F480794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 440 | 784 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0222666|Ga0395900_0222666_539_988 |
| Length | 149 |
| Sequence | MDRIPILRMGPYLLVTIQVDMHDRLALALQDDLTALIARTGSKGVLIDISSLDLVDSFIGRMLVNIAQMSRILDARTVVVGMRPAVAITLVELGMSLTGVQTALNVERGMDLLRRALADDLAANGTTGSDEKDDDGTLPGAPADAGHAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 3 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 4 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 5 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 262 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 263 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 264 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 265 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 266 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 267 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 271 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 272 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 273 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 274 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 275 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 276 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 277 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 278 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 285 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 334 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 335 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 336 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 337 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 338 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 339 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 340 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 341 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 343 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 366 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 368 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 370 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 371 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 372 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 373 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 374 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 375 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 377 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 381 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 387 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 388 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 389 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 393 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 394 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 395 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 396 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 397 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 398 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 399 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 400 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 401 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 404 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 407 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 408 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 409 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 410 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 411 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 412 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 413 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 414 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 415 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 416 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 421 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 422 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0 |
| Rhizoplane | 1.53 |
| Rhizosphere | 94.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1452750 | 2162886007 | Bacteria | 2280 |
| 2 | SwRhRL2b_contig_1758738 | 2162886007 | Bacteria | 1451 |
| 3 | SwRhRL2b_contig_219822 | 2162886007 | Bacteria | 8461 |
| 4 | JGI26145J50221_1001594 | 3300003371 | Bacteria | 1790 |
| 5 | Ga0058692_1006450 | 3300003856 | Bacteria | 3218 |
| 6 | Ga0058863_11260821 | 3300004799 | Bacteria | 782 |
| 7 | Ga0058861_10845447 | 3300004800 | Bacteria | 806 |
| 8 | Ga0058862_12756080 | 3300004803 | Bacteria | 2046 |
| 9 | Ga0065714_10434882 | 3300005288 | Bacteria | 564 |
| 10 | Ga0065704_10010704 | 3300005289 | Bacteria | 2065 |
| 11 | Ga0065704_10072434 | 3300005289 | Bacteria | 8532 |
| 12 | Ga0065712_10448217 | 3300005290 | Bacteria | 688 |
| 13 | Ga0065712_10452219 | 3300005290 | Bacteria | 685 |
| 14 | Ga0065715_10404665 | 3300005293 | Bacteria | 877 |
| 15 | Ga0065715_10413971 | 3300005293 | Bacteria | 866 |
| 16 | Ga0065715_10609137 | 3300005293 | Bacteria | 702 |
| 17 | Ga0065707_10096924 | 3300005295 | Bacteria | 3221 |
| 18 | Ga0070676_10066165 | 3300005328 | Bacteria | 2159 |
| 19 | Ga0070676_10476046 | 3300005328 | Bacteria | 882 |
| 20 | Ga0070683_100093720 | 3300005329 | Bacteria | 2822 |
| 21 | Ga0070690_100000841 | 3300005330 | Bacteria | 15569 |
| 22 | Ga0070690_100000912 | 3300005330 | Bacteria | 15074 |
| 23 | Ga0070690_100131949 | 3300005330 | Bacteria | 1688 |
| 24 | Ga0070690_100379658 | 3300005330 | Bacteria | 1033 |
| 25 | Ga0070670_100013378 | 3300005331 | Bacteria | 7029 |
| 26 | Ga0070670_100195057 | 3300005331 | Bacteria | 1759 |
| 27 | Ga0070670_100817275 | 3300005331 | Bacteria | 842 |
| 28 | Ga0070677_10022397 | 3300005333 | Bacteria | 2326 |
| 29 | Ga0068869_100000727 | 3300005334 | Bacteria | 18759 |
| 30 | Ga0068869_100014841 | 3300005334 | Bacteria | 5208 |
| 31 | Ga0068869_100473215 | 3300005334 | Bacteria | 1042 |
| 32 | Ga0068869_100550442 | 3300005334 | Bacteria | 969 |
| 33 | Ga0068869_100721555 | 3300005334 | Bacteria | 851 |
| 34 | Ga0070666_10055827 | 3300005335 | Bacteria | 2666 |
| 35 | Ga0070680_100009718 | 3300005336 | Bacteria | 7402 |
| 36 | Ga0070680_100175434 | 3300005336 | Bacteria | 1804 |
| 37 | Ga0070682_100027537 | 3300005337 | Bacteria | 3411 |
| 38 | Ga0070682_100059173 | 3300005337 | Bacteria | 2419 |
| 39 | Ga0070682_100531001 | 3300005337 | Bacteria | 917 |
| 40 | Ga0068868_100104320 | 3300005338 | Bacteria | 2297 |
| 41 | Ga0068868_100517867 | 3300005338 | Bacteria | 1047 |
| 42 | Ga0070660_100009427 | 3300005339 | Bacteria | 6865 |
| 43 | Ga0070689_100004042 | 3300005340 | Bacteria | 9869 |
| 44 | Ga0070689_100008310 | 3300005340 | Bacteria | 7307 |
| 45 | Ga0070689_100051706 | 3300005340 | Bacteria | 3176 |
| 46 | Ga0070689_100946943 | 3300005340 | Bacteria | 764 |
| 47 | Ga0070691_10014047 | 3300005341 | Bacteria | 3673 |
| 48 | Ga0070691_10132523 | 3300005341 | Bacteria | 1264 |
| 49 | Ga0070691_10152136 | 3300005341 | Bacteria | 1187 |
| 50 | Ga0070691_10871928 | 3300005341 | Bacteria | 553 |
| 51 | Ga0070687_100009907 | 3300005343 | Bacteria | 4097 |
| 52 | Ga0070687_100015720 | 3300005343 | Bacteria | 3430 |
| 53 | Ga0070687_100895258 | 3300005343 | Bacteria | 636 |
| 54 | Ga0070661_100025052 | 3300005344 | Bacteria | 4284 |
| 55 | Ga0070692_10006374 | 3300005345 | Bacteria | 5121 |
| 56 | Ga0070692_10012469 | 3300005345 | Bacteria | 3936 |
| 57 | Ga0070692_10077452 | 3300005345 | Bacteria | 1784 |
| 58 | Ga0070692_10581755 | 3300005345 | Bacteria | 738 |
| 59 | Ga0070668_100085257 | 3300005347 | Bacteria | 2482 |
| 60 | Ga0070668_100297458 | 3300005347 | Bacteria | 1353 |
| 61 | Ga0070669_100026033 | 3300005353 | Bacteria | 4207 |
| 62 | Ga0070669_100112903 | 3300005353 | Bacteria | 2064 |
| 63 | Ga0070669_100272185 | 3300005353 | Bacteria | 1355 |
| 64 | Ga0070675_100123596 | 3300005354 | Bacteria | 2200 |
| 65 | Ga0070675_100147866 | 3300005354 | Bacteria | 2013 |
| 66 | Ga0070675_100374112 | 3300005354 | Bacteria | 1267 |
| 67 | Ga0070675_102179023 | 3300005354 | Bacteria | 511 |
| 68 | Ga0070671_100779866 | 3300005355 | Bacteria | 832 |
| 69 | Ga0070674_100084892 | 3300005356 | Bacteria | 2271 |
| 70 | Ga0070673_100120125 | 3300005364 | Bacteria | 2191 |
| 71 | Ga0070673_100133352 | 3300005364 | Bacteria | 2087 |
| 72 | Ga0070673_100155156 | 3300005364 | Bacteria | 1942 |
| 73 | Ga0070673_101318465 | 3300005364 | Bacteria | 678 |
| 74 | Ga0070688_100018522 | 3300005365 | Bacteria | 4019 |
| 75 | Ga0070688_100036061 | 3300005365 | Bacteria | 3007 |
| 76 | Ga0070688_100207912 | 3300005365 | Bacteria | 1373 |
| 77 | Ga0070688_100302557 | 3300005365 | Bacteria | 1156 |
| 78 | Ga0070688_100532455 | 3300005365 | Bacteria | 891 |
| 79 | Ga0070688_100943003 | 3300005365 | Bacteria | 683 |
| 80 | Ga0070659_100080685 | 3300005366 | Bacteria | 2597 |
| 81 | Ga0070667_100198207 | 3300005367 | Bacteria | 1781 |
| 82 | Ga0070667_100222995 | 3300005367 | Bacteria | 1679 |
| 83 | Ga0070667_101041964 | 3300005367 | Bacteria | 764 |
| 84 | Ga0070703_10137711 | 3300005406 | Bacteria | 904 |
| 85 | Ga0070713_100064777 | 3300005436 | Bacteria | 3068 |
| 86 | Ga0070710_10610706 | 3300005437 | Bacteria | 760 |
| 87 | Ga0070701_10003790 | 3300005438 | Bacteria | 6041 |
| 88 | Ga0070701_10008347 | 3300005438 | Bacteria | 4476 |
| 89 | Ga0070701_10055474 | 3300005438 | Bacteria | 2070 |
| 90 | Ga0070701_10580358 | 3300005438 | Bacteria | 740 |
| 91 | Ga0070701_10639329 | 3300005438 | Bacteria | 709 |
| 92 | Ga0070711_100150709 | 3300005439 | Bacteria | 1753 |
| 93 | Ga0070705_100000565 | 3300005440 | Bacteria | 21451 |
| 94 | Ga0070705_100648925 | 3300005440 | Bacteria | 823 |
| 95 | Ga0070705_101642539 | 3300005440 | Bacteria | 542 |
| 96 | Ga0070700_100000322 | 3300005441 | Bacteria | 25019 |
| 97 | Ga0070700_100009240 | 3300005441 | Bacteria | 5404 |
| 98 | Ga0070700_100049482 | 3300005441 | Bacteria | 2610 |
| 99 | Ga0070694_100001696 | 3300005444 | Bacteria | 12967 |
| 100 | Ga0070694_100003006 | 3300005444 | Bacteria | 10033 |
| 101 | Ga0070694_100200565 | 3300005444 | Bacteria | 1487 |
| 102 | Ga0070708_100089835 | 3300005445 | Bacteria | 2796 |
| 103 | Ga0070678_100009084 | 3300005456 | Bacteria | 5994 |
| 104 | Ga0070662_100092236 | 3300005457 | Bacteria | 2276 |
| 105 | Ga0070681_10095270 | 3300005458 | Bacteria | 2925 |
| 106 | Ga0068867_100000640 | 3300005459 | Bacteria | 23146 |
| 107 | Ga0068867_100001065 | 3300005459 | Bacteria | 18727 |
| 108 | Ga0068867_101683612 | 3300005459 | Bacteria | 594 |
| 109 | Ga0070685_10339001 | 3300005466 | Bacteria | 1024 |
| 110 | Ga0070685_10352270 | 3300005466 | Bacteria | 1007 |
| 111 | Ga0070706_100405856 | 3300005467 | Bacteria | 1269 |
| 112 | Ga0070707_100538928 | 3300005468 | Bacteria | 1129 |
| 113 | Ga0070699_100266336 | 3300005518 | Bacteria | 1533 |
| 114 | Ga0070699_100365096 | 3300005518 | Bacteria | 1302 |
| 115 | Ga0070679_100034021 | 3300005530 | Bacteria | 5048 |
| 116 | Ga0070679_100227553 | 3300005530 | Bacteria | 1825 |
| 117 | Ga0070679_102017815 | 3300005530 | Bacteria | 526 |
| 118 | Ga0070684_100467157 | 3300005535 | Bacteria | 1167 |
| 119 | Ga0070684_101060586 | 3300005535 | Bacteria | 761 |
| 120 | Ga0070684_101547979 | 3300005535 | Bacteria | 625 |
| 121 | Ga0070672_100011126 | 3300005543 | Bacteria | 6267 |
| 122 | Ga0070672_100311781 | 3300005543 | Bacteria | 1336 |
| 123 | Ga0070672_100987555 | 3300005543 | Bacteria | 746 |
| 124 | Ga0070672_101814911 | 3300005543 | Bacteria | 548 |
| 125 | Ga0070686_100002616 | 3300005544 | Bacteria | 9929 |
| 126 | Ga0070686_100004998 | 3300005544 | Bacteria | 7319 |
| 127 | Ga0070686_101079135 | 3300005544 | Bacteria | 662 |
| 128 | Ga0070695_100029658 | 3300005545 | Bacteria | 3400 |
| 129 | Ga0070695_100034853 | 3300005545 | Bacteria | 3159 |
| 130 | Ga0070695_100141700 | 3300005545 | Bacteria | 1668 |
| 131 | Ga0070695_100180466 | 3300005545 | Bacteria | 1495 |
| 132 | Ga0070695_100743022 | 3300005545 | Bacteria | 782 |
| 133 | Ga0070696_100000527 | 3300005546 | Bacteria | 24255 |
| 134 | Ga0070696_100166378 | 3300005546 | Bacteria | 1627 |
| 135 | Ga0070696_100276689 | 3300005546 | Bacteria | 1278 |
| 136 | Ga0070696_100570797 | 3300005546 | Bacteria | 909 |
| 137 | Ga0070696_100937961 | 3300005546 | Bacteria | 720 |
| 138 | Ga0070693_100000145 | 3300005547 | Bacteria | 32140 |
| 139 | Ga0070693_100028320 | 3300005547 | Bacteria | 3045 |
| 140 | Ga0070693_100082655 | 3300005547 | Bacteria | 1918 |
| 141 | Ga0070665_100054089 | 3300005548 | Bacteria | 4026 |
| 142 | Ga0070704_100002205 | 3300005549 | Bacteria | 10857 |
| 143 | Ga0070704_100085804 | 3300005549 | Bacteria | 2331 |
| 144 | Ga0070704_100384651 | 3300005549 | Bacteria | 1193 |
| 145 | Ga0068855_100019512 | 3300005563 | Bacteria | 8147 |
| 146 | Ga0068855_100059672 | 3300005563 | Bacteria | 4463 |
| 147 | Ga0068855_100710056 | 3300005563 | Bacteria | 1075 |
| 148 | Ga0070664_100085618 | 3300005564 | Bacteria | 2722 |
| 149 | Ga0068857_100061866 | 3300005577 | Bacteria | 3326 |
| 150 | Ga0068854_100014453 | 3300005578 | Bacteria | 5205 |
| 151 | Ga0068854_100077746 | 3300005578 | Bacteria | 2443 |
| 152 | Ga0068856_100163161 | 3300005614 | Bacteria | 2240 |
| 153 | Ga0068856_100264168 | 3300005614 | Bacteria | 1737 |
| 154 | Ga0070702_100000209 | 3300005615 | Bacteria | 19373 |
| 155 | Ga0070702_100002869 | 3300005615 | Bacteria | 7570 |
| 156 | Ga0070702_100519580 | 3300005615 | Bacteria | 878 |
| 157 | Ga0070702_100726630 | 3300005615 | Bacteria | 760 |
| 158 | Ga0068852_100126479 | 3300005616 | Bacteria | 2348 |
| 159 | Ga0068852_100162082 | 3300005616 | Bacteria | 2089 |
| 160 | Ga0068859_100055748 | 3300005617 | Bacteria | 3977 |
