F480736

General Info

Members Datasets Scaffolds Average Seq Length
785 280 763 306

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100072304|Ga0075428_1000723045
Length 330
Sequence VSAGKRGVTTQDGGGEAAGVTAGDQRRVAVPEGLDGERLDAALARMFGLSRAVAAELISGGRVLVAGHPAAKSDRVPAGEWLDVTLPAPPAALTPVPQAVPGLVVVYEDADIIVVDKPAGVAAHPTPGWSGPTVLEGLLAAGHTIATSGAAERQGIVHRLDANTTGLMVLAKSERAYSVLKRAFRERTVDKGYHALVQGHPDPLRGTVDAPIARHPSGDGRFAVIAGGRHSITHYDTIEAFRGASLVEITLDTGRTHQIRVHMAAMRHPCVGDRLYGADPVLAAHLGLTRQWLHAVRLGFTHPVDDRPLVFTSDYPPDLAHALDTLRAES

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2855683550 Micromonospora sp. RP3T Isolate Unclassified
5 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
6 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
7 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
8 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
9 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
10 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
11 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
12 2891562705 Microbispora tritici MT50 Isolate Unclassified
13 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
14 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
15 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
16 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
276 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
277 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
278 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
279 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
280 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.56
Metatranscriptomes 0.64
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 4.84
Rhizosphere 90.19
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100185827 3300005329 Bacteria 1973
2 Ga0070660_100023868 3300005339 Bacteria 4534
3 Ga0070660_100050200 3300005339 Bacteria 3209
4 Ga0070691_10077329 3300005341 Bacteria 1624
5 Ga0070692_10020517 3300005345 Bacteria 3205
6 Ga0070671_100055465 3300005355 Bacteria 3296
7 Ga0070659_100308763 3300005366 Bacteria 1320
8 Ga0070667_100057101 3300005367 Bacteria 3297
9 Ga0070667_100251380 3300005367 Bacteria 1580
10 Ga0070709_10000346 3300005434 Bacteria 28876
11 Ga0070709_10001791 3300005434 Bacteria 11671
12 Ga0070709_10006198 3300005434 Bacteria 6509
13 Ga0070709_10025119 3300005434 Bacteria 3517
14 Ga0070709_10039650 3300005434 Bacteria 2891
15 Ga0070709_10158972 3300005434 Bacteria 1569
16 Ga0070714_100000233 3300005435 Bacteria 43523
17 Ga0070714_100001824 3300005435 Bacteria 15486
18 Ga0070714_100005412 3300005435 Bacteria 9740
19 Ga0070714_100011532 3300005435 Bacteria 7014
20 Ga0070714_100053550 3300005435 Bacteria 3445
21 Ga0070714_100070656 3300005435 Bacteria 3018
22 Ga0070714_100153490 3300005435 Bacteria 2077
23 Ga0070714_100330507 3300005435 Bacteria 1427
24 Ga0070714_100361212 3300005435 Bacteria 1365
25 Ga0070713_100000759 3300005436 Bacteria 20648
26 Ga0070713_100002913 3300005436 Bacteria 11203
27 Ga0070713_100035570 3300005436 Bacteria 4011
28 Ga0070713_100043173 3300005436 Bacteria 3684
29 Ga0070713_100085970 3300005436 Bacteria 2695
30 Ga0070713_100400084 3300005436 Bacteria 1282
31 Ga0070710_10000156 3300005437 Bacteria 31483
32 Ga0070710_10016077 3300005437 Bacteria 3800
33 Ga0070710_10044759 3300005437 Bacteria 2457
34 Ga0070710_10174549 3300005437 Bacteria 1341
35 Ga0070711_100001013 3300005439 Bacteria 14930
36 Ga0070711_100031410 3300005439 Bacteria 3526
37 Ga0070711_100074086 3300005439 Bacteria 2407
38 Ga0070694_100157903 3300005444 Bacteria 1661
39 Ga0070708_100010078 3300005445 Bacteria 7648
40 Ga0070708_100011212 3300005445 Bacteria 7289
41 Ga0070708_100089473 3300005445 Bacteria 2801
42 Ga0070708_100098949 3300005445 Bacteria 2668
43 Ga0070708_100171792 3300005445 Bacteria 2024
44 Ga0070708_100245703 3300005445 Bacteria 1681
45 Ga0070708_100283395 3300005445 Bacteria 1560
46 Ga0070708_100365267 3300005445 Bacteria 1360
47 Ga0070663_100004550 3300005455 Bacteria 8174
48 Ga0070663_100017400 3300005455 Bacteria 4691
49 Ga0070663_100044808 3300005455 Bacteria 3122
50 Ga0070681_10485848 3300005458 Bacteria 1148
51 Ga0070706_100003471 3300005467 Bacteria 15514
52 Ga0070706_100005571 3300005467 Bacteria 11984
53 Ga0070706_100007633 3300005467 Bacteria 10122
54 Ga0070706_100011229 3300005467 Bacteria 8317
55 Ga0070706_100012683 3300005467 Bacteria 7797
56 Ga0070706_100032714 3300005467 Bacteria 4798
57 Ga0070706_100040104 3300005467 Bacteria 4322
58 Ga0070706_100122538 3300005467 Bacteria 2424
59 Ga0070706_100130336 3300005467 Bacteria 2346
60 Ga0070706_100283553 3300005467 Bacteria 1546
61 Ga0070706_100502102 3300005467 Bacteria 1129
62 Ga0070707_100001697 3300005468 Bacteria 21256
63 Ga0070707_100013028 3300005468 Bacteria 7771
64 Ga0070707_100013259 3300005468 Bacteria 7708
65 Ga0070707_100019079 3300005468 Bacteria 6458
66 Ga0070707_100020535 3300005468 Bacteria 6233
67 Ga0070707_100026781 3300005468 Bacteria 5477
68 Ga0070698_100000192 3300005471 Bacteria 58336
69 Ga0070698_100000354 3300005471 Bacteria 47476
70 Ga0070698_100001213 3300005471 Bacteria 28680
71 Ga0070698_100005834 3300005471 Bacteria 13466
72 Ga0070698_100013320 3300005471 Bacteria 8702
73 Ga0070698_100029177 3300005471 Bacteria 5726
74 Ga0070698_100030880 3300005471 Bacteria 5556
75 Ga0070698_100046363 3300005471 Bacteria 4444
76 Ga0070698_100073013 3300005471 Bacteria 3438
77 Ga0070698_100078855 3300005471 Bacteria 3291
78 Ga0070698_100095373 3300005471 Bacteria 2952
79 Ga0070698_100171262 3300005471 Bacteria 2112
80 Ga0070699_100102490 3300005518 Bacteria 2509
81 Ga0070679_100193216 3300005530 Bacteria 2003
82 Ga0070684_100054966 3300005535 Bacteria 3469
83 Ga0070684_100263535 3300005535 Bacteria 1577
84 Ga0070697_100005992 3300005536 Bacteria 9399
85 Ga0070697_100054446 3300005536 Bacteria 3251
86 Ga0070697_100060897 3300005536 Bacteria 3078
87 Ga0070697_100076148 3300005536 Bacteria 2759
88 Ga0070696_100092001 3300005546 Bacteria 2161
89 Ga0070664_100610693 3300005564 Bacteria 1012
90 Ga0068856_100013479 3300005614 Bacteria 7913
91 Ga0068856_100076702 3300005614 Bacteria 3311
92 Ga0068852_100263261 3300005616 Bacteria 1656
93 Ga0068864_100138610 3300005618 Bacteria 2192
94 Ga0068863_100093634 3300005841 Bacteria 2851
95 Ga0068863_100106839 3300005841 Bacteria 2663
96 Ga0068860_100213654 3300005843 Bacteria 1871
97 Ga0081540_1000601 3300005983 Bacteria 34296
98 Ga0070717_10002685 3300006028 Bacteria 12535
99 Ga0070717_10017687 3300006028 Bacteria 5551
100 Ga0070717_10027822 3300006028 Bacteria 4520
101 Ga0070717_10128022 3300006028 Bacteria 2181
102 Ga0070717_10427000 3300006028 Bacteria 1192
103 Ga0075365_10160326 3300006038 Bacteria 1567
104 Ga0070715_10001118 3300006163 Bacteria 7639
105 Ga0070715_10003853 3300006163 Bacteria 4843
106 Ga0070716_100000371 3300006173 Bacteria 18468
107 Ga0070716_100000929 3300006173 Bacteria 12703
108 Ga0070716_100003249 3300006173 Bacteria 7634
109 Ga0070716_100022958 3300006173 Bacteria 3303
110 Ga0070716_100100957 3300006173 Bacteria 1768
111 Ga0070716_100129002 3300006173 Bacteria 1595
112 Ga0070712_100037447 3300006175 Bacteria 3307
113 Ga0070712_100234444 3300006175 Bacteria 1459
114 Ga0070712_100249606 3300006175 Bacteria 1417
115 Ga0097621_100328477 3300006237 Bacteria 1356
116 Ga0075428_100072304 3300006844 Bacteria 3768
117 Ga0075433_10029032 3300006852 Bacteria 4709
118 Ga0075433_10044691 3300006852 Bacteria 3849
119 Ga0075433_10502800 3300006852 Bacteria 1067
120 Ga0075434_100133418 3300006871 Bacteria 2503
121 Ga0075434_100262195 3300006871 Bacteria 1747
122 Ga0075436_100015916 3300006914 Bacteria 5148
123 Ga0075436_100050761 3300006914 Bacteria 2863
124 Ga0075436_100081820 3300006914 Bacteria 2239
125 Ga0075436_100153832 3300006914 Bacteria 1619
126 Ga0075435_100062323 3300007076 Bacteria 3026
127 Ga0075435_100206439 3300007076 Bacteria 1665
128 Ga0075435_100452294 3300007076 Bacteria 1107
129 Ga0099795_10057637 3300007788 Bacteria 1433
130 Ga0105240_10353704 3300009093 Bacteria 1666
131 Ga0111539_10040160 3300009094 Bacteria 5634
132 Ga0105245_10023602 3300009098 Bacteria 5400
133 Ga0114129_10009348 3300009147 Bacteria 13979
134 Ga0105241_10372626 3300009174 Bacteria 1245
135 Ga0105242_10300151 3300009176 Bacteria 1466
136 Ga0105248_10192061 3300009177 Bacteria 2301
137 Ga0105238_10145996 3300009551 Bacteria 2342
138 Ga0105239_10232709 3300010375 Bacteria 2067
139 Ga0157373_10150422 3300013100 Bacteria 1637
140 Ga0157370_10215715 3300013104 Bacteria 1778
141 Ga0157369_10058003 3300013105 Bacteria 4176
142 Ga0157369_10300786 3300013105 Bacteria 1669
143 Ga0157369_10567519 3300013105 Bacteria 1172
144 Ga0157372_10168403 3300013307 Bacteria 2534
145 Ga0157375_10158031 3300013308 Bacteria 2407
146 Ga0163163_10374853 3300014325 Bacteria 1480
147 Ga0157379_10099483 3300014968 Bacteria 2611
148 Ga0206354_11532852 3300020081 Bacteria 1480
149 Ga0206353_10338168 3300020082 Bacteria 3129
150 Ga0206353_10667712 3300020082 Bacteria 5747
151 Ga0206353_11752212 3300020082 Bacteria 3042
152 Ga0213875_10000758 3300021388 Bacteria 24340
153 Ga0213875_10000907 3300021388 Bacteria 21486
154 Ga0213875_10008834 3300021388 Bacteria 5142
155 Ga0213875_10010026 3300021388 Bacteria 4766
156 Ga0213875_10064588 3300021388 Bacteria 1710
157 Ga0213875_10108994 3300021388 Bacteria 1293
158 Ga0207692_10000123 3300025898 Bacteria 23195
159 Ga0207692_10001266 3300025898 Bacteria 9373
160 Ga0207692_10009025 3300025898 Bacteria 4151
161 Ga0207692_10032927 3300025898 Bacteria 2495
162 Ga0207692_10069895 3300025898 Bacteria 1846
163 Ga0207710_10073569 3300025900 Bacteria 1572
164 Ga0207688_10010686 3300025901 Bacteria 4996
165 Ga0207680_10024971 3300025903 Bacteria 3289
166 Ga0207685_10002387 3300025905 Bacteria 4289
167 Ga0207685_10003173 3300025905 Bacteria 3946
168 Ga0207685_10088056 3300025905 Bacteria 1301
169 Ga0207699_10000446 3300025906 Bacteria 21144
170 Ga0207699_10000563 3300025906 Bacteria 18306
171 Ga0207699_10000829 3300025906 Bacteria 14705
172 Ga0207699_10003388 3300025906 Bacteria 7600
173 Ga0207699_10015622 3300025906 Bacteria 3948
174 Ga0207699_10039319 3300025906 Bacteria 2717
175 Ga0207699_10073926 3300025906 Bacteria 2092
176 Ga0207699_10168067 3300025906 Bacteria 1465
177 Ga0207645_10065213 3300025907 Bacteria 2327
178 Ga0207643_10030097 3300025908 Bacteria 3021
179 Ga0207684_10001618 3300025910 Bacteria 23905
180 Ga0207684_10002393 3300025910 Bacteria 18981
181 Ga0207684_10039423 3300025910 Bacteria 4007
182 Ga0207684_10050976 3300025910 Bacteria 3511
183 Ga0207684_10126107 3300025910 Bacteria 2197
184 Ga0207684_10134300 3300025910 Bacteria 2124
185 Ga0207684_10175753 3300025910 Bacteria 1846
186 Ga0207684_10239876 3300025910 Bacteria 1564
187 Ga0207684_10446368 3300025910 Bacteria 1111
188 Ga0207707_10027336 3300025912 Bacteria 4990
189 Ga0207707_10257049 3300025912 Bacteria 1516
190 Ga0207707_10452165 3300025912 Bacteria 1099
191 Ga0207693_10018227 3300025915 Bacteria 5593
192 Ga0207693_10041001 3300025915 Bacteria 3646
193 Ga0207693_10113589 3300025915 Bacteria 2125
194 Ga0207693_10125945 3300025915 Bacteria 2014
195 Ga0207693_10243551 3300025915 Bacteria 1411
196 Ga0207663_10001119 3300025916 Bacteria 12327
197 Ga0207663_10005217 3300025916 Bacteria 6538
198 Ga0207663_10044674 3300025916 Bacteria 2721
199 Ga0207663_10052332 3300025916 Bacteria 2546
200 Ga0207657_10057686 3300025919 Bacteria 3345
201 Ga0207649_10079747 3300025920 Bacteria 2115
202 Ga0207652_10057211 3300025921 Bacteria 3358
203 Ga0207652_10108366 3300025921 Bacteria 2461
204 Ga0207646_10000470 3300025922 Bacteria 53859
205 Ga0207646_10001715 3300025922 Bacteria 26634
206 Ga0207646_10011732 3300025922 Bacteria 8470
207 Ga0207646_10018634 3300025922 Bacteria 6472
208 Ga0207646_10291039 3300025922 Bacteria 1476
209 Ga0207700_10000891 3300025928 Bacteria 17200
210 Ga0207700_10004620 3300025928 Bacteria 8153
211 Ga0207700_10008058 3300025928 Bacteria 6497
212 Ga0207700_10012751 3300025928 Bacteria 5435
213 Ga0207700_10013250 3300025928 Bacteria 5356
214 Ga0207700_10016381 3300025928 Bacteria 4923
215 Ga0207700_10038639 3300025928 Bacteria 3466
216 Ga0207700_10059302 3300025928 Bacteria 2894
217 Ga0207700_10386641 3300025928 Bacteria 1224
218 Ga0207664_10000224 3300025929 Bacteria 42785
219 Ga0207664_10005359 3300025929 Bacteria 8762
220 Ga0207664_10005791 3300025929 Bacteria 8451
221 Ga0207664_10006025 3300025929 Bacteria 8299
