F480794

General Info

Members Datasets Scaffolds Average Seq Length
786 440 784 126

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0222666|Ga0395900_0222666_539_988
Length 149
Sequence MDRIPILRMGPYLLVTIQVDMHDRLALALQDDLTALIARTGSKGVLIDISSLDLVDSFIGRMLVNIAQMSRILDARTVVVGMRPAVAITLVELGMSLTGVQTALNVERGMDLLRRALADDLAANGTTGSDEKDDDGTLPGAPADAGHAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
3 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
244 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
247 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
262 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
263 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
264 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
265 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
268 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
271 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
272 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
273 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
274 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
275 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
276 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
277 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
285 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
334 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
335 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
336 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
337 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
338 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
339 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
340 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
341 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
342 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
343 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
366 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
367 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
368 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
369 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
370 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
371 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
372 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
373 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
374 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
375 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
376 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
377 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
378 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
379 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
380 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
381 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
382 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
383 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
384 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
385 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
386 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
387 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
388 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
389 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
390 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
391 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
392 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
393 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
394 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
395 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
396 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
397 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
398 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
399 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
400 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
401 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
402 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
403 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
407 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
408 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
409 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
410 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
411 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
412 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
413 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
414 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
415 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
416 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
421 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
422 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
434 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.89
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.53
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1452750 2162886007 Bacteria 2280
2 SwRhRL2b_contig_1758738 2162886007 Bacteria 1451
3 SwRhRL2b_contig_219822 2162886007 Bacteria 8461
4 JGI26145J50221_1001594 3300003371 Bacteria 1790
5 Ga0058692_1006450 3300003856 Bacteria 3218
6 Ga0058863_11260821 3300004799 Bacteria 782
7 Ga0058861_10845447 3300004800 Bacteria 806
8 Ga0058862_12756080 3300004803 Bacteria 2046
9 Ga0065714_10434882 3300005288 Bacteria 564
10 Ga0065704_10010704 3300005289 Bacteria 2065
11 Ga0065704_10072434 3300005289 Bacteria 8532
12 Ga0065712_10448217 3300005290 Bacteria 688
13 Ga0065712_10452219 3300005290 Bacteria 685
14 Ga0065715_10404665 3300005293 Bacteria 877
15 Ga0065715_10413971 3300005293 Bacteria 866
16 Ga0065715_10609137 3300005293 Bacteria 702
17 Ga0065707_10096924 3300005295 Bacteria 3221
18 Ga0070676_10066165 3300005328 Bacteria 2159
19 Ga0070676_10476046 3300005328 Bacteria 882
20 Ga0070683_100093720 3300005329 Bacteria 2822
21 Ga0070690_100000841 3300005330 Bacteria 15569
22 Ga0070690_100000912 3300005330 Bacteria 15074
23 Ga0070690_100131949 3300005330 Bacteria 1688
24 Ga0070690_100379658 3300005330 Bacteria 1033
25 Ga0070670_100013378 3300005331 Bacteria 7029
26 Ga0070670_100195057 3300005331 Bacteria 1759
27 Ga0070670_100817275 3300005331 Bacteria 842
28 Ga0070677_10022397 3300005333 Bacteria 2326
29 Ga0068869_100000727 3300005334 Bacteria 18759
30 Ga0068869_100014841 3300005334 Bacteria 5208
31 Ga0068869_100473215 3300005334 Bacteria 1042
32 Ga0068869_100550442 3300005334 Bacteria 969
33 Ga0068869_100721555 3300005334 Bacteria 851
34 Ga0070666_10055827 3300005335 Bacteria 2666
35 Ga0070680_100009718 3300005336 Bacteria 7402
36 Ga0070680_100175434 3300005336 Bacteria 1804
37 Ga0070682_100027537 3300005337 Bacteria 3411
38 Ga0070682_100059173 3300005337 Bacteria 2419
39 Ga0070682_100531001 3300005337 Bacteria 917
40 Ga0068868_100104320 3300005338 Bacteria 2297
41 Ga0068868_100517867 3300005338 Bacteria 1047
42 Ga0070660_100009427 3300005339 Bacteria 6865
43 Ga0070689_100004042 3300005340 Bacteria 9869
44 Ga0070689_100008310 3300005340 Bacteria 7307
45 Ga0070689_100051706 3300005340 Bacteria 3176
46 Ga0070689_100946943 3300005340 Bacteria 764
47 Ga0070691_10014047 3300005341 Bacteria 3673
48 Ga0070691_10132523 3300005341 Bacteria 1264
49 Ga0070691_10152136 3300005341 Bacteria 1187
50 Ga0070691_10871928 3300005341 Bacteria 553
51 Ga0070687_100009907 3300005343 Bacteria 4097
52 Ga0070687_100015720 3300005343 Bacteria 3430
53 Ga0070687_100895258 3300005343 Bacteria 636
54 Ga0070661_100025052 3300005344 Bacteria 4284
55 Ga0070692_10006374 3300005345 Bacteria 5121
56 Ga0070692_10012469 3300005345 Bacteria 3936
57 Ga0070692_10077452 3300005345 Bacteria 1784
58 Ga0070692_10581755 3300005345 Bacteria 738
59 Ga0070668_100085257 3300005347 Bacteria 2482
60 Ga0070668_100297458 3300005347 Bacteria 1353
61 Ga0070669_100026033 3300005353 Bacteria 4207
62 Ga0070669_100112903 3300005353 Bacteria 2064
63 Ga0070669_100272185 3300005353 Bacteria 1355
64 Ga0070675_100123596 3300005354 Bacteria 2200
65 Ga0070675_100147866 3300005354 Bacteria 2013
66 Ga0070675_100374112 3300005354 Bacteria 1267
67 Ga0070675_102179023 3300005354 Bacteria 511
68 Ga0070671_100779866 3300005355 Bacteria 832
69 Ga0070674_100084892 3300005356 Bacteria 2271
70 Ga0070673_100120125 3300005364 Bacteria 2191
71 Ga0070673_100133352 3300005364 Bacteria 2087
72 Ga0070673_100155156 3300005364 Bacteria 1942
73 Ga0070673_101318465 3300005364 Bacteria 678
74 Ga0070688_100018522 3300005365 Bacteria 4019
75 Ga0070688_100036061 3300005365 Bacteria 3007
76 Ga0070688_100207912 3300005365 Bacteria 1373
77 Ga0070688_100302557 3300005365 Bacteria 1156
78 Ga0070688_100532455 3300005365 Bacteria 891
79 Ga0070688_100943003 3300005365 Bacteria 683
80 Ga0070659_100080685 3300005366 Bacteria 2597
81 Ga0070667_100198207 3300005367 Bacteria 1781
82 Ga0070667_100222995 3300005367 Bacteria 1679
83 Ga0070667_101041964 3300005367 Bacteria 764
84 Ga0070703_10137711 3300005406 Bacteria 904
85 Ga0070713_100064777 3300005436 Bacteria 3068
86 Ga0070710_10610706 3300005437 Bacteria 760
87 Ga0070701_10003790 3300005438 Bacteria 6041
88 Ga0070701_10008347 3300005438 Bacteria 4476
89 Ga0070701_10055474 3300005438 Bacteria 2070
90 Ga0070701_10580358 3300005438 Bacteria 740
91 Ga0070701_10639329 3300005438 Bacteria 709
92 Ga0070711_100150709 3300005439 Bacteria 1753
93 Ga0070705_100000565 3300005440 Bacteria 21451
94 Ga0070705_100648925 3300005440 Bacteria 823
95 Ga0070705_101642539 3300005440 Bacteria 542
96 Ga0070700_100000322 3300005441 Bacteria 25019
97 Ga0070700_100009240 3300005441 Bacteria 5404
98 Ga0070700_100049482 3300005441 Bacteria 2610
99 Ga0070694_100001696 3300005444 Bacteria 12967
100 Ga0070694_100003006 3300005444 Bacteria 10033
101 Ga0070694_100200565 3300005444 Bacteria 1487
102 Ga0070708_100089835 3300005445 Bacteria 2796
103 Ga0070678_100009084 3300005456 Bacteria 5994
104 Ga0070662_100092236 3300005457 Bacteria 2276
105 Ga0070681_10095270 3300005458 Bacteria 2925
106 Ga0068867_100000640 3300005459 Bacteria 23146
107 Ga0068867_100001065 3300005459 Bacteria 18727
108 Ga0068867_101683612 3300005459 Bacteria 594
109 Ga0070685_10339001 3300005466 Bacteria 1024
110 Ga0070685_10352270 3300005466 Bacteria 1007
111 Ga0070706_100405856 3300005467 Bacteria 1269
112 Ga0070707_100538928 3300005468 Bacteria 1129
113 Ga0070699_100266336 3300005518 Bacteria 1533
114 Ga0070699_100365096 3300005518 Bacteria 1302
115 Ga0070679_100034021 3300005530 Bacteria 5048
116 Ga0070679_100227553 3300005530 Bacteria 1825
117 Ga0070679_102017815 3300005530 Bacteria 526
118 Ga0070684_100467157 3300005535 Bacteria 1167
119 Ga0070684_101060586 3300005535 Bacteria 761
120 Ga0070684_101547979 3300005535 Bacteria 625
121 Ga0070672_100011126 3300005543 Bacteria 6267
122 Ga0070672_100311781 3300005543 Bacteria 1336
123 Ga0070672_100987555 3300005543 Bacteria 746
124 Ga0070672_101814911 3300005543 Bacteria 548
125 Ga0070686_100002616 3300005544 Bacteria 9929
126 Ga0070686_100004998 3300005544 Bacteria 7319
127 Ga0070686_101079135 3300005544 Bacteria 662
128 Ga0070695_100029658 3300005545 Bacteria 3400
129 Ga0070695_100034853 3300005545 Bacteria 3159
130 Ga0070695_100141700 3300005545 Bacteria 1668
131 Ga0070695_100180466 3300005545 Bacteria 1495
132 Ga0070695_100743022 3300005545 Bacteria 782
133 Ga0070696_100000527 3300005546 Bacteria 24255
134 Ga0070696_100166378 3300005546 Bacteria 1627
135 Ga0070696_100276689 3300005546 Bacteria 1278