| 161 | Ga0068859_100927463 | 3300005617 | Bacteria | 955 |
| 162 | Ga0068859_101209887 | 3300005617 | Bacteria | 832 |
| 163 | Ga0068864_100130522 | 3300005618 | Bacteria | 2257 |
| 164 | Ga0068864_101447387 | 3300005618 | Bacteria | 689 |
| 165 | Ga0068866_10007307 | 3300005718 | Bacteria | 4623 |
| 166 | Ga0068866_11228962 | 3300005718 | Bacteria | 542 |
| 167 | Ga0068866_11288964 | 3300005718 | Bacteria | 530 |
| 168 | Ga0068861_100000746 | 3300005719 | Bacteria | 19514 |
| 169 | Ga0068861_100035360 | 3300005719 | Bacteria | 3700 |
| 170 | Ga0068861_100158121 | 3300005719 | Bacteria | 1867 |
| 171 | Ga0068861_100183372 | 3300005719 | Bacteria | 1744 |
| 172 | Ga0068870_10018454 | 3300005840 | Bacteria | 3370 |
| 173 | Ga0068870_10100206 | 3300005840 | Bacteria | 1636 |
| 174 | Ga0068863_100098429 | 3300005841 | Bacteria | 2778 |
| 175 | Ga0068863_100351831 | 3300005841 | Bacteria | 1435 |
| 176 | Ga0068863_100407798 | 3300005841 | Bacteria | 1330 |
| 177 | Ga0068858_100023114 | 3300005842 | Bacteria | 5798 |
| 178 | Ga0068858_100654321 | 3300005842 | Bacteria | 1021 |
| 179 | Ga0068858_101314921 | 3300005842 | Bacteria | 712 |
| 180 | Ga0068858_101944144 | 3300005842 | Bacteria | 581 |
| 181 | Ga0068860_100024979 | 3300005843 | Bacteria | 5769 |
| 182 | Ga0068860_100085596 | 3300005843 | Bacteria | 3000 |
| 183 | Ga0068860_100091198 | 3300005843 | Bacteria | 2903 |
| 184 | Ga0068860_100257177 | 3300005843 | Bacteria | 1701 |
| 185 | Ga0068860_100402208 | 3300005843 | Bacteria | 1355 |
| 186 | Ga0068860_100468850 | 3300005843 | Bacteria | 1254 |
| 187 | Ga0068860_100713821 | 3300005843 | Bacteria | 1013 |
| 188 | Ga0068862_100003396 | 3300005844 | Bacteria | 13729 |
| 189 | Ga0068862_100164713 | 3300005844 | Bacteria | 1981 |
| 190 | Ga0068862_100227536 | 3300005844 | Bacteria | 1691 |
| 191 | Ga0068862_100739470 | 3300005844 | Bacteria | 956 |
| 192 | Ga0081455_10000014 | 3300005937 | Bacteria | 193884 |
| 193 | Ga0081455_10318346 | 3300005937 | Bacteria | 1109 |
| 194 | Ga0081455_10710497 | 3300005937 | Bacteria | 639 |
| 195 | Ga0081540_1000035 | 3300005983 | Bacteria | 141244 |
| 196 | Ga0081540_1164463 | 3300005983 | Bacteria | 855 |
| 197 | Ga0075432_10017819 | 3300006058 | Bacteria | 2422 |
| 198 | Ga0075432_10020862 | 3300006058 | Bacteria | 2241 |
| 199 | Ga0075432_10041117 | 3300006058 | Bacteria | 1614 |
| 200 | Ga0070715_10152690 | 3300006163 | Bacteria | 1133 |
| 201 | Ga0070712_100690962 | 3300006175 | Unclassified | 869 |
| 202 | Ga0075367_10000273 | 3300006178 | Bacteria | 17875 |
| 203 | Ga0075366_10000559 | 3300006195 | Bacteria | 17400 |
| 204 | Ga0097621_100019760 | 3300006237 | Bacteria | 5178 |
| 205 | Ga0097621_101080363 | 3300006237 | Bacteria | 753 |
| 206 | Ga0097621_101164945 | 3300006237 | Bacteria | 725 |
| 207 | Ga0097621_102027698 | 3300006237 | Bacteria | 550 |
| 208 | Ga0068871_100000265 | 3300006358 | Bacteria | 36023 |
| 209 | Ga0068871_100010679 | 3300006358 | Bacteria | 6714 |
| 210 | Ga0068871_100042629 | 3300006358 | Bacteria | 3644 |
| 211 | Ga0075428_100061825 | 3300006844 | Bacteria | 4101 |
| 212 | Ga0075428_100399920 | 3300006844 | Bacteria | 1472 |
| 213 | Ga0075430_100002517 | 3300006846 | Bacteria | 15273 |
| 214 | Ga0075430_100004374 | 3300006846 | Bacteria | 11926 |
| 215 | Ga0075430_100346061 | 3300006846 | Bacteria | 1228 |
| 216 | Ga0075430_100449329 | 3300006846 | Unclassified | 1064 |
| 217 | Ga0075431_100169405 | 3300006847 | Bacteria | 2244 |
| 218 | Ga0075431_100452844 | 3300006847 | Bacteria | 1279 |
| 219 | Ga0075433_10073049 | 3300006852 | Bacteria | 3017 |
| 220 | Ga0075433_10080211 | 3300006852 | Bacteria | 2876 |
| 221 | Ga0075434_100002404 | 3300006871 | Bacteria | 16437 |
| 222 | Ga0075434_101611108 | 3300006871 | Bacteria | 658 |
| 223 | Ga0075429_100009563 | 3300006880 | Bacteria | 8409 |
| 224 | Ga0075429_100011721 | 3300006880 | Bacteria | 7604 |
| 225 | Ga0075429_100150996 | 3300006880 | Bacteria | 2034 |
| 226 | Ga0068865_100002715 | 3300006881 | Bacteria | 10504 |
| 227 | Ga0068865_100005335 | 3300006881 | Bacteria | 7783 |
| 228 | Ga0075436_100322116 | 3300006914 | Bacteria | 1110 |
| 229 | Ga0075436_100716065 | 3300006914 | Bacteria | 742 |
| 230 | Ga0075436_101054600 | 3300006914 | Bacteria | 611 |
| 231 | Ga0075436_101179654 | 3300006914 | Bacteria | 578 |
| 232 | Ga0097620_100055750 | 3300006931 | Bacteria | 3977 |
| 233 | Ga0097620_100927291 | 3300006931 | Bacteria | 955 |
| 234 | Ga0097620_101209778 | 3300006931 | Bacteria | 832 |
| 235 | Ga0075435_100033993 | 3300007076 | Bacteria | 4036 |
| 236 | Ga0075435_100062450 | 3300007076 | Bacteria | 3023 |
| 237 | Ga0075435_100229410 | 3300007076 | Bacteria | 1577 |
| 238 | Ga0075435_100932607 | 3300007076 | Bacteria | 757 |
| 239 | Ga0105251_10014454 | 3300009011 | Bacteria | 4362 |
| 240 | Ga0105251_10019610 | 3300009011 | Bacteria | 3568 |
| 241 | Ga0105251_10389383 | 3300009011 | Bacteria | 640 |
| 242 | Ga0105244_10009445 | 3300009036 | Bacteria | 5993 |
| 243 | Ga0105244_10014456 | 3300009036 | Bacteria | 4563 |
| 244 | Ga0105244_10101817 | 3300009036 | Bacteria | 1404 |
| 245 | Ga0105244_10117231 | 3300009036 | Bacteria | 1292 |
| 246 | Ga0105250_10026945 | 3300009092 | Bacteria | 2316 |
| 247 | Ga0105250_10337231 | 3300009092 | Bacteria | 658 |
| 248 | Ga0105240_10574510 | 3300009093 | Bacteria | 1244 |
| 249 | Ga0111539_10014845 | 3300009094 | Bacteria | 9713 |
| 250 | Ga0111539_10032830 | 3300009094 | Bacteria | 6303 |
| 251 | Ga0111539_10142451 | 3300009094 | Bacteria | 2806 |
| 252 | Ga0111539_10301307 | 3300009094 | Bacteria | 1865 |
| 253 | Ga0111539_10446584 | 3300009094 | Bacteria | 1506 |
| 254 | Ga0111539_12203934 | 3300009094 | Unclassified | 639 |
| 255 | Ga0105245_10005829 | 3300009098 | Bacteria | 10811 |
| 256 | Ga0105245_10063301 | 3300009098 | Bacteria | 3340 |
| 257 | Ga0105245_10256070 | 3300009098 | Bacteria | 1702 |
| 258 | Ga0105245_11875859 | 3300009098 | Bacteria | 652 |
| 259 | Ga0114129_10036112 | 3300009147 | Bacteria | 6980 |
| 260 | Ga0114129_10072384 | 3300009147 | Bacteria | 4805 |
| 261 | Ga0114129_10127485 | 3300009147 | Bacteria | 3498 |
| 262 | Ga0114129_10496923 | 3300009147 | Bacteria | 1594 |
| 263 | Ga0114129_11102486 | 3300009147 | Unclassified | 994 |
| 264 | Ga0105243_10005092 | 3300009148 | Bacteria | 10312 |
| 265 | Ga0105243_10013050 | 3300009148 | Bacteria | 6277 |
| 266 | Ga0105243_10019708 | 3300009148 | Bacteria | 5115 |
| 267 | Ga0105243_10161143 | 3300009148 | Bacteria | 1934 |
| 268 | Ga0105243_10250509 | 3300009148 | Bacteria | 1581 |
| 269 | Ga0105241_10557634 | 3300009174 | Bacteria | 1030 |
| 270 | Ga0105242_10000974 | 3300009176 | Bacteria | 22370 |
| 271 | Ga0105242_10038234 | 3300009176 | Bacteria | 3859 |
| 272 | Ga0105242_10747006 | 3300009176 | Bacteria | 963 |
| 273 | Ga0105248_10108903 | 3300009177 | Bacteria | 3124 |
| 274 | Ga0105248_11535090 | 3300009177 | Bacteria | 754 |
| 275 | Ga0105248_11559005 | 3300009177 | Bacteria | 748 |
| 276 | Ga0105248_11764697 | 3300009177 | Bacteria | 702 |
| 277 | Ga0105237_10014196 | 3300009545 | Bacteria | 8341 |
| 278 | Ga0105237_10505299 | 3300009545 | Bacteria | 1215 |
| 279 | Ga0105238_10598847 | 3300009551 | Bacteria | 1110 |
| 280 | Ga0105249_10042160 | 3300009553 | Bacteria | 4150 |
| 281 | Ga0105249_10046499 | 3300009553 | Bacteria | 3949 |
| 282 | Ga0105249_10088653 | 3300009553 | Bacteria | 2890 |
| 283 | Ga0105249_10206774 | 3300009553 | Bacteria | 1924 |
| 284 | Ga0105249_10266644 | 3300009553 | Bacteria | 1704 |
| 285 | Ga0105239_10033416 | 3300010375 | Bacteria | 5649 |
| 286 | Ga0105239_10326910 | 3300010375 | Bacteria | 1729 |
| 287 | Ga0105239_10926495 | 3300010375 | Bacteria | 1000 |
| 288 | Ga0105246_10059616 | 3300011119 | Bacteria | 2648 |
| 289 | Ga0105246_10093339 | 3300011119 | Bacteria | 2174 |
| 290 | Ga0105246_10798270 | 3300011119 | Bacteria | 837 |
| 291 | Ga0157344_1008147 | 3300012476 | Bacteria | 713 |
| 292 | Ga0157373_10008432 | 3300013100 | Bacteria | 7652 |
| 293 | Ga0157371_10023810 | 3300013102 | Bacteria | 4475 |
| 294 | Ga0157371_10812576 | 3300013102 | Unclassified | 705 |
| 295 | Ga0157374_10062603 | 3300013296 | Bacteria | 3488 |
| 296 | Ga0157374_10177501 | 3300013296 | Bacteria | 2079 |
| 297 | Ga0157374_10944650 | 3300013296 | Bacteria | 881 |
| 298 | Ga0157378_10037215 | 3300013297 | Bacteria | 4309 |
| 299 | Ga0157378_10084487 | 3300013297 | Bacteria | 2874 |
| 300 | Ga0157378_10097617 | 3300013297 | Bacteria | 2678 |
| 301 | Ga0157378_10931639 | 3300013297 | Bacteria | 901 |
| 302 | Ga0157378_11255945 | 3300013297 | Bacteria | 781 |
| 303 | Ga0163162_10065560 | 3300013306 | Bacteria | 3679 |
| 304 | Ga0163162_10066174 | 3300013306 | Bacteria | 3662 |
| 305 | Ga0163162_10186000 | 3300013306 | Bacteria | 2204 |
| 306 | Ga0157372_10042741 | 3300013307 | Bacteria | 5014 |
| 307 | Ga0157372_12574682 | 3300013307 | Bacteria | 584 |
| 308 | Ga0157375_10034369 | 3300013308 | Bacteria | 4830 |
| 309 | Ga0157375_11744037 | 3300013308 | Bacteria | 738 |
| 310 | Ga0157380_10004274 | 3300014326 | Bacteria | 9890 |
| 311 | Ga0157380_10005455 | 3300014326 | Bacteria | 8889 |
| 312 | Ga0157380_10402933 | 3300014326 | Bacteria | 1298 |
| 313 | Ga0157380_10653502 | 3300014326 | Bacteria | 1049 |
| 314 | Ga0182008_10000606 | 3300014497 | Bacteria | 26385 |
| 315 | Ga0157377_10027050 | 3300014745 | Bacteria | 3076 |
| 316 | Ga0157377_10501661 | 3300014745 | Bacteria | 848 |
| 317 | Ga0157379_12377556 | 3300014968 | Bacteria | 529 |
| 318 | Ga0157376_10021456 | 3300014969 | Bacteria | 5016 |
| 319 | Ga0182006_1000514 | 3300015261 | Bacteria | 29491 |
| 320 | Ga0182006_1005825 | 3300015261 | Bacteria | 5806 |
| 321 | Ga0182007_10282470 | 3300015262 | Bacteria | 604 |
| 322 | Ga0163161_10385551 | 3300017792 | Bacteria | 1121 |
| 323 | Ga0163161_10448816 | 3300017792 | Bacteria | 1042 |
| 324 | Ga0163161_10908721 | 3300017792 | Bacteria | 746 |
| 325 | Ga0163161_11033971 | 3300017792 | Bacteria | 703 |
| 326 | Ga0213875_10005863 | 3300021388 | Bacteria | 6531 |
| 327 | Ga0209257_1000667 | 3300025304 | Bacteria | 53711 |
| 328 | Ga0207696_1000016 | 3300025711 | Bacteria | 502467 |
| 329 | Ga0207696_1011087 | 3300025711 | Bacteria | 3266 |
| 330 | Ga0207696_1012952 | 3300025711 | Bacteria | 2930 |
| 331 | Ga0207696_1055275 | 3300025711 | Bacteria | 1127 |
| 332 | Ga0207655_1000313 | 3300025728 | Bacteria | 72258 |
| 333 | Ga0207655_1019247 | 3300025728 | Bacteria | 3579 |
| 334 | Ga0207655_1030657 | 3300025728 | Bacteria | 2496 |
| 335 | Ga0207655_1038800 | 3300025728 | Bacteria | 2076 |
| 336 | Ga0207713_1001307 | 3300025735 | Bacteria | 20453 |
| 337 | Ga0207713_1041648 | 3300025735 | Bacteria | 1914 |
| 338 | Ga0207653_10130725 | 3300025885 | Bacteria | 911 |
| 339 | Ga0207682_10058689 | 3300025893 | Bacteria | 1606 |
| 340 | Ga0207692_10820360 | 3300025898 | Bacteria | 609 |
| 341 | Ga0207642_10886810 | 3300025899 | Bacteria | 571 |
| 342 | Ga0207688_10150306 | 3300025901 | Bacteria | 1375 |
| 343 | Ga0207647_10477403 | 3300025904 | Bacteria | 697 |
| 344 | Ga0207685_10151598 | 3300025905 | Bacteria | 1049 |
| 345 | Ga0207645_10002494 | 3300025907 | Bacteria | 14441 |
| 346 | Ga0207643_10018663 | 3300025908 | Bacteria | 3798 |
| 347 | Ga0207643_10043896 | 3300025908 | Bacteria | 2523 |
| 348 | Ga0207643_10567577 | 3300025908 | Bacteria | 729 |
| 349 | Ga0207643_10833334 | 3300025908 | Bacteria | 598 |
| 350 | Ga0207705_11213936 | 3300025909 | Bacteria | 578 |
| 351 | Ga0207654_10105205 | 3300025911 | Bacteria | 1746 |
| 352 | Ga0207707_10084572 | 3300025912 | Bacteria | 2771 |
| 353 | Ga0207695_10676349 | 3300025913 | Bacteria | 913 |
| 354 | Ga0207671_11020662 | 3300025914 | Bacteria | 651 |
| 355 | Ga0207693_10764696 | 3300025915 | Unclassified | 746 |
| 356 | Ga0207663_10310026 | 3300025916 | Bacteria | 1182 |
| 357 | Ga0207660_10001221 | 3300025917 | Bacteria | 17201 |
| 358 | Ga0207660_10076104 | 3300025917 | Bacteria | 2454 |
| 359 | Ga0207662_10000423 | 3300025918 | Bacteria | 18688 |
| 360 | Ga0207662_10003710 | 3300025918 | Bacteria | 7912 |
| 361 | Ga0207662_10021258 | 3300025918 | Bacteria | 3708 |
| 362 | Ga0207662_10030264 | 3300025918 | Bacteria | 3141 |
| 363 | Ga0207657_10008353 | 3300025919 | Bacteria | 10515 |
| 364 | Ga0207652_10105989 | 3300025921 | Bacteria | 2488 |
| 365 | Ga0207652_10268857 | 3300025921 | Bacteria | 1538 |
| 366 | Ga0207681_10075225 | 3300025923 | Bacteria | 2368 |
| 367 | Ga0207681_10172716 | 3300025923 | Bacteria | 1639 |
| 368 | Ga0207650_10273991 | 3300025925 | Bacteria | 1372 |
| 369 | Ga0207650_10418426 | 3300025925 | Bacteria | 1111 |
| 370 | Ga0207659_10036471 | 3300025926 | Bacteria | 3405 |
| 371 | Ga0207659_10775405 | 3300025926 | Bacteria | 823 |
| 372 | Ga0207687_10013843 | 3300025927 | Bacteria | 5268 |
| 373 | Ga0207687_10129082 | 3300025927 | Bacteria | 1902 |
| 374 | Ga0207644_10343593 | 3300025931 | Bacteria | 1211 |
| 375 | Ga0207690_10269954 | 3300025932 | Bacteria | 1321 |
| 376 | Ga0207706_10001148 | 3300025933 | Bacteria | 26985 |
| 377 | Ga0207686_10008653 | 3300025934 | Bacteria | 5496 |
| 378 | Ga0207686_10114216 | 3300025934 | Bacteria | 1827 |
| 379 | Ga0207709_10008014 | 3300025935 | Bacteria | 5852 |
| 380 | Ga0207709_10013634 | 3300025935 | Bacteria | 4484 |
| 381 | Ga0207709_10049661 | 3300025935 | Bacteria | 2562 |
| 382 | Ga0207670_10003051 | 3300025936 | Bacteria | 8840 |
| 383 | Ga0207670_10019196 | 3300025936 | Bacteria | 4170 |
| 384 | Ga0207670_10044799 | 3300025936 | Bacteria | 2929 |
| 385 | Ga0207670_10436945 | 3300025936 | Bacteria | 1053 |
| 386 | Ga0207670_11078563 | 3300025936 | Bacteria | 677 |
| 387 | Ga0207669_10095651 | 3300025937 | Bacteria | 1947 |
| 388 | Ga0207704_10004675 | 3300025938 | Bacteria | 6276 |