222 Ga0207664_10011377 3300025929 Bacteria 6321
223 Ga0207664_10012680 3300025929 Bacteria 6031
224 Ga0207664_10033493 3300025929 Bacteria 3947
225 Ga0207664_10129162 3300025929 Bacteria 2125
226 Ga0207664_10131254 3300025929 Bacteria 2109
227 Ga0207664_10134532 3300025929 Bacteria 2085
228 Ga0207664_10254658 3300025929 Bacteria 1533
229 Ga0207664_10259524 3300025929 Bacteria 1519
230 Ga0207644_10072463 3300025931 Bacteria 2523
231 Ga0207665_10000786 3300025939 Bacteria 21382
232 Ga0207665_10000882 3300025939 Bacteria 20246
233 Ga0207665_10003733 3300025939 Bacteria 10178
234 Ga0207665_10003910 3300025939 Bacteria 9970
235 Ga0207665_10008276 3300025939 Bacteria 6866
236 Ga0207665_10165935 3300025939 Bacteria 1592
237 Ga0207665_10198216 3300025939 Bacteria 1462
238 Ga0207665_10265994 3300025939 Bacteria 1272
239 Ga0207691_10043717 3300025940 Bacteria 4127
240 Ga0207689_10013841 3300025942 Bacteria 6874
241 Ga0207661_10024207 3300025944 Bacteria 4599
242 Ga0207661_10102770 3300025944 Bacteria 2404
243 Ga0207661_10344993 3300025944 Bacteria 1342
244 Ga0207679_10098501 3300025945 Bacteria 2280
245 Ga0207651_10129231 3300025960 Bacteria 1931
246 Ga0207658_10210997 3300025986 Bacteria 1627
247 Ga0207677_10040536 3300026023 Bacteria 3071
248 Ga0207678_10000248 3300026067 Bacteria 48560
249 Ga0207678_10044649 3300026067 Bacteria 3833
250 Ga0207678_10062668 3300026067 Bacteria 3196
251 Ga0207678_10082610 3300026067 Bacteria 2749
252 Ga0207702_10027569 3300026078 Bacteria 4717
253 Ga0207702_10298704 3300026078 Bacteria 1528
254 Ga0207648_10445194 3300026089 Bacteria 1179
255 Ga0207676_10013845 3300026095 Bacteria 5791
256 Ga0207674_10059346 3300026116 Bacteria 3871
257 Ga0207674_10076793 3300026116 Bacteria 3348
258 Ga0207674_10252945 3300026116 Bacteria 1709
259 Ga0207675_100034633 3300026118 Bacteria 4709
260 Ga0207683_10016543 3300026121 Bacteria 6278
261 Ga0207428_10171894 3300027907 Bacteria 1641
262 Ga0268266_10148750 3300028379 Bacteria 2109
263 Ga0268264_10342306 3300028381 Bacteria 1421
264 Ga0265326_10000784 3300028558 Bacteria 11757
265 Ga0265319_1000235 3300028563 Bacteria 41448
266 Ga0265334_10000374 3300028573 Bacteria 23952
267 Ga0265318_10037578 3300028577 Bacteria 1854
268 Ga0265323_10001596 3300028653 Bacteria 10937
269 Ga0265322_10002045 3300028654 Bacteria 6348
270 Ga0265336_10002957 3300028666 Bacteria 6799
271 Ga0265338_10000986 3300028800 Bacteria 47980
272 Ga0265338_10004621 3300028800 Bacteria 18508
273 Ga0265338_10006079 3300028800 Bacteria 15500
274 Ga0265338_10009124 3300028800 Bacteria 11914
275 Ga0265324_10000535 3300029957 Bacteria 26053
276 Ga0265332_10000225 3300031238 Bacteria 45458
277 Ga0265320_10000621 3300031240 Bacteria 27147
278 Ga0265325_10023000 3300031241 Bacteria 3408
279 Ga0265340_10000525 3300031247 Bacteria 21125
280 Ga0265339_10003503 3300031249 Bacteria 10966
281 Ga0265316_10026666 3300031344 Bacteria 4800
282 Ga0307513_10002805 3300031456 Bacteria 23900
283 Ga0265313_10009449 3300031595 Bacteria 6331
284 Ga0265314_10001593 3300031711 Bacteria 24946
285 Ga0265342_10003335 3300031712 Bacteria 13254
286 Ga0316576_10064077 3300031727 Bacteria 2699
287 Ga0316578_10020449 3300031728 Bacteria 3658
288 Ga0307413_10076820 3300031824 Bacteria 2124
289 Ga0307410_10188909 3300031852 Bacteria 1565
290 Ga0307410_10281961 3300031852 Bacteria 1304
291 Ga0307409_100038159 3300031995 Bacteria 3550
292 Ga0307409_100229412 3300031995 Bacteria 1682
293 Ga0307416_100010532 3300032002 Bacteria 6113
294 Ga0307416_100269233 3300032002 Bacteria 1671
295 Ga0307416_100296090 3300032002 Bacteria 1605
296 Ga0307411_10004211 3300032005 Bacteria 6842
297 Ga0307415_100076642 3300032126 Bacteria 2371
298 Ga0307415_100107421 3300032126 Bacteria 2062
299 Ga0307415_100221540 3300032126 Bacteria 1517
300 Ga0307507_10006423 3300033179 Bacteria 18062
301 Ga0307510_10035918 3300033180 Bacteria 5524
302 Ga0316212_1003253 3300033547 Bacteria 2340
303 Ga0373930_0001178 3300034816 Bacteria 3834
304 Ga0373938_0003804 3300034957 Bacteria 2492
305 Ga0373926_0006644 3300035083 Bacteria 3838
306 Ga0373926_0018293 3300035083 Bacteria 2408
307 Ga0373934_0000159 3300035086 Bacteria 24489
308 Ga0373934_0007737 3300035086 Bacteria 3994
309 Ga0373934_0015020 3300035086 Bacteria 2936
310 Ga0373934_0075102 3300035086 Bacteria 1354
311 Ga0373934_0101136 3300035086 Bacteria 1165
312 Ga0373944_0000075 3300035089 Bacteria 16922
313 Ga0373944_0002184 3300035089 Bacteria 4979
314 Ga0373944_0025259 3300035089 Bacteria 1748
315 Ga0373923_0004555 3300035111 Bacteria 4611
316 Ga0373923_0015425 3300035111 Bacteria 2884
317 Ga0373923_0020174 3300035111 Bacteria 2586
318 Ga0373936_0000658 3300035113 Bacteria 11970
319 Ga0373936_0000869 3300035113 Bacteria 10781
320 Ga0373936_0004327 3300035113 Bacteria 5368
321 Ga0373936_0026351 3300035113 Bacteria 2276
322 Ga0373936_0034695 3300035113 Bacteria 2006
323 Ga0373941_0018312 3300035115 Bacteria 1933
324 Ga0373941_0022921 3300035115 Bacteria 1777
325 Ga0373945_0000067 3300035116 Bacteria 23561
326 Ga0373945_0120000 3300035116 Bacteria 1045
327 Ga0373953_0000089 3300035117 Bacteria 21678
328 Ga0373953_0004371 3300035117 Bacteria 4499
329 Ga0373953_0031725 3300035117 Bacteria 2056
330 Ga0373953_0052619 3300035117 Bacteria 1648
331 Ga0373953_0071870 3300035117 Bacteria 1428
332 Ga0373954_0009771 3300035118 Bacteria 4223
333 Ga0373954_0014957 3300035118 Bacteria 3463
334 Ga0373954_0018042 3300035118 Bacteria 3174
335 Ga0373954_0023241 3300035118 Bacteria 2817
336 Ga0373954_0123655 3300035118 Bacteria 1257
337 Ga0373956_0004682 3300035119 Bacteria 5468
338 Ga0373956_0009048 3300035119 Bacteria 4038
339 Ga0373956_0018381 3300035119 Bacteria 2959
340 Ga0373956_0128086 3300035119 Bacteria 1187
341 Ga0373956_0178041 3300035119 Bacteria 1005
342 Ga0373957_0000438 3300035120 Bacteria 10448
343 Ga0373957_0010754 3300035120 Bacteria 3035
344 Ga0373957_0014026 3300035120 Bacteria 2732
345 Ga0373943_0001486 3300035170 Bacteria 10622
346 Ga0373943_0009966 3300035170 Bacteria 4259
347 Ga0373943_0055712 3300035170 Bacteria 1959
348 Ga0373946_0000202 3300035171 Bacteria 18459
349 Ga0373946_0058651 3300035171 Bacteria 1631
350 Ga0373946_0081526 3300035171 Bacteria 1417
351 Ga0373955_0000024 3300035172 Bacteria 60102
352 Ga0373955_0009966 3300035172 Bacteria 4471
353 Ga0373955_0018957 3300035172 Bacteria 3431
354 Ga0373955_0050746 3300035172 Bacteria 2257
355 Ga0373955_0075410 3300035172 Bacteria 1895
356 Ga0373955_0198687 3300035172 Bacteria 1193
357 Ga0373962_0045062 3300035242 Bacteria 1255
358 Ga0316574_0092496 3300035398 Bacteria 1930
359 Ga0373924_0001904 3300035410 Bacteria 6931
360 Ga0373924_0015754 3300035410 Bacteria 2878
361 Ga0373924_0039916 3300035410 Bacteria 1919
362 Ga0373924_0091688 3300035410 Bacteria 1300
363 Ga0373924_0121162 3300035410 Bacteria 1135
364 Ga0373931_0140175 3300035691 Bacteria 1400
365 Ga0373931_0201794 3300035691 Bacteria 1188
366 Ga0373935_0023766 3300035692 Bacteria 3765
367 Ga0373935_0047093 3300035692 Bacteria 2725
368 Ga0373935_0050424 3300035692 Bacteria 2641
369 Ga0373935_0144653 3300035692 Bacteria 1608
370 Ga0373927_0000281 3300035695 Bacteria 40043
371 Ga0373927_0006482 3300035695 Bacteria 7971
372 Ga0373927_0067045 3300035695 Bacteria 2322
373 Ga0373933_0000153 3300035724 Bacteria 44821
374 Ga0373933_0003103 3300035724 Bacteria 9265
375 Ga0373933_0003186 3300035724 Bacteria 9160
376 Ga0373933_0039109 3300035724 Bacteria 2789
377 Ga0373933_0099413 3300035724 Bacteria 1803
378 Ga0373933_0099600 3300035724 Bacteria 1802
379 Ga0373947_0000002 3300035725 Bacteria 383924
380 Ga0373947_0000793 3300035725 Bacteria 19007
381 Ga0373947_0016645 3300035725 Bacteria 4224
382 Ga0373947_0065562 3300035725 Bacteria 2215
383 Ga0373947_0090750 3300035725 Bacteria 1905
384 Ga0373947_0178481 3300035725 Bacteria 1381
385 Ga0373947_0196726 3300035725 Bacteria 1317
386 Ga0373937_0000333 3300036401 Bacteria 44782
387 Ga0373937_0006376 3300036401 Bacteria 10178
388 Ga0373937_0015734 3300036401 Bacteria 6699
389 Ga0373937_0018453 3300036401 Bacteria 6230
390 Ga0373937_0018617 3300036401 Bacteria 6203
391 Ga0373937_0083059 3300036401 Bacteria 2963
392 Ga0373937_0312084 3300036401 Bacteria 1487
393 Ga0372808_005037 3300036459 Bacteria 1722
394 Ga0316584_0170690 3300036712 Bacteria 1613
395 Ga0373925_0002004 3300037068 Bacteria 16877
396 Ga0373925_0004641 3300037068 Bacteria 10374
397 Ga0373925_0004888 3300037068 Bacteria 10084
398 Ga0373925_0041056 3300037068 Bacteria 3427
399 Ga0373925_0075068 3300037068 Bacteria 2561
400 Ga0373925_0082540 3300037068 Bacteria 2446
401 Ga0373925_0106044 3300037068 Bacteria 2166
402 Ga0373925_0123952 3300037068 Bacteria 2008
403 Ga0373925_0266745 3300037068 Bacteria 1376
404 Ga0395900_0020198 3300037418 Bacteria 6797
405 Ga0395898_0164765 3300037466 Bacteria 2120
406 Ga0436364_0024071 3300037853 Bacteria 5468
407 Ga0436364_0086889 3300037853 Bacteria 54583
408 Ga0436364_0185475 3300037853 Bacteria 22963
409 Ga0436364_0319187 3300037853 Bacteria 1979
410 Ga0436364_0508196 3300037853 Bacteria 6293
411 Ga0436364_0789302 3300037853 Bacteria 5258
412 Ga0436364_0838834 3300037853 Bacteria 3029
413 Ga0436364_1268560 3300037853 Bacteria 2008
414 Ga0395901_0012456 3300038443 Bacteria 8631
415 Ga0436361_0712461 3300039447 Bacteria 968
416 Ga0436363_0123638 3300039450 Bacteria 3610
417 Ga0436362_0802341 3300039453 Bacteria 1026
418 Ga0451797_1022337 3300041453 Bacteria 1329
419 Ga0466966_0016405 3300044684 Bacteria 4895
420 Ga0466966_0161462 3300044684 Bacteria 1364
421 Ga0466961_0060354 3300044693 Bacteria 2411
422 Ga0466963_0085983 3300044694 Bacteria 2136
423 Ga0466963_0088295 3300044694 Bacteria 2109
424 Ga0466963_0158470 3300044694 Bacteria 1575
425 Ga0466963_0173756 3300044694 Bacteria 1503
426 Ga0466971_0012412 3300044719 Bacteria 3733
427 Ga0466970_0035109 3300044765 Bacteria 2657
428 Ga0466960_0198286 3300044901 Bacteria 1095
429 Ga0466960_0202586 3300044901 Bacteria 1085
430 Ga0466959_0025353 3300045049 Bacteria 4394
431 Ga0466959_0158798 3300045049 Bacteria 1590
432 Ga0466958_0008864 3300045836 Bacteria 5589
433 Ga0466967_0036146 3300045976 Bacteria 4214
434 Ga0466967_0041438 3300045976 Bacteria 3970
435 Ga0466967_0063218 3300045976 Bacteria 3288
436 Ga0466967_0113449 3300045976 Bacteria 2493
437 Ga0466967_0418207 3300045976 Bacteria 1306
438 Ga0495592_0000304 3300046454 Bacteria 41482
439 Ga0495592_0010307 3300046454 Bacteria 7045
440 Ga0495592_0040207 3300046454 Bacteria 3509
441 Ga0495592_0054148 3300046454 Bacteria 2973
442 Ga0495592_0126492 3300046454 Bacteria 1792
443 Ga0495592_0131181 3300046454 Bacteria 1752
444 Ga0495603_0021873 3300046455 Bacteria 3872
445 Ga0495603_0027264 3300046455 Bacteria 3448
446 Ga0495603_0131661 3300046455 Bacteria 1456
447 Ga0495629_0001760 3300046459 Bacteria 16982
448 Ga0495629_0005374 3300046459 Bacteria 9560
449 Ga0495629_0017003 3300046459 Bacteria 5218
450 Ga0495629_0022645 3300046459 Bacteria 4477
451 Ga0495629_0042465 3300046459 Bacteria 3195
452 Ga0495641_0005130 3300046461 Bacteria 8966
453 Ga0495641_0005560 3300046461 Bacteria 8461
454 Ga0495641_0021555 3300046461 Bacteria 3240
455 Ga0495641_0030028 3300046461 Bacteria 2612
456 Ga0495641_0162921 3300046461 Bacteria 997
457 Ga0495651_0000252 3300046462 Bacteria 41425
458 Ga0495651_0002138 3300046462 Bacteria 15283
459 Ga0495651_0011089 3300046462 Bacteria 6930
460 Ga0495651_0021691 3300046462 Bacteria 4992
461 Ga0495651_0023401 3300046462 Bacteria 4803
462 Ga0495651_0032595 3300046462 Bacteria 4062
463 Ga0495651_0069936 3300046462 Bacteria 2671
464 Ga0495651_0083604 3300046462 Bacteria 2406
465 Ga0495651_0308360 3300046462 Bacteria 1059
466 Ga0495653_0001719 3300046463 Bacteria 17248
467 Ga0495653_0008333 3300046463 Bacteria 8497
468 Ga0495653_0010622 3300046463 Bacteria 7535
469 Ga0495653_0012189 3300046463 Bacteria 7014
470 Ga0495653_0038051 3300046463 Bacteria 3777
471 Ga0495653_0061928 3300046463 Bacteria 2828
472 Ga0495653_0073379 3300046463 Bacteria 2553
473 Ga0495653_0084554 3300046463 Bacteria 2336
474 Ga0495580_0017409 3300046472 Bacteria 5376
475 Ga0495582_0000170 3300046473 Bacteria 35330
476 Ga0495582_0006336 3300046473 Bacteria 6581
477 Ga0495582_0006953 3300046473 Bacteria 6291
478 Ga0495582_0008724 3300046473 Bacteria 5590
479 Ga0495639_0008262 3300046475 Bacteria 4468
480 Ga0495639_0011896 3300046475 Bacteria 3753
481 Ga0495639_0077951 3300046475 Bacteria 1539
482 Ga0495662_0006551 3300046476 Bacteria 5814