136 Ga0070696_100570797 3300005546 Bacteria 909
137 Ga0070696_100937961 3300005546 Bacteria 720
138 Ga0070693_100000145 3300005547 Bacteria 32140
139 Ga0070693_100028320 3300005547 Bacteria 3045
140 Ga0070693_100082655 3300005547 Bacteria 1918
141 Ga0070665_100054089 3300005548 Bacteria 4026
142 Ga0070704_100002205 3300005549 Bacteria 10857
143 Ga0070704_100085804 3300005549 Bacteria 2331
144 Ga0070704_100384651 3300005549 Bacteria 1193
145 Ga0068855_100019512 3300005563 Bacteria 8147
146 Ga0068855_100059672 3300005563 Bacteria 4463
147 Ga0068855_100710056 3300005563 Bacteria 1075
148 Ga0070664_100085618 3300005564 Bacteria 2722
149 Ga0068857_100061866 3300005577 Bacteria 3326
150 Ga0068854_100014453 3300005578 Bacteria 5205
151 Ga0068854_100077746 3300005578 Bacteria 2443
152 Ga0068856_100163161 3300005614 Bacteria 2240
153 Ga0068856_100264168 3300005614 Bacteria 1737
154 Ga0070702_100000209 3300005615 Bacteria 19373
155 Ga0070702_100002869 3300005615 Bacteria 7570
156 Ga0070702_100519580 3300005615 Bacteria 878
157 Ga0070702_100726630 3300005615 Bacteria 760
158 Ga0068852_100126479 3300005616 Bacteria 2348
159 Ga0068852_100162082 3300005616 Bacteria 2089
160 Ga0068859_100055748 3300005617 Bacteria 3977
161 Ga0068859_100927463 3300005617 Bacteria 955
162 Ga0068859_101209887 3300005617 Bacteria 832
163 Ga0068864_100130522 3300005618 Bacteria 2257
164 Ga0068864_101447387 3300005618 Bacteria 689
165 Ga0068866_10007307 3300005718 Bacteria 4623
166 Ga0068866_11228962 3300005718 Bacteria 542
167 Ga0068866_11288964 3300005718 Bacteria 530
168 Ga0068861_100000746 3300005719 Bacteria 19514
169 Ga0068861_100035360 3300005719 Bacteria 3700
170 Ga0068861_100158121 3300005719 Bacteria 1867
171 Ga0068861_100183372 3300005719 Bacteria 1744
172 Ga0068870_10018454 3300005840 Bacteria 3370
173 Ga0068870_10100206 3300005840 Bacteria 1636
174 Ga0068863_100098429 3300005841 Bacteria 2778
175 Ga0068863_100351831 3300005841 Bacteria 1435
176 Ga0068863_100407798 3300005841 Bacteria 1330
177 Ga0068858_100023114 3300005842 Bacteria 5798
178 Ga0068858_100654321 3300005842 Bacteria 1021
179 Ga0068858_101314921 3300005842 Bacteria 712
180 Ga0068858_101944144 3300005842 Bacteria 581
181 Ga0068860_100024979 3300005843 Bacteria 5769
182 Ga0068860_100085596 3300005843 Bacteria 3000
183 Ga0068860_100091198 3300005843 Bacteria 2903
184 Ga0068860_100257177 3300005843 Bacteria 1701
185 Ga0068860_100402208 3300005843 Bacteria 1355
186 Ga0068860_100468850 3300005843 Bacteria 1254
187 Ga0068860_100713821 3300005843 Bacteria 1013
188 Ga0068862_100003396 3300005844 Bacteria 13729
189 Ga0068862_100164713 3300005844 Bacteria 1981
190 Ga0068862_100227536 3300005844 Bacteria 1691
191 Ga0068862_100739470 3300005844 Bacteria 956
192 Ga0081455_10000014 3300005937 Bacteria 193884
193 Ga0081455_10318346 3300005937 Bacteria 1109
194 Ga0081455_10710497 3300005937 Bacteria 639
195 Ga0081540_1000035 3300005983 Bacteria 141244
196 Ga0081540_1164463 3300005983 Bacteria 855
197 Ga0075432_10017819 3300006058 Bacteria 2422
198 Ga0075432_10020862 3300006058 Bacteria 2241
199 Ga0075432_10041117 3300006058 Bacteria 1614
200 Ga0070715_10152690 3300006163 Bacteria 1133
201 Ga0070712_100690962 3300006175 Unclassified 869
202 Ga0075367_10000273 3300006178 Bacteria 17875
203 Ga0075366_10000559 3300006195 Bacteria 17400
204 Ga0097621_100019760 3300006237 Bacteria 5178
205 Ga0097621_101080363 3300006237 Bacteria 753
206 Ga0097621_101164945 3300006237 Bacteria 725
207 Ga0097621_102027698 3300006237 Bacteria 550
208 Ga0068871_100000265 3300006358 Bacteria 36023
209 Ga0068871_100010679 3300006358 Bacteria 6714
210 Ga0068871_100042629 3300006358 Bacteria 3644
211 Ga0075428_100061825 3300006844 Bacteria 4101
212 Ga0075428_100399920 3300006844 Bacteria 1472
213 Ga0075430_100002517 3300006846 Bacteria 15273
214 Ga0075430_100004374 3300006846 Bacteria 11926
215 Ga0075430_100346061 3300006846 Bacteria 1228
216 Ga0075430_100449329 3300006846 Unclassified 1064
217 Ga0075431_100169405 3300006847 Bacteria 2244
218 Ga0075431_100452844 3300006847 Bacteria 1279
219 Ga0075433_10073049 3300006852 Bacteria 3017
220 Ga0075433_10080211 3300006852 Bacteria 2876
221 Ga0075434_100002404 3300006871 Bacteria 16437
222 Ga0075434_101611108 3300006871 Bacteria 658
223 Ga0075429_100009563 3300006880 Bacteria 8409
224 Ga0075429_100011721 3300006880 Bacteria 7604
225 Ga0075429_100150996 3300006880 Bacteria 2034
226 Ga0068865_100002715 3300006881 Bacteria 10504
227 Ga0068865_100005335 3300006881 Bacteria 7783
228 Ga0075436_100322116 3300006914 Bacteria 1110
229 Ga0075436_100716065 3300006914 Bacteria 742
230 Ga0075436_101054600 3300006914 Bacteria 611
231 Ga0075436_101179654 3300006914 Bacteria 578
232 Ga0097620_100055750 3300006931 Bacteria 3977
233 Ga0097620_100927291 3300006931 Bacteria 955
234 Ga0097620_101209778 3300006931 Bacteria 832
235 Ga0075435_100033993 3300007076 Bacteria 4036
236 Ga0075435_100062450 3300007076 Bacteria 3023
237 Ga0075435_100229410 3300007076 Bacteria 1577
238 Ga0075435_100932607 3300007076 Bacteria 757
239 Ga0105251_10014454 3300009011 Bacteria 4362
240 Ga0105251_10019610 3300009011 Bacteria 3568
241 Ga0105251_10389383 3300009011 Bacteria 640
242 Ga0105244_10009445 3300009036 Bacteria 5993
243 Ga0105244_10014456 3300009036 Bacteria 4563
244 Ga0105244_10101817 3300009036 Bacteria 1404
245 Ga0105244_10117231 3300009036 Bacteria 1292
246 Ga0105250_10026945 3300009092 Bacteria 2316
247 Ga0105250_10337231 3300009092 Bacteria 658
248 Ga0105240_10574510 3300009093 Bacteria 1244
249 Ga0111539_10014845 3300009094 Bacteria 9713
250 Ga0111539_10032830 3300009094 Bacteria 6303
251 Ga0111539_10142451 3300009094 Bacteria 2806
252 Ga0111539_10301307 3300009094 Bacteria 1865
253 Ga0111539_10446584 3300009094 Bacteria 1506
254 Ga0111539_12203934 3300009094 Unclassified 639
255 Ga0105245_10005829 3300009098 Bacteria 10811
256 Ga0105245_10063301 3300009098 Bacteria 3340
257 Ga0105245_10256070 3300009098 Bacteria 1702
258 Ga0105245_11875859 3300009098 Bacteria 652
259 Ga0114129_10036112 3300009147 Bacteria 6980
260 Ga0114129_10072384 3300009147 Bacteria 4805
261 Ga0114129_10127485 3300009147 Bacteria 3498
262 Ga0114129_10496923 3300009147 Bacteria 1594
263 Ga0114129_11102486 3300009147 Unclassified 994
264 Ga0105243_10005092 3300009148 Bacteria 10312
265 Ga0105243_10013050 3300009148 Bacteria 6277
266 Ga0105243_10019708 3300009148 Bacteria 5115
267 Ga0105243_10161143 3300009148 Bacteria 1934
268 Ga0105243_10250509 3300009148 Bacteria 1581
269 Ga0105241_10557634 3300009174 Bacteria 1030
270 Ga0105242_10000974 3300009176 Bacteria 22370
271 Ga0105242_10038234 3300009176 Bacteria 3859
272 Ga0105242_10747006 3300009176 Bacteria 963
273 Ga0105248_10108903 3300009177 Bacteria 3124
274 Ga0105248_11535090 3300009177 Bacteria 754
275 Ga0105248_11559005 3300009177 Bacteria 748
276 Ga0105248_11764697 3300009177 Bacteria 702
277 Ga0105237_10014196 3300009545 Bacteria 8341
278 Ga0105237_10505299 3300009545 Bacteria 1215
279 Ga0105238_10598847 3300009551 Bacteria 1110
280 Ga0105249_10042160 3300009553 Bacteria 4150
281 Ga0105249_10046499 3300009553 Bacteria 3949
282 Ga0105249_10088653 3300009553 Bacteria 2890
283 Ga0105249_10206774 3300009553 Bacteria 1924
284 Ga0105249_10266644 3300009553 Bacteria 1704
285 Ga0105239_10033416 3300010375 Bacteria 5649
286 Ga0105239_10326910 3300010375 Bacteria 1729
287 Ga0105239_10926495 3300010375 Bacteria 1000
288 Ga0105246_10059616 3300011119 Bacteria 2648
289 Ga0105246_10093339 3300011119 Bacteria 2174
290 Ga0105246_10798270 3300011119 Bacteria 837
291 Ga0157344_1008147 3300012476 Bacteria 713
292 Ga0157373_10008432 3300013100 Bacteria 7652
293 Ga0157371_10023810 3300013102 Bacteria 4475
294 Ga0157371_10812576 3300013102 Unclassified 705
295 Ga0157374_10062603 3300013296 Bacteria 3488
296 Ga0157374_10177501 3300013296 Bacteria 2079
297 Ga0157374_10944650 3300013296 Bacteria 881
298 Ga0157378_10037215 3300013297 Bacteria 4309
299 Ga0157378_10084487 3300013297 Bacteria 2874
300 Ga0157378_10097617 3300013297 Bacteria 2678
301 Ga0157378_10931639 3300013297 Bacteria 901
302 Ga0157378_11255945 3300013297 Bacteria 781
303 Ga0163162_10065560 3300013306 Bacteria 3679
304 Ga0163162_10066174 3300013306 Bacteria 3662
305 Ga0163162_10186000 3300013306 Bacteria 2204
306 Ga0157372_10042741 3300013307 Bacteria 5014
307 Ga0157372_12574682 3300013307 Bacteria 584
308 Ga0157375_10034369 3300013308 Bacteria 4830
309 Ga0157375_11744037 3300013308 Bacteria 738
310 Ga0157380_10004274 3300014326 Bacteria 9890
311 Ga0157380_10005455 3300014326 Bacteria 8889
312 Ga0157380_10402933 3300014326 Bacteria 1298
313 Ga0157380_10653502 3300014326 Bacteria 1049
314 Ga0182008_10000606 3300014497 Bacteria 26385
315 Ga0157377_10027050 3300014745 Bacteria 3076
316 Ga0157377_10501661 3300014745 Bacteria 848
317 Ga0157379_12377556 3300014968 Bacteria 529
318 Ga0157376_10021456 3300014969 Bacteria 5016
319 Ga0182006_1000514 3300015261 Bacteria 29491
320 Ga0182006_1005825 3300015261 Bacteria 5806
321 Ga0182007_10282470 3300015262 Bacteria 604
322 Ga0163161_10385551 3300017792 Bacteria 1121
323 Ga0163161_10448816 3300017792 Bacteria 1042
324 Ga0163161_10908721 3300017792 Bacteria 746
325 Ga0163161_11033971 3300017792 Bacteria 703
326 Ga0213875_10005863 3300021388 Bacteria 6531
327 Ga0209257_1000667 3300025304 Bacteria 53711
328 Ga0207696_1000016 3300025711 Bacteria 502467
329 Ga0207696_1011087 3300025711 Bacteria 3266
330 Ga0207696_1012952 3300025711 Bacteria 2930
331 Ga0207696_1055275 3300025711 Bacteria 1127
332 Ga0207655_1000313 3300025728 Bacteria 72258
333 Ga0207655_1019247 3300025728 Bacteria 3579
334 Ga0207655_1030657 3300025728 Bacteria 2496
335 Ga0207655_1038800 3300025728 Bacteria 2076
336 Ga0207713_1001307 3300025735 Bacteria 20453
337 Ga0207713_1041648 3300025735 Bacteria 1914
338 Ga0207653_10130725 3300025885 Bacteria 911
339 Ga0207682_10058689 3300025893 Bacteria 1606
340 Ga0207692_10820360 3300025898 Bacteria 609
341 Ga0207642_10886810 3300025899 Bacteria 571
342 Ga0207688_10150306 3300025901 Bacteria 1375
343 Ga0207647_10477403 3300025904 Bacteria 697
344 Ga0207685_10151598 3300025905 Bacteria 1049
345 Ga0207645_10002494 3300025907 Bacteria 14441
346 Ga0207643_10018663 3300025908 Bacteria 3798
347 Ga0207643_10043896 3300025908 Bacteria 2523
348 Ga0207643_10567577 3300025908 Bacteria 729
349 Ga0207643_10833334 3300025908 Bacteria 598
350 Ga0207705_11213936 3300025909 Bacteria 578
351 Ga0207654_10105205 3300025911 Bacteria 1746
352 Ga0207707_10084572 3300025912 Bacteria 2771
353 Ga0207695_10676349 3300025913 Bacteria 913
354 Ga0207671_11020662 3300025914 Bacteria 651
355 Ga0207693_10764696 3300025915 Unclassified 746
356 Ga0207663_10310026 3300025916 Bacteria 1182
357 Ga0207660_10001221 3300025917 Bacteria 17201
358 Ga0207660_10076104 3300025917 Bacteria 2454
359 Ga0207662_10000423 3300025918 Bacteria 18688
360 Ga0207662_10003710 3300025918 Bacteria 7912
361 Ga0207662_10021258 3300025918 Bacteria 3708
362 Ga0207662_10030264 3300025918 Bacteria 3141
363 Ga0207657_10008353 3300025919 Bacteria 10515
364 Ga0207652_10105989 3300025921 Bacteria 2488
365 Ga0207652_10268857 3300025921 Bacteria 1538
366 Ga0207681_10075225 3300025923 Bacteria 2368
367 Ga0207681_10172716 3300025923 Bacteria 1639
368 Ga0207650_10273991 3300025925 Bacteria 1372
369 Ga0207650_10418426 3300025925 Bacteria 1111
370 Ga0207659_10036471 3300025926 Bacteria 3405
371 Ga0207659_10775405 3300025926 Bacteria 823
372 Ga0207687_10013843 3300025927 Bacteria 5268