| 389 | Ga0207704_10020249 | 3300025938 | Bacteria | 3515 |
| 390 | Ga0207691_10001449 | 3300025940 | Bacteria | 23639 |
| 391 | Ga0207691_10302342 | 3300025940 | Bacteria | 1374 |
| 392 | Ga0207711_11381439 | 3300025941 | Bacteria | 647 |
| 393 | Ga0207689_10001695 | 3300025942 | Bacteria | 20948 |
| 394 | Ga0207689_10024748 | 3300025942 | Bacteria | 5033 |
| 395 | Ga0207689_10250377 | 3300025942 | Bacteria | 1465 |
| 396 | Ga0207679_10089597 | 3300025945 | Bacteria | 2375 |
| 397 | Ga0207667_10082522 | 3300025949 | Bacteria | 3329 |
| 398 | Ga0207651_10219416 | 3300025960 | Bacteria | 1536 |
| 399 | Ga0207651_10793102 | 3300025960 | Bacteria | 839 |
| 400 | Ga0207651_11463435 | 3300025960 | Bacteria | 615 |
| 401 | Ga0207712_10148663 | 3300025961 | Bacteria | 1807 |
| 402 | Ga0207712_10179596 | 3300025961 | Bacteria | 1661 |
| 403 | Ga0207712_10820119 | 3300025961 | Bacteria | 819 |
| 404 | Ga0207668_10529297 | 3300025972 | Bacteria | 1018 |
| 405 | Ga0207640_10203306 | 3300025981 | Bacteria | 1503 |
| 406 | Ga0207658_10712636 | 3300025986 | Bacteria | 907 |
| 407 | Ga0207677_10035893 | 3300026023 | Bacteria | 3224 |
| 408 | Ga0207677_11440117 | 3300026023 | Bacteria | 635 |
| 409 | Ga0207703_10021294 | 3300026035 | Bacteria | 5076 |
| 410 | Ga0207703_11636483 | 3300026035 | Bacteria | 619 |
| 411 | Ga0207708_10000723 | 3300026075 | Bacteria | 24861 |
| 412 | Ga0207708_10001206 | 3300026075 | Bacteria | 19501 |
| 413 | Ga0207708_10249774 | 3300026075 | Bacteria | 1429 |
| 414 | Ga0207702_10441849 | 3300026078 | Bacteria | 1261 |
| 415 | Ga0207702_12010906 | 3300026078 | Bacteria | 568 |
| 416 | Ga0207641_10303541 | 3300026088 | Bacteria | 1509 |
| 417 | Ga0207641_10783433 | 3300026088 | Bacteria | 943 |
| 418 | Ga0207641_11227518 | 3300026088 | Bacteria | 750 |
| 419 | Ga0207641_11395639 | 3300026088 | Bacteria | 701 |
| 420 | Ga0207641_11603363 | 3300026088 | Bacteria | 653 |
| 421 | Ga0207648_10000360 | 3300026089 | Bacteria | 50174 |
| 422 | Ga0207648_10001968 | 3300026089 | Bacteria | 22433 |
| 423 | Ga0207648_10230767 | 3300026089 | Bacteria | 1646 |
| 424 | Ga0207676_11213517 | 3300026095 | Bacteria | 748 |
| 425 | Ga0207674_10054686 | 3300026116 | Bacteria | 4063 |
| 426 | Ga0207675_100001083 | 3300026118 | Bacteria | 26980 |
| 427 | Ga0207675_100101252 | 3300026118 | Bacteria | 2714 |
| 428 | Ga0207675_100122022 | 3300026118 | Bacteria | 2466 |
| 429 | Ga0207675_100624129 | 3300026118 | Bacteria | 1082 |
| 430 | Ga0207683_10000388 | 3300026121 | Bacteria | 40586 |
| 431 | Ga0207698_10186532 | 3300026142 | Bacteria | 1843 |
| 432 | Ga0209973_1001725 | 3300027252 | Bacteria | 1942 |
| 433 | Ga0209371_1001932 | 3300027312 | Bacteria | 12640 |
| 434 | Ga0209969_1004681 | 3300027360 | Bacteria | 1913 |
| 435 | Ga0209967_1001076 | 3300027364 | Bacteria | 3486 |
| 436 | Ga0209967_1012878 | 3300027364 | Bacteria | 1184 |
| 437 | Ga0209981_1000799 | 3300027378 | Bacteria | 3967 |
| 438 | Ga0209996_1007041 | 3300027395 | Bacteria | 1461 |
| 439 | Ga0209984_1001317 | 3300027424 | Bacteria | 2679 |
| 440 | Ga0210000_1000038 | 3300027462 | Bacteria | 20512 |
| 441 | Ga0209995_1001259 | 3300027471 | Bacteria | 3899 |
| 442 | Ga0209968_1000031 | 3300027526 | Bacteria | 26164 |
| 443 | Ga0209968_1008208 | 3300027526 | Bacteria | 1589 |
| 444 | Ga0209970_1000862 | 3300027614 | Bacteria | 5336 |
| 445 | Ga0210002_1002423 | 3300027617 | Bacteria | 2691 |
| 446 | Ga0209983_1000273 | 3300027665 | Bacteria | 10708 |
| 447 | Ga0209971_1000385 | 3300027682 | Bacteria | 12063 |
| 448 | Ga0209971_1008425 | 3300027682 | Bacteria | 2445 |
| 449 | Ga0209966_1000274 | 3300027695 | Bacteria | 18290 |
| 450 | Ga0209998_10000112 | 3300027717 | Bacteria | 32345 |
| 451 | Ga0209974_10000092 | 3300027876 | Bacteria | 24981 |
| 452 | Ga0209974_10001027 | 3300027876 | Bacteria | 9861 |
| 453 | Ga0209974_10009396 | 3300027876 | Bacteria | 3318 |
| 454 | Ga0207428_10001527 | 3300027907 | Bacteria | 24181 |
| 455 | Ga0207428_10051835 | 3300027907 | Bacteria | 3279 |
| 456 | Ga0207428_10166812 | 3300027907 | Bacteria | 1669 |
| 457 | Ga0268266_10078103 | 3300028379 | Bacteria | 2880 |
| 458 | Ga0268265_10068276 | 3300028380 | Bacteria | 2756 |
| 459 | Ga0268265_10127683 | 3300028380 | Bacteria | 2107 |
| 460 | Ga0268265_12413783 | 3300028380 | Bacteria | 532 |
| 461 | Ga0268264_10018627 | 3300028381 | Bacteria | 5676 |
| 462 | Ga0268264_10162365 | 3300028381 | Bacteria | 2014 |
| 463 | Ga0268264_10184964 | 3300028381 | Bacteria | 1895 |
| 464 | Ga0268264_10255159 | 3300028381 | Bacteria | 1631 |
| 465 | Ga0268264_10432473 | 3300028381 | Bacteria | 1271 |
| 466 | Ga0265319_1015317 | 3300028563 | Bacteria | 2978 |
| 467 | Ga0265318_10000771 | 3300028577 | Bacteria | 21283 |
| 468 | Ga0265338_10186467 | 3300028800 | Bacteria | 1576 |
| 469 | Ga0268256_1001681 | 3300030500 | Bacteria | 12640 |
| 470 | Ga0265762_1023803 | 3300030760 | Unclassified | 1136 |
| 471 | Ga0265330_10000896 | 3300031235 | Bacteria | 18445 |
| 472 | Ga0265332_10049022 | 3300031238 | Bacteria | 1816 |
| 473 | Ga0265328_10006698 | 3300031239 | Bacteria | 4852 |
| 474 | Ga0265320_10001966 | 3300031240 | Bacteria | 14521 |
| 475 | Ga0265329_10006674 | 3300031242 | Bacteria | 4554 |
| 476 | Ga0265339_10182124 | 3300031249 | Bacteria | 1045 |
| 477 | Ga0265331_10000655 | 3300031250 | Bacteria | 29967 |
| 478 | Ga0265316_10030113 | 3300031344 | Bacteria | 4454 |
| 479 | Ga0307408_100008411 | 3300031548 | Bacteria | 6812 |
| 480 | Ga0307408_101004487 | 3300031548 | Bacteria | 769 |
| 481 | Ga0265313_10030767 | 3300031595 | Bacteria | 2759 |
| 482 | Ga0265314_10011405 | 3300031711 | Bacteria | 7341 |
| 483 | Ga0265342_10000610 | 3300031712 | Bacteria | 37712 |
| 484 | Ga0307405_10140377 | 3300031731 | Bacteria | 1683 |
| 485 | Ga0307413_10019524 | 3300031824 | Bacteria | 3584 |
| 486 | Ga0307413_10216257 | 3300031824 | Bacteria | 1396 |
| 487 | Ga0307413_11576584 | 3300031824 | Bacteria | 582 |
| 488 | Ga0307410_10097913 | 3300031852 | Bacteria | 2097 |
| 489 | Ga0307406_10071061 | 3300031901 | Bacteria | 2280 |
| 490 | Ga0307406_10464084 | 3300031901 | Bacteria | 1019 |
| 491 | Ga0307407_10006292 | 3300031903 | Bacteria | 5253 |
| 492 | Ga0307407_10088339 | 3300031903 | Bacteria | 1893 |
| 493 | Ga0307407_10927120 | 3300031903 | Bacteria | 670 |
| 494 | Ga0307412_10010666 | 3300031911 | Bacteria | 5297 |
| 495 | Ga0307412_10052082 | 3300031911 | Bacteria | 2709 |
| 496 | Ga0307409_100050405 | 3300031995 | Bacteria | 3179 |
| 497 | Ga0307409_100091681 | 3300031995 | Bacteria | 2491 |
| 498 | Ga0307416_100072887 | 3300032002 | Bacteria | 2860 |
| 499 | Ga0307416_101996559 | 3300032002 | Bacteria | 683 |
| 500 | Ga0307414_10026505 | 3300032004 | Bacteria | 3731 |
| 501 | Ga0307414_10144341 | 3300032004 | Bacteria | 1868 |
| 502 | Ga0307414_10597833 | 3300032004 | Bacteria | 989 |
| 503 | Ga0307411_10014298 | 3300032005 | Bacteria | 4411 |
| 504 | Ga0307411_10029920 | 3300032005 | Bacteria | 3332 |
| 505 | Ga0307411_10213806 | 3300032005 | Bacteria | 1491 |
| 506 | Ga0307411_10630716 | 3300032005 | Bacteria | 925 |
| 507 | Ga0307411_10899394 | 3300032005 | Bacteria | 786 |
| 508 | Ga0307411_11594864 | 3300032005 | Bacteria | 602 |
| 509 | Ga0307415_100034162 | 3300032126 | Bacteria | 3307 |
| 510 | Ga0373930_0080034 | 3300034816 | Bacteria | 754 |
| 511 | Ga0373948_0213252 | 3300034817 | Bacteria | 508 |
| 512 | Ga0373959_0053886 | 3300034820 | Bacteria | 875 |
| 513 | Ga0373959_0075131 | 3300034820 | Bacteria | 770 |
| 514 | Ga0373938_0177640 | 3300034957 | Bacteria | 580 |
| 515 | Ga0373928_0063661 | 3300035084 | Bacteria | 897 |
| 516 | Ga0373929_0110454 | 3300035085 | Bacteria | 702 |
| 517 | Ga0373929_0229740 | 3300035085 | Bacteria | 531 |
| 518 | Ga0373940_0022345 | 3300035088 | Bacteria | 1625 |
| 519 | Ga0373951_0015888 | 3300035091 | Bacteria | 1697 |
| 520 | Ga0373952_0006708 | 3300035092 | Bacteria | 2136 |
| 521 | Ga0373932_0087372 | 3300035112 | Bacteria | 995 |
| 522 | Ga0373939_0331949 | 3300035114 | Bacteria | 614 |
| 523 | Ga0373939_0341955 | 3300035114 | Bacteria | 607 |
| 524 | Ga0373939_0350590 | 3300035114 | Bacteria | 601 |
| 525 | Ga0373941_0340983 | 3300035115 | Bacteria | 607 |
| 526 | Ga0373960_0002305 | 3300035121 | Bacteria | 4294 |
| 527 | Ga0373960_0030667 | 3300035121 | Bacteria | 1499 |
| 528 | Ga0373942_0237979 | 3300035207 | Bacteria | 615 |
| 529 | Ga0373961_0017740 | 3300035241 | Bacteria | 1851 |
| 530 | Ga0373962_0028414 | 3300035242 | Bacteria | 1517 |
| 531 | Ga0373962_0052357 | 3300035242 | Bacteria | 1179 |
| 532 | Ga0373962_0315815 | 3300035242 | Bacteria | 557 |
| 533 | Ga0373931_0000271 | 3300035691 | Bacteria | 21921 |
| 534 | Ga0373931_0001276 | 3300035691 | Bacteria | 10750 |
| 535 | Ga0373931_0068073 | 3300035691 | Bacteria | 1937 |
| 536 | Ga0373931_0421059 | 3300035691 | Bacteria | 849 |
| 537 | Ga0373937_1046637 | 3300036401 | Bacteria | 765 |
| 538 | Ga0395900_0222666 | 3300037418 | Bacteria | 1901 |
| 539 | Ga0436364_1122609 | 3300037853 | Bacteria | 15757 |
| 540 | Ga0395901_1723565 | 3300038443 | Bacteria | 577 |
| 541 | Ga0436365_0794265 | 3300039437 | Bacteria | 1110 |
| 542 | Ga0439438_000751 | 3300041405 | Bacteria | 14496 |
| 543 | Ga0439438_023427 | 3300041405 | Bacteria | 1702 |
| 544 | Ga0439439_0007000 | 3300041406 | Bacteria | 2626 |
| 545 | Ga0439447_016764 | 3300041407 | Bacteria | 2005 |
| 546 | Ga0439453_0066402 | 3300041408 | Bacteria | 756 |
| 547 | Ga0439461_0084822 | 3300041410 | Bacteria | 752 |
| 548 | Ga0439465_0238849 | 3300041413 | Bacteria | 670 |
| 549 | Ga0451800_0474703 | 3300041459 | Bacteria | 881 |
| 550 | Ga0451833_1294998 | 3300041491 | Bacteria | 969 |
| 551 | Ga0451853_1226227 | 3300041512 | Bacteria | 549 |
| 552 | Ga0451853_1768691 | 3300041512 | Bacteria | 754 |
| 553 | Ga0439445_0047230 | 3300042004 | Bacteria | 1156 |
| 554 | Ga0439432_000509 | 3300042006 | Bacteria | 14437 |
| 555 | Ga0439450_013307 | 3300042008 | Bacteria | 1651 |
| 556 | Ga0439452_047452 | 3300042010 | Bacteria | 993 |
| 557 | Ga0439463_063861 | 3300042016 | Bacteria | 941 |
| 558 | Ga0450896_050103 | 3300042133 | Bacteria | 664 |
| 559 | Ga0450898_055067 | 3300042134 | Bacteria | 775 |
| 560 | Ga0450902_000571 | 3300042137 | Bacteria | 4674 |
| 561 | Ga0450906_014236 | 3300042145 | Bacteria | 1459 |
| 562 | Ga0439446_0015222 | 3300042156 | Bacteria | 2132 |
| 563 | Ga0439446_0020138 | 3300042156 | Bacteria | 1877 |
| 564 | Ga0450909_053708 | 3300042185 | Bacteria | 631 |
| 565 | Ga0439434_0009729 | 3300042435 | Bacteria | 2828 |
| 566 | Ga0439444_0100719 | 3300042437 | Bacteria | 655 |
| 567 | Ga0439459_0041182 | 3300042438 | Bacteria | 982 |
| 568 | Ga0439464_0002073 | 3300042439 | Bacteria | 4882 |
| 569 | Ga0439464_0046168 | 3300042439 | Bacteria | 1252 |
| 570 | Ga0450901_001902 | 3300042533 | Bacteria | 2337 |
| 571 | Ga0451577_0410776 | 3300042876 | Bacteria | 1229 |
| 572 | Ga0453683_0066523 | 3300044673 | Bacteria | 2253 |
| 573 | Ga0451576_0138060 | 3300045051 | Bacteria | 2543 |
| 574 | Ga0451576_0279407 | 3300045051 | Bacteria | 1746 |
| 575 | Ga0451576_1267515 | 3300045051 | Bacteria | 769 |
| 576 | Ga0495650_0002153 | 3300046471 | Bacteria | 16723 |
| 577 | Ga0495582_0017978 | 3300046473 | Bacteria | 3865 |
| 578 | Ga0495605_0119420 | 3300046474 | Bacteria | 1196 |
| 579 | Ga0495584_0045617 | 3300046491 | Bacteria | 2211 |
| 580 | Ga0495584_0176320 | 3300046491 | Bacteria | 1086 |
| 581 | Ga0495585_0000360 | 3300046492 | Bacteria | 44156 |
| 582 | Ga0495596_0250524 | 3300046500 | Bacteria | 687 |
| 583 | Ga0495606_0000136 | 3300046507 | Bacteria | 125611 |
| 584 | Ga0495616_0000003 | 3300046513 | Bacteria | 290178 |
| 585 | Ga0495620_0000056 | 3300046515 | Bacteria | 99298 |
| 586 | Ga0495632_0000021 | 3300046519 | Bacteria | 187363 |
| 587 | Ga0495632_0005839 | 3300046519 | Bacteria | 8057 |
| 588 | Ga0495637_0129692 | 3300046520 | Bacteria | 964 |
| 589 | Ga0495643_0000089 | 3300046522 | Bacteria | 154903 |
| 590 | Ga0495643_0000253 | 3300046522 | Bacteria | 78774 |
| 591 | Ga0495648_0000099 | 3300046524 | Bacteria | 108810 |
| 592 | Ga0495666_0294668 | 3300046526 | Bacteria | 734 |
| 593 | Ga0495652_0594725 | 3300046529 | Bacteria | 755 |
| 594 | Ga0495586_0051168 | 3300046535 | Bacteria | 2236 |
| 595 | Ga0495598_0072367 | 3300046537 | Bacteria | 1088 |
| 596 | Ga0495656_0358119 | 3300046615 | Bacteria | 757 |
| 597 | Ga0495635_0107240 | 3300046663 | Bacteria | 1908 |
| 598 | Ga0495659_0273974 | 3300046664 | Bacteria | 708 |
| 599 | Ga0495658_0131201 | 3300046683 | Bacteria | 1525 |
| 600 | Ga0495670_0002391 | 3300046691 | Bacteria | 9250 |
| 601 | Ga0495636_0023456 | 3300047318 | Bacteria | 2498 |
| 602 | Ga0495683_0000699 | 3300047323 | Bacteria | 24522 |
| 603 | Ga0495686_0044498 | 3300047472 | Bacteria | 2810 |
| 604 | Ga0496101_0302886 | 3300048904 | Bacteria | 1252 |
| 605 | Ga0496102_1925991 | 3300048905 | Bacteria | 508 |
| 606 | Ga0496104_0228478 | 3300048907 | Bacteria | 1773 |
| 607 | Ga0496106_0407983 | 3300048909 | Bacteria | 1092 |
| 608 | Ga0496108_0501209 | 3300048911 | Bacteria | 1060 |
| 609 | Ga0496109_0253331 | 3300048912 | Bacteria | 1658 |
| 610 | Ga0496110_0160330 | 3300048913 | Bacteria | 2039 |
| 611 | Ga0496114_0014021 | 3300048917 | Bacteria | 6425 |
| 612 | Ga0496114_0038019 | 3300048917 | Bacteria | 3982 |
| 613 | Ga0496114_1122911 | 3300048917 | Bacteria | 671 |
| 614 | Ga0496115_0732921 | 3300048918 | Bacteria | 774 |
| 615 | Ga0496116_0042110 | 3300048919 | Bacteria | 3126 |
| 616 | Ga0496117_0000406 | 3300048920 | Bacteria | 72747 |
| 617 | Ga0496117_0000922 | 3300048920 | Bacteria | 44997 |
| 618 | Ga0496118_0000979 | 3300048921 | Bacteria | 44454 |
| 619 | Ga0496118_0412877 | 3300048921 | Bacteria | 697 |