483 Ga0495662_0008050 3300046476 Bacteria 5191
484 Ga0495662_0019779 3300046476 Bacteria 3257
485 Ga0495662_0025748 3300046476 Bacteria 2840
486 Ga0495662_0162506 3300046476 Bacteria 1100
487 Ga0495664_0000599 3300046477 Bacteria 18284
488 Ga0495664_0009930 3300046477 Bacteria 5337
489 Ga0495664_0011357 3300046477 Bacteria 5019
490 Ga0495664_0013115 3300046477 Bacteria 4700
491 Ga0495664_0015657 3300046477 Bacteria 4313
492 Ga0495664_0063161 3300046477 Bacteria 2206
493 Ga0495664_0068708 3300046477 Bacteria 2114
494 Ga0495594_0050605 3300046499 Bacteria 2285
495 Ga0495594_0125521 3300046499 Bacteria 1452
496 Ga0495608_0000101 3300046511 Bacteria 61678
497 Ga0495608_0000839 3300046511 Bacteria 21479
498 Ga0495608_0014598 3300046511 Bacteria 5450
499 Ga0495608_0062096 3300046511 Bacteria 2455
500 Ga0495608_0099691 3300046511 Bacteria 1873
501 Ga0495608_0127546 3300046511 Bacteria 1629
502 Ga0495618_0016506 3300046514 Bacteria 4518
503 Ga0495618_0018264 3300046514 Bacteria 4305
504 Ga0495618_0019669 3300046514 Bacteria 4155
505 Ga0495618_0026002 3300046514 Bacteria 3635
506 Ga0495628_0000327 3300046516 Bacteria 43068
507 Ga0495628_0012903 3300046516 Bacteria 7036
508 Ga0495628_0017420 3300046516 Bacteria 5982
509 Ga0495628_0085074 3300046516 Bacteria 2454
510 Ga0495628_0088682 3300046516 Bacteria 2396
511 Ga0495628_0237378 3300046516 Bacteria 1364
512 Ga0495628_0316839 3300046516 Bacteria 1151
513 Ga0495630_0010732 3300046517 Bacteria 6614
514 Ga0495630_0026872 3300046517 Bacteria 4264
515 Ga0495630_0037601 3300046517 Bacteria 3619
516 Ga0495630_0079075 3300046517 Bacteria 2480
517 Ga0495630_0083624 3300046517 Bacteria 2410
518 Ga0495630_0105622 3300046517 Bacteria 2132
519 Ga0495630_0227664 3300046517 Bacteria 1424
520 Ga0495630_0241311 3300046517 Bacteria 1381
521 Ga0495666_0036024 3300046526 Bacteria 2410
522 Ga0495666_0036327 3300046526 Bacteria 2399
523 Ga0495666_0043575 3300046526 Bacteria 2167
524 Ga0495666_0059048 3300046526 Bacteria 1834
525 Ga0495652_0000775 3300046529 Bacteria 36861
526 Ga0495652_0005238 3300046529 Bacteria 12249
527 Ga0495652_0020665 3300046529 Bacteria 5852
528 Ga0495652_0025699 3300046529 Bacteria 5205
529 Ga0495652_0077246 3300046529 Bacteria 2760
530 Ga0495652_0082199 3300046529 Bacteria 2656
531 Ga0495652_0084539 3300046529 Bacteria 2609
532 Ga0495652_0101328 3300046529 Bacteria 2334
533 Ga0495652_0132979 3300046529 Bacteria 1966
534 Ga0495652_0214721 3300046529 Bacteria 1449
535 Ga0495665_0001675 3300046531 Bacteria 11893
536 Ga0495665_0006142 3300046531 Bacteria 6489
537 Ga0495665_0047625 3300046531 Bacteria 2274
538 Ga0495665_0059618 3300046531 Bacteria 2014
539 Ga0495640_0016998 3300046533 Bacteria 5430
540 Ga0495640_0033340 3300046533 Bacteria 3659
541 Ga0495640_0037892 3300046533 Bacteria 3397
542 Ga0495640_0045625 3300046533 Bacteria 3040
543 Ga0495640_0069489 3300046533 Bacteria 2368
544 Ga0495640_0078904 3300046533 Bacteria 2192
545 Ga0495586_0000770 3300046535 Bacteria 18403
546 Ga0495586_0032003 3300046535 Bacteria 2819
547 Ga0495587_0000228 3300046536 Bacteria 41527
548 Ga0495587_0009908 3300046536 Bacteria 6081
549 Ga0495587_0014596 3300046536 Bacteria 4922
550 Ga0495587_0015977 3300046536 Bacteria 4672
551 Ga0495587_0040454 3300046536 Bacteria 2786
552 Ga0495587_0069686 3300046536 Bacteria 2047
553 Ga0495645_0004770 3300046543 Bacteria 9264
554 Ga0495645_0016394 3300046543 Bacteria 5288
555 Ga0495645_0022860 3300046543 Bacteria 4525
556 Ga0495645_0046798 3300046543 Bacteria 3153
557 Ga0495645_0076362 3300046543 Bacteria 2410
558 Ga0495645_0104236 3300046543 Bacteria 2014
559 Ga0495645_0127914 3300046543 Bacteria 1783
560 Ga0495645_0167411 3300046543 Bacteria 1515
561 Ga0495667_0000281 3300046559 Bacteria 33057
562 Ga0495667_0000742 3300046559 Bacteria 20968
563 Ga0495667_0022555 3300046559 Bacteria 4241
564 Ga0495667_0028667 3300046559 Bacteria 3749
565 Ga0495667_0044082 3300046559 Bacteria 2954
566 Ga0495667_0046493 3300046559 Bacteria 2870
567 Ga0495667_0053794 3300046559 Bacteria 2650
568 Ga0495667_0055691 3300046559 Bacteria 2600
569 Ga0495634_0002978 3300046642 Bacteria 13815
570 Ga0495634_0005158 3300046642 Bacteria 10089
571 Ga0495634_0014358 3300046642 Bacteria 5715
572 Ga0495634_0047925 3300046642 Bacteria 2878
573 Ga0495634_0086480 3300046642 Bacteria 2042
574 Ga0495634_0173599 3300046642 Bacteria 1353
575 Ga0495634_0197209 3300046642 Bacteria 1252
576 Ga0495635_0002055 3300046663 Bacteria 13637
577 Ga0495635_0010435 3300046663 Bacteria 6497
578 Ga0495635_0015511 3300046663 Bacteria 5325
579 Ga0495635_0030979 3300046663 Bacteria 3715
580 Ga0495635_0039866 3300046663 Bacteria 3247
581 Ga0495635_0040457 3300046663 Bacteria 3221
582 Ga0495635_0061600 3300046663 Bacteria 2577
583 Ga0495635_0129509 3300046663 Bacteria 1720
584 Ga0495635_0168354 3300046663 Bacteria 1490
585 Ga0495588_0053162 3300046674 Bacteria 2088
586 Ga0495657_0000156 3300046675 Bacteria 61702
587 Ga0495657_0000699 3300046675 Bacteria 30085
588 Ga0495657_0010513 3300046675 Bacteria 6963
589 Ga0495657_0014848 3300046675 Bacteria 5714
590 Ga0495657_0036799 3300046675 Bacteria 3379
591 Ga0495657_0044847 3300046675 Bacteria 3003
592 Ga0495657_0065967 3300046675 Bacteria 2379
593 Ga0495657_0068044 3300046675 Bacteria 2335
594 Ga0495657_0070479 3300046675 Bacteria 2284
595 Ga0495599_0000097 3300046678 Bacteria 61561
596 Ga0495599_0017903 3300046678 Bacteria 4411
597 Ga0495599_0042915 3300046678 Bacteria 2838
598 Ga0495599_0047629 3300046678 Bacteria 2687
599 Ga0495599_0057864 3300046678 Bacteria 2425
600 Ga0495599_0069504 3300046678 Bacteria 2197
601 Ga0495599_0079535 3300046678 Bacteria 2047
602 Ga0495599_0096107 3300046678 Bacteria 1847
603 Ga0495623_0000471 3300046679 Bacteria 26602
604 Ga0495623_0012270 3300046679 Bacteria 5549
605 Ga0495623_0025222 3300046679 Bacteria 3829
606 Ga0495623_0026024 3300046679 Bacteria 3768
607 Ga0495623_0054938 3300046679 Bacteria 2511
608 Ga0495623_0108609 3300046679 Bacteria 1684
609 Ga0495646_0027767 3300046680 Bacteria 3548
610 Ga0495646_0040299 3300046680 Bacteria 2877
611 Ga0495646_0043835 3300046680 Bacteria 2737
612 Ga0495646_0057155 3300046680 Bacteria 2336
613 Ga0495647_0003856 3300046681 Bacteria 4830
614 Ga0495647_0044458 3300046681 Bacteria 1703
615 Ga0495658_0004488 3300046683 Bacteria 6867
616 Ga0495658_0007391 3300046683 Bacteria 5434
617 Ga0495658_0030966 3300046683 Bacteria 2909
618 Ga0495613_0008412 3300046689 Bacteria 7661
619 Ga0495613_0016300 3300046689 Bacteria 5537
620 Ga0495613_0026830 3300046689 Bacteria 4289
621 Ga0495613_0094101 3300046689 Bacteria 2168
622 Ga0495624_0002573 3300046690 Bacteria 13711
623 Ga0495624_0030199 3300046690 Bacteria 3531
624 Ga0495624_0056672 3300046690 Bacteria 2465
625 Ga0495624_0076136 3300046690 Bacteria 2082
626 Ga0495600_0008139 3300046809 Bacteria 6433
627 Ga0495600_0042917 3300046809 Bacteria 2948
628 Ga0495600_0078532 3300046809 Bacteria 2155
629 Ga0495600_0083181 3300046809 Bacteria 2089
630 Ga0495600_0168474 3300046809 Bacteria 1414
631 Ga0495600_0239586 3300046809 Bacteria 1156
632 Ga0495581_0008289 3300047315 Bacteria 6024
633 Ga0495581_0017563 3300047315 Bacteria 4155
634 Ga0495581_0041389 3300047315 Bacteria 2666
635 Ga0495604_0000196 3300047317 Bacteria 54755
636 Ga0495604_0008600 3300047317 Bacteria 8067
637 Ga0495604_0010017 3300047317 Bacteria 7504
638 Ga0495604_0017300 3300047317 Bacteria 5769
639 Ga0495604_0176505 3300047317 Bacteria 1497
640 Ga0495604_0178415 3300047317 Bacteria 1487
641 Ga0495674_0000849 3300047319 Bacteria 29202
642 Ga0495674_0001294 3300047319 Bacteria 24309
643 Ga0495674_0006999 3300047319 Bacteria 10789
644 Ga0495674_0019700 3300047319 Bacteria 6257
645 Ga0495674_0039622 3300047319 Bacteria 4221
646 Ga0495674_0081079 3300047319 Bacteria 2783
647 Ga0495674_0315112 3300047319 Bacteria 1275
648 Ga0495676_0015518 3300047321 Bacteria 6780
649 Ga0495676_0078730 3300047321 Bacteria 2508
650 Ga0495680_0000226 3300047322 Bacteria 61646
651 Ga0495680_0006561 3300047322 Bacteria 10798
652 Ga0495680_0010774 3300047322 Bacteria 8144
653 Ga0495680_0025569 3300047322 Bacteria 4883
654 Ga0495680_0028154 3300047322 Bacteria 4609
655 Ga0495680_0037933 3300047322 Bacteria 3856
656 Ga0495680_0064653 3300047322 Bacteria 2804
657 Ga0495680_0067018 3300047322 Bacteria 2745
658 Ga0495680_0123848 3300047322 Bacteria 1906
659 Ga0495680_0271414 3300047322 Bacteria 1197
660 Ga0495675_0002108 3300047444 Bacteria 11865
661 Ga0495675_0002898 3300047444 Bacteria 10300
662 Ga0495675_0011132 3300047444 Bacteria 5640
663 Ga0495684_0001960 3300047471 Bacteria 16540
664 Ga0495684_0005679 3300047471 Bacteria 9716
665 Ga0495684_0007105 3300047471 Bacteria 8689
666 Ga0495684_0031536 3300047471 Bacteria 4069
667 Ga0495684_0067939 3300047471 Bacteria 2710
668 Ga0495684_0069081 3300047471 Bacteria 2686
669 Ga0495684_0073022 3300047471 Bacteria 2606
670 Ga0495684_0092719 3300047471 Bacteria 2287
671 Ga0495684_0133570 3300047471 Bacteria 1862
672 Ga0495593_0000136 3300047673 Bacteria 35468
673 Ga0495593_0003456 3300047673 Bacteria 9461
674 Ga0495593_0019355 3300047673 Bacteria 3817
675 Ga0495593_0021281 3300047673 Bacteria 3624
676 Ga0495602_0000172 3300048088 Bacteria 60316
677 Ga0495602_0068898 3300048088 Bacteria 3036
678 Ga0495602_0071319 3300048088 Bacteria 2967
679 Ga0495602_0131576 3300048088 Bacteria 1994
680 Ga0495602_0150837 3300048088 Bacteria 1827
681 Ga0495602_0162280 3300048088 Bacteria 1743
682 Ga0495602_0248870 3300048088 Bacteria 1325
683 Ga0495614_0005800 3300048089 Bacteria 5563
684 Ga0495614_0026542 3300048089 Bacteria 2497
685 Ga0496100_0037975 3300048903 Bacteria 3049
686 Ga0496100_0127913 3300048903 Bacteria 1785
687 Ga0496100_0149208 3300048903 Bacteria 1665
688 Ga0496101_0068244 3300048904 Bacteria 2599
689 Ga0496101_0076351 3300048904 Bacteria 2468
690 Ga0496101_0088950 3300048904 Bacteria 2294
691 Ga0496102_0094771 3300048905 Bacteria 2766
692 Ga0496102_0253894 3300048905 Bacteria 1658
693 Ga0496103_0045674 3300048906 Bacteria 2702
694 Ga0496104_0016612 3300048907 Bacteria 6688
695 Ga0496104_0032704 3300048907 Bacteria 4841
696 Ga0496105_0005277 3300048908 Bacteria 9796
697 Ga0496105_0038817 3300048908 Bacteria 3923
698 Ga0496105_0096498 3300048908 Bacteria 2441
699 Ga0496105_0137873 3300048908 Bacteria 2009
700 Ga0496106_0070439 3300048909 Bacteria 2670
701 Ga0496108_0008607 3300048911 Bacteria 8275
702 Ga0496108_0008967 3300048911 Bacteria 8107
703 Ga0496109_0209077 3300048912 Bacteria 1835
704 Ga0496110_0015488 3300048913 Bacteria 6347
705 Ga0496110_0034760 3300048913 Bacteria 4368
706 Ga0496110_0072228 3300048913 Bacteria 3061
707 Ga0496110_0408330 3300048913 Bacteria 1238
708 Ga0496111_0030500 3300048914 Bacteria 3834
709 Ga0496111_0030672 3300048914 Bacteria 3824
710 Ga0496111_0176556 3300048914 Bacteria 1588
711 Ga0496113_0053761 3300048916 Bacteria 3011
712 Ga0496113_0318354 3300048916 Bacteria 1247
713 Ga0496113_0511876 3300048916 Bacteria 963
714 Ga0496114_0021193 3300048917 Bacteria 5285
715 Ga0496114_0060981 3300048917 Bacteria 3154
716 Ga0496114_0112501 3300048917 Bacteria 2334
717 Ga0496114_0127089 3300048917 Bacteria 2198
718 Ga0496115_0033734 3300048918 Bacteria 4042
719 Ga0496115_0091767 3300048918 Bacteria 2482
720 Ga0496115_0154748 3300048918 Bacteria 1894
721 Ga0496115_0219651 3300048918 Bacteria 1568
722 Ga0501034_0006125 3300049571 Bacteria 12977
723 Ga0501036_0015733 3300049572 Bacteria 6318
724 Ga0501039_0026765 3300049575 Bacteria 4432
725 Ga0501042_0273122 3300049578 Bacteria 1220
726 Ga0501043_0011729 3300049579 Bacteria 6862
727 Ga0501043_0128347 3300049579 Bacteria 1988
728 Ga0501047_0016843 3300049581 Bacteria 6984
729 Ga0501047_0052858 3300049581 Bacteria 3927
730 Ga0501048_0002555 3300049582 Bacteria 13931
731 Ga0501070_0016609 3300049586 Bacteria 6183
732 Ga0501071_0001502 3300049587 Bacteria 13562
733 Ga0501074_0010957 3300049590 Bacteria 6582
734 Ga0501045_0079731 3300049824 Bacteria 2414
735 nmdc:mga05p37_50945_c1 3300050507 Bacteria 5092
736 nmdc:mga08y16_318615_c1 3300050511 Bacteria 1601
737 nmdc:mga0n895_243142_c1 3300050512 Bacteria 1827
738 nmdc:mga0n895_287565_c1 3300050512 Bacteria 1667
739 nmdc:mga0rr50_11102_c1 3300050513 Bacteria 4767
740 nmdc:mga0rr50_201197_c1 3300050513 Bacteria 1637
741 nmdc:mga0rr50_50841_c1 3300050513 Bacteria 3073
742 nmdc:mga08x19_150755_c1 3300050514 Bacteria 1574
743 nmdc:mga08x19_8618_c1 3300050514 Bacteria 6077