373 Ga0207687_10129082 3300025927 Bacteria 1902
374 Ga0207644_10343593 3300025931 Bacteria 1211
375 Ga0207690_10269954 3300025932 Bacteria 1321
376 Ga0207706_10001148 3300025933 Bacteria 26985
377 Ga0207686_10008653 3300025934 Bacteria 5496
378 Ga0207686_10114216 3300025934 Bacteria 1827
379 Ga0207709_10008014 3300025935 Bacteria 5852
380 Ga0207709_10013634 3300025935 Bacteria 4484
381 Ga0207709_10049661 3300025935 Bacteria 2562
382 Ga0207670_10003051 3300025936 Bacteria 8840
383 Ga0207670_10019196 3300025936 Bacteria 4170
384 Ga0207670_10044799 3300025936 Bacteria 2929
385 Ga0207670_10436945 3300025936 Bacteria 1053
386 Ga0207670_11078563 3300025936 Bacteria 677
387 Ga0207669_10095651 3300025937 Bacteria 1947
388 Ga0207704_10004675 3300025938 Bacteria 6276
389 Ga0207704_10020249 3300025938 Bacteria 3515
390 Ga0207691_10001449 3300025940 Bacteria 23639
391 Ga0207691_10302342 3300025940 Bacteria 1374
392 Ga0207711_11381439 3300025941 Bacteria 647
393 Ga0207689_10001695 3300025942 Bacteria 20948
394 Ga0207689_10024748 3300025942 Bacteria 5033
395 Ga0207689_10250377 3300025942 Bacteria 1465
396 Ga0207679_10089597 3300025945 Bacteria 2375
397 Ga0207667_10082522 3300025949 Bacteria 3329
398 Ga0207651_10219416 3300025960 Bacteria 1536
399 Ga0207651_10793102 3300025960 Bacteria 839
400 Ga0207651_11463435 3300025960 Bacteria 615
401 Ga0207712_10148663 3300025961 Bacteria 1807
402 Ga0207712_10179596 3300025961 Bacteria 1661
403 Ga0207712_10820119 3300025961 Bacteria 819
404 Ga0207668_10529297 3300025972 Bacteria 1018
405 Ga0207640_10203306 3300025981 Bacteria 1503
406 Ga0207658_10712636 3300025986 Bacteria 907
407 Ga0207677_10035893 3300026023 Bacteria 3224
408 Ga0207677_11440117 3300026023 Bacteria 635
409 Ga0207703_10021294 3300026035 Bacteria 5076
410 Ga0207703_11636483 3300026035 Bacteria 619
411 Ga0207708_10000723 3300026075 Bacteria 24861
412 Ga0207708_10001206 3300026075 Bacteria 19501
413 Ga0207708_10249774 3300026075 Bacteria 1429
414 Ga0207702_10441849 3300026078 Bacteria 1261
415 Ga0207702_12010906 3300026078 Bacteria 568
416 Ga0207641_10303541 3300026088 Bacteria 1509
417 Ga0207641_10783433 3300026088 Bacteria 943
418 Ga0207641_11227518 3300026088 Bacteria 750
419 Ga0207641_11395639 3300026088 Bacteria 701
420 Ga0207641_11603363 3300026088 Bacteria 653
421 Ga0207648_10000360 3300026089 Bacteria 50174
422 Ga0207648_10001968 3300026089 Bacteria 22433
423 Ga0207648_10230767 3300026089 Bacteria 1646
424 Ga0207676_11213517 3300026095 Bacteria 748
425 Ga0207674_10054686 3300026116 Bacteria 4063
426 Ga0207675_100001083 3300026118 Bacteria 26980
427 Ga0207675_100101252 3300026118 Bacteria 2714
428 Ga0207675_100122022 3300026118 Bacteria 2466
429 Ga0207675_100624129 3300026118 Bacteria 1082
430 Ga0207683_10000388 3300026121 Bacteria 40586
431 Ga0207698_10186532 3300026142 Bacteria 1843
432 Ga0209973_1001725 3300027252 Bacteria 1942
433 Ga0209371_1001932 3300027312 Bacteria 12640
434 Ga0209969_1004681 3300027360 Bacteria 1913
435 Ga0209967_1001076 3300027364 Bacteria 3486
436 Ga0209967_1012878 3300027364 Bacteria 1184
437 Ga0209981_1000799 3300027378 Bacteria 3967
438 Ga0209996_1007041 3300027395 Bacteria 1461
439 Ga0209984_1001317 3300027424 Bacteria 2679
440 Ga0210000_1000038 3300027462 Bacteria 20512
441 Ga0209995_1001259 3300027471 Bacteria 3899
442 Ga0209968_1000031 3300027526 Bacteria 26164
443 Ga0209968_1008208 3300027526 Bacteria 1589
444 Ga0209970_1000862 3300027614 Bacteria 5336
445 Ga0210002_1002423 3300027617 Bacteria 2691
446 Ga0209983_1000273 3300027665 Bacteria 10708
447 Ga0209971_1000385 3300027682 Bacteria 12063
448 Ga0209971_1008425 3300027682 Bacteria 2445
449 Ga0209966_1000274 3300027695 Bacteria 18290
450 Ga0209998_10000112 3300027717 Bacteria 32345
451 Ga0209974_10000092 3300027876 Bacteria 24981
452 Ga0209974_10001027 3300027876 Bacteria 9861
453 Ga0209974_10009396 3300027876 Bacteria 3318
454 Ga0207428_10001527 3300027907 Bacteria 24181
455 Ga0207428_10051835 3300027907 Bacteria 3279
456 Ga0207428_10166812 3300027907 Bacteria 1669
457 Ga0268266_10078103 3300028379 Bacteria 2880
458 Ga0268265_10068276 3300028380 Bacteria 2756
459 Ga0268265_10127683 3300028380 Bacteria 2107
460 Ga0268265_12413783 3300028380 Bacteria 532
461 Ga0268264_10018627 3300028381 Bacteria 5676
462 Ga0268264_10162365 3300028381 Bacteria 2014
463 Ga0268264_10184964 3300028381 Bacteria 1895
464 Ga0268264_10255159 3300028381 Bacteria 1631
465 Ga0268264_10432473 3300028381 Bacteria 1271
466 Ga0265319_1015317 3300028563 Bacteria 2978
467 Ga0265318_10000771 3300028577 Bacteria 21283
468 Ga0265338_10186467 3300028800 Bacteria 1576
469 Ga0268256_1001681 3300030500 Bacteria 12640
470 Ga0265762_1023803 3300030760 Unclassified 1136
471 Ga0265330_10000896 3300031235 Bacteria 18445
472 Ga0265332_10049022 3300031238 Bacteria 1816
473 Ga0265328_10006698 3300031239 Bacteria 4852
474 Ga0265320_10001966 3300031240 Bacteria 14521
475 Ga0265329_10006674 3300031242 Bacteria 4554
476 Ga0265339_10182124 3300031249 Bacteria 1045
477 Ga0265331_10000655 3300031250 Bacteria 29967
478 Ga0265316_10030113 3300031344 Bacteria 4454
479 Ga0307408_100008411 3300031548 Bacteria 6812
480 Ga0307408_101004487 3300031548 Bacteria 769
481 Ga0265313_10030767 3300031595 Bacteria 2759
482 Ga0265314_10011405 3300031711 Bacteria 7341
483 Ga0265342_10000610 3300031712 Bacteria 37712
484 Ga0307405_10140377 3300031731 Bacteria 1683
485 Ga0307413_10019524 3300031824 Bacteria 3584
486 Ga0307413_10216257 3300031824 Bacteria 1396
487 Ga0307413_11576584 3300031824 Bacteria 582
488 Ga0307410_10097913 3300031852 Bacteria 2097
489 Ga0307406_10071061 3300031901 Bacteria 2280
490 Ga0307406_10464084 3300031901 Bacteria 1019
491 Ga0307407_10006292 3300031903 Bacteria 5253
492 Ga0307407_10088339 3300031903 Bacteria 1893
493 Ga0307407_10927120 3300031903 Bacteria 670
494 Ga0307412_10010666 3300031911 Bacteria 5297
495 Ga0307412_10052082 3300031911 Bacteria 2709
496 Ga0307409_100050405 3300031995 Bacteria 3179
497 Ga0307409_100091681 3300031995 Bacteria 2491
498 Ga0307416_100072887 3300032002 Bacteria 2860
499 Ga0307416_101996559 3300032002 Bacteria 683
500 Ga0307414_10026505 3300032004 Bacteria 3731
501 Ga0307414_10144341 3300032004 Bacteria 1868
502 Ga0307414_10597833 3300032004 Bacteria 989
503 Ga0307411_10014298 3300032005 Bacteria 4411
504 Ga0307411_10029920 3300032005 Bacteria 3332
505 Ga0307411_10213806 3300032005 Bacteria 1491
506 Ga0307411_10630716 3300032005 Bacteria 925
507 Ga0307411_10899394 3300032005 Bacteria 786
508 Ga0307411_11594864 3300032005 Bacteria 602
509 Ga0307415_100034162 3300032126 Bacteria 3307
510 Ga0373930_0080034 3300034816 Bacteria 754
511 Ga0373948_0213252 3300034817 Bacteria 508
512 Ga0373959_0053886 3300034820 Bacteria 875
513 Ga0373959_0075131 3300034820 Bacteria 770
514 Ga0373938_0177640 3300034957 Bacteria 580
515 Ga0373928_0063661 3300035084 Bacteria 897
516 Ga0373929_0110454 3300035085 Bacteria 702
517 Ga0373929_0229740 3300035085 Bacteria 531
518 Ga0373940_0022345 3300035088 Bacteria 1625
519 Ga0373951_0015888 3300035091 Bacteria 1697
520 Ga0373952_0006708 3300035092 Bacteria 2136
521 Ga0373932_0087372 3300035112 Bacteria 995
522 Ga0373939_0331949 3300035114 Bacteria 614
523 Ga0373939_0341955 3300035114 Bacteria 607
524 Ga0373939_0350590 3300035114 Bacteria 601
525 Ga0373941_0340983 3300035115 Bacteria 607
526 Ga0373960_0002305 3300035121 Bacteria 4294
527 Ga0373960_0030667 3300035121 Bacteria 1499
528 Ga0373942_0237979 3300035207 Bacteria 615
529 Ga0373961_0017740 3300035241 Bacteria 1851
530 Ga0373962_0028414 3300035242 Bacteria 1517
531 Ga0373962_0052357 3300035242 Bacteria 1179
532 Ga0373962_0315815 3300035242 Bacteria 557
533 Ga0373931_0000271 3300035691 Bacteria 21921
534 Ga0373931_0001276 3300035691 Bacteria 10750
535 Ga0373931_0068073 3300035691 Bacteria 1937
536 Ga0373931_0421059 3300035691 Bacteria 849
537 Ga0373937_1046637 3300036401 Bacteria 765
538 Ga0395900_0222666 3300037418 Bacteria 1901
539 Ga0436364_1122609 3300037853 Bacteria 15757
540 Ga0395901_1723565 3300038443 Bacteria 577
541 Ga0436365_0794265 3300039437 Bacteria 1110
542 Ga0439438_000751 3300041405 Bacteria 14496
543 Ga0439438_023427 3300041405 Bacteria 1702
544 Ga0439439_0007000 3300041406 Bacteria 2626
545 Ga0439447_016764 3300041407 Bacteria 2005
546 Ga0439453_0066402 3300041408 Bacteria 756
547 Ga0439461_0084822 3300041410 Bacteria 752
548 Ga0439465_0238849 3300041413 Bacteria 670
549 Ga0451800_0474703 3300041459 Bacteria 881
550 Ga0451833_1294998 3300041491 Bacteria 969
551 Ga0451853_1226227 3300041512 Bacteria 549
552 Ga0451853_1768691 3300041512 Bacteria 754
553 Ga0439445_0047230 3300042004 Bacteria 1156
554 Ga0439432_000509 3300042006 Bacteria 14437
555 Ga0439450_013307 3300042008 Bacteria 1651
556 Ga0439452_047452 3300042010 Bacteria 993
557 Ga0439463_063861 3300042016 Bacteria 941
558 Ga0450896_050103 3300042133 Bacteria 664
559 Ga0450898_055067 3300042134 Bacteria 775
560 Ga0450902_000571 3300042137 Bacteria 4674
561 Ga0450906_014236 3300042145 Bacteria 1459
562 Ga0439446_0015222 3300042156 Bacteria 2132
563 Ga0439446_0020138 3300042156 Bacteria 1877
564 Ga0450909_053708 3300042185 Bacteria 631
565 Ga0439434_0009729 3300042435 Bacteria 2828
566 Ga0439444_0100719 3300042437 Bacteria 655
567 Ga0439459_0041182 3300042438 Bacteria 982
568 Ga0439464_0002073 3300042439 Bacteria 4882
569 Ga0439464_0046168 3300042439 Bacteria 1252
570 Ga0450901_001902 3300042533 Bacteria 2337
571 Ga0451577_0410776 3300042876 Bacteria 1229
572 Ga0453683_0066523 3300044673 Bacteria 2253
573 Ga0451576_0138060 3300045051 Bacteria 2543
574 Ga0451576_0279407 3300045051 Bacteria 1746
575 Ga0451576_1267515 3300045051 Bacteria 769
576 Ga0495650_0002153 3300046471 Bacteria 16723
577 Ga0495582_0017978 3300046473 Bacteria 3865
578 Ga0495605_0119420 3300046474 Bacteria 1196
579 Ga0495584_0045617 3300046491 Bacteria 2211
580 Ga0495584_0176320 3300046491 Bacteria 1086
581 Ga0495585_0000360 3300046492 Bacteria 44156
582 Ga0495596_0250524 3300046500 Bacteria 687
583 Ga0495606_0000136 3300046507 Bacteria 125611
584 Ga0495616_0000003 3300046513 Bacteria 290178
585 Ga0495620_0000056 3300046515 Bacteria 99298
586 Ga0495632_0000021 3300046519 Bacteria 187363
587 Ga0495632_0005839 3300046519 Bacteria 8057
588 Ga0495637_0129692 3300046520 Bacteria 964
589 Ga0495643_0000089 3300046522 Bacteria 154903
590 Ga0495643_0000253 3300046522 Bacteria 78774
591 Ga0495648_0000099 3300046524 Bacteria 108810
592 Ga0495666_0294668 3300046526 Bacteria 734
593 Ga0495652_0594725 3300046529 Bacteria 755
594 Ga0495586_0051168 3300046535 Bacteria 2236
595 Ga0495598_0072367 3300046537 Bacteria 1088
596 Ga0495656_0358119 3300046615 Bacteria 757
597 Ga0495635_0107240 3300046663 Bacteria 1908
598 Ga0495659_0273974 3300046664 Bacteria 708
599 Ga0495658_0131201 3300046683 Bacteria 1525
600 Ga0495670_0002391 3300046691 Bacteria 9250
601 Ga0495636_0023456 3300047318 Bacteria 2498
602 Ga0495683_0000699 3300047323 Bacteria 24522
603 Ga0495686_0044498 3300047472 Bacteria 2810
604 Ga0496101_0302886 3300048904 Bacteria 1252
605 Ga0496102_1925991 3300048905 Bacteria 508
606 Ga0496104_0228478 3300048907 Bacteria 1773
607 Ga0496106_0407983 3300048909 Bacteria 1092
608 Ga0496108_0501209 3300048911 Bacteria 1060
609 Ga0496109_0253331 3300048912 Bacteria 1658
610 Ga0496110_0160330 3300048913 Bacteria 2039
611 Ga0496114_0014021 3300048917 Bacteria 6425
612 Ga0496114_0038019 3300048917 Bacteria 3982
613 Ga0496114_1122911 3300048917 Bacteria 671