| 620 | Ga0496121_0001227 | 3300048924 | Bacteria | 44616 |
| 621 | Ga0496121_0015234 | 3300048924 | Bacteria | 8078 |
| 622 | Ga0496122_0000402 | 3300048925 | Bacteria | 91833 |
| 623 | Ga0496122_0002059 | 3300048925 | Bacteria | 29837 |
| 624 | Ga0496123_0000028 | 3300048926 | Bacteria | 306006 |
| 625 | Ga0496123_0002356 | 3300048926 | Bacteria | 23697 |
| 626 | Ga0496124_0000980 | 3300048927 | Bacteria | 45395 |
| 627 | Ga0496124_0014069 | 3300048927 | Bacteria | 7759 |
| 628 | Ga0496124_0023343 | 3300048927 | Bacteria | 5648 |
| 629 | Ga0496124_0040363 | 3300048927 | Bacteria | 4038 |
| 630 | Ga0496124_0060414 | 3300048927 | Bacteria | 3179 |
| 631 | Ga0496125_0037358 | 3300048928 | Bacteria | 4223 |
| 632 | Ga0496125_0166210 | 3300048928 | Bacteria | 1490 |
| 633 | Ga0496126_0005909 | 3300048929 | Bacteria | 13804 |
| 634 | Ga0501309_038759 | 3300049129 | Bacteria | 723 |
| 635 | Ga0501290_000131 | 3300049513 | Bacteria | 11636 |
| 636 | Ga0501291_001237 | 3300049514 | Bacteria | 2949 |
| 637 | Ga0501292_000120 | 3300049515 | Bacteria | 13718 |
| 638 | Ga0501295_000092 | 3300049518 | Bacteria | 8888 |
| 639 | Ga0501296_000127 | 3300049519 | Bacteria | 8921 |
| 640 | Ga0501297_000114 | 3300049520 | Bacteria | 8561 |
| 641 | Ga0501298_000079 | 3300049521 | Bacteria | 10753 |
| 642 | Ga0501299_000526 | 3300049522 | Bacteria | 4577 |
| 643 | Ga0501300_000057 | 3300049523 | Bacteria | 15761 |
| 644 | Ga0501301_001477 | 3300049524 | Bacteria | 1487 |
| 645 | Ga0501303_001069 | 3300049526 | Bacteria | 2052 |
| 646 | Ga0501031_0309712 | 3300049568 | Bacteria | 1023 |
| 647 | Ga0501032_0013265 | 3300049569 | Bacteria | 5865 |
| 648 | Ga0501033_0125025 | 3300049570 | Bacteria | 1865 |
| 649 | Ga0501033_0153844 | 3300049570 | Bacteria | 1658 |
| 650 | Ga0501033_0321886 | 3300049570 | Bacteria | 1086 |
| 651 | Ga0501034_0100813 | 3300049571 | Bacteria | 2882 |
| 652 | Ga0501036_0108830 | 3300049572 | Bacteria | 2342 |
| 653 | Ga0501036_0626113 | 3300049572 | Bacteria | 892 |
| 654 | Ga0501038_1352123 | 3300049574 | Bacteria | 513 |
| 655 | Ga0501039_0029139 | 3300049575 | Bacteria | 4251 |
| 656 | Ga0501039_0701465 | 3300049575 | Bacteria | 791 |
| 657 | Ga0501040_0027774 | 3300049576 | Bacteria | 3811 |
| 658 | Ga0501040_0202491 | 3300049576 | Bacteria | 1410 |
| 659 | Ga0501041_0004008 | 3300049577 | Bacteria | 8497 |
| 660 | Ga0501041_0797546 | 3300049577 | Bacteria | 605 |
| 661 | Ga0501043_0120008 | 3300049579 | Bacteria | 2062 |
| 662 | Ga0501046_0044091 | 3300049580 | Bacteria | 3548 |
| 663 | Ga0501047_0001904 | 3300049581 | Bacteria | 20068 |
| 664 | Ga0501047_0757387 | 3300049581 | Bacteria | 787 |
| 665 | Ga0501048_0385104 | 3300049582 | Bacteria | 1001 |
| 666 | Ga0501048_0536407 | 3300049582 | Bacteria | 839 |
| 667 | Ga0501067_0158293 | 3300049583 | Bacteria | 1261 |
| 668 | Ga0501067_0545468 | 3300049583 | Bacteria | 649 |
| 669 | Ga0501068_0114822 | 3300049584 | Bacteria | 1676 |
| 670 | Ga0501068_0122824 | 3300049584 | Bacteria | 1620 |
| 671 | Ga0501070_0285265 | 3300049586 | Bacteria | 1347 |
| 672 | Ga0501071_0002814 | 3300049587 | Bacteria | 10709 |
| 673 | Ga0501071_0272231 | 3300049587 | Bacteria | 1280 |
| 674 | Ga0501071_1273361 | 3300049587 | Bacteria | 568 |
| 675 | Ga0501072_0029962 | 3300049588 | Bacteria | 4253 |
| 676 | Ga0501075_0064474 | 3300049591 | Bacteria | 2763 |
| 677 | Ga0501075_0336739 | 3300049591 | Bacteria | 1150 |
| 678 | Ga0501075_0409462 | 3300049591 | Bacteria | 1034 |
| 679 | Ga0501076_0344692 | 3300049592 | Bacteria | 1223 |
| 680 | Ga0501077_0014302 | 3300049593 | Bacteria | 4985 |
| 681 | Ga0501198_003564 | 3300049649 | Bacteria | 2131 |
| 682 | Ga0501199_030382 | 3300049650 | Bacteria | 664 |
| 683 | Ga0501201_000857 | 3300049651 | Bacteria | 2861 |
| 684 | Ga0501202_001309 | 3300049652 | Bacteria | 3948 |
| 685 | Ga0501206_000124 | 3300049653 | Bacteria | 8152 |
| 686 | Ga0501207_000985 | 3300049654 | Bacteria | 3458 |
| 687 | Ga0501208_000439 | 3300049655 | Bacteria | 3275 |
| 688 | Ga0501211_006607 | 3300049658 | Bacteria | 1145 |
| 689 | Ga0501214_048667 | 3300049659 | Bacteria | 638 |
| 690 | Ga0501216_000146 | 3300049660 | Bacteria | 7366 |
| 691 | Ga0501217_000519 | 3300049661 | Bacteria | 6413 |
| 692 | Ga0501222_003295 | 3300049662 | Bacteria | 2216 |
| 693 | Ga0501223_004844 | 3300049663 | Bacteria | 2858 |
| 694 | Ga0501224_025307 | 3300049664 | Bacteria | 887 |
| 695 | Ga0501227_010508 | 3300049665 | Bacteria | 2008 |
| 696 | Ga0501228_012159 | 3300049666 | Bacteria | 881 |
| 697 | Ga0501233_026986 | 3300049668 | Bacteria | 1272 |
| 698 | Ga0501235_000237 | 3300049669 | Bacteria | 10091 |
| 699 | Ga0501236_002775 | 3300049670 | Bacteria | 2019 |
| 700 | Ga0501239_000716 | 3300049672 | Bacteria | 2665 |
| 701 | Ga0501242_037795 | 3300049674 | Bacteria | 674 |
| 702 | Ga0501243_000596 | 3300049675 | Bacteria | 4875 |
| 703 | Ga0501246_012500 | 3300049676 | Bacteria | 797 |
| 704 | Ga0501247_001858 | 3300049677 | Bacteria | 2123 |
| 705 | Ga0501248_002300 | 3300049678 | Bacteria | 1292 |
| 706 | Ga0501249_001783 | 3300049679 | Bacteria | 4389 |
| 707 | Ga0501250_009725 | 3300049680 | Bacteria | 1089 |
| 708 | Ga0501251_002117 | 3300049681 | Bacteria | 1900 |
| 709 | Ga0501253_000169 | 3300049683 | Bacteria | 4881 |
| 710 | Ga0501253_185234 | 3300049683 | Bacteria | 543 |
| 711 | Ga0501255_000377 | 3300049684 | Bacteria | 2952 |
| 712 | Ga0501257_001186 | 3300049686 | Bacteria | 5337 |
| 713 | Ga0501258_001337 | 3300049687 | Bacteria | 1991 |
| 714 | Ga0501259_039063 | 3300049688 | Bacteria | 927 |
| 715 | Ga0501261_003666 | 3300049690 | Bacteria | 1889 |
| 716 | Ga0501219_000569 | 3300049703 | Bacteria | 5389 |
| 717 | Ga0501221_000633 | 3300049704 | Bacteria | 5639 |
| 718 | Ga0501225_0000205 | 3300049705 | Bacteria | 18620 |
| 719 | Ga0501234_001096 | 3300049707 | Bacteria | 4280 |
| 720 | Ga0501245_002108 | 3300049708 | Bacteria | 2641 |
| 721 | Ga0501079_0028540 | 3300049741 | Bacteria | 4282 |
| 722 | Ga0501079_0404459 | 3300049741 | Bacteria | 1071 |
| 723 | Ga0501079_1001337 | 3300049741 | Bacteria | 658 |
| 724 | Ga0501083_0385830 | 3300049744 | Bacteria | 911 |
| 725 | Ga0501232_002983 | 3300049757 | Bacteria | 1512 |
| 726 | Ga0501262_018552 | 3300049759 | Bacteria | 935 |
| 727 | Ga0501264_001361 | 3300049761 | Bacteria | 2662 |
| 728 | Ga0501266_000137 | 3300049763 | Bacteria | 9182 |
| 729 | Ga0501270_001294 | 3300049767 | Bacteria | 2362 |
| 730 | Ga0501271_000405 | 3300049768 | Bacteria | 3759 |
| 731 | Ga0501274_003582 | 3300049771 | Bacteria | 1257 |
| 732 | Ga0501279_000411 | 3300049775 | Bacteria | 5682 |
| 733 | Ga0501280_003894 | 3300049776 | Bacteria | 2243 |
| 734 | Ga0501282_001924 | 3300049778 | Bacteria | 2287 |
| 735 | Ga0501283_000409 | 3300049779 | Bacteria | 5732 |
| 736 | Ga0501035_0007192 | 3300049822 | Bacteria | 10417 |
| 737 | Ga0501035_0100668 | 3300049822 | Bacteria | 2537 |
| 738 | Ga0501044_0012908 | 3300049823 | Bacteria | 9042 |
| 739 | Ga0501045_0065327 | 3300049824 | Bacteria | 2671 |
| 740 | Ga0501200_01268 | 3300049849 | Bacteria | 954 |
| 741 | Ga0501212_018549 | 3300049851 | Bacteria | 1060 |
| 742 | Ga0501226_011772 | 3300049853 | Bacteria | 969 |
| 743 | nmdc:mga0k408_573943_c1 | 3300050493 | Bacteria | 666 |
| 744 | nmdc:mga05p37_119342_c1 | 3300050507 | Bacteria | 1599 |
| 745 | nmdc:mga05p37_427717_c1 | 3300050507 | Bacteria | 1539 |
| 746 | nmdc:mga05p37_86115_c1 | 3300050507 | Bacteria | 3872 |
| 747 | nmdc:mga05p37_982328_c1 | 3300050507 | Bacteria | 899 |
| 748 | nmdc:mga09592_164568_c1 | 3300050508 | Bacteria | 1917 |
| 749 | nmdc:mga09592_25127_c1 | 3300050508 | Bacteria | 4928 |
| 750 | nmdc:mga09592_455849_c1 | 3300050508 | Unclassified | 1103 |
| 751 | nmdc:mga0qj67_101485_c1 | 3300050509 | Bacteria | 2320 |
| 752 | nmdc:mga0qj67_171122_c1 | 3300050509 | Bacteria | 1764 |
| 753 | nmdc:mga0qj67_388933_c1 | 3300050509 | Bacteria | 1126 |
| 754 | nmdc:mga0qj67_576570_c1 | 3300050509 | Bacteria | 901 |
| 755 | nmdc:mga06r32_101696_c1 | 3300050510 | Bacteria | 2821 |
| 756 | nmdc:mga06r32_122318_c1 | 3300050510 | Bacteria | 2568 |
| 757 | nmdc:mga08y16_134786_c1 | 3300050511 | Bacteria | 2567 |
| 758 | nmdc:mga08y16_207598_c1 | 3300050511 | Bacteria | 2029 |
| 759 | nmdc:mga08y16_28953_c1 | 3300050511 | Bacteria | 5839 |
| 760 | nmdc:mga08y16_54122_c1 | 3300050511 | Bacteria | 4193 |
| 761 | nmdc:mga08y16_54504_c1 | 3300050511 | Bacteria | 4178 |
| 762 | nmdc:mga08y16_814161_c1 | 3300050511 | Bacteria | 926 |
| 763 | nmdc:mga0n895_137034_c1 | 3300050512 | Bacteria | 2475 |
| 764 | nmdc:mga0n895_2115_c1 | 3300050512 | Bacteria | 15326 |
| 765 | nmdc:mga0n895_25744_c1 | 3300050512 | Bacteria | 5563 |
| 766 | nmdc:mga0n895_316353_c1 | 3300050512 | Bacteria | 1582 |
| 767 | nmdc:mga0rr50_169509_c1 | 3300050513 | Bacteria | 1778 |
| 768 | nmdc:mga0rr50_235042_c1 | 3300050513 | Bacteria | 1518 |
| 769 | nmdc:mga0rr50_30630_c1 | 3300050513 | Bacteria | 3811 |
| 770 | nmdc:mga08x19_730996_c1 | 3300050514 | Bacteria | 703 |
| 771 | nmdc:mga0a205_10339_c1 | 3300050515 | Bacteria | 8577 |
| 772 | nmdc:mga0a205_3719_c1 | 3300050515 | Bacteria | 5205 |
| 773 | nmdc:mga0a205_65443_c1 | 3300050515 | Bacteria | 3512 |
| 774 | nmdc:mga0a205_760876_c1 | 3300050515 | Bacteria | 817 |
| 775 | Ga0495619_1171006 | 3300053085 | Bacteria | 510 |
| 776 | Ga0500616_0030617 | 3300053153 | Bacteria | 2954 |
| 777 | Ga0501084_0021636 | 3300054114 | Bacteria | 5362 |
| 778 | Ga0590075_077401 | 3300059424 | Bacteria | 860 |
| 779 | Ga0587092_135114 | 3300059512 | Bacteria | 539 |
| 780 | Ga0587111_0026998 | 3300060346 | Bacteria | 1147 |
| 781 | Ga0501082_0006364 | 3300060353 | Bacteria | 10248 |
| 782 | Ga0501082_0887357 | 3300060353 | Bacteria | 780 |
| 783 | Ga0530510_0007074 | 3300061734 | Bacteria | 7808 |
| 784 | Ga0530510_0942845 | 3300061734 | Bacteria | 660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041406 | Ga0439439_0007000 | Ga0439439_0007000_1369_1788 | 103 |
| 2 | 3300042156 | Ga0439446_0020138 | Ga0439446_0020138_54_473 | 103 |
| 3 | 3300005546 | Ga0070696_100276689 | Ga0070696_1002766893 | 104 |
| 4 | 3300015262 | Ga0182007_10282470 | Ga0182007_102824701 | 104 |
| 5 | 3300005436 | Ga0070713_100064777 | Ga0070713_1000647773 | 108 |
| 6 | 3300005354 | Ga0070675_102179023 | Ga0070675_1021790231 | 109 |
| 7 | 3300005331 | Ga0070670_100195057 | Ga0070670_1001950573 | 111 |
| 8 | 3300005354 | Ga0070675_100374112 | Ga0070675_1003741122 | 111 |
| 9 | 3300005367 | Ga0070667_100198207 | Ga0070667_1001982073 | 111 |
| 10 | 3300005618 | Ga0068864_100130522 | Ga0068864_1001305222 | 111 |
| 11 | 3300005840 | Ga0068870_10100206 | Ga0068870_101002062 | 111 |
| 12 | 3300005841 | Ga0068863_100098429 | Ga0068863_1000984293 | 111 |
| 13 | 3300005842 | Ga0068858_101944144 | Ga0068858_1019441441 | 111 |
| 14 | 3300005843 | Ga0068860_100257177 | Ga0068860_1002571772 | 111 |
| 15 | 3300005844 | Ga0068862_100164713 | Ga0068862_1001647132 | 111 |
| 16 | 3300009098 | Ga0105245_11875859 | Ga0105245_118758591 | 111 |
| 17 | 3300009177 | Ga0105248_10108903 | Ga0105248_101089031 | 111 |
| 18 | 3300009553 | Ga0105249_10206774 | Ga0105249_102067742 | 111 |
| 19 | 3300013306 | Ga0163162_10065560 | Ga0163162_100655603 | 111 |
| 20 | 3300014968 | Ga0157379_12377556 | Ga0157379_123775561 | 111 |
| 21 | 3300025908 | Ga0207643_10567577 | Ga0207643_105675771 | 111 |
| 22 | 3300025925 | Ga0207650_10418426 | Ga0207650_104184262 | 111 |
| 23 | 3300025961 | Ga0207712_10820119 | Ga0207712_108201192 | 111 |
| 24 | 3300026035 | Ga0207703_11636483 | Ga0207703_116364831 | 111 |
| 25 | 3300026088 | Ga0207641_11395639 | Ga0207641_113956392 | 111 |
| 26 | 3300028381 | Ga0268264_10184964 | Ga0268264_101849643 | 111 |
| 27 | 3300032004 | Ga0307414_10597833 | Ga0307414_105978332 | 111 |
| 28 | 3300005334 | Ga0068869_100721555 | Ga0068869_1007215552 | 112 |
| 29 | 3300006178 | Ga0075367_10000273 | Ga0075367_1000027313 | 112 |
| 30 | 3300006195 | Ga0075366_10000559 | Ga0075366_100005597 | 112 |
| 31 | 3300010375 | Ga0105239_10926495 | Ga0105239_109264952 | 112 |
| 32 | 3300012476 | Ga0157344_1008147 | Ga0157344_10081472 | 112 |
| 33 | 3300013297 | Ga0157378_10097617 | Ga0157378_100976173 | 112 |
| 34 | 3300025909 | Ga0207705_11213936 | Ga0207705_112139362 | 112 |
| 35 | 3300025918 | Ga0207662_10021258 | Ga0207662_100212582 | 112 |
| 36 | 3300037853 | Ga0436364_1122609 | Ga0436364_1122609_14595_14966 | 112 |
| 37 | 3300039437 | Ga0436365_0794265 | Ga0436365_0794265_462_833 | 112 |
| 38 | 3300041512 | Ga0451853_1768691 | Ga0451853_1768691_34_399 | 112 |
| 39 | 3300042133 | Ga0450896_050103 | Ga0450896_050103_119_484 | 112 |
| 40 | 3300042145 | Ga0450906_014236 | Ga0450906_014236_412_777 | 112 |
| 41 | 3300048905 | Ga0496102_1925991 | Ga0496102_1925991_93_464 | 112 |
| 42 | 3300048921 | Ga0496118_0412877 | Ga0496118_0412877_138_509 | 112 |
| 43 | 3300049570 | Ga0501033_0321886 | Ga0501033_0321886_568_939 | 112 |
| 44 | 3300053153 | Ga0500616_0030617 | Ga0500616_0030617_185_562 | 112 |
| 45 | iso_pu_bacteria | 2839989709 | 2839992436 | 116 |
| 46 | iso_pu_bacteria | 2920107658 | 2920112458 | 116 |
| 47 | 3300014326 | Ga0157380_10005455 | Ga0157380_100054557 | 117 |
| 48 | 3300017792 | Ga0163161_10448816 | Ga0163161_104488162 | 117 |
| 49 | 3300028380 | Ga0268265_12413783 | Ga0268265_124137832 | 117 |
| 50 | 3300032002 | Ga0307416_101996559 | Ga0307416_1019965592 | 117 |
| 51 | 3300041459 | Ga0451800_0474703 | Ga0451800_0474703_387_773 | 117 |
| 52 | 3300041512 | Ga0451853_1226227 | Ga0451853_1226227_80_463 | 117 |
| 53 | 2162886007 | SwRhRL2b_contig_1758738 | SwRhRL2b_0949.00010620 | 118 |
| 54 | 3300003371 | JGI26145J50221_1001594 | JGI26145J50221_10015942 | 118 |