744 nmdc:mga0a205_15328_c1 3300050515 Bacteria 7162
745 nmdc:mga0a205_55652_c1 3300050515 Bacteria 3821
746 Ga0495601_0063692 3300053077 Bacteria 2343
747 Ga0495601_0080485 3300053077 Bacteria 2090
748 Ga0495612_0009756 3300053078 Bacteria 3889
749 Ga0495612_0010475 3300053078 Bacteria 3748
750 Ga0495612_0073500 3300053078 Bacteria 1428
751 Ga0495595_0001862 3300053084 Bacteria 8185
752 Ga0495595_0021214 3300053084 Bacteria 2835
753 Ga0495595_0027349 3300053084 Bacteria 2541
754 Ga0495595_0028808 3300053084 Bacteria 2481
755 Ga0495595_0032393 3300053084 Bacteria 2354
756 Ga0495595_0127474 3300053084 Bacteria 1242
757 Ga0495619_0010100 3300053085 Bacteria 5944
758 Ga0495619_0065193 3300053085 Bacteria 2429
759 Ga0495619_0084816 3300053085 Bacteria 2138
760 Ga0495619_0172140 3300053085 Bacteria 1497
761 Ga0500616_0000781 3300053153 Bacteria 36581
762 Ga0501084_0111943 3300054114 Bacteria 2294
763 Ga0466962_0064072 3300061719 Bacteria 1755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0015488 Ga0496110_0015488_5570_6334 247
2 3300048916 Ga0496113_0318354 Ga0496113_0318354_13_819 257
3 3300048916 Ga0496113_0511876 Ga0496113_0511876_15_815 257
4 3300046690 Ga0495624_0056672 Ga0495624_0056672_1606_2445 261
5 3300048908 Ga0496105_0137873 Ga0496105_0137873_865_1689 262
6 3300035117 Ga0373953_0052619 Ga0373953_0052619_781_1638 267
7 3300050514 nmdc:mga08x19_150755_c1 nmdc:mga08x19_150755_c1_78_938 267
8 3300048909 Ga0496106_0070439 Ga0496106_0070439_1799_2650 274
9 3300044684 Ga0466966_0161462 Ga0466966_0161462_391_1299 275
10 3300044901 Ga0466960_0198286 Ga0466960_0198286_21_926 277
11 3300048914 Ga0496111_0030672 Ga0496111_0030672_14_868 277
12 3300028800 Ga0265338_10004621 Ga0265338_100046213 278
13 3300028800 Ga0265338_10009124 Ga0265338_100091244 281
14 3300035113 Ga0373936_0034695 Ga0373936_0034695_713_1651 283
15 3300035117 Ga0373953_0071870 Ga0373953_0071870_388_1326 283
16 3300035118 Ga0373954_0023241 Ga0373954_0023241_1129_2067 283
17 3300035119 Ga0373956_0009048 Ga0373956_0009048_810_1748 283
18 3300035172 Ga0373955_0018957 Ga0373955_0018957_437_1375 283
19 3300035725 Ga0373947_0090750 Ga0373947_0090750_951_1889 283
20 3300046454 Ga0495592_0010307 Ga0495592_0010307_3765_4703 283
21 3300046462 Ga0495651_0021691 Ga0495651_0021691_393_1331 283
22 3300046463 Ga0495653_0073379 Ga0495653_0073379_511_1449 283
23 3300046477 Ga0495664_0009930 Ga0495664_0009930_2921_3859 283
24 3300046514 Ga0495618_0019669 Ga0495618_0019669_1682_2620 283
25 3300046517 Ga0495630_0105622 Ga0495630_0105622_1128_2066 283
26 3300046529 Ga0495652_0084539 Ga0495652_0084539_1161_2099 283
27 3300046533 Ga0495640_0033340 Ga0495640_0033340_2253_3191 283
28 3300046536 Ga0495587_0009908 Ga0495587_0009908_4451_5389 283
29 3300046642 Ga0495634_0005158 Ga0495634_0005158_4720_5658 283
30 3300046663 Ga0495635_0040457 Ga0495635_0040457_1112_2050 283
31 3300046809 Ga0495600_0083181 Ga0495600_0083181_549_1487 283
32 3300047317 Ga0495604_0178415 Ga0495604_0178415_504_1442 283
33 3300047319 Ga0495674_0081079 Ga0495674_0081079_1719_2657 283
34 3300047471 Ga0495684_0031536 Ga0495684_0031536_500_1438 283
35 3300048088 Ga0495602_0150837 Ga0495602_0150837_379_1317 283
36 3300053153 Ga0500616_0000781 Ga0500616_0000781_30627_31556 283
37 3300037068 Ga0373925_0075068 Ga0373925_0075068_520_1455 284
38 3300048905 Ga0496102_0253894 Ga0496102_0253894_126_1061 285
39 3300005983 Ga0081540_1000601 Ga0081540_100060133 286
40 3300005435 Ga0070714_100011532 Ga0070714_1000115325 287
41 3300005445 Ga0070708_100010078 Ga0070708_1000100782 287
42 3300025928 Ga0207700_10016381 Ga0207700_100163814 287
43 3300005434 Ga0070709_10001791 Ga0070709_100017912 288
44 3300005436 Ga0070713_100043173 Ga0070713_1000431733 288
45 3300005437 Ga0070710_10000156 Ga0070710_1000015610 288
46 3300005439 Ga0070711_100001013 Ga0070711_10000101313 288
47 3300006028 Ga0070717_10017687 Ga0070717_100176873 288
48 3300006173 Ga0070716_100022958 Ga0070716_1000229583 288
49 3300021388 Ga0213875_10000758 Ga0213875_100007585 288
50 3300025898 Ga0207692_10009025 Ga0207692_100090253 288
51 3300025906 Ga0207699_10000563 Ga0207699_1000056318 288
52 3300025915 Ga0207693_10113589 Ga0207693_101135892 288
53 3300025916 Ga0207663_10001119 Ga0207663_100011198 288
54 3300025929 Ga0207664_10006025 Ga0207664_100060255 288
55 3300025939 Ga0207665_10000882 Ga0207665_1000088213 288
56 3300031995 Ga0307409_100229412 Ga0307409_1002294122 288
57 3300032002 Ga0307416_100269233 Ga0307416_1002692332 288
58 3300032002 Ga0307416_100296090 Ga0307416_1002960901 288
59 3300032126 Ga0307415_100107421 Ga0307415_1001074212 288
60 3300032126 Ga0307415_100221540 Ga0307415_1002215401 288
61 3300037853 Ga0436364_0086889 Ga0436364_0086889_41944_42873 288
62 3300028558 Ga0265326_10000784 Ga0265326_100007847 289
63 3300028563 Ga0265319_1000235 Ga0265319_100023525 289
64 3300028573 Ga0265334_10000374 Ga0265334_1000037417 289
65 3300028577 Ga0265318_10037578 Ga0265318_100375782 289
66 3300028653 Ga0265323_10001596 Ga0265323_100015964 289
67 3300028654 Ga0265322_10002045 Ga0265322_100020454 289
68 3300028666 Ga0265336_10002957 Ga0265336_100029575 289
69 3300028800 Ga0265338_10000986 Ga0265338_1000098612 289
70 3300029957 Ga0265324_10000535 Ga0265324_100005359 289
71 3300031238 Ga0265332_10000225 Ga0265332_1000022528 289
72 3300031240 Ga0265320_10000621 Ga0265320_1000062111 289
73 3300031241 Ga0265325_10023000 Ga0265325_100230004 289
74 3300031247 Ga0265340_10000525 Ga0265340_100005258 289
75 3300031249 Ga0265339_10003503 Ga0265339_100035033 289
76 3300031344 Ga0265316_10026666 Ga0265316_100266664 289
77 3300031595 Ga0265313_10009449 Ga0265313_100094493 289
78 3300031711 Ga0265314_10001593 Ga0265314_1000159316 289
79 3300031712 Ga0265342_10003335 Ga0265342_100033357 289
80 3300005435 Ga0070714_100330507 Ga0070714_1003305071 291
81 3300005436 Ga0070713_100400084 Ga0070713_1004000841 291
82 3300005445 Ga0070708_100283395 Ga0070708_1002833952 291
83 3300005467 Ga0070706_100012683 Ga0070706_1000126833 291
84 3300005468 Ga0070707_100013028 Ga0070707_1000130285 291
85 3300005471 Ga0070698_100013320 Ga0070698_1000133205 291
86 3300005471 Ga0070698_100073013 Ga0070698_1000730132 291
87 3300005536 Ga0070697_100060897 Ga0070697_1000608971 291
88 3300025910 Ga0207684_10050976 Ga0207684_100509763 291
89 3300025922 Ga0207646_10011732 Ga0207646_100117324 291
90 3300035171 Ga0373946_0058651 Ga0373946_0058651_97_1005 291
91 3300035410 Ga0373924_0039916 Ga0373924_0039916_360_1256 291
92 3300049572 Ga0501036_0015733 Ga0501036_0015733_5197_6126 291
93 3300049575 Ga0501039_0026765 Ga0501039_0026765_724_1653 291
94 3300049578 Ga0501042_0273122 Ga0501042_0273122_115_1044 291
95 3300049579 Ga0501043_0011729 Ga0501043_0011729_5038_5967 291
96 3300049582 Ga0501048_0002555 Ga0501048_0002555_485_1414 291
97 3300049590 Ga0501074_0010957 Ga0501074_0010957_472_1401 291
98 3300005445 Ga0070708_100365267 Ga0070708_1003652672 292
99 3300005536 Ga0070697_100054446 Ga0070697_1000544463 292
100 3300021388 Ga0213875_10108994 Ga0213875_101089942 292
101 3300035113 Ga0373936_0000658 Ga0373936_0000658_2837_3775 292
102 3300035724 Ga0373933_0039109 Ga0373933_0039109_1626_2564 292
103 3300036401 Ga0373937_0018617 Ga0373937_0018617_697_1635 292
104 3300037068 Ga0373925_0004888 Ga0373925_0004888_4906_5841 292
105 3300046454 Ga0495592_0040207 Ga0495592_0040207_2346_3284 292
106 3300046473 Ga0495582_0006336 Ga0495582_0006336_873_1811 292
107 3300046531 Ga0495665_0001675 Ga0495665_0001675_4775_5713 292
108 3300046543 Ga0495645_0127914 Ga0495645_0127914_188_1126 292
109 3300046678 Ga0495599_0057864 Ga0495599_0057864_459_1397 292
110 3300046689 Ga0495613_0026830 Ga0495613_0026830_391_1329 292
111 3300046809 Ga0495600_0078532 Ga0495600_0078532_98_1036 292
112 3300047319 Ga0495674_0315112 Ga0495674_0315112_226_1164 292
113 3300047322 Ga0495680_0271414 Ga0495680_0271414_162_1100 292
114 3300047444 Ga0495675_0011132 Ga0495675_0011132_2357_3295 292
115 3300047673 Ga0495593_0003456 Ga0495593_0003456_4731_5669 292
116 3300048088 Ga0495602_0248870 Ga0495602_0248870_226_1164 292
117 3300048089 Ga0495614_0026542 Ga0495614_0026542_79_1017 292
118 3300053084 Ga0495595_0001862 Ga0495595_0001862_538_1476 292
119 3300005435 Ga0070714_100070656 Ga0070714_1000706563 293
120 3300005435 Ga0070714_100153490 Ga0070714_1001534901 293
121 3300006175 Ga0070712_100234444 Ga0070712_1002344442 293
122 3300006914 Ga0075436_100015916 Ga0075436_1000159164 293
123 3300025929 Ga0207664_10131254 Ga0207664_101312541 293
124 3300025929 Ga0207664_10254658 Ga0207664_102546582 293
125 3300035086 Ga0373934_0015020 Ga0373934_0015020_1616_2551 293
126 3300035119 Ga0373956_0178041 Ga0373956_0178041_10_912 293
127 3300035120 Ga0373957_0010754 Ga0373957_0010754_1861_2796 293
128 3300035172 Ga0373955_0075410 Ga0373955_0075410_386_1321 293
129 3300036401 Ga0373937_0083059 Ga0373937_0083059_386_1321 293
130 3300046462 Ga0495651_0032595 Ga0495651_0032595_1630_2565 293
131 3300046463 Ga0495653_0038051 Ga0495653_0038051_682_1617 293
132 3300046516 Ga0495628_0085074 Ga0495628_0085074_385_1320 293
133 3300046559 Ga0495667_0028667 Ga0495667_0028667_2103_3038 293
134 3300046675 Ga0495657_0010513 Ga0495657_0010513_5319_6254 293
135 3300046678 Ga0495599_0047629 Ga0495599_0047629_919_1854 293
136 3300046679 Ga0495623_0026024 Ga0495623_0026024_314_1249 293
137 3300047317 Ga0495604_0176505 Ga0495604_0176505_385_1320 293
138 3300047322 Ga0495680_0010774 Ga0495680_0010774_3515_4450 293
139 iso_pu_bacteria 2582580736 2583150766 293
140 3300010375 Ga0105239_10232709 Ga0105239_102327092 294
141 3300025944 Ga0207661_10102770 Ga0207661_101027702 294
142 3300035086 Ga0373934_0101136 Ga0373934_0101136_116_1054 294
143 3300035117 Ga0373953_0004371 Ga0373953_0004371_2223_3161 294
144 3300035692 Ga0373935_0144653 Ga0373935_0144653_539_1477 294
145 3300035725 Ga0373947_0016645 Ga0373947_0016645_2775_3713 294
146 3300037068 Ga0373925_0082540 Ga0373925_0082540_524_1462 294
147 3300046459 Ga0495629_0001760 Ga0495629_0001760_15030_15968 294
148 3300046461 Ga0495641_0005560 Ga0495641_0005560_1603_2541 294
149 3300046475 Ga0495639_0077951 Ga0495639_0077951_528_1466 294
150 3300046476 Ga0495662_0006551 Ga0495662_0006551_33_971 294
151 3300046526 Ga0495666_0036024 Ga0495666_0036024_875_1813 294
152 3300046535 Ga0495586_0000770 Ga0495586_0000770_6919_7857 294
153 3300046680 Ga0495646_0040299 Ga0495646_0040299_601_1539 294
154 3300047315 Ga0495581_0017563 Ga0495581_0017563_198_1136 294
155 3300049581 Ga0501047_0052858 Ga0501047_0052858_1444_2379 294
156 3300053078 Ga0495612_0010475 Ga0495612_0010475_1904_2842 294
157 3300005445 Ga0070708_100245703 Ga0070708_1002457032 295
158 3300005468 Ga0070707_100013259 Ga0070707_1000132591 295
159 3300006852 Ga0075433_10502800 Ga0075433_105028002 295
160 3300025922 Ga0207646_10291039 Ga0207646_102910392 295
161 3300044765 Ga0466970_0035109 Ga0466970_0035109_622_1557 295
162 3300045049 Ga0466959_0025353 Ga0466959_0025353_3350_4267 295
163 3300046529 Ga0495652_0132979 Ga0495652_0132979_609_1517 295
164 3300046543 Ga0495645_0167411 Ga0495645_0167411_466_1374 295
165 3300046679 Ga0495623_0108609 Ga0495623_0108609_275_1183 295
166 3300048903 Ga0496100_0037975 Ga0496100_0037975_62_970 295
167 3300048904 Ga0496101_0076351 Ga0496101_0076351_232_1140 295
168 3300048908 Ga0496105_0005277 Ga0496105_0005277_7002_7910 295
169 3300048917 Ga0496114_0112501 Ga0496114_0112501_435_1343 295
170 3300048918 Ga0496115_0219651 Ga0496115_0219651_614_1522 295
171 3300053085 Ga0495619_0084816 Ga0495619_0084816_23_931 295
172 3300005467 Ga0070706_100032714 Ga0070706_1000327145 296
173 3300005471 Ga0070698_100000354 Ga0070698_10000035431 296
174 3300006175 Ga0070712_100249606 Ga0070712_1002496061 296
175 3300006852 Ga0075433_10029032 Ga0075433_100290322 296
176 3300006914 Ga0075436_100153832 Ga0075436_1001538322 296
177 3300007076 Ga0075435_100062323 Ga0075435_1000623232 296
178 3300025910 Ga0207684_10134300 Ga0207684_101343002 296
179 3300035691 Ga0373931_0201794 Ga0373931_0201794_236_1159 296
180 3300048912 Ga0496109_0209077 Ga0496109_0209077_509_1435 296
181 3300048913 Ga0496110_0408330 Ga0496110_0408330_114_1040 296
182 3300048914 Ga0496111_0176556 Ga0496111_0176556_629_1555 296
183 3300048917 Ga0496114_0060981 Ga0496114_0060981_1766_2677 296
184 3300050513 nmdc:mga0rr50_11102_c1 nmdc:mga0rr50_11102_c1_3740_4663 296
185 3300050515 nmdc:mga0a205_15328_c1 nmdc:mga0a205_15328_c1_4801_5724 296