614 Ga0496115_0732921 3300048918 Bacteria 774
615 Ga0496116_0042110 3300048919 Bacteria 3126
616 Ga0496117_0000406 3300048920 Bacteria 72747
617 Ga0496117_0000922 3300048920 Bacteria 44997
618 Ga0496118_0000979 3300048921 Bacteria 44454
619 Ga0496118_0412877 3300048921 Bacteria 697
620 Ga0496121_0001227 3300048924 Bacteria 44616
621 Ga0496121_0015234 3300048924 Bacteria 8078
622 Ga0496122_0000402 3300048925 Bacteria 91833
623 Ga0496122_0002059 3300048925 Bacteria 29837
624 Ga0496123_0000028 3300048926 Bacteria 306006
625 Ga0496123_0002356 3300048926 Bacteria 23697
626 Ga0496124_0000980 3300048927 Bacteria 45395
627 Ga0496124_0014069 3300048927 Bacteria 7759
628 Ga0496124_0023343 3300048927 Bacteria 5648
629 Ga0496124_0040363 3300048927 Bacteria 4038
630 Ga0496124_0060414 3300048927 Bacteria 3179
631 Ga0496125_0037358 3300048928 Bacteria 4223
632 Ga0496125_0166210 3300048928 Bacteria 1490
633 Ga0496126_0005909 3300048929 Bacteria 13804
634 Ga0501309_038759 3300049129 Bacteria 723
635 Ga0501290_000131 3300049513 Bacteria 11636
636 Ga0501291_001237 3300049514 Bacteria 2949
637 Ga0501292_000120 3300049515 Bacteria 13718
638 Ga0501295_000092 3300049518 Bacteria 8888
639 Ga0501296_000127 3300049519 Bacteria 8921
640 Ga0501297_000114 3300049520 Bacteria 8561
641 Ga0501298_000079 3300049521 Bacteria 10753
642 Ga0501299_000526 3300049522 Bacteria 4577
643 Ga0501300_000057 3300049523 Bacteria 15761
644 Ga0501301_001477 3300049524 Bacteria 1487
645 Ga0501303_001069 3300049526 Bacteria 2052
646 Ga0501031_0309712 3300049568 Bacteria 1023
647 Ga0501032_0013265 3300049569 Bacteria 5865
648 Ga0501033_0125025 3300049570 Bacteria 1865
649 Ga0501033_0153844 3300049570 Bacteria 1658
650 Ga0501033_0321886 3300049570 Bacteria 1086
651 Ga0501034_0100813 3300049571 Bacteria 2882
652 Ga0501036_0108830 3300049572 Bacteria 2342
653 Ga0501036_0626113 3300049572 Bacteria 892
654 Ga0501038_1352123 3300049574 Bacteria 513
655 Ga0501039_0029139 3300049575 Bacteria 4251
656 Ga0501039_0701465 3300049575 Bacteria 791
657 Ga0501040_0027774 3300049576 Bacteria 3811
658 Ga0501040_0202491 3300049576 Bacteria 1410
659 Ga0501041_0004008 3300049577 Bacteria 8497
660 Ga0501041_0797546 3300049577 Bacteria 605
661 Ga0501043_0120008 3300049579 Bacteria 2062
662 Ga0501046_0044091 3300049580 Bacteria 3548
663 Ga0501047_0001904 3300049581 Bacteria 20068
664 Ga0501047_0757387 3300049581 Bacteria 787
665 Ga0501048_0385104 3300049582 Bacteria 1001
666 Ga0501048_0536407 3300049582 Bacteria 839
667 Ga0501067_0158293 3300049583 Bacteria 1261
668 Ga0501067_0545468 3300049583 Bacteria 649
669 Ga0501068_0114822 3300049584 Bacteria 1676
670 Ga0501068_0122824 3300049584 Bacteria 1620
671 Ga0501070_0285265 3300049586 Bacteria 1347
672 Ga0501071_0002814 3300049587 Bacteria 10709
673 Ga0501071_0272231 3300049587 Bacteria 1280
674 Ga0501071_1273361 3300049587 Bacteria 568
675 Ga0501072_0029962 3300049588 Bacteria 4253
676 Ga0501075_0064474 3300049591 Bacteria 2763
677 Ga0501075_0336739 3300049591 Bacteria 1150
678 Ga0501075_0409462 3300049591 Bacteria 1034
679 Ga0501076_0344692 3300049592 Bacteria 1223
680 Ga0501077_0014302 3300049593 Bacteria 4985
681 Ga0501198_003564 3300049649 Bacteria 2131
682 Ga0501199_030382 3300049650 Bacteria 664
683 Ga0501201_000857 3300049651 Bacteria 2861
684 Ga0501202_001309 3300049652 Bacteria 3948
685 Ga0501206_000124 3300049653 Bacteria 8152
686 Ga0501207_000985 3300049654 Bacteria 3458
687 Ga0501208_000439 3300049655 Bacteria 3275
688 Ga0501211_006607 3300049658 Bacteria 1145
689 Ga0501214_048667 3300049659 Bacteria 638
690 Ga0501216_000146 3300049660 Bacteria 7366
691 Ga0501217_000519 3300049661 Bacteria 6413
692 Ga0501222_003295 3300049662 Bacteria 2216
693 Ga0501223_004844 3300049663 Bacteria 2858
694 Ga0501224_025307 3300049664 Bacteria 887
695 Ga0501227_010508 3300049665 Bacteria 2008
696 Ga0501228_012159 3300049666 Bacteria 881
697 Ga0501233_026986 3300049668 Bacteria 1272
698 Ga0501235_000237 3300049669 Bacteria 10091
699 Ga0501236_002775 3300049670 Bacteria 2019
700 Ga0501239_000716 3300049672 Bacteria 2665
701 Ga0501242_037795 3300049674 Bacteria 674
702 Ga0501243_000596 3300049675 Bacteria 4875
703 Ga0501246_012500 3300049676 Bacteria 797
704 Ga0501247_001858 3300049677 Bacteria 2123
705 Ga0501248_002300 3300049678 Bacteria 1292
706 Ga0501249_001783 3300049679 Bacteria 4389
707 Ga0501250_009725 3300049680 Bacteria 1089
708 Ga0501251_002117 3300049681 Bacteria 1900
709 Ga0501253_000169 3300049683 Bacteria 4881
710 Ga0501253_185234 3300049683 Bacteria 543
711 Ga0501255_000377 3300049684 Bacteria 2952
712 Ga0501257_001186 3300049686 Bacteria 5337
713 Ga0501258_001337 3300049687 Bacteria 1991
714 Ga0501259_039063 3300049688 Bacteria 927
715 Ga0501261_003666 3300049690 Bacteria 1889
716 Ga0501219_000569 3300049703 Bacteria 5389
717 Ga0501221_000633 3300049704 Bacteria 5639
718 Ga0501225_0000205 3300049705 Bacteria 18620
719 Ga0501234_001096 3300049707 Bacteria 4280
720 Ga0501245_002108 3300049708 Bacteria 2641
721 Ga0501079_0028540 3300049741 Bacteria 4282
722 Ga0501079_0404459 3300049741 Bacteria 1071
723 Ga0501079_1001337 3300049741 Bacteria 658
724 Ga0501083_0385830 3300049744 Bacteria 911
725 Ga0501232_002983 3300049757 Bacteria 1512
726 Ga0501262_018552 3300049759 Bacteria 935
727 Ga0501264_001361 3300049761 Bacteria 2662
728 Ga0501266_000137 3300049763 Bacteria 9182
729 Ga0501270_001294 3300049767 Bacteria 2362
730 Ga0501271_000405 3300049768 Bacteria 3759
731 Ga0501274_003582 3300049771 Bacteria 1257
732 Ga0501279_000411 3300049775 Bacteria 5682
733 Ga0501280_003894 3300049776 Bacteria 2243
734 Ga0501282_001924 3300049778 Bacteria 2287
735 Ga0501283_000409 3300049779 Bacteria 5732
736 Ga0501035_0007192 3300049822 Bacteria 10417
737 Ga0501035_0100668 3300049822 Bacteria 2537
738 Ga0501044_0012908 3300049823 Bacteria 9042
739 Ga0501045_0065327 3300049824 Bacteria 2671
740 Ga0501200_01268 3300049849 Bacteria 954
741 Ga0501212_018549 3300049851 Bacteria 1060
742 Ga0501226_011772 3300049853 Bacteria 969
743 nmdc:mga0k408_573943_c1 3300050493 Bacteria 666
744 nmdc:mga05p37_119342_c1 3300050507 Bacteria 1599
745 nmdc:mga05p37_427717_c1 3300050507 Bacteria 1539
746 nmdc:mga05p37_86115_c1 3300050507 Bacteria 3872
747 nmdc:mga05p37_982328_c1 3300050507 Bacteria 899
748 nmdc:mga09592_164568_c1 3300050508 Bacteria 1917
749 nmdc:mga09592_25127_c1 3300050508 Bacteria 4928
750 nmdc:mga09592_455849_c1 3300050508 Unclassified 1103
751 nmdc:mga0qj67_101485_c1 3300050509 Bacteria 2320
752 nmdc:mga0qj67_171122_c1 3300050509 Bacteria 1764
753 nmdc:mga0qj67_388933_c1 3300050509 Bacteria 1126
754 nmdc:mga0qj67_576570_c1 3300050509 Bacteria 901
755 nmdc:mga06r32_101696_c1 3300050510 Bacteria 2821
756 nmdc:mga06r32_122318_c1 3300050510 Bacteria 2568
757 nmdc:mga08y16_134786_c1 3300050511 Bacteria 2567
758 nmdc:mga08y16_207598_c1 3300050511 Bacteria 2029
759 nmdc:mga08y16_28953_c1 3300050511 Bacteria 5839
760 nmdc:mga08y16_54122_c1 3300050511 Bacteria 4193
761 nmdc:mga08y16_54504_c1 3300050511 Bacteria 4178
762 nmdc:mga08y16_814161_c1 3300050511 Bacteria 926
763 nmdc:mga0n895_137034_c1 3300050512 Bacteria 2475
764 nmdc:mga0n895_2115_c1 3300050512 Bacteria 15326
765 nmdc:mga0n895_25744_c1 3300050512 Bacteria 5563
766 nmdc:mga0n895_316353_c1 3300050512 Bacteria 1582
767 nmdc:mga0rr50_169509_c1 3300050513 Bacteria 1778
768 nmdc:mga0rr50_235042_c1 3300050513 Bacteria 1518
769 nmdc:mga0rr50_30630_c1 3300050513 Bacteria 3811
770 nmdc:mga08x19_730996_c1 3300050514 Bacteria 703
771 nmdc:mga0a205_10339_c1 3300050515 Bacteria 8577
772 nmdc:mga0a205_3719_c1 3300050515 Bacteria 5205
773 nmdc:mga0a205_65443_c1 3300050515 Bacteria 3512
774 nmdc:mga0a205_760876_c1 3300050515 Bacteria 817
775 Ga0495619_1171006 3300053085 Bacteria 510
776 Ga0500616_0030617 3300053153 Bacteria 2954
777 Ga0501084_0021636 3300054114 Bacteria 5362
778 Ga0590075_077401 3300059424 Bacteria 860
779 Ga0587092_135114 3300059512 Bacteria 539
780 Ga0587111_0026998 3300060346 Bacteria 1147
781 Ga0501082_0006364 3300060353 Bacteria 10248
782 Ga0501082_0887357 3300060353 Bacteria 780
783 Ga0530510_0007074 3300061734 Bacteria 7808
784 Ga0530510_0942845 3300061734 Bacteria 660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0007000 Ga0439439_0007000_1369_1788 103
2 3300042156 Ga0439446_0020138 Ga0439446_0020138_54_473 103
3 3300005546 Ga0070696_100276689 Ga0070696_1002766893 104
4 3300015262 Ga0182007_10282470 Ga0182007_102824701 104
5 3300005436 Ga0070713_100064777 Ga0070713_1000647773 108
6 3300005354 Ga0070675_102179023 Ga0070675_1021790231 109
7 3300005331 Ga0070670_100195057 Ga0070670_1001950573 111
8 3300005354 Ga0070675_100374112 Ga0070675_1003741122 111
9 3300005367 Ga0070667_100198207 Ga0070667_1001982073 111
10 3300005618 Ga0068864_100130522 Ga0068864_1001305222 111
11 3300005840 Ga0068870_10100206 Ga0068870_101002062 111
12 3300005841 Ga0068863_100098429 Ga0068863_1000984293 111
13 3300005842 Ga0068858_101944144 Ga0068858_1019441441 111
14 3300005843 Ga0068860_100257177 Ga0068860_1002571772 111
15 3300005844 Ga0068862_100164713 Ga0068862_1001647132 111
16 3300009098 Ga0105245_11875859 Ga0105245_118758591 111
17 3300009177 Ga0105248_10108903 Ga0105248_101089031 111
18 3300009553 Ga0105249_10206774 Ga0105249_102067742 111
19 3300013306 Ga0163162_10065560 Ga0163162_100655603 111
20 3300014968 Ga0157379_12377556 Ga0157379_123775561 111
21 3300025908 Ga0207643_10567577 Ga0207643_105675771 111
22 3300025925 Ga0207650_10418426 Ga0207650_104184262 111
23 3300025961 Ga0207712_10820119 Ga0207712_108201192 111
24 3300026035 Ga0207703_11636483 Ga0207703_116364831 111
25 3300026088 Ga0207641_11395639 Ga0207641_113956392 111
26 3300028381 Ga0268264_10184964 Ga0268264_101849643 111
27 3300032004 Ga0307414_10597833 Ga0307414_105978332 111
28 3300005334 Ga0068869_100721555 Ga0068869_1007215552 112
29 3300006178 Ga0075367_10000273 Ga0075367_1000027313 112
30 3300006195 Ga0075366_10000559 Ga0075366_100005597 112
31 3300010375 Ga0105239_10926495 Ga0105239_109264952 112
32 3300012476 Ga0157344_1008147 Ga0157344_10081472 112
33 3300013297 Ga0157378_10097617 Ga0157378_100976173 112
34 3300025909 Ga0207705_11213936 Ga0207705_112139362 112
35 3300025918 Ga0207662_10021258 Ga0207662_100212582 112
36 3300037853 Ga0436364_1122609 Ga0436364_1122609_14595_14966 112
37 3300039437 Ga0436365_0794265 Ga0436365_0794265_462_833 112
38 3300041512 Ga0451853_1768691 Ga0451853_1768691_34_399 112
39 3300042133 Ga0450896_050103 Ga0450896_050103_119_484 112
40 3300042145 Ga0450906_014236 Ga0450906_014236_412_777 112
41 3300048905 Ga0496102_1925991 Ga0496102_1925991_93_464 112
42 3300048921 Ga0496118_0412877 Ga0496118_0412877_138_509 112
43 3300049570 Ga0501033_0321886 Ga0501033_0321886_568_939 112
44 3300053153 Ga0500616_0030617 Ga0500616_0030617_185_562 112
45 iso_pu_bacteria 2839989709 2839992436 116
46 iso_pu_bacteria 2920107658 2920112458 116
47 3300014326 Ga0157380_10005455 Ga0157380_100054557 117
48 3300017792 Ga0163161_10448816 Ga0163161_104488162 117
49 3300028380 Ga0268265_12413783 Ga0268265_124137832 117
50 3300032002 Ga0307416_101996559 Ga0307416_1019965592 117
51 3300041459 Ga0451800_0474703 Ga0451800_0474703_387_773 117
52 3300041512 Ga0451853_1226227 Ga0451853_1226227_80_463 117
53 2162886007 SwRhRL2b_contig_1758738 SwRhRL2b_0949.00010620 118
54 3300003371 JGI26145J50221_1001594 JGI26145J50221_10015942 118
55 3300004800 Ga0058861_10845447 Ga0058861_108454472 118
