 1.20.1050.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9669 15 90 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9668 18 83 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A429MKP1-F1-model_v4 Maleylacetoacetate isomerase 0.9835 16 110 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A1AYE6-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9823 15 225 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A519JGG1-F1-model_v4 Maleylacetoacetate isomerase 0.9821 16 129 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A5N7S147-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9816 15 225 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A2W5DZC1-F1-model_v4 Maleylacetoacetate isomerase 0.9792 16 224 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
91.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map