186 iso_pu_bacteria 2866612099 2866618542 296
187 iso_pu_bacteria 8057568493 8057568665 296
188 3300005467 Ga0070706_100011229 Ga0070706_1000112294 297
189 3300005468 Ga0070707_100019079 Ga0070707_1000190792 297
190 3300005471 Ga0070698_100030880 Ga0070698_1000308802 297
191 3300021388 Ga0213875_10008834 Ga0213875_100088343 297
192 3300025922 Ga0207646_10018634 Ga0207646_100186344 297
193 3300031456 Ga0307513_10002805 Ga0307513_100028058 297
194 3300031727 Ga0316576_10064077 Ga0316576_100640773 297
195 3300031728 Ga0316578_10020449 Ga0316578_100204493 297
196 3300033179 Ga0307507_10006423 Ga0307507_1000642315 297
197 3300033180 Ga0307510_10035918 Ga0307510_100359184 297
198 3300035398 Ga0316574_0092496 Ga0316574_0092496_112_1038 297
199 3300036712 Ga0316584_0170690 Ga0316584_0170690_465_1391 297
200 3300037853 Ga0436364_0024071 Ga0436364_0024071_4469_5398 297
201 3300037853 Ga0436364_0508196 Ga0436364_0508196_859_1788 297
202 3300044901 Ga0466960_0202586 Ga0466960_0202586_88_1035 297
203 iso_pu_bacteria 2861520306 2861520937 297
204 iso_pu_bacteria 2897561785 2897563531 297
205 iso_pu_bacteria 8003314358 8003318618 297
206 iso_pu_bacteria 8056060235 8056062017 297
207 3300005366 Ga0070659_100308763 Ga0070659_1003087632 298
208 3300005434 Ga0070709_10158972 Ga0070709_101589722 298
209 3300005435 Ga0070714_100000233 Ga0070714_10000023310 298
210 3300005436 Ga0070713_100085970 Ga0070713_1000859702 298
211 3300005444 Ga0070694_100157903 Ga0070694_1001579032 298
212 3300005467 Ga0070706_100007633 Ga0070706_1000076336 298
213 3300005468 Ga0070707_100001697 Ga0070707_10000169720 298
214 3300005471 Ga0070698_100046363 Ga0070698_1000463633 298
215 3300005843 Ga0068860_100213654 Ga0068860_1002136542 298
216 3300006173 Ga0070716_100129002 Ga0070716_1001290022 298
217 3300009176 Ga0105242_10300151 Ga0105242_103001512 298
218 3300013105 Ga0157369_10567519 Ga0157369_105675191 298
219 3300021388 Ga0213875_10064588 Ga0213875_100645882 298
220 3300025907 Ga0207645_10065213 Ga0207645_100652133 298
221 3300025910 Ga0207684_10002393 Ga0207684_100023933 298
222 3300025922 Ga0207646_10000470 Ga0207646_100004703 298
223 3300025929 Ga0207664_10005791 Ga0207664_100057916 298
224 3300025929 Ga0207664_10259524 Ga0207664_102595242 298
225 3300026089 Ga0207648_10445194 Ga0207648_104451942 298
226 3300026118 Ga0207675_100034633 Ga0207675_1000346333 298
227 3300031824 Ga0307413_10076820 Ga0307413_100768203 298
228 3300031852 Ga0307410_10281961 Ga0307410_102819612 298
229 3300032005 Ga0307411_10004211 Ga0307411_100042116 298
230 3300035083 Ga0373926_0006644 Ga0373926_0006644_1511_2440 298
231 3300035086 Ga0373934_0075102 Ga0373934_0075102_118_1047 298
232 3300035089 Ga0373944_0000075 Ga0373944_0000075_1009_1938 298
233 3300035111 Ga0373923_0015425 Ga0373923_0015425_717_1646 298
234 3300035113 Ga0373936_0026351 Ga0373936_0026351_124_1053 298
235 3300035118 Ga0373954_0014957 Ga0373954_0014957_1337_2266 298
236 3300035171 Ga0373946_0081526 Ga0373946_0081526_118_1047 298
237 3300035410 Ga0373924_0091688 Ga0373924_0091688_216_1145 298
238 3300035695 Ga0373927_0006482 Ga0373927_0006482_6039_6968 298
239 3300035725 Ga0373947_0196726 Ga0373947_0196726_243_1172 298
240 3300037068 Ga0373925_0041056 Ga0373925_0041056_1152_2081 298
241 3300037853 Ga0436364_0838834 Ga0436364_0838834_1309_2238 298
242 3300039450 Ga0436363_0123638 Ga0436363_0123638_1268_2212 298
243 3300045976 Ga0466967_0418207 Ga0466967_0418207_263_1192 298
244 3300046454 Ga0495592_0126492 Ga0495592_0126492_132_1061 298
245 3300046455 Ga0495603_0027264 Ga0495603_0027264_1483_2412 298
246 3300046459 Ga0495629_0022645 Ga0495629_0022645_987_1916 298
247 3300046461 Ga0495641_0021555 Ga0495641_0021555_965_1894 298
248 3300046462 Ga0495651_0011089 Ga0495651_0011089_1033_1962 298
249 3300046463 Ga0495653_0084554 Ga0495653_0084554_184_1113 298
250 3300046473 Ga0495582_0000170 Ga0495582_0000170_33459_34388 298
251 3300046475 Ga0495639_0011896 Ga0495639_0011896_2454_3383 298
252 3300046476 Ga0495662_0025748 Ga0495662_0025748_1052_1981 298
253 3300046477 Ga0495664_0063161 Ga0495664_0063161_334_1263 298
254 3300046499 Ga0495594_0050605 Ga0495594_0050605_370_1299 298
255 3300046511 Ga0495608_0062096 Ga0495608_0062096_1170_2099 298
256 3300046514 Ga0495618_0026002 Ga0495618_0026002_1037_1966 298
257 3300046516 Ga0495628_0088682 Ga0495628_0088682_1225_2154 298
258 3300046517 Ga0495630_0010732 Ga0495630_0010732_1034_1963 298
259 3300046526 Ga0495666_0043575 Ga0495666_0043575_1093_2022 298
260 3300046529 Ga0495652_0101328 Ga0495652_0101328_371_1300 298
261 3300046531 Ga0495665_0059618 Ga0495665_0059618_371_1300 298
262 3300046533 Ga0495640_0069489 Ga0495640_0069489_243_1172 298
263 3300046535 Ga0495586_0032003 Ga0495586_0032003_859_1788 298
264 3300046536 Ga0495587_0040454 Ga0495587_0040454_1126_2055 298
265 3300046543 Ga0495645_0022860 Ga0495645_0022860_1035_1964 298
266 3300046559 Ga0495667_0044082 Ga0495667_0044082_1058_1987 298
267 3300046642 Ga0495634_0173599 Ga0495634_0173599_371_1300 298
268 3300046663 Ga0495635_0061600 Ga0495635_0061600_1278_2207 298
269 3300046674 Ga0495588_0053162 Ga0495588_0053162_132_1061 298
270 3300046675 Ga0495657_0070479 Ga0495657_0070479_132_1061 298
271 3300046678 Ga0495599_0042915 Ga0495599_0042915_860_1789 298
272 3300046679 Ga0495623_0054938 Ga0495623_0054938_1315_2244 298
273 3300046680 Ga0495646_0057155 Ga0495646_0057155_371_1300 298
274 3300046681 Ga0495647_0003856 Ga0495647_0003856_1340_2269 298
275 3300046683 Ga0495658_0007391 Ga0495658_0007391_3481_4410 298
276 3300046689 Ga0495613_0008412 Ga0495613_0008412_951_1880 298
277 3300046690 Ga0495624_0030199 Ga0495624_0030199_1515_2444 298
278 3300047317 Ga0495604_0017300 Ga0495604_0017300_1043_1972 298
279 3300047319 Ga0495674_0006999 Ga0495674_0006999_8709_9638 298
280 3300047321 Ga0495676_0015518 Ga0495676_0015518_4452_5381 298
281 3300047322 Ga0495680_0067018 Ga0495680_0067018_593_1522 298
282 3300047471 Ga0495684_0092719 Ga0495684_0092719_371_1300 298
283 3300047673 Ga0495593_0000136 Ga0495593_0000136_1059_1988 298
284 3300048088 Ga0495602_0131576 Ga0495602_0131576_882_1811 298
285 3300049571 Ga0501034_0006125 Ga0501034_0006125_7013_7933 298
286 3300049579 Ga0501043_0128347 Ga0501043_0128347_388_1308 298
287 3300049586 Ga0501070_0016609 Ga0501070_0016609_3435_4355 298
288 3300049587 Ga0501071_0001502 Ga0501071_0001502_5302_6222 298
289 3300053078 Ga0495612_0073500 Ga0495612_0073500_371_1300 298
290 3300053084 Ga0495595_0028808 Ga0495595_0028808_1016_1945 298
291 3300053085 Ga0495619_0010100 Ga0495619_0010100_4096_5025 298
292 3300054114 Ga0501084_0111943 Ga0501084_0111943_252_1172 298
293 iso_pu_bacteria 2675903060 2676487879 298
294 iso_pu_bacteria 2856741275 2856741556 298
295 iso_pu_bacteria 2873314349 2873320761 298
296 iso_pu_bacteria 2884693830 2884697596 298
297 iso_pu_bacteria 2891395885 2891403043 298
298 iso_pu_bacteria 2891554331 2891554634 298
299 iso_pu_bacteria 2891562705 2891564594 298
300 iso_pu_bacteria 2895427314 2895438158 298
301 iso_pu_bacteria 2895442618 2895447610 298
302 iso_pu_bacteria 3002998708 3003001703 298
303 iso_pu_bacteria 8053945823 8053947366 298
304 iso_pu_bacteria 8055066027 8055067401 298
305 3300013307 Ga0157372_10168403 Ga0157372_101684031 299
306 3300035111 Ga0373923_0020174 Ga0373923_0020174_1404_2336 299
307 3300035113 Ga0373936_0004327 Ga0373936_0004327_2334_3266 299
308 3300035117 Ga0373953_0031725 Ga0373953_0031725_237_1169 299
309 3300035118 Ga0373954_0018042 Ga0373954_0018042_1125_2057 299
310 3300035119 Ga0373956_0128086 Ga0373956_0128086_57_989 299
311 3300035120 Ga0373957_0014026 Ga0373957_0014026_1529_2461 299
312 3300035170 Ga0373943_0009966 Ga0373943_0009966_2231_3163 299
313 3300035172 Ga0373955_0009966 Ga0373955_0009966_3443_4375 299
314 3300035410 Ga0373924_0015754 Ga0373924_0015754_829_1761 299
315 3300035692 Ga0373935_0023766 Ga0373935_0023766_97_1029 299
316 3300035695 Ga0373927_0067045 Ga0373927_0067045_1053_1985 299
317 3300035724 Ga0373933_0003186 Ga0373933_0003186_4004_4936 299
318 3300035725 Ga0373947_0065562 Ga0373947_0065562_231_1163 299
319 3300036401 Ga0373937_0015734 Ga0373937_0015734_1106_2038 299
320 3300037068 Ga0373925_0123952 Ga0373925_0123952_700_1632 299
321 3300041453 Ga0451797_1022337 Ga0451797_1022337_121_1056 299
322 3300046454 Ga0495592_0054148 Ga0495592_0054148_711_1643 299
323 3300046455 Ga0495603_0021873 Ga0495603_0021873_1628_2560 299
324 3300046459 Ga0495629_0005374 Ga0495629_0005374_4983_5915 299
325 3300046459 Ga0495629_0017003 Ga0495629_0017003_4106_5038 299
326 3300046461 Ga0495641_0005130 Ga0495641_0005130_2757_3689 299
327 3300046461 Ga0495641_0030028 Ga0495641_0030028_1549_2481 299
328 3300046462 Ga0495651_0083604 Ga0495651_0083604_585_1517 299
329 3300046462 Ga0495651_0308360 Ga0495651_0308360_19_951 299
330 3300046463 Ga0495653_0061928 Ga0495653_0061928_566_1498 299
331 3300046472 Ga0495580_0017409 Ga0495580_0017409_1654_2586 299
332 3300046473 Ga0495582_0006953 Ga0495582_0006953_1365_2297 299
333 3300046473 Ga0495582_0008724 Ga0495582_0008724_881_1813 299
334 3300046475 Ga0495639_0008262 Ga0495639_0008262_2758_3690 299
335 3300046476 Ga0495662_0008050 Ga0495662_0008050_3370_4302 299
336 3300046477 Ga0495664_0013115 Ga0495664_0013115_2245_3177 299
337 3300046499 Ga0495594_0125521 Ga0495594_0125521_210_1142 299
338 3300046514 Ga0495618_0016506 Ga0495618_0016506_259_1191 299
339 3300046514 Ga0495618_0018264 Ga0495618_0018264_132_1064 299
340 3300046516 Ga0495628_0017420 Ga0495628_0017420_2273_3205 299
341 3300046517 Ga0495630_0026872 Ga0495630_0026872_1858_2790 299
342 3300046517 Ga0495630_0037601 Ga0495630_0037601_1735_2667 299
343 3300046526 Ga0495666_0036327 Ga0495666_0036327_1404_2336 299
344 3300046526 Ga0495666_0059048 Ga0495666_0059048_272_1204 299
345 3300046529 Ga0495652_0025699 Ga0495652_0025699_4153_5085 299
346 3300046529 Ga0495652_0077246 Ga0495652_0077246_1321_2253 299
347 3300046531 Ga0495665_0006142 Ga0495665_0006142_4184_5116 299
348 3300046533 Ga0495640_0016998 Ga0495640_0016998_3037_3969 299
349 3300046533 Ga0495640_0078904 Ga0495640_0078904_907_1839 299
350 3300046536 Ga0495587_0069686 Ga0495587_0069686_531_1463 299
351 3300046543 Ga0495645_0016394 Ga0495645_0016394_566_1498 299
352 3300046559 Ga0495667_0046493 Ga0495667_0046493_1802_2734 299
353 3300046559 Ga0495667_0055691 Ga0495667_0055691_907_1839 299
354 3300046642 Ga0495634_0002978 Ga0495634_0002978_5712_6644 299
355 3300046642 Ga0495634_0014358 Ga0495634_0014358_3451_4383 299
356 3300046663 Ga0495635_0015511 Ga0495635_0015511_3069_4001 299
357 3300046663 Ga0495635_0039866 Ga0495635_0039866_1449_2381 299
358 3300046675 Ga0495657_0044847 Ga0495657_0044847_353_1285 299
359 3300046678 Ga0495599_0017903 Ga0495599_0017903_2574_3506 299
360 3300046679 Ga0495623_0012270 Ga0495623_0012270_2993_3925 299
361 3300046680 Ga0495646_0043835 Ga0495646_0043835_1453_2385 299
362 3300046681 Ga0495647_0044458 Ga0495647_0044458_171_1103 299
363 3300046683 Ga0495658_0004488 Ga0495658_0004488_4108_5040 299
364 3300046683 Ga0495658_0030966 Ga0495658_0030966_132_1064 299
365 3300046689 Ga0495613_0016300 Ga0495613_0016300_1718_2650 299
366 3300046689 Ga0495613_0094101 Ga0495613_0094101_753_1685 299
367 3300046690 Ga0495624_0076136 Ga0495624_0076136_713_1645 299
368 3300046809 Ga0495600_0042917 Ga0495600_0042917_1517_2449 299
369 3300047315 Ga0495581_0008289 Ga0495581_0008289_3807_4739 299
370 3300047315 Ga0495581_0041389 Ga0495581_0041389_349_1281 299
371 3300047317 Ga0495604_0010017 Ga0495604_0010017_6220_7152 299
372 3300047321 Ga0495676_0078730 Ga0495676_0078730_365_1297 299
373 3300047322 Ga0495680_0025569 Ga0495680_0025569_2364_3296 299
374 3300047322 Ga0495680_0064653 Ga0495680_0064653_1094_2026 299
375 3300047444 Ga0495675_0002898 Ga0495675_0002898_7814_8746 299
376 3300047471 Ga0495684_0005679 Ga0495684_0005679_4720_5652 299
377 3300047471 Ga0495684_0133570 Ga0495684_0133570_152_1084 299
378 3300047673 Ga0495593_0021281 Ga0495593_0021281_158_1090 299
379 3300048088 Ga0495602_0162280 Ga0495602_0162280_33_965 299
380 3300048089 Ga0495614_0005800 Ga0495614_0005800_524_1456 299
381 3300053077 Ga0495601_0063692 Ga0495601_0063692_620_1552 299
382 3300053078 Ga0495612_0009756 Ga0495612_0009756_1010_1942 299
383 3300053084 Ga0495595_0032393 Ga0495595_0032393_982_1914 299
384 3300053085 Ga0495619_0065193 Ga0495619_0065193_245_1177 299
385 3300005339 Ga0070660_100050200 Ga0070660_1000502002 300