56 3300004803 Ga0058862_12756080 Ga0058862_127560802 118
57 3300005288 Ga0065714_10434882 Ga0065714_104348821 118
58 3300005289 Ga0065704_10010704 Ga0065704_100107043 118
59 3300005290 Ga0065712_10452219 Ga0065712_104522192 118
60 3300005293 Ga0065715_10413971 Ga0065715_104139712 118
61 3300005293 Ga0065715_10609137 Ga0065715_106091371 118
62 3300005295 Ga0065707_10096924 Ga0065707_100969243 118
63 3300005328 Ga0070676_10476046 Ga0070676_104760462 118
64 3300005330 Ga0070690_100131949 Ga0070690_1001319492 118
65 3300005331 Ga0070670_100013378 Ga0070670_1000133784 118
66 3300005333 Ga0070677_10022397 Ga0070677_100223973 118
67 3300005334 Ga0068869_100014841 Ga0068869_1000148413 118
68 3300005335 Ga0070666_10055827 Ga0070666_100558273 118
69 3300005336 Ga0070680_100175434 Ga0070680_1001754342 118
70 3300005337 Ga0070682_100059173 Ga0070682_1000591733 118
71 3300005338 Ga0068868_100104320 Ga0068868_1001043203 118
72 3300005339 Ga0070660_100009427 Ga0070660_1000094273 118
73 3300005340 Ga0070689_100051706 Ga0070689_1000517062 118
74 3300005341 Ga0070691_10014047 Ga0070691_100140472 118
75 3300005343 Ga0070687_100015720 Ga0070687_1000157202 118
76 3300005344 Ga0070661_100025052 Ga0070661_1000250523 118
77 3300005345 Ga0070692_10012469 Ga0070692_100124693 118
78 3300005347 Ga0070668_100085257 Ga0070668_1000852573 118
79 3300005353 Ga0070669_100026033 Ga0070669_1000260334 118
80 3300005354 Ga0070675_100123596 Ga0070675_1001235963 118
81 3300005355 Ga0070671_100779866 Ga0070671_1007798662 118
82 3300005356 Ga0070674_100084892 Ga0070674_1000848922 118
83 3300005364 Ga0070673_100133352 Ga0070673_1001333523 118
84 3300005364 Ga0070673_100155156 Ga0070673_1001551563 118
85 3300005365 Ga0070688_100207912 Ga0070688_1002079122 118
86 3300005365 Ga0070688_100532455 Ga0070688_1005324552 118
87 3300005366 Ga0070659_100080685 Ga0070659_1000806853 118
88 3300005367 Ga0070667_100222995 Ga0070667_1002229952 118
89 3300005406 Ga0070703_10137711 Ga0070703_101377111 118
90 3300005437 Ga0070710_10610706 Ga0070710_106107062 118
91 3300005438 Ga0070701_10008347 Ga0070701_100083473 118
92 3300005439 Ga0070711_100150709 Ga0070711_1001507092 118
93 3300005440 Ga0070705_101642539 Ga0070705_1016425391 118
94 3300005441 Ga0070700_100000322 Ga0070700_10000032217 118
95 3300005444 Ga0070694_100003006 Ga0070694_1000030064 118
96 3300005456 Ga0070678_100009084 Ga0070678_1000090846 118
97 3300005457 Ga0070662_100092236 Ga0070662_1000922362 118
98 3300005458 Ga0070681_10095270 Ga0070681_100952703 118
99 3300005459 Ga0068867_100001065 Ga0068867_10000106513 118
100 3300005530 Ga0070679_100227553 Ga0070679_1002275531 118
101 3300005535 Ga0070684_101060586 Ga0070684_1010605861 118
102 3300005543 Ga0070672_100011126 Ga0070672_1000111264 118
103 3300005543 Ga0070672_100311781 Ga0070672_1003117812 118
104 3300005544 Ga0070686_100004998 Ga0070686_1000049986 118
105 3300005544 Ga0070686_101079135 Ga0070686_1010791352 118
106 3300005545 Ga0070695_100180466 Ga0070695_1001804662 118
107 3300005546 Ga0070696_100166378 Ga0070696_1001663782 118
108 3300005546 Ga0070696_100937961 Ga0070696_1009379612 118
109 3300005547 Ga0070693_100082655 Ga0070693_1000826552 118
110 3300005549 Ga0070704_100384651 Ga0070704_1003846511 118
111 3300005563 Ga0068855_100710056 Ga0068855_1007100562 118
112 3300005564 Ga0070664_100085618 Ga0070664_1000856183 118
113 3300005577 Ga0068857_100061866 Ga0068857_1000618663 118
114 3300005578 Ga0068854_100077746 Ga0068854_1000777463 118
115 3300005614 Ga0068856_100264168 Ga0068856_1002641682 118
116 3300005615 Ga0070702_100002869 Ga0070702_1000028694 118
117 3300005616 Ga0068852_100126479 Ga0068852_1001264793 118
118 3300005617 Ga0068859_101209887 Ga0068859_1012098872 118
119 3300005618 Ga0068864_101447387 Ga0068864_1014473872 118
120 3300005719 Ga0068861_100158121 Ga0068861_1001581212 118
121 3300005840 Ga0068870_10018454 Ga0068870_100184543 118
122 3300005843 Ga0068860_100091198 Ga0068860_1000911983 118
123 3300005844 Ga0068862_100227536 Ga0068862_1002275362 118
124 3300005937 Ga0081455_10318346 Ga0081455_103183462 118
125 3300006058 Ga0075432_10017819 Ga0075432_100178193 118
126 3300006237 Ga0097621_100019760 Ga0097621_1000197603 118
127 3300006237 Ga0097621_101164945 Ga0097621_1011649452 118
128 3300006358 Ga0068871_100010679 Ga0068871_1000106792 118
129 3300006358 Ga0068871_100042629 Ga0068871_1000426294 118
130 3300006844 Ga0075428_100399920 Ga0075428_1003999202 118
131 3300006846 Ga0075430_100002517 Ga0075430_1000025173 118
132 3300006846 Ga0075430_100004374 Ga0075430_1000043747 118
133 3300006847 Ga0075431_100169405 Ga0075431_1001694053 118
134 3300006852 Ga0075433_10073049 Ga0075433_100730494 118
135 3300006880 Ga0075429_100009563 Ga0075429_1000095638 118
136 3300006880 Ga0075429_100011721 Ga0075429_1000117215 118
137 3300006881 Ga0068865_100002715 Ga0068865_1000027153 118
138 3300006914 Ga0075436_100322116 Ga0075436_1003221162 118
139 3300006914 Ga0075436_101179654 Ga0075436_1011796541 118
140 3300006931 Ga0097620_101209778 Ga0097620_1012097782 118
141 3300007076 Ga0075435_100229410 Ga0075435_1002294101 118
142 3300007076 Ga0075435_100932607 Ga0075435_1009326072 118
143 3300009093 Ga0105240_10574510 Ga0105240_105745101 118
144 3300009098 Ga0105245_10063301 Ga0105245_100633012 118
145 3300009147 Ga0114129_10036112 Ga0114129_100361123 118
146 3300009147 Ga0114129_10127485 Ga0114129_101274853 118
147 3300009147 Ga0114129_11102486 Ga0114129_111024862 118
148 3300009148 Ga0105243_10013050 Ga0105243_100130505 118
149 3300009174 Ga0105241_10557634 Ga0105241_105576342 118
150 3300009176 Ga0105242_10000974 Ga0105242_100009745 118
151 3300009177 Ga0105248_11764697 Ga0105248_117646972 118
152 3300009551 Ga0105238_10598847 Ga0105238_105988472 118
153 3300009553 Ga0105249_10266644 Ga0105249_102666443 118
154 3300010375 Ga0105239_10033416 Ga0105239_100334164 118
155 3300011119 Ga0105246_10059616 Ga0105246_100596163 118
156 3300013296 Ga0157374_10062603 Ga0157374_100626033 118
157 3300013296 Ga0157374_10177501 Ga0157374_101775013 118
158 3300013296 Ga0157374_10944650 Ga0157374_109446502 118
159 3300013297 Ga0157378_10084487 Ga0157378_100844872 118
160 3300013306 Ga0163162_10066174 Ga0163162_100661744 118
161 3300013307 Ga0157372_12574682 Ga0157372_125746822 118
162 3300013308 Ga0157375_10034369 Ga0157375_100343693 118
163 3300014326 Ga0157380_10004274 Ga0157380_100042742 118
164 3300014745 Ga0157377_10027050 Ga0157377_100270503 118
165 3300014745 Ga0157377_10501661 Ga0157377_105016611 118
166 3300014969 Ga0157376_10021456 Ga0157376_100214562 118
167 3300025885 Ga0207653_10130725 Ga0207653_101307252 118
168 3300025893 Ga0207682_10058689 Ga0207682_100586893 118
169 3300025898 Ga0207692_10820360 Ga0207692_108203602 118
170 3300025904 Ga0207647_10477403 Ga0207647_104774031 118
171 3300025907 Ga0207645_10002494 Ga0207645_100024945 118
172 3300025908 Ga0207643_10043896 Ga0207643_100438963 118
173 3300025912 Ga0207707_10084572 Ga0207707_100845722 118
174 3300025913 Ga0207695_10676349 Ga0207695_106763491 118
175 3300025916 Ga0207663_10310026 Ga0207663_103100262 118
176 3300025917 Ga0207660_10076104 Ga0207660_100761043 118
177 3300025918 Ga0207662_10003710 Ga0207662_100037103 118
178 3300025918 Ga0207662_10030264 Ga0207662_100302642 118
179 3300025919 Ga0207657_10008353 Ga0207657_100083535 118
180 3300025921 Ga0207652_10105989 Ga0207652_101059891 118
181 3300025923 Ga0207681_10172716 Ga0207681_101727162 118
182 3300025925 Ga0207650_10273991 Ga0207650_102739912 118
183 3300025926 Ga0207659_10775405 Ga0207659_107754051 118
184 3300025927 Ga0207687_10129082 Ga0207687_101290823 118
185 3300025931 Ga0207644_10343593 Ga0207644_103435932 118
186 3300025932 Ga0207690_10269954 Ga0207690_102699542 118
187 3300025933 Ga0207706_10001148 Ga0207706_100011487 118
188 3300025934 Ga0207686_10114216 Ga0207686_101142163 118
189 3300025935 Ga0207709_10049661 Ga0207709_100496614 118
190 3300025936 Ga0207670_10019196 Ga0207670_100191963 118
191 3300025936 Ga0207670_10044799 Ga0207670_100447994 118
192 3300025937 Ga0207669_10095651 Ga0207669_100956512 118
193 3300025938 Ga0207704_10004675 Ga0207704_100046754 118
194 3300025940 Ga0207691_10001449 Ga0207691_100014494 118
195 3300025940 Ga0207691_10302342 Ga0207691_103023422 118
196 3300025941 Ga0207711_11381439 Ga0207711_113814392 118
197 3300025942 Ga0207689_10024748 Ga0207689_100247484 118
198 3300025945 Ga0207679_10089597 Ga0207679_100895973 118
199 3300025960 Ga0207651_10219416 Ga0207651_102194162 118
200 3300025960 Ga0207651_10793102 Ga0207651_107931022 118
201 3300025961 Ga0207712_10179596 Ga0207712_101795963 118
202 3300025981 Ga0207640_10203306 Ga0207640_102033062 118
203 3300026023 Ga0207677_11440117 Ga0207677_114401171 118
204 3300026075 Ga0207708_10001206 Ga0207708_100012068 118
205 3300026088 Ga0207641_11227518 Ga0207641_112275182 118
206 3300026089 Ga0207648_10000360 Ga0207648_1000036013 118
207 3300026095 Ga0207676_11213517 Ga0207676_112135171 118
208 3300026116 Ga0207674_10054686 Ga0207674_100546863 118
209 3300026118 Ga0207675_100101252 Ga0207675_1001012523 118
210 3300026121 Ga0207683_10000388 Ga0207683_1000038813 118
211 3300027252 Ga0209973_1001725 Ga0209973_10017253 118
212 3300027360 Ga0209969_1004681 Ga0209969_10046812 118
213 3300027364 Ga0209967_1001076 Ga0209967_10010762 118
214 3300027364 Ga0209967_1012878 Ga0209967_10128782 118
215 3300027378 Ga0209981_1000799 Ga0209981_10007992 118
216 3300027424 Ga0209984_1001317 Ga0209984_10013172 118
217 3300027462 Ga0210000_1000038 Ga0210000_100003816 118
218 3300027471 Ga0209995_1001259 Ga0209995_10012594 118
219 3300027526 Ga0209968_1000031 Ga0209968_10000313 118
220 3300027526 Ga0209968_1008208 Ga0209968_10082083 118
221 3300027614 Ga0209970_1000862 Ga0209970_10008623 118
222 3300027617 Ga0210002_1002423 Ga0210002_10024233 118
223 3300027665 Ga0209983_1000273 Ga0209983_10002732 118
224 3300027682 Ga0209971_1000385 Ga0209971_10003853 118
225 3300027682 Ga0209971_1008425 Ga0209971_10084253 118
226 3300027695 Ga0209966_1000274 Ga0209966_10002745 118
227 3300027717 Ga0209998_10000112 Ga0209998_100001126 118
228 3300027876 Ga0209974_10000092 Ga0209974_1000009218 118
229 3300027876 Ga0209974_10001027 Ga0209974_100010274 118
230 3300027876 Ga0209974_10009396 Ga0209974_100093963 118
231 3300027907 Ga0207428_10001527 Ga0207428_100015274 118
232 3300028380 Ga0268265_10068276 Ga0268265_100682761 118
233 3300028381 Ga0268264_10162365 Ga0268264_101623652 118
234 3300031548 Ga0307408_100008411 Ga0307408_1000084113 118
235 3300031731 Ga0307405_10140377 Ga0307405_101403773 118
236 3300031824 Ga0307413_11576584 Ga0307413_115765842 118
237 3300031852 Ga0307410_10097913 Ga0307410_100979132 118
238 3300031901 Ga0307406_10071061 Ga0307406_100710614 118
239 3300031903 Ga0307407_10006292 Ga0307407_100062926 118
240 3300031903 Ga0307407_10927120 Ga0307407_109271202 118
241 3300031911 Ga0307412_10010666 Ga0307412_100106664 118
242 3300031911 Ga0307412_10052082 Ga0307412_100520821 118
243 3300031995 Ga0307409_100050405 Ga0307409_1000504052 118
244 3300032002 Ga0307416_100072887 Ga0307416_1000728873 118
245 3300032005 Ga0307411_10029920 Ga0307411_100299203 118
246 3300032005 Ga0307411_10630716 Ga0307411_106307163 118
247 3300032005 Ga0307411_10899394 Ga0307411_108993942 118
248 3300032005 Ga0307411_11594864 Ga0307411_115948641 118
249 3300032126 Ga0307415_100034162 Ga0307415_1000341624 118
250 3300034820 Ga0373959_0053886 Ga0373959_0053886_286_669 118
251 3300035085 Ga0373929_0229740 Ga0373929_0229740_130_513 118