| 55 | 3300004800 | Ga0058861_10845447 | Ga0058861_108454472 | 118 |
| 56 | 3300004803 | Ga0058862_12756080 | Ga0058862_127560802 | 118 |
| 57 | 3300005288 | Ga0065714_10434882 | Ga0065714_104348821 | 118 |
| 58 | 3300005289 | Ga0065704_10010704 | Ga0065704_100107043 | 118 |
| 59 | 3300005290 | Ga0065712_10452219 | Ga0065712_104522192 | 118 |
| 60 | 3300005293 | Ga0065715_10413971 | Ga0065715_104139712 | 118 |
| 61 | 3300005293 | Ga0065715_10609137 | Ga0065715_106091371 | 118 |
| 62 | 3300005295 | Ga0065707_10096924 | Ga0065707_100969243 | 118 |
| 63 | 3300005328 | Ga0070676_10476046 | Ga0070676_104760462 | 118 |
| 64 | 3300005330 | Ga0070690_100131949 | Ga0070690_1001319492 | 118 |
| 65 | 3300005331 | Ga0070670_100013378 | Ga0070670_1000133784 | 118 |
| 66 | 3300005333 | Ga0070677_10022397 | Ga0070677_100223973 | 118 |
| 67 | 3300005334 | Ga0068869_100014841 | Ga0068869_1000148413 | 118 |
| 68 | 3300005335 | Ga0070666_10055827 | Ga0070666_100558273 | 118 |
| 69 | 3300005336 | Ga0070680_100175434 | Ga0070680_1001754342 | 118 |
| 70 | 3300005337 | Ga0070682_100059173 | Ga0070682_1000591733 | 118 |
| 71 | 3300005338 | Ga0068868_100104320 | Ga0068868_1001043203 | 118 |
| 72 | 3300005339 | Ga0070660_100009427 | Ga0070660_1000094273 | 118 |
| 73 | 3300005340 | Ga0070689_100051706 | Ga0070689_1000517062 | 118 |
| 74 | 3300005341 | Ga0070691_10014047 | Ga0070691_100140472 | 118 |
| 75 | 3300005343 | Ga0070687_100015720 | Ga0070687_1000157202 | 118 |
| 76 | 3300005344 | Ga0070661_100025052 | Ga0070661_1000250523 | 118 |
| 77 | 3300005345 | Ga0070692_10012469 | Ga0070692_100124693 | 118 |
| 78 | 3300005347 | Ga0070668_100085257 | Ga0070668_1000852573 | 118 |
| 79 | 3300005353 | Ga0070669_100026033 | Ga0070669_1000260334 | 118 |
| 80 | 3300005354 | Ga0070675_100123596 | Ga0070675_1001235963 | 118 |
| 81 | 3300005355 | Ga0070671_100779866 | Ga0070671_1007798662 | 118 |
| 82 | 3300005356 | Ga0070674_100084892 | Ga0070674_1000848922 | 118 |
| 83 | 3300005364 | Ga0070673_100133352 | Ga0070673_1001333523 | 118 |
| 84 | 3300005364 | Ga0070673_100155156 | Ga0070673_1001551563 | 118 |
| 85 | 3300005365 | Ga0070688_100207912 | Ga0070688_1002079122 | 118 |
| 86 | 3300005365 | Ga0070688_100532455 | Ga0070688_1005324552 | 118 |
| 87 | 3300005366 | Ga0070659_100080685 | Ga0070659_1000806853 | 118 |
| 88 | 3300005367 | Ga0070667_100222995 | Ga0070667_1002229952 | 118 |
| 89 | 3300005406 | Ga0070703_10137711 | Ga0070703_101377111 | 118 |
| 90 | 3300005437 | Ga0070710_10610706 | Ga0070710_106107062 | 118 |
| 91 | 3300005438 | Ga0070701_10008347 | Ga0070701_100083473 | 118 |
| 92 | 3300005439 | Ga0070711_100150709 | Ga0070711_1001507092 | 118 |
| 93 | 3300005440 | Ga0070705_101642539 | Ga0070705_1016425391 | 118 |
| 94 | 3300005441 | Ga0070700_100000322 | Ga0070700_10000032217 | 118 |
| 95 | 3300005444 | Ga0070694_100003006 | Ga0070694_1000030064 | 118 |
| 96 | 3300005456 | Ga0070678_100009084 | Ga0070678_1000090846 | 118 |
| 97 | 3300005457 | Ga0070662_100092236 | Ga0070662_1000922362 | 118 |
| 98 | 3300005458 | Ga0070681_10095270 | Ga0070681_100952703 | 118 |
| 99 | 3300005459 | Ga0068867_100001065 | Ga0068867_10000106513 | 118 |
| 100 | 3300005530 | Ga0070679_100227553 | Ga0070679_1002275531 | 118 |
| 101 | 3300005535 | Ga0070684_101060586 | Ga0070684_1010605861 | 118 |
| 102 | 3300005543 | Ga0070672_100011126 | Ga0070672_1000111264 | 118 |
| 103 | 3300005543 | Ga0070672_100311781 | Ga0070672_1003117812 | 118 |
| 104 | 3300005544 | Ga0070686_100004998 | Ga0070686_1000049986 | 118 |
| 105 | 3300005544 | Ga0070686_101079135 | Ga0070686_1010791352 | 118 |
| 106 | 3300005545 | Ga0070695_100180466 | Ga0070695_1001804662 | 118 |
| 107 | 3300005546 | Ga0070696_100166378 | Ga0070696_1001663782 | 118 |
| 108 | 3300005546 | Ga0070696_100937961 | Ga0070696_1009379612 | 118 |
| 109 | 3300005547 | Ga0070693_100082655 | Ga0070693_1000826552 | 118 |
| 110 | 3300005549 | Ga0070704_100384651 | Ga0070704_1003846511 | 118 |
| 111 | 3300005563 | Ga0068855_100710056 | Ga0068855_1007100562 | 118 |
| 112 | 3300005564 | Ga0070664_100085618 | Ga0070664_1000856183 | 118 |
| 113 | 3300005577 | Ga0068857_100061866 | Ga0068857_1000618663 | 118 |
| 114 | 3300005578 | Ga0068854_100077746 | Ga0068854_1000777463 | 118 |
| 115 | 3300005614 | Ga0068856_100264168 | Ga0068856_1002641682 | 118 |
| 116 | 3300005615 | Ga0070702_100002869 | Ga0070702_1000028694 | 118 |
| 117 | 3300005616 | Ga0068852_100126479 | Ga0068852_1001264793 | 118 |
| 118 | 3300005617 | Ga0068859_101209887 | Ga0068859_1012098872 | 118 |
| 119 | 3300005618 | Ga0068864_101447387 | Ga0068864_1014473872 | 118 |
| 120 | 3300005719 | Ga0068861_100158121 | Ga0068861_1001581212 | 118 |
| 121 | 3300005840 | Ga0068870_10018454 | Ga0068870_100184543 | 118 |
| 122 | 3300005843 | Ga0068860_100091198 | Ga0068860_1000911983 | 118 |
| 123 | 3300005844 | Ga0068862_100227536 | Ga0068862_1002275362 | 118 |
| 124 | 3300005937 | Ga0081455_10318346 | Ga0081455_103183462 | 118 |
| 125 | 3300006058 | Ga0075432_10017819 | Ga0075432_100178193 | 118 |
| 126 | 3300006237 | Ga0097621_100019760 | Ga0097621_1000197603 | 118 |
| 127 | 3300006237 | Ga0097621_101164945 | Ga0097621_1011649452 | 118 |
| 128 | 3300006358 | Ga0068871_100010679 | Ga0068871_1000106792 | 118 |
| 129 | 3300006358 | Ga0068871_100042629 | Ga0068871_1000426294 | 118 |
| 130 | 3300006844 | Ga0075428_100399920 | Ga0075428_1003999202 | 118 |
| 131 | 3300006846 | Ga0075430_100002517 | Ga0075430_1000025173 | 118 |
| 132 | 3300006846 | Ga0075430_100004374 | Ga0075430_1000043747 | 118 |
| 133 | 3300006847 | Ga0075431_100169405 | Ga0075431_1001694053 | 118 |
| 134 | 3300006852 | Ga0075433_10073049 | Ga0075433_100730494 | 118 |
| 135 | 3300006880 | Ga0075429_100009563 | Ga0075429_1000095638 | 118 |
| 136 | 3300006880 | Ga0075429_100011721 | Ga0075429_1000117215 | 118 |
| 137 | 3300006881 | Ga0068865_100002715 | Ga0068865_1000027153 | 118 |
| 138 | 3300006914 | Ga0075436_100322116 | Ga0075436_1003221162 | 118 |
| 139 | 3300006914 | Ga0075436_101179654 | Ga0075436_1011796541 | 118 |
| 140 | 3300006931 | Ga0097620_101209778 | Ga0097620_1012097782 | 118 |
| 141 | 3300007076 | Ga0075435_100229410 | Ga0075435_1002294101 | 118 |
| 142 | 3300007076 | Ga0075435_100932607 | Ga0075435_1009326072 | 118 |
| 143 | 3300009093 | Ga0105240_10574510 | Ga0105240_105745101 | 118 |
| 144 | 3300009098 | Ga0105245_10063301 | Ga0105245_100633012 | 118 |
| 145 | 3300009147 | Ga0114129_10036112 | Ga0114129_100361123 | 118 |
| 146 | 3300009147 | Ga0114129_10127485 | Ga0114129_101274853 | 118 |
| 147 | 3300009147 | Ga0114129_11102486 | Ga0114129_111024862 | 118 |
| 148 | 3300009148 | Ga0105243_10013050 | Ga0105243_100130505 | 118 |
| 149 | 3300009174 | Ga0105241_10557634 | Ga0105241_105576342 | 118 |
| 150 | 3300009176 | Ga0105242_10000974 | Ga0105242_100009745 | 118 |
| 151 | 3300009177 | Ga0105248_11764697 | Ga0105248_117646972 | 118 |
| 152 | 3300009551 | Ga0105238_10598847 | Ga0105238_105988472 | 118 |
| 153 | 3300009553 | Ga0105249_10266644 | Ga0105249_102666443 | 118 |
| 154 | 3300010375 | Ga0105239_10033416 | Ga0105239_100334164 | 118 |
| 155 | 3300011119 | Ga0105246_10059616 | Ga0105246_100596163 | 118 |
| 156 | 3300013296 | Ga0157374_10062603 | Ga0157374_100626033 | 118 |
| 157 | 3300013296 | Ga0157374_10177501 | Ga0157374_101775013 | 118 |
| 158 | 3300013296 | Ga0157374_10944650 | Ga0157374_109446502 | 118 |
| 159 | 3300013297 | Ga0157378_10084487 | Ga0157378_100844872 | 118 |
| 160 | 3300013306 | Ga0163162_10066174 | Ga0163162_100661744 | 118 |
| 161 | 3300013307 | Ga0157372_12574682 | Ga0157372_125746822 | 118 |
| 162 | 3300013308 | Ga0157375_10034369 | Ga0157375_100343693 | 118 |
| 163 | 3300014326 | Ga0157380_10004274 | Ga0157380_100042742 | 118 |
| 164 | 3300014745 | Ga0157377_10027050 | Ga0157377_100270503 | 118 |
| 165 | 3300014745 | Ga0157377_10501661 | Ga0157377_105016611 | 118 |
| 166 | 3300014969 | Ga0157376_10021456 | Ga0157376_100214562 | 118 |
| 167 | 3300025885 | Ga0207653_10130725 | Ga0207653_101307252 | 118 |
| 168 | 3300025893 | Ga0207682_10058689 | Ga0207682_100586893 | 118 |
| 169 | 3300025898 | Ga0207692_10820360 | Ga0207692_108203602 | 118 |
| 170 | 3300025904 | Ga0207647_10477403 | Ga0207647_104774031 | 118 |
| 171 | 3300025907 | Ga0207645_10002494 | Ga0207645_100024945 | 118 |
| 172 | 3300025908 | Ga0207643_10043896 | Ga0207643_100438963 | 118 |
| 173 | 3300025912 | Ga0207707_10084572 | Ga0207707_100845722 | 118 |
| 174 | 3300025913 | Ga0207695_10676349 | Ga0207695_106763491 | 118 |
| 175 | 3300025916 | Ga0207663_10310026 | Ga0207663_103100262 | 118 |
| 176 | 3300025917 | Ga0207660_10076104 | Ga0207660_100761043 | 118 |
| 177 | 3300025918 | Ga0207662_10003710 | Ga0207662_100037103 | 118 |
| 178 | 3300025918 | Ga0207662_10030264 | Ga0207662_100302642 | 118 |
| 179 | 3300025919 | Ga0207657_10008353 | Ga0207657_100083535 | 118 |
| 180 | 3300025921 | Ga0207652_10105989 | Ga0207652_101059891 | 118 |
| 181 | 3300025923 | Ga0207681_10172716 | Ga0207681_101727162 | 118 |
| 182 | 3300025925 | Ga0207650_10273991 | Ga0207650_102739912 | 118 |
| 183 | 3300025926 | Ga0207659_10775405 | Ga0207659_107754051 | 118 |
| 184 | 3300025927 | Ga0207687_10129082 | Ga0207687_101290823 | 118 |
| 185 | 3300025931 | Ga0207644_10343593 | Ga0207644_103435932 | 118 |
| 186 | 3300025932 | Ga0207690_10269954 | Ga0207690_102699542 | 118 |
| 187 | 3300025933 | Ga0207706_10001148 | Ga0207706_100011487 | 118 |
| 188 | 3300025934 | Ga0207686_10114216 | Ga0207686_101142163 | 118 |
| 189 | 3300025935 | Ga0207709_10049661 | Ga0207709_100496614 | 118 |
| 190 | 3300025936 | Ga0207670_10019196 | Ga0207670_100191963 | 118 |
| 191 | 3300025936 | Ga0207670_10044799 | Ga0207670_100447994 | 118 |
| 192 | 3300025937 | Ga0207669_10095651 | Ga0207669_100956512 | 118 |
| 193 | 3300025938 | Ga0207704_10004675 | Ga0207704_100046754 | 118 |
| 194 | 3300025940 | Ga0207691_10001449 | Ga0207691_100014494 | 118 |
| 195 | 3300025940 | Ga0207691_10302342 | Ga0207691_103023422 | 118 |
| 196 | 3300025941 | Ga0207711_11381439 | Ga0207711_113814392 | 118 |
| 197 | 3300025942 | Ga0207689_10024748 | Ga0207689_100247484 | 118 |
| 198 | 3300025945 | Ga0207679_10089597 | Ga0207679_100895973 | 118 |
| 199 | 3300025960 | Ga0207651_10219416 | Ga0207651_102194162 | 118 |
| 200 | 3300025960 | Ga0207651_10793102 | Ga0207651_107931022 | 118 |
| 201 | 3300025961 | Ga0207712_10179596 | Ga0207712_101795963 | 118 |
| 202 | 3300025981 | Ga0207640_10203306 | Ga0207640_102033062 | 118 |
| 203 | 3300026023 | Ga0207677_11440117 | Ga0207677_114401171 | 118 |
| 204 | 3300026075 | Ga0207708_10001206 | Ga0207708_100012068 | 118 |
| 205 | 3300026088 | Ga0207641_11227518 | Ga0207641_112275182 | 118 |
| 206 | 3300026089 | Ga0207648_10000360 | Ga0207648_1000036013 | 118 |
| 207 | 3300026095 | Ga0207676_11213517 | Ga0207676_112135171 | 118 |
| 208 | 3300026116 | Ga0207674_10054686 | Ga0207674_100546863 | 118 |
| 209 | 3300026118 | Ga0207675_100101252 | Ga0207675_1001012523 | 118 |
| 210 | 3300026121 | Ga0207683_10000388 | Ga0207683_1000038813 | 118 |
| 211 | 3300027252 | Ga0209973_1001725 | Ga0209973_10017253 | 118 |
| 212 | 3300027360 | Ga0209969_1004681 | Ga0209969_10046812 | 118 |
| 213 | 3300027364 | Ga0209967_1001076 | Ga0209967_10010762 | 118 |
| 214 | 3300027364 | Ga0209967_1012878 | Ga0209967_10128782 | 118 |
| 215 | 3300027378 | Ga0209981_1000799 | Ga0209981_10007992 | 118 |
| 216 | 3300027424 | Ga0209984_1001317 | Ga0209984_10013172 | 118 |
| 217 | 3300027462 | Ga0210000_1000038 | Ga0210000_100003816 | 118 |
| 218 | 3300027471 | Ga0209995_1001259 | Ga0209995_10012594 | 118 |
| 219 | 3300027526 | Ga0209968_1000031 | Ga0209968_10000313 | 118 |
| 220 | 3300027526 | Ga0209968_1008208 | Ga0209968_10082083 | 118 |
| 221 | 3300027614 | Ga0209970_1000862 | Ga0209970_10008623 | 118 |
| 222 | 3300027617 | Ga0210002_1002423 | Ga0210002_10024233 | 118 |
| 223 | 3300027665 | Ga0209983_1000273 | Ga0209983_10002732 | 118 |
| 224 | 3300027682 | Ga0209971_1000385 | Ga0209971_10003853 | 118 |
| 225 | 3300027682 | Ga0209971_1008425 | Ga0209971_10084253 | 118 |
| 226 | 3300027695 | Ga0209966_1000274 | Ga0209966_10002745 | 118 |
| 227 | 3300027717 | Ga0209998_10000112 | Ga0209998_100001126 | 118 |
| 228 | 3300027876 | Ga0209974_10000092 | Ga0209974_1000009218 | 118 |
| 229 | 3300027876 | Ga0209974_10001027 | Ga0209974_100010274 | 118 |
| 230 | 3300027876 | Ga0209974_10009396 | Ga0209974_100093963 | 118 |
| 231 | 3300027907 | Ga0207428_10001527 | Ga0207428_100015274 | 118 |
| 232 | 3300028380 | Ga0268265_10068276 | Ga0268265_100682761 | 118 |
| 233 | 3300028381 | Ga0268264_10162365 | Ga0268264_101623652 | 118 |
| 234 | 3300031548 | Ga0307408_100008411 | Ga0307408_1000084113 | 118 |
| 235 | 3300031731 | Ga0307405_10140377 | Ga0307405_101403773 | 118 |
| 236 | 3300031824 | Ga0307413_11576584 | Ga0307413_115765842 | 118 |
| 237 | 3300031852 | Ga0307410_10097913 | Ga0307410_100979132 | 118 |
| 238 | 3300031901 | Ga0307406_10071061 | Ga0307406_100710614 | 118 |
| 239 | 3300031903 | Ga0307407_10006292 | Ga0307407_100062926 | 118 |
| 240 | 3300031903 | Ga0307407_10927120 | Ga0307407_109271202 | 118 |
| 241 | 3300031911 | Ga0307412_10010666 | Ga0307412_100106664 | 118 |
| 242 | 3300031911 | Ga0307412_10052082 | Ga0307412_100520821 | 118 |
| 243 | 3300031995 | Ga0307409_100050405 | Ga0307409_1000504052 | 118 |
| 244 | 3300032002 | Ga0307416_100072887 | Ga0307416_1000728873 | 118 |
| 245 | 3300032005 | Ga0307411_10029920 | Ga0307411_100299203 | 118 |
| 246 | 3300032005 | Ga0307411_10630716 | Ga0307411_106307163 | 118 |
| 247 | 3300032005 | Ga0307411_10899394 | Ga0307411_108993942 | 118 |
| 248 | 3300032005 | Ga0307411_11594864 | Ga0307411_115948641 | 118 |