386 3300005345 Ga0070692_10020517 Ga0070692_100205173 300
387 3300005367 Ga0070667_100251380 Ga0070667_1002513802 300
388 3300005437 Ga0070710_10174549 Ga0070710_101745492 300
389 3300005445 Ga0070708_100011212 Ga0070708_1000112123 300
390 3300005445 Ga0070708_100089473 Ga0070708_1000894733 300
391 3300005467 Ga0070706_100130336 Ga0070706_1001303363 300
392 3300005468 Ga0070707_100026781 Ga0070707_1000267813 300
393 3300005471 Ga0070698_100029177 Ga0070698_1000291773 300
394 3300005471 Ga0070698_100171262 Ga0070698_1001712622 300
395 3300005518 Ga0070699_100102490 Ga0070699_1001024902 300
396 3300005530 Ga0070679_100193216 Ga0070679_1001932162 300
397 3300005535 Ga0070684_100054966 Ga0070684_1000549663 300
398 3300005536 Ga0070697_100076148 Ga0070697_1000761483 300
399 3300005546 Ga0070696_100092001 Ga0070696_1000920012 300
400 3300005618 Ga0068864_100138610 Ga0068864_1001386102 300
401 3300005841 Ga0068863_100106839 Ga0068863_1001068392 300
402 3300006028 Ga0070717_10128022 Ga0070717_101280223 300
403 3300006028 Ga0070717_10427000 Ga0070717_104270001 300
404 3300006871 Ga0075434_100262195 Ga0075434_1002621952 300
405 3300006914 Ga0075436_100050761 Ga0075436_1000507612 300
406 3300007076 Ga0075435_100452294 Ga0075435_1004522941 300
407 3300007788 Ga0099795_10057637 Ga0099795_100576372 300
408 3300009177 Ga0105248_10192061 Ga0105248_101920613 300
409 3300009551 Ga0105238_10145996 Ga0105238_101459963 300
410 3300013100 Ga0157373_10150422 Ga0157373_101504222 300
411 3300021388 Ga0213875_10000907 Ga0213875_1000090721 300
412 3300021388 Ga0213875_10010026 Ga0213875_100100262 300
413 3300025898 Ga0207692_10069895 Ga0207692_100698952 300
414 3300025900 Ga0207710_10073569 Ga0207710_100735692 300
415 3300025901 Ga0207688_10010686 Ga0207688_100106863 300
416 3300025903 Ga0207680_10024971 Ga0207680_100249713 300
417 3300025906 Ga0207699_10073926 Ga0207699_100739262 300
418 3300025908 Ga0207643_10030097 Ga0207643_100300973 300
419 3300025910 Ga0207684_10126107 Ga0207684_101261073 300
420 3300025915 Ga0207693_10243551 Ga0207693_102435512 300
421 3300025916 Ga0207663_10044674 Ga0207663_100446742 300
422 3300025919 Ga0207657_10057686 Ga0207657_100576863 300
423 3300025920 Ga0207649_10079747 Ga0207649_100797473 300
424 3300025921 Ga0207652_10057211 Ga0207652_100572112 300
425 3300025929 Ga0207664_10129162 Ga0207664_101291623 300
426 3300025939 Ga0207665_10265994 Ga0207665_102659942 300
427 3300025940 Ga0207691_10043717 Ga0207691_100437173 300
428 3300025942 Ga0207689_10013841 Ga0207689_100138414 300
429 3300025944 Ga0207661_10024207 Ga0207661_100242073 300
430 3300025945 Ga0207679_10098501 Ga0207679_100985012 300
431 3300025960 Ga0207651_10129231 Ga0207651_101292312 300
432 3300026067 Ga0207678_10044649 Ga0207678_100446493 300
433 3300026078 Ga0207702_10027569 Ga0207702_100275693 300
434 3300026116 Ga0207674_10059346 Ga0207674_100593463 300
435 3300026121 Ga0207683_10016543 Ga0207683_100165433 300
436 3300034816 Ga0373930_0001178 Ga0373930_0001178_2660_3589 300
437 3300034957 Ga0373938_0003804 Ga0373938_0003804_820_1749 300
438 3300035086 Ga0373934_0007737 Ga0373934_0007737_1433_2362 300
439 3300035115 Ga0373941_0018312 Ga0373941_0018312_172_1101 300
440 3300035119 Ga0373956_0018381 Ga0373956_0018381_1636_2565 300
441 3300035410 Ga0373924_0121162 Ga0373924_0121162_161_1090 300
442 3300036401 Ga0373937_0018453 Ga0373937_0018453_3860_4789 300
443 3300037853 Ga0436364_0185475 Ga0436364_0185475_17782_18708 300
444 3300037853 Ga0436364_0319187 Ga0436364_0319187_587_1516 300
445 3300037853 Ga0436364_0789302 Ga0436364_0789302_1122_2051 300
446 3300039447 Ga0436361_0712461 Ga0436361_0712461_28_957 300
447 3300039453 Ga0436362_0802341 Ga0436362_0802341_31_960 300
448 3300046462 Ga0495651_0023401 Ga0495651_0023401_3477_4406 300
449 3300046462 Ga0495651_0069936 Ga0495651_0069936_282_1211 300
450 3300046463 Ga0495653_0008333 Ga0495653_0008333_5854_6783 300
451 3300046477 Ga0495664_0015657 Ga0495664_0015657_1034_1963 300
452 3300046511 Ga0495608_0014598 Ga0495608_0014598_21_950 300
453 3300046511 Ga0495608_0127546 Ga0495608_0127546_269_1198 300
454 3300046529 Ga0495652_0214721 Ga0495652_0214721_426_1355 300
455 3300046533 Ga0495640_0037892 Ga0495640_0037892_706_1635 300
456 3300046559 Ga0495667_0022555 Ga0495667_0022555_1612_2541 300
457 3300046559 Ga0495667_0053794 Ga0495667_0053794_525_1454 300
458 3300046663 Ga0495635_0010435 Ga0495635_0010435_3157_4086 300
459 3300046663 Ga0495635_0129509 Ga0495635_0129509_297_1226 300
460 3300046675 Ga0495657_0014848 Ga0495657_0014848_959_1888 300
461 3300046675 Ga0495657_0065967 Ga0495657_0065967_1331_2260 300
462 3300046809 Ga0495600_0168474 Ga0495600_0168474_378_1307 300
463 3300046809 Ga0495600_0239586 Ga0495600_0239586_88_1017 300
464 3300047322 Ga0495680_0006561 Ga0495680_0006561_3860_4789 300
465 3300047322 Ga0495680_0037933 Ga0495680_0037933_2464_3393 300
466 3300047471 Ga0495684_0069081 Ga0495684_0069081_1329_2258 300
467 3300047471 Ga0495684_0073022 Ga0495684_0073022_344_1273 300
468 3300048088 Ga0495602_0071319 Ga0495602_0071319_543_1472 300
469 3300048903 Ga0496100_0127913 Ga0496100_0127913_559_1488 300
470 3300048904 Ga0496101_0088950 Ga0496101_0088950_890_1819 300
471 3300048906 Ga0496103_0045674 Ga0496103_0045674_1599_2528 300
472 3300048908 Ga0496105_0096498 Ga0496105_0096498_1019_1948 300
473 3300048913 Ga0496110_0034760 Ga0496110_0034760_244_1173 300
474 3300048914 Ga0496111_0030500 Ga0496111_0030500_721_1650 300
475 3300048917 Ga0496114_0127089 Ga0496114_0127089_934_1863 300
476 3300048918 Ga0496115_0154748 Ga0496115_0154748_746_1675 300
477 3300049824 Ga0501045_0079731 Ga0501045_0079731_1113_2051 300
478 3300050512 nmdc:mga0n895_287565_c1 nmdc:mga0n895_287565_c1_159_1088 300
479 3300005339 Ga0070660_100023868 Ga0070660_1000238682 301
480 3300005341 Ga0070691_10077329 Ga0070691_100773292 301
481 3300005435 Ga0070714_100361212 Ga0070714_1003612122 301
482 3300005436 Ga0070713_100035570 Ga0070713_1000355703 301
483 3300005455 Ga0070663_100004550 Ga0070663_1000045503 301
484 3300005455 Ga0070663_100017400 Ga0070663_1000174004 301
485 3300005455 Ga0070663_100044808 Ga0070663_1000448082 301
486 3300005458 Ga0070681_10485848 Ga0070681_104858481 301
487 3300005535 Ga0070684_100263535 Ga0070684_1002635352 301
488 3300005564 Ga0070664_100610693 Ga0070664_1006106932 301
489 3300005616 Ga0068852_100263261 Ga0068852_1002632612 301
490 3300006173 Ga0070716_100100957 Ga0070716_1001009573 301
491 3300009093 Ga0105240_10353704 Ga0105240_103537042 301
492 3300013105 Ga0157369_10300786 Ga0157369_103007862 301
493 3300020081 Ga0206354_11532852 Ga0206354_115328522 301
494 3300020082 Ga0206353_10338168 Ga0206353_103381682 301
495 3300020082 Ga0206353_10667712 Ga0206353_106677124 301
496 3300025905 Ga0207685_10088056 Ga0207685_100880562 301
497 3300025906 Ga0207699_10039319 Ga0207699_100393192 301
498 3300025906 Ga0207699_10168067 Ga0207699_101680672 301
499 3300025912 Ga0207707_10027336 Ga0207707_100273364 301
500 3300025912 Ga0207707_10257049 Ga0207707_102570492 301
501 3300025921 Ga0207652_10108366 Ga0207652_101083663 301
502 3300025929 Ga0207664_10011377 Ga0207664_100113773 301
503 3300025929 Ga0207664_10134532 Ga0207664_101345322 301
504 3300025944 Ga0207661_10344993 Ga0207661_103449931 301
505 3300026067 Ga0207678_10000248 Ga0207678_1000024817 301
506 3300026067 Ga0207678_10062668 Ga0207678_100626684 301
507 3300026067 Ga0207678_10082610 Ga0207678_100826101 301
508 3300026116 Ga0207674_10252945 Ga0207674_102529452 301
509 3300028379 Ga0268266_10148750 Ga0268266_101487502 301
510 3300033547 Ga0316212_1003253 Ga0316212_10032532 301
511 3300035089 Ga0373944_0002184 Ga0373944_0002184_3896_4828 301
512 3300035111 Ga0373923_0004555 Ga0373923_0004555_2944_3876 301
513 3300035113 Ga0373936_0000869 Ga0373936_0000869_1814_2746 301
514 3300035116 Ga0373945_0000067 Ga0373945_0000067_20043_20975 301
515 3300035170 Ga0373943_0001486 Ga0373943_0001486_8139_9071 301
516 3300035171 Ga0373946_0000202 Ga0373946_0000202_10626_11558 301
517 3300035172 Ga0373955_0050746 Ga0373955_0050746_194_1126 301
518 3300035695 Ga0373927_0000281 Ga0373927_0000281_28351_29283 301
519 3300035724 Ga0373933_0099600 Ga0373933_0099600_793_1725 301
520 3300035725 Ga0373947_0000793 Ga0373947_0000793_2592_3524 301
521 3300037068 Ga0373925_0004641 Ga0373925_0004641_945_1877 301
522 3300044694 Ga0466963_0088295 Ga0466963_0088295_886_1818 301
523 3300044694 Ga0466963_0173756 Ga0466963_0173756_317_1246 301
524 3300045976 Ga0466967_0041438 Ga0466967_0041438_750_1682 301
525 3300046463 Ga0495653_0010622 Ga0495653_0010622_644_1576 301
526 3300046477 Ga0495664_0000599 Ga0495664_0000599_8341_9273 301
527 3300046517 Ga0495630_0079075 Ga0495630_0079075_359_1291 301
528 3300046529 Ga0495652_0005238 Ga0495652_0005238_7572_8504 301
529 3300046531 Ga0495665_0047625 Ga0495665_0047625_1126_2058 301
530 3300046642 Ga0495634_0047925 Ga0495634_0047925_488_1420 301
531 3300046663 Ga0495635_0002055 Ga0495635_0002055_5545_6477 301
532 3300046678 Ga0495599_0069504 Ga0495599_0069504_232_1164 301
533 3300046690 Ga0495624_0002573 Ga0495624_0002573_4007_4939 301
534 3300047319 Ga0495674_0000849 Ga0495674_0000849_5996_6928 301
535 3300047471 Ga0495684_0001960 Ga0495684_0001960_4992_5924 301
536 3300047673 Ga0495593_0019355 Ga0495593_0019355_152_1084 301
537 iso_pu_bacteria 2855683550 2855684701 301
538 3300005367 Ga0070667_100057101 Ga0070667_1000571013 302
539 3300005434 Ga0070709_10006198 Ga0070709_100061982 302
540 3300005437 Ga0070710_10016077 Ga0070710_100160772 302
541 3300005445 Ga0070708_100171792 Ga0070708_1001717922 302
542 3300005467 Ga0070706_100040104 Ga0070706_1000401041 302
543 3300005467 Ga0070706_100122538 Ga0070706_1001225382 302
544 3300005467 Ga0070706_100283553 Ga0070706_1002835532 302
545 3300005471 Ga0070698_100000192 Ga0070698_10000019217 302
546 3300005471 Ga0070698_100001213 Ga0070698_10000121315 302
547 3300005471 Ga0070698_100078855 Ga0070698_1000788552 302
548 3300005471 Ga0070698_100095373 Ga0070698_1000953733 302
549 3300006038 Ga0075365_10160326 Ga0075365_101603261 302
550 3300006173 Ga0070716_100000929 Ga0070716_1000009294 302
551 3300013104 Ga0157370_10215715 Ga0157370_102157152 302
552 3300025898 Ga0207692_10032927 Ga0207692_100329271 302
553 3300025906 Ga0207699_10000446 Ga0207699_100004464 302
554 3300025910 Ga0207684_10039423 Ga0207684_100394233 302
555 3300025910 Ga0207684_10239876 Ga0207684_102398762 302
556 3300025928 Ga0207700_10012751 Ga0207700_100127512 302
557 3300025929 Ga0207664_10012680 Ga0207664_100126804 302
558 3300025939 Ga0207665_10003733 Ga0207665_100037334 302
559 3300025986 Ga0207658_10210997 Ga0207658_102109973 302
560 3300028381 Ga0268264_10342306 Ga0268264_103423061 302
561 3300028800 Ga0265338_10006079 Ga0265338_100060797 302
562 3300037853 Ga0436364_1268560 Ga0436364_1268560_109_1044 302
563 3300044684 Ga0466966_0016405 Ga0466966_0016405_3192_4121 302
564 3300044693 Ga0466961_0060354 Ga0466961_0060354_442_1371 302
565 3300044719 Ga0466971_0012412 Ga0466971_0012412_1762_2691 302
566 3300045836 Ga0466958_0008864 Ga0466958_0008864_2571_3500 302
567 3300046476 Ga0495662_0162506 Ga0495662_0162506_62_991 302
568 3300046517 Ga0495630_0241311 Ga0495630_0241311_18_953 302
569 3300046675 Ga0495657_0036799 Ga0495657_0036799_1729_2667 302
570 3300048918 Ga0496115_0091767 Ga0496115_0091767_428_1363 302
571 3300049581 Ga0501047_0016843 Ga0501047_0016843_1912_2841 302
572 3300061719 Ga0466962_0064072 Ga0466962_0064072_320_1249 302
573 iso_pu_bacteria 2622736605 2623498622 302
574 3300005355 Ga0070671_100055465 Ga0070671_1000554652 303
575 3300005434 Ga0070709_10025119 Ga0070709_100251193 303
576 3300005434 Ga0070709_10039650 Ga0070709_100396504 303
577 3300005435 Ga0070714_100001824 Ga0070714_10000182410 303
578 3300005435 Ga0070714_100053550 Ga0070714_1000535504 303
579 3300005436 Ga0070713_100002913 Ga0070713_1000029135 303
580 3300005437 Ga0070710_10044759 Ga0070710_100447593 303
581 3300005439 Ga0070711_100074086 Ga0070711_1000740861 303
582 3300005467 Ga0070706_100005571 Ga0070706_1000055716 303
583 3300005467 Ga0070706_100502102 Ga0070706_1005021022 303
584 3300005614 Ga0068856_100013479 Ga0068856_1000134797 303
585 3300005614 Ga0068856_100076702 Ga0068856_1000767022 303
586 3300005841 Ga0068863_100093634 Ga0068863_1000936342 303
587 3300006028 Ga0070717_10027822 Ga0070717_100278223 303
588 3300006163 Ga0070715_10001118 Ga0070715_100011186 303