252 3300035114 Ga0373939_0331949 Ga0373939_0331949_187_570 118
253 3300035114 Ga0373939_0341955 Ga0373939_0341955_210_593 118
254 3300035115 Ga0373941_0340983 Ga0373941_0340983_213_596 118
255 3300035121 Ga0373960_0030667 Ga0373960_0030667_511_894 118
256 3300035207 Ga0373942_0237979 Ga0373942_0237979_204_587 118
257 3300035241 Ga0373961_0017740 Ga0373961_0017740_1350_1733 118
258 3300035691 Ga0373931_0068073 Ga0373931_0068073_303_686 118
259 3300041405 Ga0439438_023427 Ga0439438_023427_25_408 118
260 3300041408 Ga0439453_0066402 Ga0439453_0066402_245_628 118
261 3300041410 Ga0439461_0084822 Ga0439461_0084822_92_475 118
262 3300041413 Ga0439465_0238849 Ga0439465_0238849_49_432 118
263 3300042004 Ga0439445_0047230 Ga0439445_0047230_467_850 118
264 3300042008 Ga0439450_013307 Ga0439450_013307_983_1366 118
265 3300042010 Ga0439452_047452 Ga0439452_047452_192_575 118
266 3300042016 Ga0439463_063861 Ga0439463_063861_541_924 118
267 3300042134 Ga0450898_055067 Ga0450898_055067_26_409 118
268 3300042156 Ga0439446_0015222 Ga0439446_0015222_1050_1433 118
269 3300042185 Ga0450909_053708 Ga0450909_053708_176_559 118
270 3300042435 Ga0439434_0009729 Ga0439434_0009729_1625_2008 118
271 3300042438 Ga0439459_0041182 Ga0439459_0041182_285_668 118
272 3300042439 Ga0439464_0046168 Ga0439464_0046168_147_530 118
273 3300042876 Ga0451577_0410776 Ga0451577_0410776_129_506 118
274 3300044673 Ga0453683_0066523 Ga0453683_0066523_1304_1687 118
275 3300045051 Ga0451576_0138060 Ga0451576_0138060_230_613 118
276 3300045051 Ga0451576_1267515 Ga0451576_1267515_299_682 118
277 3300046520 Ga0495637_0129692 Ga0495637_0129692_388_771 118
278 3300047318 Ga0495636_0023456 Ga0495636_0023456_224_607 118
279 3300048909 Ga0496106_0407983 Ga0496106_0407983_507_890 118
280 3300049129 Ga0501309_038759 Ga0501309_038759_264_647 118
281 3300049513 Ga0501290_000131 Ga0501290_000131_5992_6375 118
282 3300049514 Ga0501291_001237 Ga0501291_001237_2073_2456 118
283 3300049515 Ga0501292_000120 Ga0501292_000120_2788_3171 118
284 3300049518 Ga0501295_000092 Ga0501295_000092_4691_5074 118
285 3300049519 Ga0501296_000127 Ga0501296_000127_3462_3845 118
286 3300049520 Ga0501297_000114 Ga0501297_000114_3452_3835 118
287 3300049521 Ga0501298_000079 Ga0501298_000079_1466_1849 118
288 3300049522 Ga0501299_000526 Ga0501299_000526_1976_2359 118
289 3300049523 Ga0501300_000057 Ga0501300_000057_3769_4152 118
290 3300049524 Ga0501301_001477 Ga0501301_001477_385_768 118
291 3300049526 Ga0501303_001069 Ga0501303_001069_1176_1559 118
292 3300049568 Ga0501031_0309712 Ga0501031_0309712_449_829 118
293 3300049570 Ga0501033_0125025 Ga0501033_0125025_567_950 118
294 3300049572 Ga0501036_0108830 Ga0501036_0108830_1944_2327 118
295 3300049574 Ga0501038_1352123 Ga0501038_1352123_28_411 118
296 3300049575 Ga0501039_0029139 Ga0501039_0029139_3629_4012 118
297 3300049575 Ga0501039_0701465 Ga0501039_0701465_399_779 118
298 3300049576 Ga0501040_0027774 Ga0501040_0027774_635_1018 118
299 3300049577 Ga0501041_0004008 Ga0501041_0004008_188_571 118
300 3300049580 Ga0501046_0044091 Ga0501046_0044091_1502_1885 118
301 3300049582 Ga0501048_0385104 Ga0501048_0385104_488_871 118
302 3300049582 Ga0501048_0536407 Ga0501048_0536407_449_829 118
303 3300049583 Ga0501067_0158293 Ga0501067_0158293_789_1172 118
304 3300049584 Ga0501068_0114822 Ga0501068_0114822_1095_1478 118
305 3300049584 Ga0501068_0122824 Ga0501068_0122824_923_1306 118
306 3300049587 Ga0501071_0002814 Ga0501071_0002814_7216_7599 118
307 3300049587 Ga0501071_0272231 Ga0501071_0272231_878_1261 118
308 3300049588 Ga0501072_0029962 Ga0501072_0029962_247_630 118
309 3300049591 Ga0501075_0064474 Ga0501075_0064474_2317_2700 118
310 3300049591 Ga0501075_0409462 Ga0501075_0409462_276_641 118
311 3300049592 Ga0501076_0344692 Ga0501076_0344692_685_1065 118
312 3300049593 Ga0501077_0014302 Ga0501077_0014302_1805_2188 118
313 3300049649 Ga0501198_003564 Ga0501198_003564_1335_1718 118
314 3300049650 Ga0501199_030382 Ga0501199_030382_104_487 118
315 3300049651 Ga0501201_000857 Ga0501201_000857_1953_2336 118
316 3300049652 Ga0501202_001309 Ga0501202_001309_361_744 118
317 3300049653 Ga0501206_000124 Ga0501206_000124_3551_3934 118
318 3300049654 Ga0501207_000985 Ga0501207_000985_15_398 118
319 3300049655 Ga0501208_000439 Ga0501208_000439_2674_3057 118
320 3300049658 Ga0501211_006607 Ga0501211_006607_235_618 118
321 3300049659 Ga0501214_048667 Ga0501214_048667_227_610 118
322 3300049660 Ga0501216_000146 Ga0501216_000146_4325_4708 118
323 3300049661 Ga0501217_000519 Ga0501217_000519_2447_2830 118
324 3300049662 Ga0501222_003295 Ga0501222_003295_779_1162 118
325 3300049663 Ga0501223_004844 Ga0501223_004844_1371_1754 118
326 3300049664 Ga0501224_025307 Ga0501224_025307_331_714 118
327 3300049665 Ga0501227_010508 Ga0501227_010508_454_837 118
328 3300049666 Ga0501228_012159 Ga0501228_012159_385_768 118
329 3300049668 Ga0501233_026986 Ga0501233_026986_89_472 118
330 3300049669 Ga0501235_000237 Ga0501235_000237_6378_6761 118
331 3300049670 Ga0501236_002775 Ga0501236_002775_1549_1932 118
332 3300049672 Ga0501239_000716 Ga0501239_000716_1388_1771 118
333 3300049674 Ga0501242_037795 Ga0501242_037795_212_595 118
334 3300049675 Ga0501243_000596 Ga0501243_000596_1043_1426 118
335 3300049676 Ga0501246_012500 Ga0501246_012500_400_783 118
336 3300049677 Ga0501247_001858 Ga0501247_001858_1110_1493 118
337 3300049678 Ga0501248_002300 Ga0501248_002300_858_1241 118
338 3300049679 Ga0501249_001783 Ga0501249_001783_1908_2291 118
339 3300049680 Ga0501250_009725 Ga0501250_009725_45_428 118
340 3300049681 Ga0501251_002117 Ga0501251_002117_1379_1762 118
341 3300049683 Ga0501253_000169 Ga0501253_000169_1515_1898 118
342 3300049684 Ga0501255_000377 Ga0501255_000377_2156_2539 118
343 3300049686 Ga0501257_001186 Ga0501257_001186_3435_3818 118
344 3300049687 Ga0501258_001337 Ga0501258_001337_621_1004 118
345 3300049688 Ga0501259_039063 Ga0501259_039063_452_835 118
346 3300049690 Ga0501261_003666 Ga0501261_003666_529_912 118
347 3300049703 Ga0501219_000569 Ga0501219_000569_1456_1839 118
348 3300049704 Ga0501221_000633 Ga0501221_000633_1653_2036 118
349 3300049705 Ga0501225_0000205 Ga0501225_0000205_4283_4666 118
350 3300049707 Ga0501234_001096 Ga0501234_001096_3713_4096 118
351 3300049708 Ga0501245_002108 Ga0501245_002108_305_688 118
352 3300049741 Ga0501079_0028540 Ga0501079_0028540_3635_4018 118
353 3300049744 Ga0501083_0385830 Ga0501083_0385830_136_519 118
354 3300049757 Ga0501232_002983 Ga0501232_002983_54_437 118
355 3300049759 Ga0501262_018552 Ga0501262_018552_179_562 118
356 3300049761 Ga0501264_001361 Ga0501264_001361_1162_1545 118
357 3300049763 Ga0501266_000137 Ga0501266_000137_4810_5193 118
358 3300049767 Ga0501270_001294 Ga0501270_001294_212_595 118
359 3300049768 Ga0501271_000405 Ga0501271_000405_399_782 118
360 3300049771 Ga0501274_003582 Ga0501274_003582_375_758 118
361 3300049775 Ga0501279_000411 Ga0501279_000411_3476_3859 118
362 3300049776 Ga0501280_003894 Ga0501280_003894_1816_2199 118
363 3300049778 Ga0501282_001924 Ga0501282_001924_285_668 118
364 3300049779 Ga0501283_000409 Ga0501283_000409_3259_3642 118
365 3300049822 Ga0501035_0100668 Ga0501035_0100668_569_952 118
366 3300049824 Ga0501045_0065327 Ga0501045_0065327_10_393 118
367 3300049849 Ga0501200_01268 Ga0501200_01268_222_605 118
368 3300049851 Ga0501212_018549 Ga0501212_018549_621_1004 118
369 3300049853 Ga0501226_011772 Ga0501226_011772_428_811 118
370 3300050507 nmdc:mga05p37_427717_c1 nmdc:mga05p37_427717_c1_152_535 118
371 3300050507 nmdc:mga05p37_982328_c1 nmdc:mga05p37_982328_c1_363_746 118
372 3300050508 nmdc:mga09592_164568_c1 nmdc:mga09592_164568_c1_38_421 118
373 3300050508 nmdc:mga09592_25127_c1 nmdc:mga09592_25127_c1_312_695 118
374 3300050509 nmdc:mga0qj67_101485_c1 nmdc:mga0qj67_101485_c1_1326_1709 118
375 3300050509 nmdc:mga0qj67_171122_c1 nmdc:mga0qj67_171122_c1_38_421 118
376 3300050510 nmdc:mga06r32_122318_c1 nmdc:mga06r32_122318_c1_2083_2466 118
377 3300050511 nmdc:mga08y16_28953_c1 nmdc:mga08y16_28953_c1_821_1204 118
378 3300050512 nmdc:mga0n895_137034_c1 nmdc:mga0n895_137034_c1_1327_1710 118
379 3300050513 nmdc:mga0rr50_235042_c1 nmdc:mga0rr50_235042_c1_11_394 118
380 3300050514 nmdc:mga08x19_730996_c1 nmdc:mga08x19_730996_c1_149_532 118
381 3300050515 nmdc:mga0a205_65443_c1 nmdc:mga0a205_65443_c1_616_999 118
382 3300054114 Ga0501084_0021636 Ga0501084_0021636_122_505 118
383 3300059512 Ga0587092_135114 Ga0587092_135114_38_418 118
384 3300060353 Ga0501082_0006364 Ga0501082_0006364_414_797 118
385 3300061734 Ga0530510_0007074 Ga0530510_0007074_259_642 118
386 3300005330 Ga0070690_100000912 Ga0070690_1000009122 119
387 3300005330 Ga0070690_100379658 Ga0070690_1003796582 119
388 3300005334 Ga0068869_100473215 Ga0068869_1004732152 119
389 3300005337 Ga0070682_100531001 Ga0070682_1005310011 119
390 3300005338 Ga0068868_100517867 Ga0068868_1005178672 119
391 3300005340 Ga0070689_100008310 Ga0070689_1000083105 119
392 3300005341 Ga0070691_10152136 Ga0070691_101521362 119
393 3300005343 Ga0070687_100895258 Ga0070687_1008952582 119
394 3300005345 Ga0070692_10077452 Ga0070692_100774523 119
395 3300005345 Ga0070692_10581755 Ga0070692_105817552 119
396 3300005347 Ga0070668_100297458 Ga0070668_1002974582 119
397 3300005365 Ga0070688_100943003 Ga0070688_1009430031 119
398 3300005438 Ga0070701_10055474 Ga0070701_100554743 119
399 3300005438 Ga0070701_10580358 Ga0070701_105803582 119
400 3300005441 Ga0070700_100049482 Ga0070700_1000494824 119
401 3300005467 Ga0070706_100405856 Ga0070706_1004058562 119
402 3300005468 Ga0070707_100538928 Ga0070707_1005389281 119
403 3300005535 Ga0070684_100467157 Ga0070684_1004671572 119
404 3300005545 Ga0070695_100034853 Ga0070695_1000348532 119
405 3300005545 Ga0070695_100743022 Ga0070695_1007430222 119
406 3300005563 Ga0068855_100019512 Ga0068855_1000195127 119
407 3300005578 Ga0068854_100014453 Ga0068854_1000144532 119
408 3300005615 Ga0070702_100519580 Ga0070702_1005195802 119
409 3300005718 Ga0068866_11228962 Ga0068866_112289622 119
410 3300005719 Ga0068861_100035360 Ga0068861_1000353602 119
411 3300005719 Ga0068861_100183372 Ga0068861_1001833722 119
412 3300005842 Ga0068858_101314921 Ga0068858_1013149212 119
413 3300005843 Ga0068860_100085596 Ga0068860_1000855962 119
414 3300005843 Ga0068860_100402208 Ga0068860_1004022082 119
415 3300005844 Ga0068862_100739470 Ga0068862_1007394702 119
416 3300005937 Ga0081455_10000014 Ga0081455_10000014138 119
417 3300005983 Ga0081540_1000035 Ga0081540_1000035103 119
418 3300005983 Ga0081540_1164463 Ga0081540_11644631 119
419 3300006058 Ga0075432_10041117 Ga0075432_100411173 119
420 3300006163 Ga0070715_10152690 Ga0070715_101526902 119
421 3300006175 Ga0070712_100690962 Ga0070712_1006909622 119
422 3300006237 Ga0097621_101080363 Ga0097621_1010803632 119
423 3300006237 Ga0097621_102027698 Ga0097621_1020276981 119
424 3300006844 Ga0075428_100061825 Ga0075428_1000618254 119
425 3300006871 Ga0075434_100002404 Ga0075434_10000240419 119
426 3300006914 Ga0075436_101054600 Ga0075436_1010546001 119
427 3300007076 Ga0075435_100033993 Ga0075435_1000339933 119
428 3300009094 Ga0111539_10032830 Ga0111539_100328303 119
429 3300009094 Ga0111539_10301307 Ga0111539_103013072 119
430 3300009094 Ga0111539_10446584 Ga0111539_104465843 119
431 3300009098 Ga0105245_10256070 Ga0105245_102560703 119
432 3300009147 Ga0114129_10496923 Ga0114129_104969231 119
433 3300009148 Ga0105243_10161143 Ga0105243_101611433 119