| 249 | 3300032126 | Ga0307415_100034162 | Ga0307415_1000341624 | 118 |
| 250 | 3300034820 | Ga0373959_0053886 | Ga0373959_0053886_286_669 | 118 |
| 251 | 3300035085 | Ga0373929_0229740 | Ga0373929_0229740_130_513 | 118 |
| 252 | 3300035114 | Ga0373939_0331949 | Ga0373939_0331949_187_570 | 118 |
| 253 | 3300035114 | Ga0373939_0341955 | Ga0373939_0341955_210_593 | 118 |
| 254 | 3300035115 | Ga0373941_0340983 | Ga0373941_0340983_213_596 | 118 |
| 255 | 3300035121 | Ga0373960_0030667 | Ga0373960_0030667_511_894 | 118 |
| 256 | 3300035207 | Ga0373942_0237979 | Ga0373942_0237979_204_587 | 118 |
| 257 | 3300035241 | Ga0373961_0017740 | Ga0373961_0017740_1350_1733 | 118 |
| 258 | 3300035691 | Ga0373931_0068073 | Ga0373931_0068073_303_686 | 118 |
| 259 | 3300041405 | Ga0439438_023427 | Ga0439438_023427_25_408 | 118 |
| 260 | 3300041408 | Ga0439453_0066402 | Ga0439453_0066402_245_628 | 118 |
| 261 | 3300041410 | Ga0439461_0084822 | Ga0439461_0084822_92_475 | 118 |
| 262 | 3300041413 | Ga0439465_0238849 | Ga0439465_0238849_49_432 | 118 |
| 263 | 3300042004 | Ga0439445_0047230 | Ga0439445_0047230_467_850 | 118 |
| 264 | 3300042008 | Ga0439450_013307 | Ga0439450_013307_983_1366 | 118 |
| 265 | 3300042010 | Ga0439452_047452 | Ga0439452_047452_192_575 | 118 |
| 266 | 3300042016 | Ga0439463_063861 | Ga0439463_063861_541_924 | 118 |
| 267 | 3300042134 | Ga0450898_055067 | Ga0450898_055067_26_409 | 118 |
| 268 | 3300042156 | Ga0439446_0015222 | Ga0439446_0015222_1050_1433 | 118 |
| 269 | 3300042185 | Ga0450909_053708 | Ga0450909_053708_176_559 | 118 |
| 270 | 3300042435 | Ga0439434_0009729 | Ga0439434_0009729_1625_2008 | 118 |
| 271 | 3300042438 | Ga0439459_0041182 | Ga0439459_0041182_285_668 | 118 |
| 272 | 3300042439 | Ga0439464_0046168 | Ga0439464_0046168_147_530 | 118 |
| 273 | 3300042876 | Ga0451577_0410776 | Ga0451577_0410776_129_506 | 118 |
| 274 | 3300044673 | Ga0453683_0066523 | Ga0453683_0066523_1304_1687 | 118 |
| 275 | 3300045051 | Ga0451576_0138060 | Ga0451576_0138060_230_613 | 118 |
| 276 | 3300045051 | Ga0451576_1267515 | Ga0451576_1267515_299_682 | 118 |
| 277 | 3300046520 | Ga0495637_0129692 | Ga0495637_0129692_388_771 | 118 |
| 278 | 3300047318 | Ga0495636_0023456 | Ga0495636_0023456_224_607 | 118 |
| 279 | 3300048909 | Ga0496106_0407983 | Ga0496106_0407983_507_890 | 118 |
| 280 | 3300049129 | Ga0501309_038759 | Ga0501309_038759_264_647 | 118 |
| 281 | 3300049513 | Ga0501290_000131 | Ga0501290_000131_5992_6375 | 118 |
| 282 | 3300049514 | Ga0501291_001237 | Ga0501291_001237_2073_2456 | 118 |
| 283 | 3300049515 | Ga0501292_000120 | Ga0501292_000120_2788_3171 | 118 |
| 284 | 3300049518 | Ga0501295_000092 | Ga0501295_000092_4691_5074 | 118 |
| 285 | 3300049519 | Ga0501296_000127 | Ga0501296_000127_3462_3845 | 118 |
| 286 | 3300049520 | Ga0501297_000114 | Ga0501297_000114_3452_3835 | 118 |
| 287 | 3300049521 | Ga0501298_000079 | Ga0501298_000079_1466_1849 | 118 |
| 288 | 3300049522 | Ga0501299_000526 | Ga0501299_000526_1976_2359 | 118 |
| 289 | 3300049523 | Ga0501300_000057 | Ga0501300_000057_3769_4152 | 118 |
| 290 | 3300049524 | Ga0501301_001477 | Ga0501301_001477_385_768 | 118 |
| 291 | 3300049526 | Ga0501303_001069 | Ga0501303_001069_1176_1559 | 118 |
| 292 | 3300049568 | Ga0501031_0309712 | Ga0501031_0309712_449_829 | 118 |
| 293 | 3300049570 | Ga0501033_0125025 | Ga0501033_0125025_567_950 | 118 |
| 294 | 3300049572 | Ga0501036_0108830 | Ga0501036_0108830_1944_2327 | 118 |
| 295 | 3300049574 | Ga0501038_1352123 | Ga0501038_1352123_28_411 | 118 |
| 296 | 3300049575 | Ga0501039_0029139 | Ga0501039_0029139_3629_4012 | 118 |
| 297 | 3300049575 | Ga0501039_0701465 | Ga0501039_0701465_399_779 | 118 |
| 298 | 3300049576 | Ga0501040_0027774 | Ga0501040_0027774_635_1018 | 118 |
| 299 | 3300049577 | Ga0501041_0004008 | Ga0501041_0004008_188_571 | 118 |
| 300 | 3300049580 | Ga0501046_0044091 | Ga0501046_0044091_1502_1885 | 118 |
| 301 | 3300049582 | Ga0501048_0385104 | Ga0501048_0385104_488_871 | 118 |
| 302 | 3300049582 | Ga0501048_0536407 | Ga0501048_0536407_449_829 | 118 |
| 303 | 3300049583 | Ga0501067_0158293 | Ga0501067_0158293_789_1172 | 118 |
| 304 | 3300049584 | Ga0501068_0114822 | Ga0501068_0114822_1095_1478 | 118 |
| 305 | 3300049584 | Ga0501068_0122824 | Ga0501068_0122824_923_1306 | 118 |
| 306 | 3300049587 | Ga0501071_0002814 | Ga0501071_0002814_7216_7599 | 118 |
| 307 | 3300049587 | Ga0501071_0272231 | Ga0501071_0272231_878_1261 | 118 |
| 308 | 3300049588 | Ga0501072_0029962 | Ga0501072_0029962_247_630 | 118 |
| 309 | 3300049591 | Ga0501075_0064474 | Ga0501075_0064474_2317_2700 | 118 |
| 310 | 3300049591 | Ga0501075_0409462 | Ga0501075_0409462_276_641 | 118 |
| 311 | 3300049592 | Ga0501076_0344692 | Ga0501076_0344692_685_1065 | 118 |
| 312 | 3300049593 | Ga0501077_0014302 | Ga0501077_0014302_1805_2188 | 118 |
| 313 | 3300049649 | Ga0501198_003564 | Ga0501198_003564_1335_1718 | 118 |
| 314 | 3300049650 | Ga0501199_030382 | Ga0501199_030382_104_487 | 118 |
| 315 | 3300049651 | Ga0501201_000857 | Ga0501201_000857_1953_2336 | 118 |
| 316 | 3300049652 | Ga0501202_001309 | Ga0501202_001309_361_744 | 118 |
| 317 | 3300049653 | Ga0501206_000124 | Ga0501206_000124_3551_3934 | 118 |
| 318 | 3300049654 | Ga0501207_000985 | Ga0501207_000985_15_398 | 118 |
| 319 | 3300049655 | Ga0501208_000439 | Ga0501208_000439_2674_3057 | 118 |
| 320 | 3300049658 | Ga0501211_006607 | Ga0501211_006607_235_618 | 118 |
| 321 | 3300049659 | Ga0501214_048667 | Ga0501214_048667_227_610 | 118 |
| 322 | 3300049660 | Ga0501216_000146 | Ga0501216_000146_4325_4708 | 118 |
| 323 | 3300049661 | Ga0501217_000519 | Ga0501217_000519_2447_2830 | 118 |
| 324 | 3300049662 | Ga0501222_003295 | Ga0501222_003295_779_1162 | 118 |
| 325 | 3300049663 | Ga0501223_004844 | Ga0501223_004844_1371_1754 | 118 |
| 326 | 3300049664 | Ga0501224_025307 | Ga0501224_025307_331_714 | 118 |
| 327 | 3300049665 | Ga0501227_010508 | Ga0501227_010508_454_837 | 118 |
| 328 | 3300049666 | Ga0501228_012159 | Ga0501228_012159_385_768 | 118 |
| 329 | 3300049668 | Ga0501233_026986 | Ga0501233_026986_89_472 | 118 |
| 330 | 3300049669 | Ga0501235_000237 | Ga0501235_000237_6378_6761 | 118 |
| 331 | 3300049670 | Ga0501236_002775 | Ga0501236_002775_1549_1932 | 118 |
| 332 | 3300049672 | Ga0501239_000716 | Ga0501239_000716_1388_1771 | 118 |
| 333 | 3300049674 | Ga0501242_037795 | Ga0501242_037795_212_595 | 118 |
| 334 | 3300049675 | Ga0501243_000596 | Ga0501243_000596_1043_1426 | 118 |
| 335 | 3300049676 | Ga0501246_012500 | Ga0501246_012500_400_783 | 118 |
| 336 | 3300049677 | Ga0501247_001858 | Ga0501247_001858_1110_1493 | 118 |
| 337 | 3300049678 | Ga0501248_002300 | Ga0501248_002300_858_1241 | 118 |
| 338 | 3300049679 | Ga0501249_001783 | Ga0501249_001783_1908_2291 | 118 |
| 339 | 3300049680 | Ga0501250_009725 | Ga0501250_009725_45_428 | 118 |
| 340 | 3300049681 | Ga0501251_002117 | Ga0501251_002117_1379_1762 | 118 |
| 341 | 3300049683 | Ga0501253_000169 | Ga0501253_000169_1515_1898 | 118 |
| 342 | 3300049684 | Ga0501255_000377 | Ga0501255_000377_2156_2539 | 118 |
| 343 | 3300049686 | Ga0501257_001186 | Ga0501257_001186_3435_3818 | 118 |
| 344 | 3300049687 | Ga0501258_001337 | Ga0501258_001337_621_1004 | 118 |
| 345 | 3300049688 | Ga0501259_039063 | Ga0501259_039063_452_835 | 118 |
| 346 | 3300049690 | Ga0501261_003666 | Ga0501261_003666_529_912 | 118 |
| 347 | 3300049703 | Ga0501219_000569 | Ga0501219_000569_1456_1839 | 118 |
| 348 | 3300049704 | Ga0501221_000633 | Ga0501221_000633_1653_2036 | 118 |
| 349 | 3300049705 | Ga0501225_0000205 | Ga0501225_0000205_4283_4666 | 118 |
| 350 | 3300049707 | Ga0501234_001096 | Ga0501234_001096_3713_4096 | 118 |
| 351 | 3300049708 | Ga0501245_002108 | Ga0501245_002108_305_688 | 118 |
| 352 | 3300049741 | Ga0501079_0028540 | Ga0501079_0028540_3635_4018 | 118 |
| 353 | 3300049744 | Ga0501083_0385830 | Ga0501083_0385830_136_519 | 118 |
| 354 | 3300049757 | Ga0501232_002983 | Ga0501232_002983_54_437 | 118 |
| 355 | 3300049759 | Ga0501262_018552 | Ga0501262_018552_179_562 | 118 |
| 356 | 3300049761 | Ga0501264_001361 | Ga0501264_001361_1162_1545 | 118 |
| 357 | 3300049763 | Ga0501266_000137 | Ga0501266_000137_4810_5193 | 118 |
| 358 | 3300049767 | Ga0501270_001294 | Ga0501270_001294_212_595 | 118 |
| 359 | 3300049768 | Ga0501271_000405 | Ga0501271_000405_399_782 | 118 |
| 360 | 3300049771 | Ga0501274_003582 | Ga0501274_003582_375_758 | 118 |
| 361 | 3300049775 | Ga0501279_000411 | Ga0501279_000411_3476_3859 | 118 |
| 362 | 3300049776 | Ga0501280_003894 | Ga0501280_003894_1816_2199 | 118 |
| 363 | 3300049778 | Ga0501282_001924 | Ga0501282_001924_285_668 | 118 |
| 364 | 3300049779 | Ga0501283_000409 | Ga0501283_000409_3259_3642 | 118 |
| 365 | 3300049822 | Ga0501035_0100668 | Ga0501035_0100668_569_952 | 118 |
| 366 | 3300049824 | Ga0501045_0065327 | Ga0501045_0065327_10_393 | 118 |
| 367 | 3300049849 | Ga0501200_01268 | Ga0501200_01268_222_605 | 118 |
| 368 | 3300049851 | Ga0501212_018549 | Ga0501212_018549_621_1004 | 118 |
| 369 | 3300049853 | Ga0501226_011772 | Ga0501226_011772_428_811 | 118 |
| 370 | 3300050507 | nmdc:mga05p37_427717_c1 | nmdc:mga05p37_427717_c1_152_535 | 118 |
| 371 | 3300050507 | nmdc:mga05p37_982328_c1 | nmdc:mga05p37_982328_c1_363_746 | 118 |
| 372 | 3300050508 | nmdc:mga09592_164568_c1 | nmdc:mga09592_164568_c1_38_421 | 118 |
| 373 | 3300050508 | nmdc:mga09592_25127_c1 | nmdc:mga09592_25127_c1_312_695 | 118 |
| 374 | 3300050509 | nmdc:mga0qj67_101485_c1 | nmdc:mga0qj67_101485_c1_1326_1709 | 118 |
| 375 | 3300050509 | nmdc:mga0qj67_171122_c1 | nmdc:mga0qj67_171122_c1_38_421 | 118 |
| 376 | 3300050510 | nmdc:mga06r32_122318_c1 | nmdc:mga06r32_122318_c1_2083_2466 | 118 |
| 377 | 3300050511 | nmdc:mga08y16_28953_c1 | nmdc:mga08y16_28953_c1_821_1204 | 118 |
| 378 | 3300050512 | nmdc:mga0n895_137034_c1 | nmdc:mga0n895_137034_c1_1327_1710 | 118 |
| 379 | 3300050513 | nmdc:mga0rr50_235042_c1 | nmdc:mga0rr50_235042_c1_11_394 | 118 |
| 380 | 3300050514 | nmdc:mga08x19_730996_c1 | nmdc:mga08x19_730996_c1_149_532 | 118 |
| 381 | 3300050515 | nmdc:mga0a205_65443_c1 | nmdc:mga0a205_65443_c1_616_999 | 118 |
| 382 | 3300054114 | Ga0501084_0021636 | Ga0501084_0021636_122_505 | 118 |
| 383 | 3300059512 | Ga0587092_135114 | Ga0587092_135114_38_418 | 118 |
| 384 | 3300060353 | Ga0501082_0006364 | Ga0501082_0006364_414_797 | 118 |
| 385 | 3300061734 | Ga0530510_0007074 | Ga0530510_0007074_259_642 | 118 |
| 386 | 3300005330 | Ga0070690_100000912 | Ga0070690_1000009122 | 119 |
| 387 | 3300005330 | Ga0070690_100379658 | Ga0070690_1003796582 | 119 |
| 388 | 3300005334 | Ga0068869_100473215 | Ga0068869_1004732152 | 119 |
| 389 | 3300005337 | Ga0070682_100531001 | Ga0070682_1005310011 | 119 |
| 390 | 3300005338 | Ga0068868_100517867 | Ga0068868_1005178672 | 119 |
| 391 | 3300005340 | Ga0070689_100008310 | Ga0070689_1000083105 | 119 |
| 392 | 3300005341 | Ga0070691_10152136 | Ga0070691_101521362 | 119 |
| 393 | 3300005343 | Ga0070687_100895258 | Ga0070687_1008952582 | 119 |
| 394 | 3300005345 | Ga0070692_10077452 | Ga0070692_100774523 | 119 |
| 395 | 3300005345 | Ga0070692_10581755 | Ga0070692_105817552 | 119 |
| 396 | 3300005347 | Ga0070668_100297458 | Ga0070668_1002974582 | 119 |
| 397 | 3300005365 | Ga0070688_100943003 | Ga0070688_1009430031 | 119 |
| 398 | 3300005438 | Ga0070701_10055474 | Ga0070701_100554743 | 119 |
| 399 | 3300005438 | Ga0070701_10580358 | Ga0070701_105803582 | 119 |
| 400 | 3300005441 | Ga0070700_100049482 | Ga0070700_1000494824 | 119 |
| 401 | 3300005467 | Ga0070706_100405856 | Ga0070706_1004058562 | 119 |
| 402 | 3300005468 | Ga0070707_100538928 | Ga0070707_1005389281 | 119 |
| 403 | 3300005535 | Ga0070684_100467157 | Ga0070684_1004671572 | 119 |
| 404 | 3300005545 | Ga0070695_100034853 | Ga0070695_1000348532 | 119 |
| 405 | 3300005545 | Ga0070695_100743022 | Ga0070695_1007430222 | 119 |
| 406 | 3300005563 | Ga0068855_100019512 | Ga0068855_1000195127 | 119 |
| 407 | 3300005578 | Ga0068854_100014453 | Ga0068854_1000144532 | 119 |
| 408 | 3300005615 | Ga0070702_100519580 | Ga0070702_1005195802 | 119 |
| 409 | 3300005718 | Ga0068866_11228962 | Ga0068866_112289622 | 119 |
| 410 | 3300005719 | Ga0068861_100035360 | Ga0068861_1000353602 | 119 |
| 411 | 3300005719 | Ga0068861_100183372 | Ga0068861_1001833722 | 119 |
| 412 | 3300005842 | Ga0068858_101314921 | Ga0068858_1013149212 | 119 |
| 413 | 3300005843 | Ga0068860_100085596 | Ga0068860_1000855962 | 119 |
| 414 | 3300005843 | Ga0068860_100402208 | Ga0068860_1004022082 | 119 |
| 415 | 3300005844 | Ga0068862_100739470 | Ga0068862_1007394702 | 119 |
| 416 | 3300005937 | Ga0081455_10000014 | Ga0081455_10000014138 | 119 |
| 417 | 3300005983 | Ga0081540_1000035 | Ga0081540_1000035103 | 119 |
| 418 | 3300005983 | Ga0081540_1164463 | Ga0081540_11644631 | 119 |
| 419 | 3300006058 | Ga0075432_10041117 | Ga0075432_100411173 | 119 |
| 420 | 3300006163 | Ga0070715_10152690 | Ga0070715_101526902 | 119 |
| 421 | 3300006175 | Ga0070712_100690962 | Ga0070712_1006909622 | 119 |
| 422 | 3300006237 | Ga0097621_101080363 | Ga0097621_1010803632 | 119 |
| 423 | 3300006237 | Ga0097621_102027698 | Ga0097621_1020276981 | 119 |
| 424 | 3300006844 | Ga0075428_100061825 | Ga0075428_1000618254 | 119 |
| 425 | 3300006871 | Ga0075434_100002404 | Ga0075434_10000240419 | 119 |
| 426 | 3300006914 | Ga0075436_101054600 | Ga0075436_1010546001 | 119 |
| 427 | 3300007076 | Ga0075435_100033993 | Ga0075435_1000339933 | 119 |
| 428 | 3300009094 | Ga0111539_10032830 | Ga0111539_100328303 | 119 |
| 429 | 3300009094 | Ga0111539_10301307 | Ga0111539_103013072 | 119 |
| 430 | 3300009094 | Ga0111539_10446584 | Ga0111539_104465843 | 119 |
| 431 | 3300009098 | Ga0105245_10256070 | Ga0105245_102560703 | 119 |
| 432 | 3300009147 | Ga0114129_10496923 | Ga0114129_104969231 | 119 |