589 3300006173 Ga0070716_100000371 Ga0070716_10000037115 303
590 3300006175 Ga0070712_100037447 Ga0070712_1000374472 303
591 3300006237 Ga0097621_100328477 Ga0097621_1003284772 303
592 3300006871 Ga0075434_100133418 Ga0075434_1001334183 303
593 3300009098 Ga0105245_10023602 Ga0105245_100236022 303
594 3300009174 Ga0105241_10372626 Ga0105241_103726261 303
595 3300013105 Ga0157369_10058003 Ga0157369_100580032 303
596 3300013308 Ga0157375_10158031 Ga0157375_101580312 303
597 3300014325 Ga0163163_10374853 Ga0163163_103748532 303
598 3300014968 Ga0157379_10099483 Ga0157379_100994832 303
599 3300025898 Ga0207692_10001266 Ga0207692_100012662 303
600 3300025905 Ga0207685_10003173 Ga0207685_100031733 303
601 3300025906 Ga0207699_10003388 Ga0207699_100033882 303
602 3300025906 Ga0207699_10015622 Ga0207699_100156223 303
603 3300025910 Ga0207684_10175753 Ga0207684_101757532 303
604 3300025910 Ga0207684_10446368 Ga0207684_104463681 303
605 3300025912 Ga0207707_10452165 Ga0207707_104521651 303
606 3300025915 Ga0207693_10018227 Ga0207693_100182272 303
607 3300025915 Ga0207693_10041001 Ga0207693_100410013 303
608 3300025915 Ga0207693_10125945 Ga0207693_101259453 303
609 3300025916 Ga0207663_10052332 Ga0207663_100523322 303
610 3300025928 Ga0207700_10008058 Ga0207700_100080584 303
611 3300025928 Ga0207700_10013250 Ga0207700_100132504 303
612 3300025928 Ga0207700_10038639 Ga0207700_100386392 303
613 3300025928 Ga0207700_10059302 Ga0207700_100593022 303
614 3300025928 Ga0207700_10386641 Ga0207700_103866411 303
615 3300025929 Ga0207664_10005359 Ga0207664_100053594 303
616 3300025929 Ga0207664_10033493 Ga0207664_100334934 303
617 3300025931 Ga0207644_10072463 Ga0207644_100724632 303
618 3300025939 Ga0207665_10000786 Ga0207665_100007864 303
619 3300025939 Ga0207665_10008276 Ga0207665_100082762 303
620 3300025939 Ga0207665_10165935 Ga0207665_101659352 303
621 3300025939 Ga0207665_10198216 Ga0207665_101982162 303
622 3300026023 Ga0207677_10040536 Ga0207677_100405364 303
623 3300026078 Ga0207702_10298704 Ga0207702_102987041 303
624 3300026095 Ga0207676_10013845 Ga0207676_100138452 303
625 3300026116 Ga0207674_10076793 Ga0207674_100767934 303
626 3300035089 Ga0373944_0025259 Ga0373944_0025259_665_1597 303
627 3300035115 Ga0373941_0022921 Ga0373941_0022921_461_1393 303
628 3300035116 Ga0373945_0120000 Ga0373945_0120000_35_979 303
629 3300035118 Ga0373954_0123655 Ga0373954_0123655_180_1112 303
630 3300035170 Ga0373943_0055712 Ga0373943_0055712_574_1506 303
631 3300035242 Ga0373962_0045062 Ga0373962_0045062_131_1063 303
632 3300035692 Ga0373935_0047093 Ga0373935_0047093_1534_2466 303
633 3300035724 Ga0373933_0003103 Ga0373933_0003103_4164_5096 303
634 3300035725 Ga0373947_0178481 Ga0373947_0178481_286_1218 303
635 3300036401 Ga0373937_0006376 Ga0373937_0006376_2808_3740 303
636 3300037068 Ga0373925_0002004 Ga0373925_0002004_7215_8147 303
637 3300037068 Ga0373925_0106044 Ga0373925_0106044_1028_1972 303
638 3300037068 Ga0373925_0266745 Ga0373925_0266745_165_1097 303
639 3300037466 Ga0395898_0164765 Ga0395898_0164765_763_1710 303
640 3300038443 Ga0395901_0012456 Ga0395901_0012456_1930_2877 303
641 3300044694 Ga0466963_0085983 Ga0466963_0085983_767_1708 303
642 3300045976 Ga0466967_0036146 Ga0466967_0036146_1393_2340 303
643 3300046454 Ga0495592_0131181 Ga0495592_0131181_649_1581 303
644 3300046455 Ga0495603_0131661 Ga0495603_0131661_212_1144 303
645 3300046459 Ga0495629_0042465 Ga0495629_0042465_2193_3125 303
646 3300046461 Ga0495641_0162921 Ga0495641_0162921_23_955 303
647 3300046462 Ga0495651_0002138 Ga0495651_0002138_1265_2197 303
648 3300046463 Ga0495653_0001719 Ga0495653_0001719_3938_4870 303
649 3300046476 Ga0495662_0019779 Ga0495662_0019779_1769_2701 303
650 3300046477 Ga0495664_0011357 Ga0495664_0011357_560_1504 303
651 3300046477 Ga0495664_0068708 Ga0495664_0068708_62_994 303
652 3300046511 Ga0495608_0000839 Ga0495608_0000839_13902_14834 303
653 3300046511 Ga0495608_0099691 Ga0495608_0099691_350_1282 303
654 3300046516 Ga0495628_0012903 Ga0495628_0012903_139_1071 303
655 3300046516 Ga0495628_0237378 Ga0495628_0237378_342_1274 303
656 3300046516 Ga0495628_0316839 Ga0495628_0316839_21_953 303
657 3300046517 Ga0495630_0083624 Ga0495630_0083624_269_1201 303
658 3300046517 Ga0495630_0227664 Ga0495630_0227664_138_1070 303
659 3300046529 Ga0495652_0020665 Ga0495652_0020665_4187_5119 303
660 3300046529 Ga0495652_0082199 Ga0495652_0082199_1362_2294 303
661 3300046533 Ga0495640_0045625 Ga0495640_0045625_26_958 303
662 3300046536 Ga0495587_0014596 Ga0495587_0014596_2596_3528 303
663 3300046536 Ga0495587_0015977 Ga0495587_0015977_223_1155 303
664 3300046543 Ga0495645_0004770 Ga0495645_0004770_1767_2699 303
665 3300046543 Ga0495645_0076362 Ga0495645_0076362_744_1688 303
666 3300046543 Ga0495645_0104236 Ga0495645_0104236_936_1868 303
667 3300046559 Ga0495667_0000281 Ga0495667_0000281_27313_28245 303
668 3300046642 Ga0495634_0086480 Ga0495634_0086480_280_1212 303
669 3300046642 Ga0495634_0197209 Ga0495634_0197209_111_1043 303
670 3300046663 Ga0495635_0030979 Ga0495635_0030979_1717_2649 303
671 3300046663 Ga0495635_0168354 Ga0495635_0168354_92_1024 303
672 3300046675 Ga0495657_0000699 Ga0495657_0000699_22522_23454 303
673 3300046675 Ga0495657_0068044 Ga0495657_0068044_191_1123 303
674 3300046678 Ga0495599_0079535 Ga0495599_0079535_862_1794 303
675 3300046678 Ga0495599_0096107 Ga0495599_0096107_728_1660 303
676 3300046809 Ga0495600_0008139 Ga0495600_0008139_77_1009 303
677 3300047317 Ga0495604_0008600 Ga0495604_0008600_5057_5989 303
678 3300047319 Ga0495674_0001294 Ga0495674_0001294_16342_17274 303
679 3300047319 Ga0495674_0019700 Ga0495674_0019700_328_1272 303
680 3300047319 Ga0495674_0039622 Ga0495674_0039622_1061_1993 303
681 3300047322 Ga0495680_0028154 Ga0495680_0028154_132_1064 303
682 3300047322 Ga0495680_0123848 Ga0495680_0123848_592_1524 303
683 3300047471 Ga0495684_0007105 Ga0495684_0007105_1564_2496 303
684 3300047471 Ga0495684_0067939 Ga0495684_0067939_1299_2231 303
685 3300048088 Ga0495602_0068898 Ga0495602_0068898_791_1723 303
686 3300048903 Ga0496100_0149208 Ga0496100_0149208_222_1154 303
687 3300048904 Ga0496101_0068244 Ga0496101_0068244_87_1019 303
688 3300048905 Ga0496102_0094771 Ga0496102_0094771_685_1617 303
689 3300048907 Ga0496104_0016612 Ga0496104_0016612_3781_4713 303
690 3300048907 Ga0496104_0032704 Ga0496104_0032704_1698_2630 303
691 3300048908 Ga0496105_0038817 Ga0496105_0038817_1837_2769 303
692 3300048911 Ga0496108_0008607 Ga0496108_0008607_4123_5055 303
693 3300048911 Ga0496108_0008967 Ga0496108_0008967_2235_3167 303
694 3300048913 Ga0496110_0072228 Ga0496110_0072228_676_1608 303
695 3300048916 Ga0496113_0053761 Ga0496113_0053761_1831_2763 303
696 3300048917 Ga0496114_0021193 Ga0496114_0021193_2679_3611 303
697 3300048918 Ga0496115_0033734 Ga0496115_0033734_2428_3360 303
698 3300050512 nmdc:mga0n895_243142_c1 nmdc:mga0n895_243142_c1_257_1189 303
699 3300050513 nmdc:mga0rr50_201197_c1 nmdc:mga0rr50_201197_c1_444_1376 303
700 3300053077 Ga0495601_0080485 Ga0495601_0080485_330_1274 303
701 3300053084 Ga0495595_0027349 Ga0495595_0027349_478_1410 303
702 3300053084 Ga0495595_0127474 Ga0495595_0127474_27_959 303
703 3300053085 Ga0495619_0172140 Ga0495619_0172140_387_1319 303
704 3300005445 Ga0070708_100098949 Ga0070708_1000989491 304
705 3300005467 Ga0070706_100003471 Ga0070706_10000347111 304
706 3300005468 Ga0070707_100020535 Ga0070707_1000205351 304
707 3300005471 Ga0070698_100005834 Ga0070698_1000058345 304
708 3300005536 Ga0070697_100005992 Ga0070697_1000059928 304
709 3300025910 Ga0207684_10001618 Ga0207684_100016186 304
710 3300025922 Ga0207646_10001715 Ga0207646_100017154 304
711 3300025928 Ga0207700_10004620 Ga0207700_100046202 304
712 3300035083 Ga0373926_0018293 Ga0373926_0018293_846_1784 304
713 3300035086 Ga0373934_0000159 Ga0373934_0000159_14472_15407 304
714 3300035117 Ga0373953_0000089 Ga0373953_0000089_7904_8839 304
715 3300035118 Ga0373954_0009771 Ga0373954_0009771_739_1674 304
716 3300035119 Ga0373956_0004682 Ga0373956_0004682_406_1341 304
717 3300035120 Ga0373957_0000438 Ga0373957_0000438_1147_2082 304
718 3300035172 Ga0373955_0000024 Ga0373955_0000024_26687_27622 304
719 3300035172 Ga0373955_0198687 Ga0373955_0198687_239_1174 304
720 3300035410 Ga0373924_0001904 Ga0373924_0001904_2083_3018 304
721 3300035692 Ga0373935_0050424 Ga0373935_0050424_936_1874 304
722 3300035724 Ga0373933_0000153 Ga0373933_0000153_15658_16593 304
723 3300035724 Ga0373933_0099413 Ga0373933_0099413_781_1716 304
724 3300035725 Ga0373947_0000002 Ga0373947_0000002_209635_210573 304
725 3300036401 Ga0373937_0000333 Ga0373937_0000333_11309_12244 304
726 3300036401 Ga0373937_0312084 Ga0373937_0312084_167_1102 304
727 3300036459 Ga0372808_005037 Ga0372808_005037_600_1547 304
728 3300046454 Ga0495592_0000304 Ga0495592_0000304_8034_8969 304
729 3300046462 Ga0495651_0000252 Ga0495651_0000252_8074_9009 304
730 3300046463 Ga0495653_0012189 Ga0495653_0012189_1536_2471 304
731 3300046511 Ga0495608_0000101 Ga0495608_0000101_32523_33458 304
732 3300046516 Ga0495628_0000327 Ga0495628_0000327_13923_14858 304
733 3300046529 Ga0495652_0000775 Ga0495652_0000775_11927_12862 304
734 3300046536 Ga0495587_0000228 Ga0495587_0000228_8061_8996 304
735 3300046543 Ga0495645_0046798 Ga0495645_0046798_974_1909 304
736 3300046559 Ga0495667_0000742 Ga0495667_0000742_15254_16189 304
737 3300046675 Ga0495657_0000156 Ga0495657_0000156_28229_29164 304
738 3300046678 Ga0495599_0000097 Ga0495599_0000097_32416_33351 304
739 3300046679 Ga0495623_0000471 Ga0495623_0000471_20846_21781 304
740 3300046679 Ga0495623_0025222 Ga0495623_0025222_1525_2460 304
741 3300046680 Ga0495646_0027767 Ga0495646_0027767_833_1768 304
742 3300047317 Ga0495604_0000196 Ga0495604_0000196_22530_23465 304
743 3300047322 Ga0495680_0000226 Ga0495680_0000226_28200_29135 304
744 3300047444 Ga0495675_0002108 Ga0495675_0002108_2118_3053 304
745 3300048088 Ga0495602_0000172 Ga0495602_0000172_28073_29008 304
746 3300053084 Ga0495595_0021214 Ga0495595_0021214_1441_2376 304
747 iso_pu_bacteria 8055172936 8055178842 304
748 3300005434 Ga0070709_10000346 Ga0070709_100003466 306
749 3300005435 Ga0070714_100005412 Ga0070714_1000054125 306
750 3300005436 Ga0070713_100000759 Ga0070713_1000007595 306
751 3300005439 Ga0070711_100031410 Ga0070711_1000314102 306
752 3300006028 Ga0070717_10002685 Ga0070717_100026854 306
753 3300006163 Ga0070715_10003853 Ga0070715_100038533 306
754 3300006173 Ga0070716_100003249 Ga0070716_1000032496 306
755 3300025898 Ga0207692_10000123 Ga0207692_100001236 306
756 3300025905 Ga0207685_10002387 Ga0207685_100023875 306
757 3300025906 Ga0207699_10000829 Ga0207699_100008296 306
758 3300025916 Ga0207663_10005217 Ga0207663_100052174 306
759 3300025928 Ga0207700_10000891 Ga0207700_1000089113 306
760 3300025929 Ga0207664_10000224 Ga0207664_100002246 306
761 3300025939 Ga0207665_10003910 Ga0207665_100039102 306
762 3300037418 Ga0395900_0020198 Ga0395900_0020198_5112_6050 306
763 3300044694 Ga0466963_0158470 Ga0466963_0158470_368_1306 306
764 3300045976 Ga0466967_0063218 Ga0466967_0063218_1896_2834 306
765 3300045976 Ga0466967_0113449 Ga0466967_0113449_1338_2285 307
766 3300006844 Ga0075428_100072304 Ga0075428_1000723045 308
767 3300006852 Ga0075433_10044691 Ga0075433_100446912 308
768 3300006914 Ga0075436_100081820 Ga0075436_1000818202 308
769 3300007076 Ga0075435_100206439 Ga0075435_1002064392 308
770 3300009094 Ga0111539_10040160 Ga0111539_100401604 308
771 3300009147 Ga0114129_10009348 Ga0114129_100093488 308
772 3300027907 Ga0207428_10171894 Ga0207428_101718942 308
773 3300035691 Ga0373931_0140175 Ga0373931_0140175_318_1289 308
774 3300050507 nmdc:mga05p37_50945_c1 nmdc:mga05p37_50945_c1_1509_2480 308
775 3300050511 nmdc:mga08y16_318615_c1 nmdc:mga08y16_318615_c1_592_1563 308
776 3300050513 nmdc:mga0rr50_50841_c1 nmdc:mga0rr50_50841_c1_748_1719 308
777 3300050514 nmdc:mga08x19_8618_c1 nmdc:mga08x19_8618_c1_1137_2108 308
778 3300050515 nmdc:mga0a205_55652_c1 nmdc:mga0a205_55652_c1_320_1291 308
779 3300005329 Ga0070683_100185827 Ga0070683_1001858272 309
780 3300020082 Ga0206353_11752212 Ga0206353_117522122 309
781 3300031852 Ga0307410_10188909 Ga0307410_101889092 309
782 3300031995 Ga0307409_100038159 Ga0307409_1000381594 309
783 3300032002 Ga0307416_100010532 Ga0307416_1000105324 309
784 3300032126 Ga0307415_100076642 Ga0307415_1000766423 309
785 3300045049 Ga0466959_0158798 Ga0466959_0158798_589_1536 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

111

265

0.91

PF01479

S4

S4 domain

37

82

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8871 23 70
1prz-assembly1.cif.gz_A crystal structure of pseudouridine synthase rlud catalytic module 0.8859 82 308
7pic-assembly1.cif.gz_C 70s ribosome with p/e-site trna in spectinomycin-treated mycoplasma pneumoniae cells 0.8825 23 71
7aqc-assembly1.cif.gz_Y structure of the bacterial rqc complex (decoding state) 0.8818 24 73
1v9f-assembly1.cif.gz_A crystal structure of catalytic domain of pseudouridine synthase rlud from escherichia coli 0.8814 82 308
ID Description Score Start End Superfamily
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9871 12 74 3.10.290.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.974 89 307 3.30.2350.10
af_Q2FZ78_82_304_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.945 94 309 3.30.2350.10
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9428 12 74 3.10.290.10
af_I1JSZ4_206_438_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9369 134 309 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A448UT97-F1-model_v4 Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) 0.9904 147 308 GO:0000455
GO:0003723
GO:0160140
AF-A0A3D2VKT9-F1-model_v4 RNA pseudouridine synthase 0.9883 187 309 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A6J6GGR7-F1-model_v4 Unannotated protein 0.9843 180 309 GO:0000455
GO:0003723
GO:0009982
AF-A0A3D2VKT9-F1-model_v4 RNA pseudouridine synthase 0.9804 187 309 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A317Z3S0-F1-model_v4 RluA family pseudouridine synthase 0.9644 169 241 GO:0000455
GO:0003723
GO:0009982
GO:0140098

Feature Viewer

pLDDT pTM Quality
84.57 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map