434 3300009148 Ga0105243_10250509 Ga0105243_102505092 119
435 3300009176 Ga0105242_10747006 Ga0105242_107470062 119
436 3300009177 Ga0105248_11559005 Ga0105248_115590052 119
437 3300009545 Ga0105237_10014196 Ga0105237_100141965 119
438 3300009553 Ga0105249_10046499 Ga0105249_100464995 119
439 3300009553 Ga0105249_10088653 Ga0105249_100886533 119
440 3300013297 Ga0157378_11255945 Ga0157378_112559452 119
441 3300025899 Ga0207642_10886810 Ga0207642_108868102 119
442 3300025905 Ga0207685_10151598 Ga0207685_101515983 119
443 3300025915 Ga0207693_10764696 Ga0207693_107646962 119
444 3300025942 Ga0207689_10250377 Ga0207689_102503772 119
445 3300025972 Ga0207668_10529297 Ga0207668_105292972 119
446 3300026075 Ga0207708_10249774 Ga0207708_102497743 119
447 3300026118 Ga0207675_100624129 Ga0207675_1006241292 119
448 3300027907 Ga0207428_10051835 Ga0207428_100518353 119
449 3300034816 Ga0373930_0080034 Ga0373930_0080034_122_511 119
450 3300034817 Ga0373948_0213252 Ga0373948_0213252_47_436 119
451 3300034820 Ga0373959_0075131 Ga0373959_0075131_113_502 119
452 3300034957 Ga0373938_0177640 Ga0373938_0177640_95_484 119
453 3300035084 Ga0373928_0063661 Ga0373928_0063661_118_507 119
454 3300035085 Ga0373929_0110454 Ga0373929_0110454_256_645 119
455 3300035088 Ga0373940_0022345 Ga0373940_0022345_1048_1437 119
456 3300035091 Ga0373951_0015888 Ga0373951_0015888_322_711 119
457 3300035092 Ga0373952_0006708 Ga0373952_0006708_26_415 119
458 3300035112 Ga0373932_0087372 Ga0373932_0087372_123_512 119
459 3300035121 Ga0373960_0002305 Ga0373960_0002305_2001_2390 119
460 3300035242 Ga0373962_0028414 Ga0373962_0028414_359_748 119
461 3300035242 Ga0373962_0052357 Ga0373962_0052357_328_717 119
462 3300035242 Ga0373962_0315815 Ga0373962_0315815_12_377 119
463 3300035691 Ga0373931_0000271 Ga0373931_0000271_9333_9722 119
464 3300035691 Ga0373931_0421059 Ga0373931_0421059_399_788 119
465 3300046491 Ga0495584_0045617 Ga0495584_0045617_1239_1628 119
466 3300046664 Ga0495659_0273974 Ga0495659_0273974_190_579 119
467 3300048917 Ga0496114_1122911 Ga0496114_1122911_131_520 119
468 3300048918 Ga0496115_0732921 Ga0496115_0732921_230_619 119
469 3300050507 nmdc:mga05p37_119342_c1 nmdc:mga05p37_119342_c1_1178_1567 119
470 3300050511 nmdc:mga08y16_134786_c1 nmdc:mga08y16_134786_c1_1688_2077 119
471 3300050511 nmdc:mga08y16_207598_c1 nmdc:mga08y16_207598_c1_324_713 119
472 3300050511 nmdc:mga08y16_814161_c1 nmdc:mga08y16_814161_c1_469_858 119
473 3300050512 nmdc:mga0n895_2115_c1 nmdc:mga0n895_2115_c1_853_1242 119
474 3300050513 nmdc:mga0rr50_30630_c1 nmdc:mga0rr50_30630_c1_2064_2453 119
475 3300050515 nmdc:mga0a205_3719_c1 nmdc:mga0a205_3719_c1_1453_1842 119
476 3300050515 nmdc:mga0a205_760876_c1 nmdc:mga0a205_760876_c1_39_428 119
477 3300059424 Ga0590075_077401 Ga0590075_077401_380_763 119
478 2162886007 SwRhRL2b_contig_1452750 SwRhRL2b_0069.00000450 120
479 2162886007 SwRhRL2b_contig_219822 SwRhRL2b_0704.00005400 120
480 3300003856 Ga0058692_1006450 Ga0058692_10064503 120
481 3300004799 Ga0058863_11260821 Ga0058863_112608212 120
482 3300005289 Ga0065704_10072434 Ga0065704_100724349 120
483 3300005290 Ga0065712_10448217 Ga0065712_104482171 120
484 3300005293 Ga0065715_10404665 Ga0065715_104046651 120
485 3300005328 Ga0070676_10066165 Ga0070676_100661652 120
486 3300005329 Ga0070683_100093720 Ga0070683_1000937203 120
487 3300005330 Ga0070690_100000841 Ga0070690_10000084116 120
488 3300005331 Ga0070670_100817275 Ga0070670_1008172751 120
489 3300005334 Ga0068869_100000727 Ga0068869_10000072719 120
490 3300005334 Ga0068869_100550442 Ga0068869_1005504421 120
491 3300005336 Ga0070680_100009718 Ga0070680_1000097186 120
492 3300005337 Ga0070682_100027537 Ga0070682_1000275373 120
493 3300005340 Ga0070689_100004042 Ga0070689_1000040424 120
494 3300005340 Ga0070689_100946943 Ga0070689_1009469431 120
495 3300005341 Ga0070691_10132523 Ga0070691_101325231 120
496 3300005341 Ga0070691_10871928 Ga0070691_108719281 120
497 3300005343 Ga0070687_100009907 Ga0070687_1000099073 120
498 3300005345 Ga0070692_10006374 Ga0070692_100063743 120
499 3300005353 Ga0070669_100112903 Ga0070669_1001129033 120
500 3300005353 Ga0070669_100272185 Ga0070669_1002721852 120
501 3300005354 Ga0070675_100147866 Ga0070675_1001478662 120
502 3300005364 Ga0070673_100120125 Ga0070673_1001201253 120
503 3300005364 Ga0070673_101318465 Ga0070673_1013184652 120
504 3300005365 Ga0070688_100018522 Ga0070688_1000185223 120
505 3300005365 Ga0070688_100036061 Ga0070688_1000360614 120
506 3300005365 Ga0070688_100302557 Ga0070688_1003025572 120
507 3300005367 Ga0070667_101041964 Ga0070667_1010419642 120
508 3300005438 Ga0070701_10003790 Ga0070701_100037904 120
509 3300005438 Ga0070701_10639329 Ga0070701_106393292 120
510 3300005440 Ga0070705_100000565 Ga0070705_1000005654 120
511 3300005440 Ga0070705_100648925 Ga0070705_1006489252 120
512 3300005441 Ga0070700_100009240 Ga0070700_1000092403 120
513 3300005444 Ga0070694_100001696 Ga0070694_1000016965 120
514 3300005444 Ga0070694_100200565 Ga0070694_1002005652 120
515 3300005445 Ga0070708_100089835 Ga0070708_1000898353 120
516 3300005459 Ga0068867_100000640 Ga0068867_10000064017 120
517 3300005459 Ga0068867_101683612 Ga0068867_1016836121 120
518 3300005466 Ga0070685_10339001 Ga0070685_103390012 120
519 3300005466 Ga0070685_10352270 Ga0070685_103522702 120
520 3300005518 Ga0070699_100266336 Ga0070699_1002663362 120
521 3300005518 Ga0070699_100365096 Ga0070699_1003650962 120
522 3300005530 Ga0070679_100034021 Ga0070679_1000340215 120
523 3300005530 Ga0070679_102017815 Ga0070679_1020178151 120
524 3300005535 Ga0070684_101547979 Ga0070684_1015479791 120
525 3300005543 Ga0070672_100987555 Ga0070672_1009875552 120
526 3300005543 Ga0070672_101814911 Ga0070672_1018149111 120
527 3300005544 Ga0070686_100002616 Ga0070686_1000026164 120
528 3300005545 Ga0070695_100029658 Ga0070695_1000296583 120
529 3300005545 Ga0070695_100141700 Ga0070695_1001417002 120
530 3300005546 Ga0070696_100000527 Ga0070696_10000052722 120
531 3300005546 Ga0070696_100570797 Ga0070696_1005707971 120
532 3300005547 Ga0070693_100000145 Ga0070693_10000014527 120
533 3300005547 Ga0070693_100028320 Ga0070693_1000283203 120
534 3300005548 Ga0070665_100054089 Ga0070665_1000540894 120
535 3300005549 Ga0070704_100002205 Ga0070704_10000220512 120
536 3300005549 Ga0070704_100085804 Ga0070704_1000858042 120
537 3300005563 Ga0068855_100059672 Ga0068855_1000596724 120
538 3300005614 Ga0068856_100163161 Ga0068856_1001631612 120
539 3300005615 Ga0070702_100000209 Ga0070702_10000020912 120
540 3300005615 Ga0070702_100726630 Ga0070702_1007266302 120
541 3300005616 Ga0068852_100162082 Ga0068852_1001620823 120
542 3300005617 Ga0068859_100055748 Ga0068859_1000557483 120
543 3300005617 Ga0068859_100927463 Ga0068859_1009274632 120
544 3300005718 Ga0068866_10007307 Ga0068866_100073073 120
545 3300005718 Ga0068866_11288964 Ga0068866_112889641 120
546 3300005719 Ga0068861_100000746 Ga0068861_10000074613 120
547 3300005841 Ga0068863_100351831 Ga0068863_1003518313 120
548 3300005841 Ga0068863_100407798 Ga0068863_1004077982 120
549 3300005842 Ga0068858_100023114 Ga0068858_1000231143 120
550 3300005842 Ga0068858_100654321 Ga0068858_1006543212 120
551 3300005843 Ga0068860_100024979 Ga0068860_1000249793 120
552 3300005843 Ga0068860_100468850 Ga0068860_1004688502 120
553 3300005843 Ga0068860_100713821 Ga0068860_1007138212 120
554 3300005844 Ga0068862_100003396 Ga0068862_1000033964 120
555 3300005937 Ga0081455_10710497 Ga0081455_107104972 120
556 3300006058 Ga0075432_10020862 Ga0075432_100208623 120
557 3300006358 Ga0068871_100000265 Ga0068871_10000026529 120
558 3300006846 Ga0075430_100346061 Ga0075430_1003460612 120
559 3300006846 Ga0075430_100449329 Ga0075430_1004493292 120
560 3300006847 Ga0075431_100452844 Ga0075431_1004528443 120
561 3300006852 Ga0075433_10080211 Ga0075433_100802114 120
562 3300006871 Ga0075434_101611108 Ga0075434_1016111082 120
563 3300006880 Ga0075429_100150996 Ga0075429_1001509963 120
564 3300006881 Ga0068865_100005335 Ga0068865_1000053358 120
565 3300006914 Ga0075436_100716065 Ga0075436_1007160652 120
566 3300006931 Ga0097620_100055750 Ga0097620_1000557503 120
567 3300006931 Ga0097620_100927291 Ga0097620_1009272912 120
568 3300007076 Ga0075435_100062450 Ga0075435_1000624504 120
569 3300009011 Ga0105251_10014454 Ga0105251_100144542 120
570 3300009011 Ga0105251_10019610 Ga0105251_100196104 120
571 3300009011 Ga0105251_10389383 Ga0105251_103893832 120
572 3300009036 Ga0105244_10009445 Ga0105244_100094455 120
573 3300009036 Ga0105244_10014456 Ga0105244_100144568 120
574 3300009036 Ga0105244_10101817 Ga0105244_101018172 120
575 3300009036 Ga0105244_10117231 Ga0105244_101172312 120
576 3300009092 Ga0105250_10026945 Ga0105250_100269454 120
577 3300009092 Ga0105250_10337231 Ga0105250_103372312 120
578 3300009094 Ga0111539_10014845 Ga0111539_100148456 120
579 3300009094 Ga0111539_10142451 Ga0111539_101424513 120
580 3300009094 Ga0111539_12203934 Ga0111539_122039342 120
581 3300009098 Ga0105245_10005829 Ga0105245_1000582910 120
582 3300009147 Ga0114129_10072384 Ga0114129_100723842 120
583 3300009148 Ga0105243_10005092 Ga0105243_100050924 120
584 3300009148 Ga0105243_10019708 Ga0105243_100197083 120
585 3300009176 Ga0105242_10038234 Ga0105242_100382342 120
586 3300009177 Ga0105248_11535090 Ga0105248_115350902 120
587 3300009545 Ga0105237_10505299 Ga0105237_105052992 120
588 3300009553 Ga0105249_10042160 Ga0105249_100421602 120
589 3300010375 Ga0105239_10326910 Ga0105239_103269101 120
590 3300011119 Ga0105246_10093339 Ga0105246_100933392 120
591 3300011119 Ga0105246_10798270 Ga0105246_107982702 120
592 3300013100 Ga0157373_10008432 Ga0157373_100084326 120
593 3300013102 Ga0157371_10023810 Ga0157371_100238105 120
594 3300013102 Ga0157371_10812576 Ga0157371_108125762 120
595 3300013297 Ga0157378_10037215 Ga0157378_100372154 120
596 3300013297 Ga0157378_10931639 Ga0157378_109316391 120
597 3300013306 Ga0163162_10186000 Ga0163162_101860003 120
598 3300013307 Ga0157372_10042741 Ga0157372_100427413 120
599 3300013308 Ga0157375_11744037 Ga0157375_117440372 120
600 3300014326 Ga0157380_10402933 Ga0157380_104029331 120
601 3300014326 Ga0157380_10653502 Ga0157380_106535023 120
602 3300014497 Ga0182008_10000606 Ga0182008_1000060618 120
603 3300015261 Ga0182006_1000514 Ga0182006_100051423 120
604 3300015261 Ga0182006_1005825 Ga0182006_10058254 120
605 3300017792 Ga0163161_10385551 Ga0163161_103855512 120
606 3300017792 Ga0163161_10908721 Ga0163161_109087212 120
607 3300017792 Ga0163161_11033971 Ga0163161_110339712 120
608 3300021388 Ga0213875_10005863 Ga0213875_100058632 120
609 3300025304 Ga0209257_1000667 Ga0209257_100066741 120
610 3300025711 Ga0207696_1000016 Ga0207696_1000016104 120
611 3300025711 Ga0207696_1011087 Ga0207696_10110873 120
612 3300025711 Ga0207696_1012952 Ga0207696_10129523 120
613 3300025711 Ga0207696_1055275 Ga0207696_10552752 120
614 3300025728 Ga0207655_1000313 Ga0207655_100031347 120
615 3300025728 Ga0207655_1019247 Ga0207655_10192475 120
616 3300025728 Ga0207655_1030657 Ga0207655_10306574 120
617 3300025728 Ga0207655_1038800 Ga0207655_10388003 120
618 3300025735 Ga0207713_1001307 Ga0207713_100130716 120
619 3300025735 Ga0207713_1041648 Ga0207713_10416483 120
620 3300025901 Ga0207688_10150306 Ga0207688_101503062 120
621 3300025908 Ga0207643_10018663 Ga0207643_100186632 120
622 3300025908 Ga0207643_10833334 Ga0207643_108333342 120
623 3300025911 Ga0207654_10105205 Ga0207654_101052053 120
624 3300025914 Ga0207671_11020662 Ga0207671_110206622 120