| 433 | 3300009148 | Ga0105243_10161143 | Ga0105243_101611433 | 119 |
| 434 | 3300009148 | Ga0105243_10250509 | Ga0105243_102505092 | 119 |
| 435 | 3300009176 | Ga0105242_10747006 | Ga0105242_107470062 | 119 |
| 436 | 3300009177 | Ga0105248_11559005 | Ga0105248_115590052 | 119 |
| 437 | 3300009545 | Ga0105237_10014196 | Ga0105237_100141965 | 119 |
| 438 | 3300009553 | Ga0105249_10046499 | Ga0105249_100464995 | 119 |
| 439 | 3300009553 | Ga0105249_10088653 | Ga0105249_100886533 | 119 |
| 440 | 3300013297 | Ga0157378_11255945 | Ga0157378_112559452 | 119 |
| 441 | 3300025899 | Ga0207642_10886810 | Ga0207642_108868102 | 119 |
| 442 | 3300025905 | Ga0207685_10151598 | Ga0207685_101515983 | 119 |
| 443 | 3300025915 | Ga0207693_10764696 | Ga0207693_107646962 | 119 |
| 444 | 3300025942 | Ga0207689_10250377 | Ga0207689_102503772 | 119 |
| 445 | 3300025972 | Ga0207668_10529297 | Ga0207668_105292972 | 119 |
| 446 | 3300026075 | Ga0207708_10249774 | Ga0207708_102497743 | 119 |
| 447 | 3300026118 | Ga0207675_100624129 | Ga0207675_1006241292 | 119 |
| 448 | 3300027907 | Ga0207428_10051835 | Ga0207428_100518353 | 119 |
| 449 | 3300034816 | Ga0373930_0080034 | Ga0373930_0080034_122_511 | 119 |
| 450 | 3300034817 | Ga0373948_0213252 | Ga0373948_0213252_47_436 | 119 |
| 451 | 3300034820 | Ga0373959_0075131 | Ga0373959_0075131_113_502 | 119 |
| 452 | 3300034957 | Ga0373938_0177640 | Ga0373938_0177640_95_484 | 119 |
| 453 | 3300035084 | Ga0373928_0063661 | Ga0373928_0063661_118_507 | 119 |
| 454 | 3300035085 | Ga0373929_0110454 | Ga0373929_0110454_256_645 | 119 |
| 455 | 3300035088 | Ga0373940_0022345 | Ga0373940_0022345_1048_1437 | 119 |
| 456 | 3300035091 | Ga0373951_0015888 | Ga0373951_0015888_322_711 | 119 |
| 457 | 3300035092 | Ga0373952_0006708 | Ga0373952_0006708_26_415 | 119 |
| 458 | 3300035112 | Ga0373932_0087372 | Ga0373932_0087372_123_512 | 119 |
| 459 | 3300035121 | Ga0373960_0002305 | Ga0373960_0002305_2001_2390 | 119 |
| 460 | 3300035242 | Ga0373962_0028414 | Ga0373962_0028414_359_748 | 119 |
| 461 | 3300035242 | Ga0373962_0052357 | Ga0373962_0052357_328_717 | 119 |
| 462 | 3300035242 | Ga0373962_0315815 | Ga0373962_0315815_12_377 | 119 |
| 463 | 3300035691 | Ga0373931_0000271 | Ga0373931_0000271_9333_9722 | 119 |
| 464 | 3300035691 | Ga0373931_0421059 | Ga0373931_0421059_399_788 | 119 |
| 465 | 3300046491 | Ga0495584_0045617 | Ga0495584_0045617_1239_1628 | 119 |
| 466 | 3300046664 | Ga0495659_0273974 | Ga0495659_0273974_190_579 | 119 |
| 467 | 3300048917 | Ga0496114_1122911 | Ga0496114_1122911_131_520 | 119 |
| 468 | 3300048918 | Ga0496115_0732921 | Ga0496115_0732921_230_619 | 119 |
| 469 | 3300050507 | nmdc:mga05p37_119342_c1 | nmdc:mga05p37_119342_c1_1178_1567 | 119 |
| 470 | 3300050511 | nmdc:mga08y16_134786_c1 | nmdc:mga08y16_134786_c1_1688_2077 | 119 |
| 471 | 3300050511 | nmdc:mga08y16_207598_c1 | nmdc:mga08y16_207598_c1_324_713 | 119 |
| 472 | 3300050511 | nmdc:mga08y16_814161_c1 | nmdc:mga08y16_814161_c1_469_858 | 119 |
| 473 | 3300050512 | nmdc:mga0n895_2115_c1 | nmdc:mga0n895_2115_c1_853_1242 | 119 |
| 474 | 3300050513 | nmdc:mga0rr50_30630_c1 | nmdc:mga0rr50_30630_c1_2064_2453 | 119 |
| 475 | 3300050515 | nmdc:mga0a205_3719_c1 | nmdc:mga0a205_3719_c1_1453_1842 | 119 |
| 476 | 3300050515 | nmdc:mga0a205_760876_c1 | nmdc:mga0a205_760876_c1_39_428 | 119 |
| 477 | 3300059424 | Ga0590075_077401 | Ga0590075_077401_380_763 | 119 |
| 478 | 2162886007 | SwRhRL2b_contig_1452750 | SwRhRL2b_0069.00000450 | 120 |
| 479 | 2162886007 | SwRhRL2b_contig_219822 | SwRhRL2b_0704.00005400 | 120 |
| 480 | 3300003856 | Ga0058692_1006450 | Ga0058692_10064503 | 120 |
| 481 | 3300004799 | Ga0058863_11260821 | Ga0058863_112608212 | 120 |
| 482 | 3300005289 | Ga0065704_10072434 | Ga0065704_100724349 | 120 |
| 483 | 3300005290 | Ga0065712_10448217 | Ga0065712_104482171 | 120 |
| 484 | 3300005293 | Ga0065715_10404665 | Ga0065715_104046651 | 120 |
| 485 | 3300005328 | Ga0070676_10066165 | Ga0070676_100661652 | 120 |
| 486 | 3300005329 | Ga0070683_100093720 | Ga0070683_1000937203 | 120 |
| 487 | 3300005330 | Ga0070690_100000841 | Ga0070690_10000084116 | 120 |
| 488 | 3300005331 | Ga0070670_100817275 | Ga0070670_1008172751 | 120 |
| 489 | 3300005334 | Ga0068869_100000727 | Ga0068869_10000072719 | 120 |
| 490 | 3300005334 | Ga0068869_100550442 | Ga0068869_1005504421 | 120 |
| 491 | 3300005336 | Ga0070680_100009718 | Ga0070680_1000097186 | 120 |
| 492 | 3300005337 | Ga0070682_100027537 | Ga0070682_1000275373 | 120 |
| 493 | 3300005340 | Ga0070689_100004042 | Ga0070689_1000040424 | 120 |
| 494 | 3300005340 | Ga0070689_100946943 | Ga0070689_1009469431 | 120 |
| 495 | 3300005341 | Ga0070691_10132523 | Ga0070691_101325231 | 120 |
| 496 | 3300005341 | Ga0070691_10871928 | Ga0070691_108719281 | 120 |
| 497 | 3300005343 | Ga0070687_100009907 | Ga0070687_1000099073 | 120 |
| 498 | 3300005345 | Ga0070692_10006374 | Ga0070692_100063743 | 120 |
| 499 | 3300005353 | Ga0070669_100112903 | Ga0070669_1001129033 | 120 |
| 500 | 3300005353 | Ga0070669_100272185 | Ga0070669_1002721852 | 120 |
| 501 | 3300005354 | Ga0070675_100147866 | Ga0070675_1001478662 | 120 |
| 502 | 3300005364 | Ga0070673_100120125 | Ga0070673_1001201253 | 120 |
| 503 | 3300005364 | Ga0070673_101318465 | Ga0070673_1013184652 | 120 |
| 504 | 3300005365 | Ga0070688_100018522 | Ga0070688_1000185223 | 120 |
| 505 | 3300005365 | Ga0070688_100036061 | Ga0070688_1000360614 | 120 |
| 506 | 3300005365 | Ga0070688_100302557 | Ga0070688_1003025572 | 120 |
| 507 | 3300005367 | Ga0070667_101041964 | Ga0070667_1010419642 | 120 |
| 508 | 3300005438 | Ga0070701_10003790 | Ga0070701_100037904 | 120 |
| 509 | 3300005438 | Ga0070701_10639329 | Ga0070701_106393292 | 120 |
| 510 | 3300005440 | Ga0070705_100000565 | Ga0070705_1000005654 | 120 |
| 511 | 3300005440 | Ga0070705_100648925 | Ga0070705_1006489252 | 120 |
| 512 | 3300005441 | Ga0070700_100009240 | Ga0070700_1000092403 | 120 |
| 513 | 3300005444 | Ga0070694_100001696 | Ga0070694_1000016965 | 120 |
| 514 | 3300005444 | Ga0070694_100200565 | Ga0070694_1002005652 | 120 |
| 515 | 3300005445 | Ga0070708_100089835 | Ga0070708_1000898353 | 120 |
| 516 | 3300005459 | Ga0068867_100000640 | Ga0068867_10000064017 | 120 |
| 517 | 3300005459 | Ga0068867_101683612 | Ga0068867_1016836121 | 120 |
| 518 | 3300005466 | Ga0070685_10339001 | Ga0070685_103390012 | 120 |
| 519 | 3300005466 | Ga0070685_10352270 | Ga0070685_103522702 | 120 |
| 520 | 3300005518 | Ga0070699_100266336 | Ga0070699_1002663362 | 120 |
| 521 | 3300005518 | Ga0070699_100365096 | Ga0070699_1003650962 | 120 |
| 522 | 3300005530 | Ga0070679_100034021 | Ga0070679_1000340215 | 120 |
| 523 | 3300005530 | Ga0070679_102017815 | Ga0070679_1020178151 | 120 |
| 524 | 3300005535 | Ga0070684_101547979 | Ga0070684_1015479791 | 120 |
| 525 | 3300005543 | Ga0070672_100987555 | Ga0070672_1009875552 | 120 |
| 526 | 3300005543 | Ga0070672_101814911 | Ga0070672_1018149111 | 120 |
| 527 | 3300005544 | Ga0070686_100002616 | Ga0070686_1000026164 | 120 |
| 528 | 3300005545 | Ga0070695_100029658 | Ga0070695_1000296583 | 120 |
| 529 | 3300005545 | Ga0070695_100141700 | Ga0070695_1001417002 | 120 |
| 530 | 3300005546 | Ga0070696_100000527 | Ga0070696_10000052722 | 120 |
| 531 | 3300005546 | Ga0070696_100570797 | Ga0070696_1005707971 | 120 |
| 532 | 3300005547 | Ga0070693_100000145 | Ga0070693_10000014527 | 120 |
| 533 | 3300005547 | Ga0070693_100028320 | Ga0070693_1000283203 | 120 |
| 534 | 3300005548 | Ga0070665_100054089 | Ga0070665_1000540894 | 120 |
| 535 | 3300005549 | Ga0070704_100002205 | Ga0070704_10000220512 | 120 |
| 536 | 3300005549 | Ga0070704_100085804 | Ga0070704_1000858042 | 120 |
| 537 | 3300005563 | Ga0068855_100059672 | Ga0068855_1000596724 | 120 |
| 538 | 3300005614 | Ga0068856_100163161 | Ga0068856_1001631612 | 120 |
| 539 | 3300005615 | Ga0070702_100000209 | Ga0070702_10000020912 | 120 |
| 540 | 3300005615 | Ga0070702_100726630 | Ga0070702_1007266302 | 120 |
| 541 | 3300005616 | Ga0068852_100162082 | Ga0068852_1001620823 | 120 |
| 542 | 3300005617 | Ga0068859_100055748 | Ga0068859_1000557483 | 120 |
| 543 | 3300005617 | Ga0068859_100927463 | Ga0068859_1009274632 | 120 |
| 544 | 3300005718 | Ga0068866_10007307 | Ga0068866_100073073 | 120 |
| 545 | 3300005718 | Ga0068866_11288964 | Ga0068866_112889641 | 120 |
| 546 | 3300005719 | Ga0068861_100000746 | Ga0068861_10000074613 | 120 |
| 547 | 3300005841 | Ga0068863_100351831 | Ga0068863_1003518313 | 120 |
| 548 | 3300005841 | Ga0068863_100407798 | Ga0068863_1004077982 | 120 |
| 549 | 3300005842 | Ga0068858_100023114 | Ga0068858_1000231143 | 120 |
| 550 | 3300005842 | Ga0068858_100654321 | Ga0068858_1006543212 | 120 |
| 551 | 3300005843 | Ga0068860_100024979 | Ga0068860_1000249793 | 120 |
| 552 | 3300005843 | Ga0068860_100468850 | Ga0068860_1004688502 | 120 |
| 553 | 3300005843 | Ga0068860_100713821 | Ga0068860_1007138212 | 120 |
| 554 | 3300005844 | Ga0068862_100003396 | Ga0068862_1000033964 | 120 |
| 555 | 3300005937 | Ga0081455_10710497 | Ga0081455_107104972 | 120 |
| 556 | 3300006058 | Ga0075432_10020862 | Ga0075432_100208623 | 120 |
| 557 | 3300006358 | Ga0068871_100000265 | Ga0068871_10000026529 | 120 |
| 558 | 3300006846 | Ga0075430_100346061 | Ga0075430_1003460612 | 120 |
| 559 | 3300006846 | Ga0075430_100449329 | Ga0075430_1004493292 | 120 |
| 560 | 3300006847 | Ga0075431_100452844 | Ga0075431_1004528443 | 120 |
| 561 | 3300006852 | Ga0075433_10080211 | Ga0075433_100802114 | 120 |
| 562 | 3300006871 | Ga0075434_101611108 | Ga0075434_1016111082 | 120 |
| 563 | 3300006880 | Ga0075429_100150996 | Ga0075429_1001509963 | 120 |
| 564 | 3300006881 | Ga0068865_100005335 | Ga0068865_1000053358 | 120 |
| 565 | 3300006914 | Ga0075436_100716065 | Ga0075436_1007160652 | 120 |
| 566 | 3300006931 | Ga0097620_100055750 | Ga0097620_1000557503 | 120 |
| 567 | 3300006931 | Ga0097620_100927291 | Ga0097620_1009272912 | 120 |
| 568 | 3300007076 | Ga0075435_100062450 | Ga0075435_1000624504 | 120 |
| 569 | 3300009011 | Ga0105251_10014454 | Ga0105251_100144542 | 120 |
| 570 | 3300009011 | Ga0105251_10019610 | Ga0105251_100196104 | 120 |
| 571 | 3300009011 | Ga0105251_10389383 | Ga0105251_103893832 | 120 |
| 572 | 3300009036 | Ga0105244_10009445 | Ga0105244_100094455 | 120 |
| 573 | 3300009036 | Ga0105244_10014456 | Ga0105244_100144568 | 120 |
| 574 | 3300009036 | Ga0105244_10101817 | Ga0105244_101018172 | 120 |
| 575 | 3300009036 | Ga0105244_10117231 | Ga0105244_101172312 | 120 |
| 576 | 3300009092 | Ga0105250_10026945 | Ga0105250_100269454 | 120 |
| 577 | 3300009092 | Ga0105250_10337231 | Ga0105250_103372312 | 120 |
| 578 | 3300009094 | Ga0111539_10014845 | Ga0111539_100148456 | 120 |
| 579 | 3300009094 | Ga0111539_10142451 | Ga0111539_101424513 | 120 |
| 580 | 3300009094 | Ga0111539_12203934 | Ga0111539_122039342 | 120 |
| 581 | 3300009098 | Ga0105245_10005829 | Ga0105245_1000582910 | 120 |
| 582 | 3300009147 | Ga0114129_10072384 | Ga0114129_100723842 | 120 |
| 583 | 3300009148 | Ga0105243_10005092 | Ga0105243_100050924 | 120 |
| 584 | 3300009148 | Ga0105243_10019708 | Ga0105243_100197083 | 120 |
| 585 | 3300009176 | Ga0105242_10038234 | Ga0105242_100382342 | 120 |
| 586 | 3300009177 | Ga0105248_11535090 | Ga0105248_115350902 | 120 |
| 587 | 3300009545 | Ga0105237_10505299 | Ga0105237_105052992 | 120 |
| 588 | 3300009553 | Ga0105249_10042160 | Ga0105249_100421602 | 120 |
| 589 | 3300010375 | Ga0105239_10326910 | Ga0105239_103269101 | 120 |
| 590 | 3300011119 | Ga0105246_10093339 | Ga0105246_100933392 | 120 |
| 591 | 3300011119 | Ga0105246_10798270 | Ga0105246_107982702 | 120 |
| 592 | 3300013100 | Ga0157373_10008432 | Ga0157373_100084326 | 120 |
| 593 | 3300013102 | Ga0157371_10023810 | Ga0157371_100238105 | 120 |
| 594 | 3300013102 | Ga0157371_10812576 | Ga0157371_108125762 | 120 |
| 595 | 3300013297 | Ga0157378_10037215 | Ga0157378_100372154 | 120 |
| 596 | 3300013297 | Ga0157378_10931639 | Ga0157378_109316391 | 120 |
| 597 | 3300013306 | Ga0163162_10186000 | Ga0163162_101860003 | 120 |
| 598 | 3300013307 | Ga0157372_10042741 | Ga0157372_100427413 | 120 |
| 599 | 3300013308 | Ga0157375_11744037 | Ga0157375_117440372 | 120 |
| 600 | 3300014326 | Ga0157380_10402933 | Ga0157380_104029331 | 120 |
| 601 | 3300014326 | Ga0157380_10653502 | Ga0157380_106535023 | 120 |
| 602 | 3300014497 | Ga0182008_10000606 | Ga0182008_1000060618 | 120 |
| 603 | 3300015261 | Ga0182006_1000514 | Ga0182006_100051423 | 120 |
| 604 | 3300015261 | Ga0182006_1005825 | Ga0182006_10058254 | 120 |
| 605 | 3300017792 | Ga0163161_10385551 | Ga0163161_103855512 | 120 |
| 606 | 3300017792 | Ga0163161_10908721 | Ga0163161_109087212 | 120 |
| 607 | 3300017792 | Ga0163161_11033971 | Ga0163161_110339712 | 120 |
| 608 | 3300021388 | Ga0213875_10005863 | Ga0213875_100058632 | 120 |
| 609 | 3300025304 | Ga0209257_1000667 | Ga0209257_100066741 | 120 |
| 610 | 3300025711 | Ga0207696_1000016 | Ga0207696_1000016104 | 120 |
| 611 | 3300025711 | Ga0207696_1011087 | Ga0207696_10110873 | 120 |
| 612 | 3300025711 | Ga0207696_1012952 | Ga0207696_10129523 | 120 |
| 613 | 3300025711 | Ga0207696_1055275 | Ga0207696_10552752 | 120 |
| 614 | 3300025728 | Ga0207655_1000313 | Ga0207655_100031347 | 120 |
| 615 | 3300025728 | Ga0207655_1019247 | Ga0207655_10192475 | 120 |
| 616 | 3300025728 | Ga0207655_1030657 | Ga0207655_10306574 | 120 |
| 617 | 3300025728 | Ga0207655_1038800 | Ga0207655_10388003 | 120 |
| 618 | 3300025735 | Ga0207713_1001307 | Ga0207713_100130716 | 120 |
| 619 | 3300025735 | Ga0207713_1041648 | Ga0207713_10416483 | 120 |
| 620 | 3300025901 | Ga0207688_10150306 | Ga0207688_101503062 | 120 |
| 621 | 3300025908 | Ga0207643_10018663 | Ga0207643_100186632 | 120 |
| 622 | 3300025908 | Ga0207643_10833334 | Ga0207643_108333342 | 120 |