625 3300025917 Ga0207660_10001221 Ga0207660_100012214 120
626 3300025918 Ga0207662_10000423 Ga0207662_1000042312 120
627 3300025921 Ga0207652_10268857 Ga0207652_102688572 120
628 3300025923 Ga0207681_10075225 Ga0207681_100752253 120
629 3300025926 Ga0207659_10036471 Ga0207659_100364712 120
630 3300025927 Ga0207687_10013843 Ga0207687_100138434 120
631 3300025934 Ga0207686_10008653 Ga0207686_100086533 120
632 3300025935 Ga0207709_10008014 Ga0207709_100080144 120
633 3300025935 Ga0207709_10013634 Ga0207709_100136344 120
634 3300025936 Ga0207670_10003051 Ga0207670_100030519 120
635 3300025936 Ga0207670_10436945 Ga0207670_104369452 120
636 3300025936 Ga0207670_11078563 Ga0207670_110785631 120
637 3300025938 Ga0207704_10020249 Ga0207704_100202493 120
638 3300025942 Ga0207689_10001695 Ga0207689_100016954 120
639 3300025949 Ga0207667_10082522 Ga0207667_100825224 120
640 3300025960 Ga0207651_11463435 Ga0207651_114634351 120
641 3300025961 Ga0207712_10148663 Ga0207712_101486632 120
642 3300025986 Ga0207658_10712636 Ga0207658_107126362 120
643 3300026023 Ga0207677_10035893 Ga0207677_100358933 120
644 3300026035 Ga0207703_10021294 Ga0207703_100212945 120
645 3300026075 Ga0207708_10000723 Ga0207708_1000072312 120
646 3300026078 Ga0207702_10441849 Ga0207702_104418492 120
647 3300026078 Ga0207702_12010906 Ga0207702_120109061 120
648 3300026088 Ga0207641_10303541 Ga0207641_103035412 120
649 3300026088 Ga0207641_10783433 Ga0207641_107834332 120
650 3300026088 Ga0207641_11603363 Ga0207641_116033632 120
651 3300026089 Ga0207648_10001968 Ga0207648_100019685 120
652 3300026089 Ga0207648_10230767 Ga0207648_102307672 120
653 3300026118 Ga0207675_100001083 Ga0207675_10000108330 120
654 3300026118 Ga0207675_100122022 Ga0207675_1001220223 120
655 3300026142 Ga0207698_10186532 Ga0207698_101865323 120
656 3300027312 Ga0209371_1001932 Ga0209371_10019329 120
657 3300027395 Ga0209996_1007041 Ga0209996_10070411 120
658 3300027907 Ga0207428_10166812 Ga0207428_101668122 120
659 3300028379 Ga0268266_10078103 Ga0268266_100781035 120
660 3300028380 Ga0268265_10127683 Ga0268265_101276834 120
661 3300028381 Ga0268264_10018627 Ga0268264_100186275 120
662 3300028381 Ga0268264_10255159 Ga0268264_102551593 120
663 3300028381 Ga0268264_10432473 Ga0268264_104324732 120
664 3300028563 Ga0265319_1015317 Ga0265319_10153173 120
665 3300028577 Ga0265318_10000771 Ga0265318_100007718 120
666 3300028800 Ga0265338_10186467 Ga0265338_101864673 120
667 3300030500 Ga0268256_1001681 Ga0268256_10016816 120
668 3300030760 Ga0265762_1023803 Ga0265762_10238032 120
669 3300031235 Ga0265330_10000896 Ga0265330_1000089617 120
670 3300031238 Ga0265332_10049022 Ga0265332_100490223 120
671 3300031239 Ga0265328_10006698 Ga0265328_100066983 120
672 3300031240 Ga0265320_10001966 Ga0265320_100019664 120
673 3300031242 Ga0265329_10006674 Ga0265329_100066743 120
674 3300031249 Ga0265339_10182124 Ga0265339_101821242 120
675 3300031250 Ga0265331_10000655 Ga0265331_1000065517 120
676 3300031344 Ga0265316_10030113 Ga0265316_100301135 120
677 3300031548 Ga0307408_101004487 Ga0307408_1010044872 120
678 3300031595 Ga0265313_10030767 Ga0265313_100307674 120
679 3300031711 Ga0265314_10011405 Ga0265314_100114052 120
680 3300031712 Ga0265342_10000610 Ga0265342_1000061019 120
681 3300031824 Ga0307413_10019524 Ga0307413_100195245 120
682 3300031824 Ga0307413_10216257 Ga0307413_102162572 120
683 3300031901 Ga0307406_10464084 Ga0307406_104640842 120
684 3300031903 Ga0307407_10088339 Ga0307407_100883392 120
685 3300031995 Ga0307409_100091681 Ga0307409_1000916814 120
686 3300032004 Ga0307414_10026505 Ga0307414_100265054 120
687 3300032004 Ga0307414_10144341 Ga0307414_101443412 120
688 3300032005 Ga0307411_10014298 Ga0307411_100142983 120
689 3300032005 Ga0307411_10213806 Ga0307411_102138062 120
690 3300035114 Ga0373939_0350590 Ga0373939_0350590_47_451 120
691 3300035691 Ga0373931_0001276 Ga0373931_0001276_64_432 120
692 3300036401 Ga0373937_1046637 Ga0373937_1046637_27_416 120
693 3300037418 Ga0395900_0222666 Ga0395900_0222666_539_988 120
694 3300038443 Ga0395901_1723565 Ga0395901_1723565_64_513 120
695 3300041405 Ga0439438_000751 Ga0439438_000751_2548_2910 120
696 3300041407 Ga0439447_016764 Ga0439447_016764_1503_1865 120
697 3300041491 Ga0451833_1294998 Ga0451833_1294998_313_693 120
698 3300042006 Ga0439432_000509 Ga0439432_000509_7526_7888 120
699 3300042137 Ga0450902_000571 Ga0450902_000571_1613_1975 120
700 3300042437 Ga0439444_0100719 Ga0439444_0100719_178_564 120
701 3300042439 Ga0439464_0002073 Ga0439464_0002073_1532_1894 120
702 3300042533 Ga0450901_001902 Ga0450901_001902_875_1237 120
703 3300045051 Ga0451576_0279407 Ga0451576_0279407_638_1012 120
704 3300046471 Ga0495650_0002153 Ga0495650_0002153_180_542 120
705 3300046473 Ga0495582_0017978 Ga0495582_0017978_2251_2640 120
706 3300046474 Ga0495605_0119420 Ga0495605_0119420_50_412 120
707 3300046491 Ga0495584_0176320 Ga0495584_0176320_517_879 120
708 3300046492 Ga0495585_0000360 Ga0495585_0000360_43595_43957 120
709 3300046500 Ga0495596_0250524 Ga0495596_0250524_46_408 120
710 3300046507 Ga0495606_0000136 Ga0495606_0000136_99567_99929 120
711 3300046513 Ga0495616_0000003 Ga0495616_0000003_79873_80235 120
712 3300046515 Ga0495620_0000056 Ga0495620_0000056_79199_79561 120
713 3300046519 Ga0495632_0000021 Ga0495632_0000021_37897_38259 120
714 3300046519 Ga0495632_0005839 Ga0495632_0005839_6180_6542 120
715 3300046522 Ga0495643_0000089 Ga0495643_0000089_52088_52450 120
716 3300046522 Ga0495643_0000253 Ga0495643_0000253_71138_71500 120
717 3300046524 Ga0495648_0000099 Ga0495648_0000099_22074_22436 120
718 3300046526 Ga0495666_0294668 Ga0495666_0294668_63_452 120
719 3300046529 Ga0495652_0594725 Ga0495652_0594725_261_653 120
720 3300046535 Ga0495586_0051168 Ga0495586_0051168_176_565 120
721 3300046537 Ga0495598_0072367 Ga0495598_0072367_229_597 120
722 3300046615 Ga0495656_0358119 Ga0495656_0358119_335_742 120
723 3300046663 Ga0495635_0107240 Ga0495635_0107240_285_674 120
724 3300046683 Ga0495658_0131201 Ga0495658_0131201_1003_1392 120
725 3300046691 Ga0495670_0002391 Ga0495670_0002391_7944_8306 120
726 3300047323 Ga0495683_0000699 Ga0495683_0000699_3150_3512 120
727 3300047472 Ga0495686_0044498 Ga0495686_0044498_1130_1492 120
728 3300048904 Ga0496101_0302886 Ga0496101_0302886_677_1042 120
729 3300048907 Ga0496104_0228478 Ga0496104_0228478_1018_1383 120
730 3300048911 Ga0496108_0501209 Ga0496108_0501209_262_624 120
731 3300048912 Ga0496109_0253331 Ga0496109_0253331_467_832 120
732 3300048913 Ga0496110_0160330 Ga0496110_0160330_1316_1681 120
733 3300048917 Ga0496114_0014021 Ga0496114_0014021_5461_5823 120
734 3300048917 Ga0496114_0038019 Ga0496114_0038019_2221_2586 120
735 3300048919 Ga0496116_0042110 Ga0496116_0042110_276_638 120
736 3300048920 Ga0496117_0000406 Ga0496117_0000406_20848_21210 120
737 3300048920 Ga0496117_0000922 Ga0496117_0000922_42481_42843 120
738 3300048921 Ga0496118_0000979 Ga0496118_0000979_32239_32601 120
739 3300048924 Ga0496121_0001227 Ga0496121_0001227_7365_7727 120
740 3300048924 Ga0496121_0015234 Ga0496121_0015234_5417_5779 120
741 3300048925 Ga0496122_0000402 Ga0496122_0000402_42471_42833 120
742 3300048925 Ga0496122_0002059 Ga0496122_0002059_19979_20341 120
743 3300048926 Ga0496123_0000028 Ga0496123_0000028_284096_284458 120
744 3300048926 Ga0496123_0002356 Ga0496123_0002356_19303_19665 120
745 3300048927 Ga0496124_0000980 Ga0496124_0000980_22298_22660 120
746 3300048927 Ga0496124_0014069 Ga0496124_0014069_5488_5850 120
747 3300048927 Ga0496124_0023343 Ga0496124_0023343_4270_4632 120
748 3300048927 Ga0496124_0040363 Ga0496124_0040363_1044_1406 120
749 3300048927 Ga0496124_0060414 Ga0496124_0060414_154_516 120
750 3300048928 Ga0496125_0037358 Ga0496125_0037358_2114_2476 120
751 3300048928 Ga0496125_0166210 Ga0496125_0166210_1005_1367 120
752 3300048929 Ga0496126_0005909 Ga0496126_0005909_5672_6034 120
753 3300049569 Ga0501032_0013265 Ga0501032_0013265_5252_5647 120
754 3300049570 Ga0501033_0153844 Ga0501033_0153844_654_1049 120
755 3300049571 Ga0501034_0100813 Ga0501034_0100813_1504_1899 120
756 3300049572 Ga0501036_0626113 Ga0501036_0626113_395_790 120
757 3300049576 Ga0501040_0202491 Ga0501040_0202491_782_1147 120
758 3300049577 Ga0501041_0797546 Ga0501041_0797546_146_535 120
759 3300049579 Ga0501043_0120008 Ga0501043_0120008_256_651 120
760 3300049581 Ga0501047_0001904 Ga0501047_0001904_14721_15116 120
761 3300049581 Ga0501047_0757387 Ga0501047_0757387_69_485 120
762 3300049583 Ga0501067_0545468 Ga0501067_0545468_173_574 120
763 3300049586 Ga0501070_0285265 Ga0501070_0285265_55_450 120
764 3300049587 Ga0501071_1273361 Ga0501071_1273361_100_483 120
765 3300049591 Ga0501075_0336739 Ga0501075_0336739_501_893 120
766 3300049683 Ga0501253_185234 Ga0501253_185234_125_490 120
767 3300049741 Ga0501079_0404459 Ga0501079_0404459_262_651 120
768 3300049741 Ga0501079_1001337 Ga0501079_1001337_95_484 120
769 3300049822 Ga0501035_0007192 Ga0501035_0007192_3343_3738 120
770 3300049823 Ga0501044_0012908 Ga0501044_0012908_3349_3744 120
771 3300050493 nmdc:mga0k408_573943_c1 nmdc:mga0k408_573943_c1_209_598 120
772 3300050507 nmdc:mga05p37_86115_c1 nmdc:mga05p37_86115_c1_1568_1960 120
773 3300050508 nmdc:mga09592_455849_c1 nmdc:mga09592_455849_c1_700_1092 120
774 3300050509 nmdc:mga0qj67_388933_c1 nmdc:mga0qj67_388933_c1_128_511 120
775 3300050509 nmdc:mga0qj67_576570_c1 nmdc:mga0qj67_576570_c1_268_654 120
776 3300050510 nmdc:mga06r32_101696_c1 nmdc:mga06r32_101696_c1_1545_1937 120
777 3300050511 nmdc:mga08y16_54122_c1 nmdc:mga08y16_54122_c1_2859_3224 120
778 3300050511 nmdc:mga08y16_54504_c1 nmdc:mga08y16_54504_c1_1201_1575 120
779 3300050512 nmdc:mga0n895_25744_c1 nmdc:mga0n895_25744_c1_2168_2560 120
780 3300050512 nmdc:mga0n895_316353_c1 nmdc:mga0n895_316353_c1_333_722 120
781 3300050513 nmdc:mga0rr50_169509_c1 nmdc:mga0rr50_169509_c1_365_757 120
782 3300050515 nmdc:mga0a205_10339_c1 nmdc:mga0a205_10339_c1_7655_8044 120
783 3300053085 Ga0495619_1171006 Ga0495619_1171006_73_465 120
784 3300060346 Ga0587111_0026998 Ga0587111_0026998_76_492 120
785 3300060353 Ga0501082_0887357 Ga0501082_0887357_354_737 120
786 3300061734 Ga0530510_0942845 Ga0530510_0942845_17_400 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

5

108

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.9338 2 118
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9272 2 116
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.919 2 118
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9122 2 116
6qcm-assembly1.cif.gz_I cryo em structure of the listeria stressosome 0.8987 2 118
ID Description Score Start End Superfamily
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8864 5 117 3.30.750.24
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8719 5 117 3.30.750.24
af_G5EDS5_481_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8456 11 115 3.30.750.24
af_I1MIF4_33_222_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8439 12 50 3.60.21.10
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8431 3 115 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7U9EZI3-F1-model_v4 deleted 1 2 119
AF-A0A4Y5WCN6-F1-model_v4 deleted 1 1 119
AF-A0A4Q3YJ11-F1-model_v4 STAS domain-containing protein 0.9998 1 102
AF-A0A679HEX1-F1-model_v4 Antagonist of RsbT 0.9997 1 119
AF-A0A0S1Y3K6-F1-model_v4 Anti-anti-sigma factor 0.9991 1 119

Feature Viewer

pLDDT pTM Quality
90.78 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map