| 623 | 3300025911 | Ga0207654_10105205 | Ga0207654_101052053 | 120 |
| 624 | 3300025914 | Ga0207671_11020662 | Ga0207671_110206622 | 120 |
| 625 | 3300025917 | Ga0207660_10001221 | Ga0207660_100012214 | 120 |
| 626 | 3300025918 | Ga0207662_10000423 | Ga0207662_1000042312 | 120 |
| 627 | 3300025921 | Ga0207652_10268857 | Ga0207652_102688572 | 120 |
| 628 | 3300025923 | Ga0207681_10075225 | Ga0207681_100752253 | 120 |
| 629 | 3300025926 | Ga0207659_10036471 | Ga0207659_100364712 | 120 |
| 630 | 3300025927 | Ga0207687_10013843 | Ga0207687_100138434 | 120 |
| 631 | 3300025934 | Ga0207686_10008653 | Ga0207686_100086533 | 120 |
| 632 | 3300025935 | Ga0207709_10008014 | Ga0207709_100080144 | 120 |
| 633 | 3300025935 | Ga0207709_10013634 | Ga0207709_100136344 | 120 |
| 634 | 3300025936 | Ga0207670_10003051 | Ga0207670_100030519 | 120 |
| 635 | 3300025936 | Ga0207670_10436945 | Ga0207670_104369452 | 120 |
| 636 | 3300025936 | Ga0207670_11078563 | Ga0207670_110785631 | 120 |
| 637 | 3300025938 | Ga0207704_10020249 | Ga0207704_100202493 | 120 |
| 638 | 3300025942 | Ga0207689_10001695 | Ga0207689_100016954 | 120 |
| 639 | 3300025949 | Ga0207667_10082522 | Ga0207667_100825224 | 120 |
| 640 | 3300025960 | Ga0207651_11463435 | Ga0207651_114634351 | 120 |
| 641 | 3300025961 | Ga0207712_10148663 | Ga0207712_101486632 | 120 |
| 642 | 3300025986 | Ga0207658_10712636 | Ga0207658_107126362 | 120 |
| 643 | 3300026023 | Ga0207677_10035893 | Ga0207677_100358933 | 120 |
| 644 | 3300026035 | Ga0207703_10021294 | Ga0207703_100212945 | 120 |
| 645 | 3300026075 | Ga0207708_10000723 | Ga0207708_1000072312 | 120 |
| 646 | 3300026078 | Ga0207702_10441849 | Ga0207702_104418492 | 120 |
| 647 | 3300026078 | Ga0207702_12010906 | Ga0207702_120109061 | 120 |
| 648 | 3300026088 | Ga0207641_10303541 | Ga0207641_103035412 | 120 |
| 649 | 3300026088 | Ga0207641_10783433 | Ga0207641_107834332 | 120 |
| 650 | 3300026088 | Ga0207641_11603363 | Ga0207641_116033632 | 120 |
| 651 | 3300026089 | Ga0207648_10001968 | Ga0207648_100019685 | 120 |
| 652 | 3300026089 | Ga0207648_10230767 | Ga0207648_102307672 | 120 |
| 653 | 3300026118 | Ga0207675_100001083 | Ga0207675_10000108330 | 120 |
| 654 | 3300026118 | Ga0207675_100122022 | Ga0207675_1001220223 | 120 |
| 655 | 3300026142 | Ga0207698_10186532 | Ga0207698_101865323 | 120 |
| 656 | 3300027312 | Ga0209371_1001932 | Ga0209371_10019329 | 120 |
| 657 | 3300027395 | Ga0209996_1007041 | Ga0209996_10070411 | 120 |
| 658 | 3300027907 | Ga0207428_10166812 | Ga0207428_101668122 | 120 |
| 659 | 3300028379 | Ga0268266_10078103 | Ga0268266_100781035 | 120 |
| 660 | 3300028380 | Ga0268265_10127683 | Ga0268265_101276834 | 120 |
| 661 | 3300028381 | Ga0268264_10018627 | Ga0268264_100186275 | 120 |
| 662 | 3300028381 | Ga0268264_10255159 | Ga0268264_102551593 | 120 |
| 663 | 3300028381 | Ga0268264_10432473 | Ga0268264_104324732 | 120 |
| 664 | 3300028563 | Ga0265319_1015317 | Ga0265319_10153173 | 120 |
| 665 | 3300028577 | Ga0265318_10000771 | Ga0265318_100007718 | 120 |
| 666 | 3300028800 | Ga0265338_10186467 | Ga0265338_101864673 | 120 |
| 667 | 3300030500 | Ga0268256_1001681 | Ga0268256_10016816 | 120 |
| 668 | 3300030760 | Ga0265762_1023803 | Ga0265762_10238032 | 120 |
| 669 | 3300031235 | Ga0265330_10000896 | Ga0265330_1000089617 | 120 |
| 670 | 3300031238 | Ga0265332_10049022 | Ga0265332_100490223 | 120 |
| 671 | 3300031239 | Ga0265328_10006698 | Ga0265328_100066983 | 120 |
| 672 | 3300031240 | Ga0265320_10001966 | Ga0265320_100019664 | 120 |
| 673 | 3300031242 | Ga0265329_10006674 | Ga0265329_100066743 | 120 |
| 674 | 3300031249 | Ga0265339_10182124 | Ga0265339_101821242 | 120 |
| 675 | 3300031250 | Ga0265331_10000655 | Ga0265331_1000065517 | 120 |
| 676 | 3300031344 | Ga0265316_10030113 | Ga0265316_100301135 | 120 |
| 677 | 3300031548 | Ga0307408_101004487 | Ga0307408_1010044872 | 120 |
| 678 | 3300031595 | Ga0265313_10030767 | Ga0265313_100307674 | 120 |
| 679 | 3300031711 | Ga0265314_10011405 | Ga0265314_100114052 | 120 |
| 680 | 3300031712 | Ga0265342_10000610 | Ga0265342_1000061019 | 120 |
| 681 | 3300031824 | Ga0307413_10019524 | Ga0307413_100195245 | 120 |
| 682 | 3300031824 | Ga0307413_10216257 | Ga0307413_102162572 | 120 |
| 683 | 3300031901 | Ga0307406_10464084 | Ga0307406_104640842 | 120 |
| 684 | 3300031903 | Ga0307407_10088339 | Ga0307407_100883392 | 120 |
| 685 | 3300031995 | Ga0307409_100091681 | Ga0307409_1000916814 | 120 |
| 686 | 3300032004 | Ga0307414_10026505 | Ga0307414_100265054 | 120 |
| 687 | 3300032004 | Ga0307414_10144341 | Ga0307414_101443412 | 120 |
| 688 | 3300032005 | Ga0307411_10014298 | Ga0307411_100142983 | 120 |
| 689 | 3300032005 | Ga0307411_10213806 | Ga0307411_102138062 | 120 |
| 690 | 3300035114 | Ga0373939_0350590 | Ga0373939_0350590_47_451 | 120 |
| 691 | 3300035691 | Ga0373931_0001276 | Ga0373931_0001276_64_432 | 120 |
| 692 | 3300036401 | Ga0373937_1046637 | Ga0373937_1046637_27_416 | 120 |
| 693 | 3300037418 | Ga0395900_0222666 | Ga0395900_0222666_539_988 | 120 |
| 694 | 3300038443 | Ga0395901_1723565 | Ga0395901_1723565_64_513 | 120 |
| 695 | 3300041405 | Ga0439438_000751 | Ga0439438_000751_2548_2910 | 120 |
| 696 | 3300041407 | Ga0439447_016764 | Ga0439447_016764_1503_1865 | 120 |
| 697 | 3300041491 | Ga0451833_1294998 | Ga0451833_1294998_313_693 | 120 |
| 698 | 3300042006 | Ga0439432_000509 | Ga0439432_000509_7526_7888 | 120 |
| 699 | 3300042137 | Ga0450902_000571 | Ga0450902_000571_1613_1975 | 120 |
| 700 | 3300042437 | Ga0439444_0100719 | Ga0439444_0100719_178_564 | 120 |
| 701 | 3300042439 | Ga0439464_0002073 | Ga0439464_0002073_1532_1894 | 120 |
| 702 | 3300042533 | Ga0450901_001902 | Ga0450901_001902_875_1237 | 120 |
| 703 | 3300045051 | Ga0451576_0279407 | Ga0451576_0279407_638_1012 | 120 |
| 704 | 3300046471 | Ga0495650_0002153 | Ga0495650_0002153_180_542 | 120 |
| 705 | 3300046473 | Ga0495582_0017978 | Ga0495582_0017978_2251_2640 | 120 |
| 706 | 3300046474 | Ga0495605_0119420 | Ga0495605_0119420_50_412 | 120 |
| 707 | 3300046491 | Ga0495584_0176320 | Ga0495584_0176320_517_879 | 120 |
| 708 | 3300046492 | Ga0495585_0000360 | Ga0495585_0000360_43595_43957 | 120 |
| 709 | 3300046500 | Ga0495596_0250524 | Ga0495596_0250524_46_408 | 120 |
| 710 | 3300046507 | Ga0495606_0000136 | Ga0495606_0000136_99567_99929 | 120 |
| 711 | 3300046513 | Ga0495616_0000003 | Ga0495616_0000003_79873_80235 | 120 |
| 712 | 3300046515 | Ga0495620_0000056 | Ga0495620_0000056_79199_79561 | 120 |
| 713 | 3300046519 | Ga0495632_0000021 | Ga0495632_0000021_37897_38259 | 120 |
| 714 | 3300046519 | Ga0495632_0005839 | Ga0495632_0005839_6180_6542 | 120 |
| 715 | 3300046522 | Ga0495643_0000089 | Ga0495643_0000089_52088_52450 | 120 |
| 716 | 3300046522 | Ga0495643_0000253 | Ga0495643_0000253_71138_71500 | 120 |
| 717 | 3300046524 | Ga0495648_0000099 | Ga0495648_0000099_22074_22436 | 120 |
| 718 | 3300046526 | Ga0495666_0294668 | Ga0495666_0294668_63_452 | 120 |
| 719 | 3300046529 | Ga0495652_0594725 | Ga0495652_0594725_261_653 | 120 |
| 720 | 3300046535 | Ga0495586_0051168 | Ga0495586_0051168_176_565 | 120 |
| 721 | 3300046537 | Ga0495598_0072367 | Ga0495598_0072367_229_597 | 120 |
| 722 | 3300046615 | Ga0495656_0358119 | Ga0495656_0358119_335_742 | 120 |
| 723 | 3300046663 | Ga0495635_0107240 | Ga0495635_0107240_285_674 | 120 |
| 724 | 3300046683 | Ga0495658_0131201 | Ga0495658_0131201_1003_1392 | 120 |
| 725 | 3300046691 | Ga0495670_0002391 | Ga0495670_0002391_7944_8306 | 120 |
| 726 | 3300047323 | Ga0495683_0000699 | Ga0495683_0000699_3150_3512 | 120 |
| 727 | 3300047472 | Ga0495686_0044498 | Ga0495686_0044498_1130_1492 | 120 |
| 728 | 3300048904 | Ga0496101_0302886 | Ga0496101_0302886_677_1042 | 120 |
| 729 | 3300048907 | Ga0496104_0228478 | Ga0496104_0228478_1018_1383 | 120 |
| 730 | 3300048911 | Ga0496108_0501209 | Ga0496108_0501209_262_624 | 120 |
| 731 | 3300048912 | Ga0496109_0253331 | Ga0496109_0253331_467_832 | 120 |
| 732 | 3300048913 | Ga0496110_0160330 | Ga0496110_0160330_1316_1681 | 120 |
| 733 | 3300048917 | Ga0496114_0014021 | Ga0496114_0014021_5461_5823 | 120 |
| 734 | 3300048917 | Ga0496114_0038019 | Ga0496114_0038019_2221_2586 | 120 |
| 735 | 3300048919 | Ga0496116_0042110 | Ga0496116_0042110_276_638 | 120 |
| 736 | 3300048920 | Ga0496117_0000406 | Ga0496117_0000406_20848_21210 | 120 |
| 737 | 3300048920 | Ga0496117_0000922 | Ga0496117_0000922_42481_42843 | 120 |
| 738 | 3300048921 | Ga0496118_0000979 | Ga0496118_0000979_32239_32601 | 120 |
| 739 | 3300048924 | Ga0496121_0001227 | Ga0496121_0001227_7365_7727 | 120 |
| 740 | 3300048924 | Ga0496121_0015234 | Ga0496121_0015234_5417_5779 | 120 |
| 741 | 3300048925 | Ga0496122_0000402 | Ga0496122_0000402_42471_42833 | 120 |
| 742 | 3300048925 | Ga0496122_0002059 | Ga0496122_0002059_19979_20341 | 120 |
| 743 | 3300048926 | Ga0496123_0000028 | Ga0496123_0000028_284096_284458 | 120 |
| 744 | 3300048926 | Ga0496123_0002356 | Ga0496123_0002356_19303_19665 | 120 |
| 745 | 3300048927 | Ga0496124_0000980 | Ga0496124_0000980_22298_22660 | 120 |
| 746 | 3300048927 | Ga0496124_0014069 | Ga0496124_0014069_5488_5850 | 120 |
| 747 | 3300048927 | Ga0496124_0023343 | Ga0496124_0023343_4270_4632 | 120 |
| 748 | 3300048927 | Ga0496124_0040363 | Ga0496124_0040363_1044_1406 | 120 |
| 749 | 3300048927 | Ga0496124_0060414 | Ga0496124_0060414_154_516 | 120 |
| 750 | 3300048928 | Ga0496125_0037358 | Ga0496125_0037358_2114_2476 | 120 |
| 751 | 3300048928 | Ga0496125_0166210 | Ga0496125_0166210_1005_1367 | 120 |
| 752 | 3300048929 | Ga0496126_0005909 | Ga0496126_0005909_5672_6034 | 120 |
| 753 | 3300049569 | Ga0501032_0013265 | Ga0501032_0013265_5252_5647 | 120 |
| 754 | 3300049570 | Ga0501033_0153844 | Ga0501033_0153844_654_1049 | 120 |
| 755 | 3300049571 | Ga0501034_0100813 | Ga0501034_0100813_1504_1899 | 120 |
| 756 | 3300049572 | Ga0501036_0626113 | Ga0501036_0626113_395_790 | 120 |
| 757 | 3300049576 | Ga0501040_0202491 | Ga0501040_0202491_782_1147 | 120 |
| 758 | 3300049577 | Ga0501041_0797546 | Ga0501041_0797546_146_535 | 120 |
| 759 | 3300049579 | Ga0501043_0120008 | Ga0501043_0120008_256_651 | 120 |
| 760 | 3300049581 | Ga0501047_0001904 | Ga0501047_0001904_14721_15116 | 120 |
| 761 | 3300049581 | Ga0501047_0757387 | Ga0501047_0757387_69_485 | 120 |
| 762 | 3300049583 | Ga0501067_0545468 | Ga0501067_0545468_173_574 | 120 |
| 763 | 3300049586 | Ga0501070_0285265 | Ga0501070_0285265_55_450 | 120 |
| 764 | 3300049587 | Ga0501071_1273361 | Ga0501071_1273361_100_483 | 120 |
| 765 | 3300049591 | Ga0501075_0336739 | Ga0501075_0336739_501_893 | 120 |
| 766 | 3300049683 | Ga0501253_185234 | Ga0501253_185234_125_490 | 120 |
| 767 | 3300049741 | Ga0501079_0404459 | Ga0501079_0404459_262_651 | 120 |
| 768 | 3300049741 | Ga0501079_1001337 | Ga0501079_1001337_95_484 | 120 |
| 769 | 3300049822 | Ga0501035_0007192 | Ga0501035_0007192_3343_3738 | 120 |
| 770 | 3300049823 | Ga0501044_0012908 | Ga0501044_0012908_3349_3744 | 120 |
| 771 | 3300050493 | nmdc:mga0k408_573943_c1 | nmdc:mga0k408_573943_c1_209_598 | 120 |
| 772 | 3300050507 | nmdc:mga05p37_86115_c1 | nmdc:mga05p37_86115_c1_1568_1960 | 120 |
| 773 | 3300050508 | nmdc:mga09592_455849_c1 | nmdc:mga09592_455849_c1_700_1092 | 120 |
| 774 | 3300050509 | nmdc:mga0qj67_388933_c1 | nmdc:mga0qj67_388933_c1_128_511 | 120 |
| 775 | 3300050509 | nmdc:mga0qj67_576570_c1 | nmdc:mga0qj67_576570_c1_268_654 | 120 |
| 776 | 3300050510 | nmdc:mga06r32_101696_c1 | nmdc:mga06r32_101696_c1_1545_1937 | 120 |
| 777 | 3300050511 | nmdc:mga08y16_54122_c1 | nmdc:mga08y16_54122_c1_2859_3224 | 120 |
| 778 | 3300050511 | nmdc:mga08y16_54504_c1 | nmdc:mga08y16_54504_c1_1201_1575 | 120 |
| 779 | 3300050512 | nmdc:mga0n895_25744_c1 | nmdc:mga0n895_25744_c1_2168_2560 | 120 |
| 780 | 3300050512 | nmdc:mga0n895_316353_c1 | nmdc:mga0n895_316353_c1_333_722 | 120 |
| 781 | 3300050513 | nmdc:mga0rr50_169509_c1 | nmdc:mga0rr50_169509_c1_365_757 | 120 |
| 782 | 3300050515 | nmdc:mga0a205_10339_c1 | nmdc:mga0a205_10339_c1_7655_8044 | 120 |
| 783 | 3300053085 | Ga0495619_1171006 | Ga0495619_1171006_73_465 | 120 |
| 784 | 3300060346 | Ga0587111_0026998 | Ga0587111_0026998_76_492 | 120 |
| 785 | 3300060353 | Ga0501082_0887357 | Ga0501082_0887357_354_737 | 120 |
| 786 | 3300061734 | Ga0530510_0942845 | Ga0530510_0942845_17_400 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qcm-assembly1.cif.gz_d | cryo em structure of the listeria stressosome | 0.9338 | 2 | 118 |
| 6jhk-assembly1.cif.gz_A | crystal structure of bacillus subtilis rsbs | 0.9272 | 2 | 116 |
| 6qcm-assembly1.cif.gz_d | cryo em structure of the listeria stressosome | 0.919 | 2 | 118 |
| 6jhk-assembly1.cif.gz_A | crystal structure of bacillus subtilis rsbs | 0.9122 | 2 | 116 |
| 6qcm-assembly1.cif.gz_I | cryo em structure of the listeria stressosome | 0.8987 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vy9B00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8864 | 5 | 117 | 3.30.750.24 |
| 2vy9B00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8719 | 5 | 117 | 3.30.750.24 |
| af_G5EDS5_481_631_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8456 | 11 | 115 | 3.30.750.24 |
| af_I1MIF4_33_222_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8439 | 12 | 50 | 3.60.21.10 |
| af_B0V3V8_450_565_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8431 | 3 | 115 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U9EZI3-F1-model_v4 | deleted | 1 | 2 | 119 |
|
| AF-A0A4Y5WCN6-F1-model_v4 | deleted | 1 | 1 | 119 |
|
| AF-A0A4Q3YJ11-F1-model_v4 | STAS domain-containing protein | 0.9998 | 1 | 102 |
|
| AF-A0A679HEX1-F1-model_v4 | Antagonist of RsbT | 0.9997 | 1 | 119 |
|
| AF-A0A0S1Y3K6-F1-model_v4 | Anti-anti-sigma factor | 0.9991 | 1 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar