F480736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 785 | 280 | 763 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100072304|Ga0075428_1000723045 |
| Length | 330 |
| Sequence | VSAGKRGVTTQDGGGEAAGVTAGDQRRVAVPEGLDGERLDAALARMFGLSRAVAAELISGGRVLVAGHPAAKSDRVPAGEWLDVTLPAPPAALTPVPQAVPGLVVVYEDADIIVVDKPAGVAAHPTPGWSGPTVLEGLLAAGHTIATSGAAERQGIVHRLDANTTGLMVLAKSERAYSVLKRAFRERTVDKGYHALVQGHPDPLRGTVDAPIARHPSGDGRFAVIAGGRHSITHYDTIEAFRGASLVEITLDTGRTHQIRVHMAAMRHPCVGDRLYGADPVLAAHLGLTRQWLHAVRLGFTHPVDDRPLVFTSDYPPDLAHALDTLRAES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 2 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 3 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 4 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 5 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 6 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 7 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 8 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 9 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 10 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 11 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 12 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 13 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 14 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 15 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 16 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 121 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 136 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 146 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 147 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 148 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 163 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 172 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 275 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 276 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 277 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 278 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 279 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 280 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.56 |
| Metatranscriptomes | 0.64 |
| Isolates | 2.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.25 |
| Nodule | 0 |
| Rhizoplane | 4.84 |
| Rhizosphere | 90.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100185827 | 3300005329 | Bacteria | 1973 |
| 2 | Ga0070660_100023868 | 3300005339 | Bacteria | 4534 |
| 3 | Ga0070660_100050200 | 3300005339 | Bacteria | 3209 |
| 4 | Ga0070691_10077329 | 3300005341 | Bacteria | 1624 |
| 5 | Ga0070692_10020517 | 3300005345 | Bacteria | 3205 |
| 6 | Ga0070671_100055465 | 3300005355 | Bacteria | 3296 |
| 7 | Ga0070659_100308763 | 3300005366 | Bacteria | 1320 |
| 8 | Ga0070667_100057101 | 3300005367 | Bacteria | 3297 |
| 9 | Ga0070667_100251380 | 3300005367 | Bacteria | 1580 |
| 10 | Ga0070709_10000346 | 3300005434 | Bacteria | 28876 |
| 11 | Ga0070709_10001791 | 3300005434 | Bacteria | 11671 |
| 12 | Ga0070709_10006198 | 3300005434 | Bacteria | 6509 |
| 13 | Ga0070709_10025119 | 3300005434 | Bacteria | 3517 |
| 14 | Ga0070709_10039650 | 3300005434 | Bacteria | 2891 |
| 15 | Ga0070709_10158972 | 3300005434 | Bacteria | 1569 |
| 16 | Ga0070714_100000233 | 3300005435 | Bacteria | 43523 |
| 17 | Ga0070714_100001824 | 3300005435 | Bacteria | 15486 |
| 18 | Ga0070714_100005412 | 3300005435 | Bacteria | 9740 |
| 19 | Ga0070714_100011532 | 3300005435 | Bacteria | 7014 |
| 20 | Ga0070714_100053550 | 3300005435 | Bacteria | 3445 |
| 21 | Ga0070714_100070656 | 3300005435 | Bacteria | 3018 |
| 22 | Ga0070714_100153490 | 3300005435 | Bacteria | 2077 |
| 23 | Ga0070714_100330507 | 3300005435 | Bacteria | 1427 |
| 24 | Ga0070714_100361212 | 3300005435 | Bacteria | 1365 |
| 25 | Ga0070713_100000759 | 3300005436 | Bacteria | 20648 |
| 26 | Ga0070713_100002913 | 3300005436 | Bacteria | 11203 |
| 27 | Ga0070713_100035570 | 3300005436 | Bacteria | 4011 |
| 28 | Ga0070713_100043173 | 3300005436 | Bacteria | 3684 |
| 29 | Ga0070713_100085970 | 3300005436 | Bacteria | 2695 |
| 30 | Ga0070713_100400084 | 3300005436 | Bacteria | 1282 |
| 31 | Ga0070710_10000156 | 3300005437 | Bacteria | 31483 |
| 32 | Ga0070710_10016077 | 3300005437 | Bacteria | 3800 |
| 33 | Ga0070710_10044759 | 3300005437 | Bacteria | 2457 |
| 34 | Ga0070710_10174549 | 3300005437 | Bacteria | 1341 |
| 35 | Ga0070711_100001013 | 3300005439 | Bacteria | 14930 |
| 36 | Ga0070711_100031410 | 3300005439 | Bacteria | 3526 |
| 37 | Ga0070711_100074086 | 3300005439 | Bacteria | 2407 |
| 38 | Ga0070694_100157903 | 3300005444 | Bacteria | 1661 |
| 39 | Ga0070708_100010078 | 3300005445 | Bacteria | 7648 |
| 40 | Ga0070708_100011212 | 3300005445 | Bacteria | 7289 |
| 41 | Ga0070708_100089473 | 3300005445 | Bacteria | 2801 |
| 42 | Ga0070708_100098949 | 3300005445 | Bacteria | 2668 |
| 43 | Ga0070708_100171792 | 3300005445 | Bacteria | 2024 |
| 44 | Ga0070708_100245703 | 3300005445 | Bacteria | 1681 |
| 45 | Ga0070708_100283395 | 3300005445 | Bacteria | 1560 |
| 46 | Ga0070708_100365267 | 3300005445 | Bacteria | 1360 |
| 47 | Ga0070663_100004550 | 3300005455 | Bacteria | 8174 |
| 48 | Ga0070663_100017400 | 3300005455 | Bacteria | 4691 |
| 49 | Ga0070663_100044808 | 3300005455 | Bacteria | 3122 |
| 50 | Ga0070681_10485848 | 3300005458 | Bacteria | 1148 |
| 51 | Ga0070706_100003471 | 3300005467 | Bacteria | 15514 |
| 52 | Ga0070706_100005571 | 3300005467 | Bacteria | 11984 |
| 53 | Ga0070706_100007633 | 3300005467 | Bacteria | 10122 |
| 54 | Ga0070706_100011229 | 3300005467 | Bacteria | 8317 |
| 55 | Ga0070706_100012683 | 3300005467 | Bacteria | 7797 |
| 56 | Ga0070706_100032714 | 3300005467 | Bacteria | 4798 |
| 57 | Ga0070706_100040104 | 3300005467 | Bacteria | 4322 |
| 58 | Ga0070706_100122538 | 3300005467 | Bacteria | 2424 |
| 59 | Ga0070706_100130336 | 3300005467 | Bacteria | 2346 |
| 60 | Ga0070706_100283553 | 3300005467 | Bacteria | 1546 |
| 61 | Ga0070706_100502102 | 3300005467 | Bacteria | 1129 |
| 62 | Ga0070707_100001697 | 3300005468 | Bacteria | 21256 |
| 63 | Ga0070707_100013028 | 3300005468 | Bacteria | 7771 |
| 64 | Ga0070707_100013259 | 3300005468 | Bacteria | 7708 |
| 65 | Ga0070707_100019079 | 3300005468 | Bacteria | 6458 |
| 66 | Ga0070707_100020535 | 3300005468 | Bacteria | 6233 |
| 67 | Ga0070707_100026781 | 3300005468 | Bacteria | 5477 |
| 68 | Ga0070698_100000192 | 3300005471 | Bacteria | 58336 |
| 69 | Ga0070698_100000354 | 3300005471 | Bacteria | 47476 |
| 70 | Ga0070698_100001213 | 3300005471 | Bacteria | 28680 |
| 71 | Ga0070698_100005834 | 3300005471 | Bacteria | 13466 |
| 72 | Ga0070698_100013320 | 3300005471 | Bacteria | 8702 |
| 73 | Ga0070698_100029177 | 3300005471 | Bacteria | 5726 |
| 74 | Ga0070698_100030880 | 3300005471 | Bacteria | 5556 |
| 75 | Ga0070698_100046363 | 3300005471 | Bacteria | 4444 |
| 76 | Ga0070698_100073013 | 3300005471 | Bacteria | 3438 |
| 77 | Ga0070698_100078855 | 3300005471 | Bacteria | 3291 |
| 78 | Ga0070698_100095373 | 3300005471 | Bacteria | 2952 |
| 79 | Ga0070698_100171262 | 3300005471 | Bacteria | 2112 |
| 80 | Ga0070699_100102490 | 3300005518 | Bacteria | 2509 |
| 81 | Ga0070679_100193216 | 3300005530 | Bacteria | 2003 |
| 82 | Ga0070684_100054966 | 3300005535 | Bacteria | 3469 |
| 83 | Ga0070684_100263535 | 3300005535 | Bacteria | 1577 |
| 84 | Ga0070697_100005992 | 3300005536 | Bacteria | 9399 |
| 85 | Ga0070697_100054446 | 3300005536 | Bacteria | 3251 |
| 86 | Ga0070697_100060897 | 3300005536 | Bacteria | 3078 |
| 87 | Ga0070697_100076148 | 3300005536 | Bacteria | 2759 |
| 88 | Ga0070696_100092001 | 3300005546 | Bacteria | 2161 |
| 89 | Ga0070664_100610693 | 3300005564 | Bacteria | 1012 |
| 90 | Ga0068856_100013479 | 3300005614 | Bacteria | 7913 |
| 91 | Ga0068856_100076702 | 3300005614 | Bacteria | 3311 |
| 92 | Ga0068852_100263261 | 3300005616 | Bacteria | 1656 |
| 93 | Ga0068864_100138610 | 3300005618 | Bacteria | 2192 |
| 94 | Ga0068863_100093634 | 3300005841 | Bacteria | 2851 |
| 95 | Ga0068863_100106839 | 3300005841 | Bacteria | 2663 |
| 96 | Ga0068860_100213654 | 3300005843 | Bacteria | 1871 |
| 97 | Ga0081540_1000601 | 3300005983 | Bacteria | 34296 |
| 98 | Ga0070717_10002685 | 3300006028 | Bacteria | 12535 |
| 99 | Ga0070717_10017687 | 3300006028 | Bacteria | 5551 |
| 100 | Ga0070717_10027822 | 3300006028 | Bacteria | 4520 |
| 101 | Ga0070717_10128022 | 3300006028 | Bacteria | 2181 |
| 102 | Ga0070717_10427000 | 3300006028 | Bacteria | 1192 |
| 103 | Ga0075365_10160326 | 3300006038 | Bacteria | 1567 |
| 104 | Ga0070715_10001118 | 3300006163 | Bacteria | 7639 |
| 105 | Ga0070715_10003853 | 3300006163 | Bacteria | 4843 |
| 106 | Ga0070716_100000371 | 3300006173 | Bacteria | 18468 |
| 107 | Ga0070716_100000929 | 3300006173 | Bacteria | 12703 |
| 108 | Ga0070716_100003249 | 3300006173 | Bacteria | 7634 |
| 109 | Ga0070716_100022958 | 3300006173 | Bacteria | 3303 |
| 110 | Ga0070716_100100957 | 3300006173 | Bacteria | 1768 |
| 111 | Ga0070716_100129002 | 3300006173 | Bacteria | 1595 |
| 112 | Ga0070712_100037447 | 3300006175 | Bacteria | 3307 |
| 113 | Ga0070712_100234444 | 3300006175 | Bacteria | 1459 |
| 114 | Ga0070712_100249606 | 3300006175 | Bacteria | 1417 |
| 115 | Ga0097621_100328477 | 3300006237 | Bacteria | 1356 |
| 116 | Ga0075428_100072304 | 3300006844 | Bacteria | 3768 |
| 117 | Ga0075433_10029032 | 3300006852 | Bacteria | 4709 |
| 118 | Ga0075433_10044691 | 3300006852 | Bacteria | 3849 |
| 119 | Ga0075433_10502800 | 3300006852 | Bacteria | 1067 |
| 120 | Ga0075434_100133418 | 3300006871 | Bacteria | 2503 |
| 121 | Ga0075434_100262195 | 3300006871 | Bacteria | 1747 |
| 122 | Ga0075436_100015916 | 3300006914 | Bacteria | 5148 |
| 123 | Ga0075436_100050761 | 3300006914 | Bacteria | 2863 |
| 124 | Ga0075436_100081820 | 3300006914 | Bacteria | 2239 |
| 125 | Ga0075436_100153832 | 3300006914 | Bacteria | 1619 |
| 126 | Ga0075435_100062323 | 3300007076 | Bacteria | 3026 |
| 127 | Ga0075435_100206439 | 3300007076 | Bacteria | 1665 |
| 128 | Ga0075435_100452294 | 3300007076 | Bacteria | 1107 |
| 129 | Ga0099795_10057637 | 3300007788 | Bacteria | 1433 |
| 130 | Ga0105240_10353704 | 3300009093 | Bacteria | 1666 |
| 131 | Ga0111539_10040160 | 3300009094 | Bacteria | 5634 |
| 132 | Ga0105245_10023602 | 3300009098 | Bacteria | 5400 |
| 133 | Ga0114129_10009348 | 3300009147 | Bacteria | 13979 |
| 134 | Ga0105241_10372626 | 3300009174 | Bacteria | 1245 |
| 135 | Ga0105242_10300151 | 3300009176 | Bacteria | 1466 |
| 136 | Ga0105248_10192061 | 3300009177 | Bacteria | 2301 |
| 137 | Ga0105238_10145996 | 3300009551 | Bacteria | 2342 |
| 138 | Ga0105239_10232709 | 3300010375 | Bacteria | 2067 |
| 139 | Ga0157373_10150422 | 3300013100 | Bacteria | 1637 |
| 140 | Ga0157370_10215715 | 3300013104 | Bacteria | 1778 |
| 141 | Ga0157369_10058003 | 3300013105 | Bacteria | 4176 |
| 142 | Ga0157369_10300786 | 3300013105 | Bacteria | 1669 |
| 143 | Ga0157369_10567519 | 3300013105 | Bacteria | 1172 |
| 144 | Ga0157372_10168403 | 3300013307 | Bacteria | 2534 |
| 145 | Ga0157375_10158031 | 3300013308 | Bacteria | 2407 |
| 146 | Ga0163163_10374853 | 3300014325 | Bacteria | 1480 |
| 147 | Ga0157379_10099483 | 3300014968 | Bacteria | 2611 |
| 148 | Ga0206354_11532852 | 3300020081 | Bacteria | 1480 |
| 149 | Ga0206353_10338168 | 3300020082 | Bacteria | 3129 |
| 150 | Ga0206353_10667712 | 3300020082 | Bacteria | 5747 |
| 151 | Ga0206353_11752212 | 3300020082 | Bacteria | 3042 |
| 152 | Ga0213875_10000758 | 3300021388 | Bacteria | 24340 |
| 153 | Ga0213875_10000907 | 3300021388 | Bacteria | 21486 |
| 154 | Ga0213875_10008834 | 3300021388 | Bacteria | 5142 |
| 155 | Ga0213875_10010026 | 3300021388 | Bacteria | 4766 |
| 156 | Ga0213875_10064588 | 3300021388 | Bacteria | 1710 |
| 157 | Ga0213875_10108994 | 3300021388 | Bacteria | 1293 |
| 158 | Ga0207692_10000123 | 3300025898 | Bacteria | 23195 |
| 159 | Ga0207692_10001266 | 3300025898 | Bacteria | 9373 |
| 160 | Ga0207692_10009025 | 3300025898 | Bacteria | 4151 |
| 161 | Ga0207692_10032927 | 3300025898 | Bacteria | 2495 |
| 162 | Ga0207692_10069895 | 3300025898 | Bacteria | 1846 |
| 163 | Ga0207710_10073569 | 3300025900 | Bacteria | 1572 |
| 164 | Ga0207688_10010686 | 3300025901 | Bacteria | 4996 |
| 165 | Ga0207680_10024971 | 3300025903 | Bacteria | 3289 |
| 166 | Ga0207685_10002387 | 3300025905 | Bacteria | 4289 |
| 167 | Ga0207685_10003173 | 3300025905 | Bacteria | 3946 |
| 168 | Ga0207685_10088056 | 3300025905 | Bacteria | 1301 |
| 169 | Ga0207699_10000446 | 3300025906 | Bacteria | 21144 |
| 170 | Ga0207699_10000563 | 3300025906 | Bacteria | 18306 |
| 171 | Ga0207699_10000829 | 3300025906 | Bacteria | 14705 |
| 172 | Ga0207699_10003388 | 3300025906 | Bacteria | 7600 |
| 173 | Ga0207699_10015622 | 3300025906 | Bacteria | 3948 |
| 174 | Ga0207699_10039319 | 3300025906 | Bacteria | 2717 |
| 175 | Ga0207699_10073926 | 3300025906 | Bacteria | 2092 |
| 176 | Ga0207699_10168067 | 3300025906 | Bacteria | 1465 |
| 177 | Ga0207645_10065213 | 3300025907 | Bacteria | 2327 |
| 178 | Ga0207643_10030097 | 3300025908 | Bacteria | 3021 |
| 179 | Ga0207684_10001618 | 3300025910 | Bacteria | 23905 |
| 180 | Ga0207684_10002393 | 3300025910 | Bacteria | 18981 |
| 181 | Ga0207684_10039423 | 3300025910 | Bacteria | 4007 |
| 182 | Ga0207684_10050976 | 3300025910 | Bacteria | 3511 |
| 183 | Ga0207684_10126107 | 3300025910 | Bacteria | 2197 |
| 184 | Ga0207684_10134300 | 3300025910 | Bacteria | 2124 |
| 185 | Ga0207684_10175753 | 3300025910 | Bacteria | 1846 |
| 186 | Ga0207684_10239876 | 3300025910 | Bacteria | 1564 |
| 187 | Ga0207684_10446368 | 3300025910 | Bacteria | 1111 |
| 188 | Ga0207707_10027336 | 3300025912 | Bacteria | 4990 |
| 189 | Ga0207707_10257049 | 3300025912 | Bacteria | 1516 |
| 190 | Ga0207707_10452165 | 3300025912 | Bacteria | 1099 |
| 191 | Ga0207693_10018227 | 3300025915 | Bacteria | 5593 |
| 192 | Ga0207693_10041001 | 3300025915 | Bacteria | 3646 |
| 193 | Ga0207693_10113589 | 3300025915 | Bacteria | 2125 |
| 194 | Ga0207693_10125945 | 3300025915 | Bacteria | 2014 |
| 195 | Ga0207693_10243551 | 3300025915 | Bacteria | 1411 |
| 196 | Ga0207663_10001119 | 3300025916 | Bacteria | 12327 |
| 197 | Ga0207663_10005217 | 3300025916 | Bacteria | 6538 |
| 198 | Ga0207663_10044674 | 3300025916 | Bacteria | 2721 |
| 199 | Ga0207663_10052332 | 3300025916 | Bacteria | 2546 |
| 200 | Ga0207657_10057686 | 3300025919 | Bacteria | 3345 |
| 201 | Ga0207649_10079747 | 3300025920 | Bacteria | 2115 |
| 202 | Ga0207652_10057211 | 3300025921 | Bacteria | 3358 |
| 203 | Ga0207652_10108366 | 3300025921 | Bacteria | 2461 |
| 204 | Ga0207646_10000470 | 3300025922 | Bacteria | 53859 |
| 205 | Ga0207646_10001715 | 3300025922 | Bacteria | 26634 |
| 206 | Ga0207646_10011732 | 3300025922 | Bacteria | 8470 |
| 207 | Ga0207646_10018634 | 3300025922 | Bacteria | 6472 |
| 208 | Ga0207646_10291039 | 3300025922 | Bacteria | 1476 |
| 209 | Ga0207700_10000891 | 3300025928 | Bacteria | 17200 |
| 210 | Ga0207700_10004620 | 3300025928 | Bacteria | 8153 |
| 211 | Ga0207700_10008058 | 3300025928 | Bacteria | 6497 |
| 212 | Ga0207700_10012751 | 3300025928 | Bacteria | 5435 |
| 213 | Ga0207700_10013250 | 3300025928 | Bacteria | 5356 |
| 214 | Ga0207700_10016381 | 3300025928 | Bacteria | 4923 |
| 215 | Ga0207700_10038639 | 3300025928 | Bacteria | 3466 |
| 216 | Ga0207700_10059302 | 3300025928 | Bacteria | 2894 |
| 217 | Ga0207700_10386641 | 3300025928 | Bacteria | 1224 |
| 218 | Ga0207664_10000224 | 3300025929 | Bacteria | 42785 |
| 219 | Ga0207664_10005359 | 3300025929 | Bacteria | 8762 |
| 220 | Ga0207664_10005791 | 3300025929 | Bacteria | 8451 |
| 221 | Ga0207664_10006025 | 3300025929 | Bacteria | 8299 |
| 222 | Ga0207664_10011377 | 3300025929 | Bacteria | 6321 |
| 223 | Ga0207664_10012680 | 3300025929 | Bacteria | 6031 |
| 224 | Ga0207664_10033493 | 3300025929 | Bacteria | 3947 |
| 225 | Ga0207664_10129162 | 3300025929 | Bacteria | 2125 |
| 226 | Ga0207664_10131254 | 3300025929 | Bacteria | 2109 |
| 227 | Ga0207664_10134532 | 3300025929 | Bacteria | 2085 |
| 228 | Ga0207664_10254658 | 3300025929 | Bacteria | 1533 |
| 229 | Ga0207664_10259524 | 3300025929 | Bacteria | 1519 |
| 230 | Ga0207644_10072463 | 3300025931 | Bacteria | 2523 |
| 231 | Ga0207665_10000786 | 3300025939 | Bacteria | 21382 |
| 232 | Ga0207665_10000882 | 3300025939 | Bacteria | 20246 |
| 233 | Ga0207665_10003733 | 3300025939 | Bacteria | 10178 |
| 234 | Ga0207665_10003910 | 3300025939 | Bacteria | 9970 |
| 235 | Ga0207665_10008276 | 3300025939 | Bacteria | 6866 |
| 236 | Ga0207665_10165935 | 3300025939 | Bacteria | 1592 |
| 237 | Ga0207665_10198216 | 3300025939 | Bacteria | 1462 |
| 238 | Ga0207665_10265994 | 3300025939 | Bacteria | 1272 |
| 239 | Ga0207691_10043717 | 3300025940 | Bacteria | 4127 |
| 240 | Ga0207689_10013841 | 3300025942 | Bacteria | 6874 |
| 241 | Ga0207661_10024207 | 3300025944 | Bacteria | 4599 |
| 242 | Ga0207661_10102770 | 3300025944 | Bacteria | 2404 |
| 243 | Ga0207661_10344993 | 3300025944 | Bacteria | 1342 |
| 244 | Ga0207679_10098501 | 3300025945 | Bacteria | 2280 |
| 245 | Ga0207651_10129231 | 3300025960 | Bacteria | 1931 |
| 246 | Ga0207658_10210997 | 3300025986 | Bacteria | 1627 |
| 247 | Ga0207677_10040536 | 3300026023 | Bacteria | 3071 |
| 248 | Ga0207678_10000248 | 3300026067 | Bacteria | 48560 |
| 249 | Ga0207678_10044649 | 3300026067 | Bacteria | 3833 |
| 250 | Ga0207678_10062668 | 3300026067 | Bacteria | 3196 |
| 251 | Ga0207678_10082610 | 3300026067 | Bacteria | 2749 |
| 252 | Ga0207702_10027569 | 3300026078 | Bacteria | 4717 |
| 253 | Ga0207702_10298704 | 3300026078 | Bacteria | 1528 |
| 254 | Ga0207648_10445194 | 3300026089 | Bacteria | 1179 |
| 255 | Ga0207676_10013845 | 3300026095 | Bacteria | 5791 |
| 256 | Ga0207674_10059346 | 3300026116 | Bacteria | 3871 |
| 257 | Ga0207674_10076793 | 3300026116 | Bacteria | 3348 |
| 258 | Ga0207674_10252945 | 3300026116 | Bacteria | 1709 |
| 259 | Ga0207675_100034633 | 3300026118 | Bacteria | 4709 |
| 260 | Ga0207683_10016543 | 3300026121 | Bacteria | 6278 |
| 261 | Ga0207428_10171894 | 3300027907 | Bacteria | 1641 |
| 262 | Ga0268266_10148750 | 3300028379 | Bacteria | 2109 |
| 263 | Ga0268264_10342306 | 3300028381 | Bacteria | 1421 |
| 264 | Ga0265326_10000784 | 3300028558 | Bacteria | 11757 |
| 265 | Ga0265319_1000235 | 3300028563 | Bacteria | 41448 |
| 266 | Ga0265334_10000374 | 3300028573 | Bacteria | 23952 |
| 267 | Ga0265318_10037578 | 3300028577 | Bacteria | 1854 |
| 268 | Ga0265323_10001596 | 3300028653 | Bacteria | 10937 |
| 269 | Ga0265322_10002045 | 3300028654 | Bacteria | 6348 |
| 270 | Ga0265336_10002957 | 3300028666 | Bacteria | 6799 |
| 271 | Ga0265338_10000986 | 3300028800 | Bacteria | 47980 |
| 272 | Ga0265338_10004621 | 3300028800 | Bacteria | 18508 |
| 273 | Ga0265338_10006079 | 3300028800 | Bacteria | 15500 |
| 274 | Ga0265338_10009124 | 3300028800 | Bacteria | 11914 |
| 275 | Ga0265324_10000535 | 3300029957 | Bacteria | 26053 |
| 276 | Ga0265332_10000225 | 3300031238 | Bacteria | 45458 |
| 277 | Ga0265320_10000621 | 3300031240 | Bacteria | 27147 |
| 278 | Ga0265325_10023000 | 3300031241 | Bacteria | 3408 |
| 279 | Ga0265340_10000525 | 3300031247 | Bacteria | 21125 |
| 280 | Ga0265339_10003503 | 3300031249 | Bacteria | 10966 |
| 281 | Ga0265316_10026666 | 3300031344 | Bacteria | 4800 |
| 282 | Ga0307513_10002805 | 3300031456 | Bacteria | 23900 |
| 283 | Ga0265313_10009449 | 3300031595 | Bacteria | 6331 |
| 284 | Ga0265314_10001593 | 3300031711 | Bacteria | 24946 |
| 285 | Ga0265342_10003335 | 3300031712 | Bacteria | 13254 |
| 286 | Ga0316576_10064077 | 3300031727 | Bacteria | 2699 |
| 287 | Ga0316578_10020449 | 3300031728 | Bacteria | 3658 |
| 288 | Ga0307413_10076820 | 3300031824 | Bacteria | 2124 |
| 289 | Ga0307410_10188909 | 3300031852 | Bacteria | 1565 |
| 290 | Ga0307410_10281961 | 3300031852 | Bacteria | 1304 |
| 291 | Ga0307409_100038159 | 3300031995 | Bacteria | 3550 |
| 292 | Ga0307409_100229412 | 3300031995 | Bacteria | 1682 |
| 293 | Ga0307416_100010532 | 3300032002 | Bacteria | 6113 |
| 294 | Ga0307416_100269233 | 3300032002 | Bacteria | 1671 |
| 295 | Ga0307416_100296090 | 3300032002 | Bacteria | 1605 |
| 296 | Ga0307411_10004211 | 3300032005 | Bacteria | 6842 |
| 297 | Ga0307415_100076642 | 3300032126 | Bacteria | 2371 |
| 298 | Ga0307415_100107421 | 3300032126 | Bacteria | 2062 |
| 299 | Ga0307415_100221540 | 3300032126 | Bacteria | 1517 |
| 300 | Ga0307507_10006423 | 3300033179 | Bacteria | 18062 |
| 301 | Ga0307510_10035918 | 3300033180 | Bacteria | 5524 |
| 302 | Ga0316212_1003253 | 3300033547 | Bacteria | 2340 |
| 303 | Ga0373930_0001178 | 3300034816 | Bacteria | 3834 |
| 304 | Ga0373938_0003804 | 3300034957 | Bacteria | 2492 |
| 305 | Ga0373926_0006644 | 3300035083 | Bacteria | 3838 |
| 306 | Ga0373926_0018293 | 3300035083 | Bacteria | 2408 |
| 307 | Ga0373934_0000159 | 3300035086 | Bacteria | 24489 |
| 308 | Ga0373934_0007737 | 3300035086 | Bacteria | 3994 |
| 309 | Ga0373934_0015020 | 3300035086 | Bacteria | 2936 |
| 310 | Ga0373934_0075102 | 3300035086 | Bacteria | 1354 |
| 311 | Ga0373934_0101136 | 3300035086 | Bacteria | 1165 |
| 312 | Ga0373944_0000075 | 3300035089 | Bacteria | 16922 |
| 313 | Ga0373944_0002184 | 3300035089 | Bacteria | 4979 |
| 314 | Ga0373944_0025259 | 3300035089 | Bacteria | 1748 |
| 315 | Ga0373923_0004555 | 3300035111 | Bacteria | 4611 |
| 316 | Ga0373923_0015425 | 3300035111 | Bacteria | 2884 |
| 317 | Ga0373923_0020174 | 3300035111 | Bacteria | 2586 |
| 318 | Ga0373936_0000658 | 3300035113 | Bacteria | 11970 |
| 319 | Ga0373936_0000869 | 3300035113 | Bacteria | 10781 |
| 320 | Ga0373936_0004327 | 3300035113 | Bacteria | 5368 |
| 321 | Ga0373936_0026351 | 3300035113 | Bacteria | 2276 |
| 322 | Ga0373936_0034695 | 3300035113 | Bacteria | 2006 |
| 323 | Ga0373941_0018312 | 3300035115 | Bacteria | 1933 |
| 324 | Ga0373941_0022921 | 3300035115 | Bacteria | 1777 |
| 325 | Ga0373945_0000067 | 3300035116 | Bacteria | 23561 |
| 326 | Ga0373945_0120000 | 3300035116 | Bacteria | 1045 |
| 327 | Ga0373953_0000089 | 3300035117 | Bacteria | 21678 |
| 328 | Ga0373953_0004371 | 3300035117 | Bacteria | 4499 |
| 329 | Ga0373953_0031725 | 3300035117 | Bacteria | 2056 |
| 330 | Ga0373953_0052619 | 3300035117 | Bacteria | 1648 |
| 331 | Ga0373953_0071870 | 3300035117 | Bacteria | 1428 |
| 332 | Ga0373954_0009771 | 3300035118 | Bacteria | 4223 |
| 333 | Ga0373954_0014957 | 3300035118 | Bacteria | 3463 |
| 334 | Ga0373954_0018042 | 3300035118 | Bacteria | 3174 |
| 335 | Ga0373954_0023241 | 3300035118 | Bacteria | 2817 |
| 336 | Ga0373954_0123655 | 3300035118 | Bacteria | 1257 |
| 337 | Ga0373956_0004682 | 3300035119 | Bacteria | 5468 |
| 338 | Ga0373956_0009048 | 3300035119 | Bacteria | 4038 |
| 339 | Ga0373956_0018381 | 3300035119 | Bacteria | 2959 |
| 340 | Ga0373956_0128086 | 3300035119 | Bacteria | 1187 |
| 341 | Ga0373956_0178041 | 3300035119 | Bacteria | 1005 |
| 342 | Ga0373957_0000438 | 3300035120 | Bacteria | 10448 |
| 343 | Ga0373957_0010754 | 3300035120 | Bacteria | 3035 |
| 344 | Ga0373957_0014026 | 3300035120 | Bacteria | 2732 |
| 345 | Ga0373943_0001486 | 3300035170 | Bacteria | 10622 |
| 346 | Ga0373943_0009966 | 3300035170 | Bacteria | 4259 |
| 347 | Ga0373943_0055712 | 3300035170 | Bacteria | 1959 |
| 348 | Ga0373946_0000202 | 3300035171 | Bacteria | 18459 |
| 349 | Ga0373946_0058651 | 3300035171 | Bacteria | 1631 |
| 350 | Ga0373946_0081526 | 3300035171 | Bacteria | 1417 |
| 351 | Ga0373955_0000024 | 3300035172 | Bacteria | 60102 |
| 352 | Ga0373955_0009966 | 3300035172 | Bacteria | 4471 |
| 353 | Ga0373955_0018957 | 3300035172 | Bacteria | 3431 |
| 354 | Ga0373955_0050746 | 3300035172 | Bacteria | 2257 |
| 355 | Ga0373955_0075410 | 3300035172 | Bacteria | 1895 |
| 356 | Ga0373955_0198687 | 3300035172 | Bacteria | 1193 |
| 357 | Ga0373962_0045062 | 3300035242 | Bacteria | 1255 |
| 358 | Ga0316574_0092496 | 3300035398 | Bacteria | 1930 |
| 359 | Ga0373924_0001904 | 3300035410 | Bacteria | 6931 |
| 360 | Ga0373924_0015754 | 3300035410 | Bacteria | 2878 |
| 361 | Ga0373924_0039916 | 3300035410 | Bacteria | 1919 |
| 362 | Ga0373924_0091688 | 3300035410 | Bacteria | 1300 |
| 363 | Ga0373924_0121162 | 3300035410 | Bacteria | 1135 |
| 364 | Ga0373931_0140175 | 3300035691 | Bacteria | 1400 |
| 365 | Ga0373931_0201794 | 3300035691 | Bacteria | 1188 |
| 366 | Ga0373935_0023766 | 3300035692 | Bacteria | 3765 |
| 367 | Ga0373935_0047093 | 3300035692 | Bacteria | 2725 |
| 368 | Ga0373935_0050424 | 3300035692 | Bacteria | 2641 |
| 369 | Ga0373935_0144653 | 3300035692 | Bacteria | 1608 |
| 370 | Ga0373927_0000281 | 3300035695 | Bacteria | 40043 |
| 371 | Ga0373927_0006482 | 3300035695 | Bacteria | 7971 |
| 372 | Ga0373927_0067045 | 3300035695 | Bacteria | 2322 |
| 373 | Ga0373933_0000153 | 3300035724 | Bacteria | 44821 |
| 374 | Ga0373933_0003103 | 3300035724 | Bacteria | 9265 |
| 375 | Ga0373933_0003186 | 3300035724 | Bacteria | 9160 |
| 376 | Ga0373933_0039109 | 3300035724 | Bacteria | 2789 |
| 377 | Ga0373933_0099413 | 3300035724 | Bacteria | 1803 |
| 378 | Ga0373933_0099600 | 3300035724 | Bacteria | 1802 |
| 379 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 380 | Ga0373947_0000793 | 3300035725 | Bacteria | 19007 |
| 381 | Ga0373947_0016645 | 3300035725 | Bacteria | 4224 |
| 382 | Ga0373947_0065562 | 3300035725 | Bacteria | 2215 |
| 383 | Ga0373947_0090750 | 3300035725 | Bacteria | 1905 |
| 384 | Ga0373947_0178481 | 3300035725 | Bacteria | 1381 |
| 385 | Ga0373947_0196726 | 3300035725 | Bacteria | 1317 |
| 386 | Ga0373937_0000333 | 3300036401 | Bacteria | 44782 |
| 387 | Ga0373937_0006376 | 3300036401 | Bacteria | 10178 |
| 388 | Ga0373937_0015734 | 3300036401 | Bacteria | 6699 |
| 389 | Ga0373937_0018453 | 3300036401 | Bacteria | 6230 |
| 390 | Ga0373937_0018617 | 3300036401 | Bacteria | 6203 |
| 391 | Ga0373937_0083059 | 3300036401 | Bacteria | 2963 |
| 392 | Ga0373937_0312084 | 3300036401 | Bacteria | 1487 |
| 393 | Ga0372808_005037 | 3300036459 | Bacteria | 1722 |
| 394 | Ga0316584_0170690 | 3300036712 | Bacteria | 1613 |
| 395 | Ga0373925_0002004 | 3300037068 | Bacteria | 16877 |
| 396 | Ga0373925_0004641 | 3300037068 | Bacteria | 10374 |
| 397 | Ga0373925_0004888 | 3300037068 | Bacteria | 10084 |
| 398 | Ga0373925_0041056 | 3300037068 | Bacteria | 3427 |
| 399 | Ga0373925_0075068 | 3300037068 | Bacteria | 2561 |
| 400 | Ga0373925_0082540 | 3300037068 | Bacteria | 2446 |
| 401 | Ga0373925_0106044 | 3300037068 | Bacteria | 2166 |
| 402 | Ga0373925_0123952 | 3300037068 | Bacteria | 2008 |
| 403 | Ga0373925_0266745 | 3300037068 | Bacteria | 1376 |
| 404 | Ga0395900_0020198 | 3300037418 | Bacteria | 6797 |
| 405 | Ga0395898_0164765 | 3300037466 | Bacteria | 2120 |
| 406 | Ga0436364_0024071 | 3300037853 | Bacteria | 5468 |
| 407 | Ga0436364_0086889 | 3300037853 | Bacteria | 54583 |
| 408 | Ga0436364_0185475 | 3300037853 | Bacteria | 22963 |
| 409 | Ga0436364_0319187 | 3300037853 | Bacteria | 1979 |
| 410 | Ga0436364_0508196 | 3300037853 | Bacteria | 6293 |
| 411 | Ga0436364_0789302 | 3300037853 | Bacteria | 5258 |
| 412 | Ga0436364_0838834 | 3300037853 | Bacteria | 3029 |
| 413 | Ga0436364_1268560 | 3300037853 | Bacteria | 2008 |
| 414 | Ga0395901_0012456 | 3300038443 | Bacteria | 8631 |
| 415 | Ga0436361_0712461 | 3300039447 | Bacteria | 968 |
| 416 | Ga0436363_0123638 | 3300039450 | Bacteria | 3610 |
| 417 | Ga0436362_0802341 | 3300039453 | Bacteria | 1026 |
| 418 | Ga0451797_1022337 | 3300041453 | Bacteria | 1329 |
| 419 | Ga0466966_0016405 | 3300044684 | Bacteria | 4895 |
| 420 | Ga0466966_0161462 | 3300044684 | Bacteria | 1364 |
| 421 | Ga0466961_0060354 | 3300044693 | Bacteria | 2411 |
| 422 | Ga0466963_0085983 | 3300044694 | Bacteria | 2136 |
| 423 | Ga0466963_0088295 | 3300044694 | Bacteria | 2109 |
| 424 | Ga0466963_0158470 | 3300044694 | Bacteria | 1575 |
| 425 | Ga0466963_0173756 | 3300044694 | Bacteria | 1503 |
| 426 | Ga0466971_0012412 | 3300044719 | Bacteria | 3733 |
| 427 | Ga0466970_0035109 | 3300044765 | Bacteria | 2657 |
| 428 | Ga0466960_0198286 | 3300044901 | Bacteria | 1095 |
| 429 | Ga0466960_0202586 | 3300044901 | Bacteria | 1085 |
| 430 | Ga0466959_0025353 | 3300045049 | Bacteria | 4394 |
| 431 | Ga0466959_0158798 | 3300045049 | Bacteria | 1590 |
| 432 | Ga0466958_0008864 | 3300045836 | Bacteria | 5589 |
| 433 | Ga0466967_0036146 | 3300045976 | Bacteria | 4214 |
| 434 | Ga0466967_0041438 | 3300045976 | Bacteria | 3970 |
| 435 | Ga0466967_0063218 | 3300045976 | Bacteria | 3288 |
| 436 | Ga0466967_0113449 | 3300045976 | Bacteria | 2493 |
| 437 | Ga0466967_0418207 | 3300045976 | Bacteria | 1306 |
| 438 | Ga0495592_0000304 | 3300046454 | Bacteria | 41482 |
| 439 | Ga0495592_0010307 | 3300046454 | Bacteria | 7045 |
| 440 | Ga0495592_0040207 | 3300046454 | Bacteria | 3509 |
| 441 | Ga0495592_0054148 | 3300046454 | Bacteria | 2973 |
| 442 | Ga0495592_0126492 | 3300046454 | Bacteria | 1792 |
| 443 | Ga0495592_0131181 | 3300046454 | Bacteria | 1752 |
| 444 | Ga0495603_0021873 | 3300046455 | Bacteria | 3872 |
| 445 | Ga0495603_0027264 | 3300046455 | Bacteria | 3448 |
| 446 | Ga0495603_0131661 | 3300046455 | Bacteria | 1456 |
| 447 | Ga0495629_0001760 | 3300046459 | Bacteria | 16982 |
| 448 | Ga0495629_0005374 | 3300046459 | Bacteria | 9560 |
| 449 | Ga0495629_0017003 | 3300046459 | Bacteria | 5218 |
| 450 | Ga0495629_0022645 | 3300046459 | Bacteria | 4477 |
| 451 | Ga0495629_0042465 | 3300046459 | Bacteria | 3195 |
| 452 | Ga0495641_0005130 | 3300046461 | Bacteria | 8966 |
| 453 | Ga0495641_0005560 | 3300046461 | Bacteria | 8461 |
| 454 | Ga0495641_0021555 | 3300046461 | Bacteria | 3240 |
| 455 | Ga0495641_0030028 | 3300046461 | Bacteria | 2612 |
| 456 | Ga0495641_0162921 | 3300046461 | Bacteria | 997 |
| 457 | Ga0495651_0000252 | 3300046462 | Bacteria | 41425 |
| 458 | Ga0495651_0002138 | 3300046462 | Bacteria | 15283 |
| 459 | Ga0495651_0011089 | 3300046462 | Bacteria | 6930 |
| 460 | Ga0495651_0021691 | 3300046462 | Bacteria | 4992 |
| 461 | Ga0495651_0023401 | 3300046462 | Bacteria | 4803 |
| 462 | Ga0495651_0032595 | 3300046462 | Bacteria | 4062 |
| 463 | Ga0495651_0069936 | 3300046462 | Bacteria | 2671 |
| 464 | Ga0495651_0083604 | 3300046462 | Bacteria | 2406 |
| 465 | Ga0495651_0308360 | 3300046462 | Bacteria | 1059 |
| 466 | Ga0495653_0001719 | 3300046463 | Bacteria | 17248 |
| 467 | Ga0495653_0008333 | 3300046463 | Bacteria | 8497 |
| 468 | Ga0495653_0010622 | 3300046463 | Bacteria | 7535 |
| 469 | Ga0495653_0012189 | 3300046463 | Bacteria | 7014 |
| 470 | Ga0495653_0038051 | 3300046463 | Bacteria | 3777 |
| 471 | Ga0495653_0061928 | 3300046463 | Bacteria | 2828 |
| 472 | Ga0495653_0073379 | 3300046463 | Bacteria | 2553 |
| 473 | Ga0495653_0084554 | 3300046463 | Bacteria | 2336 |
| 474 | Ga0495580_0017409 | 3300046472 | Bacteria | 5376 |
| 475 | Ga0495582_0000170 | 3300046473 | Bacteria | 35330 |
| 476 | Ga0495582_0006336 | 3300046473 | Bacteria | 6581 |
| 477 | Ga0495582_0006953 | 3300046473 | Bacteria | 6291 |
| 478 | Ga0495582_0008724 | 3300046473 | Bacteria | 5590 |
| 479 | Ga0495639_0008262 | 3300046475 | Bacteria | 4468 |
| 480 | Ga0495639_0011896 | 3300046475 | Bacteria | 3753 |
| 481 | Ga0495639_0077951 | 3300046475 | Bacteria | 1539 |
| 482 | Ga0495662_0006551 | 3300046476 | Bacteria | 5814 |
| 483 | Ga0495662_0008050 | 3300046476 | Bacteria | 5191 |
| 484 | Ga0495662_0019779 | 3300046476 | Bacteria | 3257 |
| 485 | Ga0495662_0025748 | 3300046476 | Bacteria | 2840 |
| 486 | Ga0495662_0162506 | 3300046476 | Bacteria | 1100 |
| 487 | Ga0495664_0000599 | 3300046477 | Bacteria | 18284 |
| 488 | Ga0495664_0009930 | 3300046477 | Bacteria | 5337 |
| 489 | Ga0495664_0011357 | 3300046477 | Bacteria | 5019 |
| 490 | Ga0495664_0013115 | 3300046477 | Bacteria | 4700 |
| 491 | Ga0495664_0015657 | 3300046477 | Bacteria | 4313 |
| 492 | Ga0495664_0063161 | 3300046477 | Bacteria | 2206 |
| 493 | Ga0495664_0068708 | 3300046477 | Bacteria | 2114 |
| 494 | Ga0495594_0050605 | 3300046499 | Bacteria | 2285 |
| 495 | Ga0495594_0125521 | 3300046499 | Bacteria | 1452 |
| 496 | Ga0495608_0000101 | 3300046511 | Bacteria | 61678 |
| 497 | Ga0495608_0000839 | 3300046511 | Bacteria | 21479 |
| 498 | Ga0495608_0014598 | 3300046511 | Bacteria | 5450 |
| 499 | Ga0495608_0062096 | 3300046511 | Bacteria | 2455 |
| 500 | Ga0495608_0099691 | 3300046511 | Bacteria | 1873 |
| 501 | Ga0495608_0127546 | 3300046511 | Bacteria | 1629 |
| 502 | Ga0495618_0016506 | 3300046514 | Bacteria | 4518 |
| 503 | Ga0495618_0018264 | 3300046514 | Bacteria | 4305 |
| 504 | Ga0495618_0019669 | 3300046514 | Bacteria | 4155 |
| 505 | Ga0495618_0026002 | 3300046514 | Bacteria | 3635 |
| 506 | Ga0495628_0000327 | 3300046516 | Bacteria | 43068 |
| 507 | Ga0495628_0012903 | 3300046516 | Bacteria | 7036 |
| 508 | Ga0495628_0017420 | 3300046516 | Bacteria | 5982 |
| 509 | Ga0495628_0085074 | 3300046516 | Bacteria | 2454 |
| 510 | Ga0495628_0088682 | 3300046516 | Bacteria | 2396 |
| 511 | Ga0495628_0237378 | 3300046516 | Bacteria | 1364 |
| 512 | Ga0495628_0316839 | 3300046516 | Bacteria | 1151 |
| 513 | Ga0495630_0010732 | 3300046517 | Bacteria | 6614 |
| 514 | Ga0495630_0026872 | 3300046517 | Bacteria | 4264 |
| 515 | Ga0495630_0037601 | 3300046517 | Bacteria | 3619 |
| 516 | Ga0495630_0079075 | 3300046517 | Bacteria | 2480 |
| 517 | Ga0495630_0083624 | 3300046517 | Bacteria | 2410 |
| 518 | Ga0495630_0105622 | 3300046517 | Bacteria | 2132 |
| 519 | Ga0495630_0227664 | 3300046517 | Bacteria | 1424 |
| 520 | Ga0495630_0241311 | 3300046517 | Bacteria | 1381 |
| 521 | Ga0495666_0036024 | 3300046526 | Bacteria | 2410 |
| 522 | Ga0495666_0036327 | 3300046526 | Bacteria | 2399 |
| 523 | Ga0495666_0043575 | 3300046526 | Bacteria | 2167 |
| 524 | Ga0495666_0059048 | 3300046526 | Bacteria | 1834 |
| 525 | Ga0495652_0000775 | 3300046529 | Bacteria | 36861 |
| 526 | Ga0495652_0005238 | 3300046529 | Bacteria | 12249 |
| 527 | Ga0495652_0020665 | 3300046529 | Bacteria | 5852 |
| 528 | Ga0495652_0025699 | 3300046529 | Bacteria | 5205 |
| 529 | Ga0495652_0077246 | 3300046529 | Bacteria | 2760 |
| 530 | Ga0495652_0082199 | 3300046529 | Bacteria | 2656 |
| 531 | Ga0495652_0084539 | 3300046529 | Bacteria | 2609 |
| 532 | Ga0495652_0101328 | 3300046529 | Bacteria | 2334 |
| 533 | Ga0495652_0132979 | 3300046529 | Bacteria | 1966 |
| 534 | Ga0495652_0214721 | 3300046529 | Bacteria | 1449 |
| 535 | Ga0495665_0001675 | 3300046531 | Bacteria | 11893 |
| 536 | Ga0495665_0006142 | 3300046531 | Bacteria | 6489 |
| 537 | Ga0495665_0047625 | 3300046531 | Bacteria | 2274 |
| 538 | Ga0495665_0059618 | 3300046531 | Bacteria | 2014 |
| 539 | Ga0495640_0016998 | 3300046533 | Bacteria | 5430 |
| 540 | Ga0495640_0033340 | 3300046533 | Bacteria | 3659 |
| 541 | Ga0495640_0037892 | 3300046533 | Bacteria | 3397 |
| 542 | Ga0495640_0045625 | 3300046533 | Bacteria | 3040 |
| 543 | Ga0495640_0069489 | 3300046533 | Bacteria | 2368 |
| 544 | Ga0495640_0078904 | 3300046533 | Bacteria | 2192 |
| 545 | Ga0495586_0000770 | 3300046535 | Bacteria | 18403 |
| 546 | Ga0495586_0032003 | 3300046535 | Bacteria | 2819 |
| 547 | Ga0495587_0000228 | 3300046536 | Bacteria | 41527 |
| 548 | Ga0495587_0009908 | 3300046536 | Bacteria | 6081 |
| 549 | Ga0495587_0014596 | 3300046536 | Bacteria | 4922 |
| 550 | Ga0495587_0015977 | 3300046536 | Bacteria | 4672 |
| 551 | Ga0495587_0040454 | 3300046536 | Bacteria | 2786 |
| 552 | Ga0495587_0069686 | 3300046536 | Bacteria | 2047 |
| 553 | Ga0495645_0004770 | 3300046543 | Bacteria | 9264 |
| 554 | Ga0495645_0016394 | 3300046543 | Bacteria | 5288 |
| 555 | Ga0495645_0022860 | 3300046543 | Bacteria | 4525 |
| 556 | Ga0495645_0046798 | 3300046543 | Bacteria | 3153 |
| 557 | Ga0495645_0076362 | 3300046543 | Bacteria | 2410 |
| 558 | Ga0495645_0104236 | 3300046543 | Bacteria | 2014 |
| 559 | Ga0495645_0127914 | 3300046543 | Bacteria | 1783 |
| 560 | Ga0495645_0167411 | 3300046543 | Bacteria | 1515 |
| 561 | Ga0495667_0000281 | 3300046559 | Bacteria | 33057 |
| 562 | Ga0495667_0000742 | 3300046559 | Bacteria | 20968 |
| 563 | Ga0495667_0022555 | 3300046559 | Bacteria | 4241 |
| 564 | Ga0495667_0028667 | 3300046559 | Bacteria | 3749 |
| 565 | Ga0495667_0044082 | 3300046559 | Bacteria | 2954 |
| 566 | Ga0495667_0046493 | 3300046559 | Bacteria | 2870 |
| 567 | Ga0495667_0053794 | 3300046559 | Bacteria | 2650 |
| 568 | Ga0495667_0055691 | 3300046559 | Bacteria | 2600 |
| 569 | Ga0495634_0002978 | 3300046642 | Bacteria | 13815 |
| 570 | Ga0495634_0005158 | 3300046642 | Bacteria | 10089 |
| 571 | Ga0495634_0014358 | 3300046642 | Bacteria | 5715 |
| 572 | Ga0495634_0047925 | 3300046642 | Bacteria | 2878 |
| 573 | Ga0495634_0086480 | 3300046642 | Bacteria | 2042 |
| 574 | Ga0495634_0173599 | 3300046642 | Bacteria | 1353 |
| 575 | Ga0495634_0197209 | 3300046642 | Bacteria | 1252 |
| 576 | Ga0495635_0002055 | 3300046663 | Bacteria | 13637 |
| 577 | Ga0495635_0010435 | 3300046663 | Bacteria | 6497 |
| 578 | Ga0495635_0015511 | 3300046663 | Bacteria | 5325 |
| 579 | Ga0495635_0030979 | 3300046663 | Bacteria | 3715 |
| 580 | Ga0495635_0039866 | 3300046663 | Bacteria | 3247 |
| 581 | Ga0495635_0040457 | 3300046663 | Bacteria | 3221 |
| 582 | Ga0495635_0061600 | 3300046663 | Bacteria | 2577 |
| 583 | Ga0495635_0129509 | 3300046663 | Bacteria | 1720 |
| 584 | Ga0495635_0168354 | 3300046663 | Bacteria | 1490 |
| 585 | Ga0495588_0053162 | 3300046674 | Bacteria | 2088 |
| 586 | Ga0495657_0000156 | 3300046675 | Bacteria | 61702 |
| 587 | Ga0495657_0000699 | 3300046675 | Bacteria | 30085 |
| 588 | Ga0495657_0010513 | 3300046675 | Bacteria | 6963 |
| 589 | Ga0495657_0014848 | 3300046675 | Bacteria | 5714 |
| 590 | Ga0495657_0036799 | 3300046675 | Bacteria | 3379 |
| 591 | Ga0495657_0044847 | 3300046675 | Bacteria | 3003 |
| 592 | Ga0495657_0065967 | 3300046675 | Bacteria | 2379 |
| 593 | Ga0495657_0068044 | 3300046675 | Bacteria | 2335 |
| 594 | Ga0495657_0070479 | 3300046675 | Bacteria | 2284 |
| 595 | Ga0495599_0000097 | 3300046678 | Bacteria | 61561 |
| 596 | Ga0495599_0017903 | 3300046678 | Bacteria | 4411 |
| 597 | Ga0495599_0042915 | 3300046678 | Bacteria | 2838 |
| 598 | Ga0495599_0047629 | 3300046678 | Bacteria | 2687 |
| 599 | Ga0495599_0057864 | 3300046678 | Bacteria | 2425 |
| 600 | Ga0495599_0069504 | 3300046678 | Bacteria | 2197 |
| 601 | Ga0495599_0079535 | 3300046678 | Bacteria | 2047 |
| 602 | Ga0495599_0096107 | 3300046678 | Bacteria | 1847 |
| 603 | Ga0495623_0000471 | 3300046679 | Bacteria | 26602 |
| 604 | Ga0495623_0012270 | 3300046679 | Bacteria | 5549 |
| 605 | Ga0495623_0025222 | 3300046679 | Bacteria | 3829 |
| 606 | Ga0495623_0026024 | 3300046679 | Bacteria | 3768 |
| 607 | Ga0495623_0054938 | 3300046679 | Bacteria | 2511 |
| 608 | Ga0495623_0108609 | 3300046679 | Bacteria | 1684 |
| 609 | Ga0495646_0027767 | 3300046680 | Bacteria | 3548 |
| 610 | Ga0495646_0040299 | 3300046680 | Bacteria | 2877 |
| 611 | Ga0495646_0043835 | 3300046680 | Bacteria | 2737 |
| 612 | Ga0495646_0057155 | 3300046680 | Bacteria | 2336 |
| 613 | Ga0495647_0003856 | 3300046681 | Bacteria | 4830 |
| 614 | Ga0495647_0044458 | 3300046681 | Bacteria | 1703 |
| 615 | Ga0495658_0004488 | 3300046683 | Bacteria | 6867 |
| 616 | Ga0495658_0007391 | 3300046683 | Bacteria | 5434 |
| 617 | Ga0495658_0030966 | 3300046683 | Bacteria | 2909 |
| 618 | Ga0495613_0008412 | 3300046689 | Bacteria | 7661 |
| 619 | Ga0495613_0016300 | 3300046689 | Bacteria | 5537 |
| 620 | Ga0495613_0026830 | 3300046689 | Bacteria | 4289 |
| 621 | Ga0495613_0094101 | 3300046689 | Bacteria | 2168 |
| 622 | Ga0495624_0002573 | 3300046690 | Bacteria | 13711 |
| 623 | Ga0495624_0030199 | 3300046690 | Bacteria | 3531 |
| 624 | Ga0495624_0056672 | 3300046690 | Bacteria | 2465 |
| 625 | Ga0495624_0076136 | 3300046690 | Bacteria | 2082 |
| 626 | Ga0495600_0008139 | 3300046809 | Bacteria | 6433 |
| 627 | Ga0495600_0042917 | 3300046809 | Bacteria | 2948 |
| 628 | Ga0495600_0078532 | 3300046809 | Bacteria | 2155 |
| 629 | Ga0495600_0083181 | 3300046809 | Bacteria | 2089 |
| 630 | Ga0495600_0168474 | 3300046809 | Bacteria | 1414 |
| 631 | Ga0495600_0239586 | 3300046809 | Bacteria | 1156 |
| 632 | Ga0495581_0008289 | 3300047315 | Bacteria | 6024 |
| 633 | Ga0495581_0017563 | 3300047315 | Bacteria | 4155 |
| 634 | Ga0495581_0041389 | 3300047315 | Bacteria | 2666 |
| 635 | Ga0495604_0000196 | 3300047317 | Bacteria | 54755 |
| 636 | Ga0495604_0008600 | 3300047317 | Bacteria | 8067 |
| 637 | Ga0495604_0010017 | 3300047317 | Bacteria | 7504 |
| 638 | Ga0495604_0017300 | 3300047317 | Bacteria | 5769 |
| 639 | Ga0495604_0176505 | 3300047317 | Bacteria | 1497 |
| 640 | Ga0495604_0178415 | 3300047317 | Bacteria | 1487 |
| 641 | Ga0495674_0000849 | 3300047319 | Bacteria | 29202 |
| 642 | Ga0495674_0001294 | 3300047319 | Bacteria | 24309 |
| 643 | Ga0495674_0006999 | 3300047319 | Bacteria | 10789 |
| 644 | Ga0495674_0019700 | 3300047319 | Bacteria | 6257 |
| 645 | Ga0495674_0039622 | 3300047319 | Bacteria | 4221 |
| 646 | Ga0495674_0081079 | 3300047319 | Bacteria | 2783 |
| 647 | Ga0495674_0315112 | 3300047319 | Bacteria | 1275 |
| 648 | Ga0495676_0015518 | 3300047321 | Bacteria | 6780 |
| 649 | Ga0495676_0078730 | 3300047321 | Bacteria | 2508 |
| 650 | Ga0495680_0000226 | 3300047322 | Bacteria | 61646 |
| 651 | Ga0495680_0006561 | 3300047322 | Bacteria | 10798 |
| 652 | Ga0495680_0010774 | 3300047322 | Bacteria | 8144 |
| 653 | Ga0495680_0025569 | 3300047322 | Bacteria | 4883 |
| 654 | Ga0495680_0028154 | 3300047322 | Bacteria | 4609 |
| 655 | Ga0495680_0037933 | 3300047322 | Bacteria | 3856 |
| 656 | Ga0495680_0064653 | 3300047322 | Bacteria | 2804 |
| 657 | Ga0495680_0067018 | 3300047322 | Bacteria | 2745 |
| 658 | Ga0495680_0123848 | 3300047322 | Bacteria | 1906 |
| 659 | Ga0495680_0271414 | 3300047322 | Bacteria | 1197 |
| 660 | Ga0495675_0002108 | 3300047444 | Bacteria | 11865 |
| 661 | Ga0495675_0002898 | 3300047444 | Bacteria | 10300 |
| 662 | Ga0495675_0011132 | 3300047444 | Bacteria | 5640 |
| 663 | Ga0495684_0001960 | 3300047471 | Bacteria | 16540 |
| 664 | Ga0495684_0005679 | 3300047471 | Bacteria | 9716 |
| 665 | Ga0495684_0007105 | 3300047471 | Bacteria | 8689 |
| 666 | Ga0495684_0031536 | 3300047471 | Bacteria | 4069 |
| 667 | Ga0495684_0067939 | 3300047471 | Bacteria | 2710 |
| 668 | Ga0495684_0069081 | 3300047471 | Bacteria | 2686 |
| 669 | Ga0495684_0073022 | 3300047471 | Bacteria | 2606 |
| 670 | Ga0495684_0092719 | 3300047471 | Bacteria | 2287 |
| 671 | Ga0495684_0133570 | 3300047471 | Bacteria | 1862 |
| 672 | Ga0495593_0000136 | 3300047673 | Bacteria | 35468 |
| 673 | Ga0495593_0003456 | 3300047673 | Bacteria | 9461 |
| 674 | Ga0495593_0019355 | 3300047673 | Bacteria | 3817 |
| 675 | Ga0495593_0021281 | 3300047673 | Bacteria | 3624 |
| 676 | Ga0495602_0000172 | 3300048088 | Bacteria | 60316 |
| 677 | Ga0495602_0068898 | 3300048088 | Bacteria | 3036 |
| 678 | Ga0495602_0071319 | 3300048088 | Bacteria | 2967 |
| 679 | Ga0495602_0131576 | 3300048088 | Bacteria | 1994 |
| 680 | Ga0495602_0150837 | 3300048088 | Bacteria | 1827 |
| 681 | Ga0495602_0162280 | 3300048088 | Bacteria | 1743 |
| 682 | Ga0495602_0248870 | 3300048088 | Bacteria | 1325 |
| 683 | Ga0495614_0005800 | 3300048089 | Bacteria | 5563 |
| 684 | Ga0495614_0026542 | 3300048089 | Bacteria | 2497 |
| 685 | Ga0496100_0037975 | 3300048903 | Bacteria | 3049 |
| 686 | Ga0496100_0127913 | 3300048903 | Bacteria | 1785 |
| 687 | Ga0496100_0149208 | 3300048903 | Bacteria | 1665 |
| 688 | Ga0496101_0068244 | 3300048904 | Bacteria | 2599 |
| 689 | Ga0496101_0076351 | 3300048904 | Bacteria | 2468 |
| 690 | Ga0496101_0088950 | 3300048904 | Bacteria | 2294 |
| 691 | Ga0496102_0094771 | 3300048905 | Bacteria | 2766 |
| 692 | Ga0496102_0253894 | 3300048905 | Bacteria | 1658 |
| 693 | Ga0496103_0045674 | 3300048906 | Bacteria | 2702 |
| 694 | Ga0496104_0016612 | 3300048907 | Bacteria | 6688 |
| 695 | Ga0496104_0032704 | 3300048907 | Bacteria | 4841 |
| 696 | Ga0496105_0005277 | 3300048908 | Bacteria | 9796 |
| 697 | Ga0496105_0038817 | 3300048908 | Bacteria | 3923 |
| 698 | Ga0496105_0096498 | 3300048908 | Bacteria | 2441 |
| 699 | Ga0496105_0137873 | 3300048908 | Bacteria | 2009 |
| 700 | Ga0496106_0070439 | 3300048909 | Bacteria | 2670 |
| 701 | Ga0496108_0008607 | 3300048911 | Bacteria | 8275 |
| 702 | Ga0496108_0008967 | 3300048911 | Bacteria | 8107 |
| 703 | Ga0496109_0209077 | 3300048912 | Bacteria | 1835 |
| 704 | Ga0496110_0015488 | 3300048913 | Bacteria | 6347 |
| 705 | Ga0496110_0034760 | 3300048913 | Bacteria | 4368 |
| 706 | Ga0496110_0072228 | 3300048913 | Bacteria | 3061 |
| 707 | Ga0496110_0408330 | 3300048913 | Bacteria | 1238 |
| 708 | Ga0496111_0030500 | 3300048914 | Bacteria | 3834 |
| 709 | Ga0496111_0030672 | 3300048914 | Bacteria | 3824 |
| 710 | Ga0496111_0176556 | 3300048914 | Bacteria | 1588 |
| 711 | Ga0496113_0053761 | 3300048916 | Bacteria | 3011 |
| 712 | Ga0496113_0318354 | 3300048916 | Bacteria | 1247 |
| 713 | Ga0496113_0511876 | 3300048916 | Bacteria | 963 |
| 714 | Ga0496114_0021193 | 3300048917 | Bacteria | 5285 |
| 715 | Ga0496114_0060981 | 3300048917 | Bacteria | 3154 |
| 716 | Ga0496114_0112501 | 3300048917 | Bacteria | 2334 |
| 717 | Ga0496114_0127089 | 3300048917 | Bacteria | 2198 |
| 718 | Ga0496115_0033734 | 3300048918 | Bacteria | 4042 |
| 719 | Ga0496115_0091767 | 3300048918 | Bacteria | 2482 |
| 720 | Ga0496115_0154748 | 3300048918 | Bacteria | 1894 |
| 721 | Ga0496115_0219651 | 3300048918 | Bacteria | 1568 |
| 722 | Ga0501034_0006125 | 3300049571 | Bacteria | 12977 |
| 723 | Ga0501036_0015733 | 3300049572 | Bacteria | 6318 |
| 724 | Ga0501039_0026765 | 3300049575 | Bacteria | 4432 |
| 725 | Ga0501042_0273122 | 3300049578 | Bacteria | 1220 |
| 726 | Ga0501043_0011729 | 3300049579 | Bacteria | 6862 |
| 727 | Ga0501043_0128347 | 3300049579 | Bacteria | 1988 |
| 728 | Ga0501047_0016843 | 3300049581 | Bacteria | 6984 |
| 729 | Ga0501047_0052858 | 3300049581 | Bacteria | 3927 |
| 730 | Ga0501048_0002555 | 3300049582 | Bacteria | 13931 |
| 731 | Ga0501070_0016609 | 3300049586 | Bacteria | 6183 |
| 732 | Ga0501071_0001502 | 3300049587 | Bacteria | 13562 |
| 733 | Ga0501074_0010957 | 3300049590 | Bacteria | 6582 |
| 734 | Ga0501045_0079731 | 3300049824 | Bacteria | 2414 |
| 735 | nmdc:mga05p37_50945_c1 | 3300050507 | Bacteria | 5092 |
| 736 | nmdc:mga08y16_318615_c1 | 3300050511 | Bacteria | 1601 |
| 737 | nmdc:mga0n895_243142_c1 | 3300050512 | Bacteria | 1827 |
| 738 | nmdc:mga0n895_287565_c1 | 3300050512 | Bacteria | 1667 |
| 739 | nmdc:mga0rr50_11102_c1 | 3300050513 | Bacteria | 4767 |
| 740 | nmdc:mga0rr50_201197_c1 | 3300050513 | Bacteria | 1637 |
| 741 | nmdc:mga0rr50_50841_c1 | 3300050513 | Bacteria | 3073 |
| 742 | nmdc:mga08x19_150755_c1 | 3300050514 | Bacteria | 1574 |
| 743 | nmdc:mga08x19_8618_c1 | 3300050514 | Bacteria | 6077 |
| 744 | nmdc:mga0a205_15328_c1 | 3300050515 | Bacteria | 7162 |
| 745 | nmdc:mga0a205_55652_c1 | 3300050515 | Bacteria | 3821 |
| 746 | Ga0495601_0063692 | 3300053077 | Bacteria | 2343 |
| 747 | Ga0495601_0080485 | 3300053077 | Bacteria | 2090 |
| 748 | Ga0495612_0009756 | 3300053078 | Bacteria | 3889 |
| 749 | Ga0495612_0010475 | 3300053078 | Bacteria | 3748 |
| 750 | Ga0495612_0073500 | 3300053078 | Bacteria | 1428 |
| 751 | Ga0495595_0001862 | 3300053084 | Bacteria | 8185 |
| 752 | Ga0495595_0021214 | 3300053084 | Bacteria | 2835 |
| 753 | Ga0495595_0027349 | 3300053084 | Bacteria | 2541 |
| 754 | Ga0495595_0028808 | 3300053084 | Bacteria | 2481 |
| 755 | Ga0495595_0032393 | 3300053084 | Bacteria | 2354 |
| 756 | Ga0495595_0127474 | 3300053084 | Bacteria | 1242 |
| 757 | Ga0495619_0010100 | 3300053085 | Bacteria | 5944 |
| 758 | Ga0495619_0065193 | 3300053085 | Bacteria | 2429 |
| 759 | Ga0495619_0084816 | 3300053085 | Bacteria | 2138 |
| 760 | Ga0495619_0172140 | 3300053085 | Bacteria | 1497 |
| 761 | Ga0500616_0000781 | 3300053153 | Bacteria | 36581 |
| 762 | Ga0501084_0111943 | 3300054114 | Bacteria | 2294 |
| 763 | Ga0466962_0064072 | 3300061719 | Bacteria | 1755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0015488 | Ga0496110_0015488_5570_6334 | 247 |
| 2 | 3300048916 | Ga0496113_0318354 | Ga0496113_0318354_13_819 | 257 |
| 3 | 3300048916 | Ga0496113_0511876 | Ga0496113_0511876_15_815 | 257 |
| 4 | 3300046690 | Ga0495624_0056672 | Ga0495624_0056672_1606_2445 | 261 |
| 5 | 3300048908 | Ga0496105_0137873 | Ga0496105_0137873_865_1689 | 262 |
| 6 | 3300035117 | Ga0373953_0052619 | Ga0373953_0052619_781_1638 | 267 |
| 7 | 3300050514 | nmdc:mga08x19_150755_c1 | nmdc:mga08x19_150755_c1_78_938 | 267 |
| 8 | 3300048909 | Ga0496106_0070439 | Ga0496106_0070439_1799_2650 | 274 |
| 9 | 3300044684 | Ga0466966_0161462 | Ga0466966_0161462_391_1299 | 275 |
| 10 | 3300044901 | Ga0466960_0198286 | Ga0466960_0198286_21_926 | 277 |
| 11 | 3300048914 | Ga0496111_0030672 | Ga0496111_0030672_14_868 | 277 |
| 12 | 3300028800 | Ga0265338_10004621 | Ga0265338_100046213 | 278 |
| 13 | 3300028800 | Ga0265338_10009124 | Ga0265338_100091244 | 281 |
| 14 | 3300035113 | Ga0373936_0034695 | Ga0373936_0034695_713_1651 | 283 |
| 15 | 3300035117 | Ga0373953_0071870 | Ga0373953_0071870_388_1326 | 283 |
| 16 | 3300035118 | Ga0373954_0023241 | Ga0373954_0023241_1129_2067 | 283 |
| 17 | 3300035119 | Ga0373956_0009048 | Ga0373956_0009048_810_1748 | 283 |
| 18 | 3300035172 | Ga0373955_0018957 | Ga0373955_0018957_437_1375 | 283 |
| 19 | 3300035725 | Ga0373947_0090750 | Ga0373947_0090750_951_1889 | 283 |
| 20 | 3300046454 | Ga0495592_0010307 | Ga0495592_0010307_3765_4703 | 283 |
| 21 | 3300046462 | Ga0495651_0021691 | Ga0495651_0021691_393_1331 | 283 |
| 22 | 3300046463 | Ga0495653_0073379 | Ga0495653_0073379_511_1449 | 283 |
| 23 | 3300046477 | Ga0495664_0009930 | Ga0495664_0009930_2921_3859 | 283 |
| 24 | 3300046514 | Ga0495618_0019669 | Ga0495618_0019669_1682_2620 | 283 |
| 25 | 3300046517 | Ga0495630_0105622 | Ga0495630_0105622_1128_2066 | 283 |
| 26 | 3300046529 | Ga0495652_0084539 | Ga0495652_0084539_1161_2099 | 283 |
| 27 | 3300046533 | Ga0495640_0033340 | Ga0495640_0033340_2253_3191 | 283 |
| 28 | 3300046536 | Ga0495587_0009908 | Ga0495587_0009908_4451_5389 | 283 |
| 29 | 3300046642 | Ga0495634_0005158 | Ga0495634_0005158_4720_5658 | 283 |
| 30 | 3300046663 | Ga0495635_0040457 | Ga0495635_0040457_1112_2050 | 283 |
| 31 | 3300046809 | Ga0495600_0083181 | Ga0495600_0083181_549_1487 | 283 |
| 32 | 3300047317 | Ga0495604_0178415 | Ga0495604_0178415_504_1442 | 283 |
| 33 | 3300047319 | Ga0495674_0081079 | Ga0495674_0081079_1719_2657 | 283 |
| 34 | 3300047471 | Ga0495684_0031536 | Ga0495684_0031536_500_1438 | 283 |
| 35 | 3300048088 | Ga0495602_0150837 | Ga0495602_0150837_379_1317 | 283 |
| 36 | 3300053153 | Ga0500616_0000781 | Ga0500616_0000781_30627_31556 | 283 |
| 37 | 3300037068 | Ga0373925_0075068 | Ga0373925_0075068_520_1455 | 284 |
| 38 | 3300048905 | Ga0496102_0253894 | Ga0496102_0253894_126_1061 | 285 |
| 39 | 3300005983 | Ga0081540_1000601 | Ga0081540_100060133 | 286 |
| 40 | 3300005435 | Ga0070714_100011532 | Ga0070714_1000115325 | 287 |
| 41 | 3300005445 | Ga0070708_100010078 | Ga0070708_1000100782 | 287 |
| 42 | 3300025928 | Ga0207700_10016381 | Ga0207700_100163814 | 287 |
| 43 | 3300005434 | Ga0070709_10001791 | Ga0070709_100017912 | 288 |
| 44 | 3300005436 | Ga0070713_100043173 | Ga0070713_1000431733 | 288 |
| 45 | 3300005437 | Ga0070710_10000156 | Ga0070710_1000015610 | 288 |
| 46 | 3300005439 | Ga0070711_100001013 | Ga0070711_10000101313 | 288 |
| 47 | 3300006028 | Ga0070717_10017687 | Ga0070717_100176873 | 288 |
| 48 | 3300006173 | Ga0070716_100022958 | Ga0070716_1000229583 | 288 |
| 49 | 3300021388 | Ga0213875_10000758 | Ga0213875_100007585 | 288 |
| 50 | 3300025898 | Ga0207692_10009025 | Ga0207692_100090253 | 288 |
| 51 | 3300025906 | Ga0207699_10000563 | Ga0207699_1000056318 | 288 |
| 52 | 3300025915 | Ga0207693_10113589 | Ga0207693_101135892 | 288 |
| 53 | 3300025916 | Ga0207663_10001119 | Ga0207663_100011198 | 288 |
| 54 | 3300025929 | Ga0207664_10006025 | Ga0207664_100060255 | 288 |
| 55 | 3300025939 | Ga0207665_10000882 | Ga0207665_1000088213 | 288 |
| 56 | 3300031995 | Ga0307409_100229412 | Ga0307409_1002294122 | 288 |
| 57 | 3300032002 | Ga0307416_100269233 | Ga0307416_1002692332 | 288 |
| 58 | 3300032002 | Ga0307416_100296090 | Ga0307416_1002960901 | 288 |
| 59 | 3300032126 | Ga0307415_100107421 | Ga0307415_1001074212 | 288 |
| 60 | 3300032126 | Ga0307415_100221540 | Ga0307415_1002215401 | 288 |
| 61 | 3300037853 | Ga0436364_0086889 | Ga0436364_0086889_41944_42873 | 288 |
| 62 | 3300028558 | Ga0265326_10000784 | Ga0265326_100007847 | 289 |
| 63 | 3300028563 | Ga0265319_1000235 | Ga0265319_100023525 | 289 |
| 64 | 3300028573 | Ga0265334_10000374 | Ga0265334_1000037417 | 289 |
| 65 | 3300028577 | Ga0265318_10037578 | Ga0265318_100375782 | 289 |
| 66 | 3300028653 | Ga0265323_10001596 | Ga0265323_100015964 | 289 |
| 67 | 3300028654 | Ga0265322_10002045 | Ga0265322_100020454 | 289 |
| 68 | 3300028666 | Ga0265336_10002957 | Ga0265336_100029575 | 289 |
| 69 | 3300028800 | Ga0265338_10000986 | Ga0265338_1000098612 | 289 |
| 70 | 3300029957 | Ga0265324_10000535 | Ga0265324_100005359 | 289 |
| 71 | 3300031238 | Ga0265332_10000225 | Ga0265332_1000022528 | 289 |
| 72 | 3300031240 | Ga0265320_10000621 | Ga0265320_1000062111 | 289 |
| 73 | 3300031241 | Ga0265325_10023000 | Ga0265325_100230004 | 289 |
| 74 | 3300031247 | Ga0265340_10000525 | Ga0265340_100005258 | 289 |
| 75 | 3300031249 | Ga0265339_10003503 | Ga0265339_100035033 | 289 |
| 76 | 3300031344 | Ga0265316_10026666 | Ga0265316_100266664 | 289 |
| 77 | 3300031595 | Ga0265313_10009449 | Ga0265313_100094493 | 289 |
| 78 | 3300031711 | Ga0265314_10001593 | Ga0265314_1000159316 | 289 |
| 79 | 3300031712 | Ga0265342_10003335 | Ga0265342_100033357 | 289 |
| 80 | 3300005435 | Ga0070714_100330507 | Ga0070714_1003305071 | 291 |
| 81 | 3300005436 | Ga0070713_100400084 | Ga0070713_1004000841 | 291 |
| 82 | 3300005445 | Ga0070708_100283395 | Ga0070708_1002833952 | 291 |
| 83 | 3300005467 | Ga0070706_100012683 | Ga0070706_1000126833 | 291 |
| 84 | 3300005468 | Ga0070707_100013028 | Ga0070707_1000130285 | 291 |
| 85 | 3300005471 | Ga0070698_100013320 | Ga0070698_1000133205 | 291 |
| 86 | 3300005471 | Ga0070698_100073013 | Ga0070698_1000730132 | 291 |
| 87 | 3300005536 | Ga0070697_100060897 | Ga0070697_1000608971 | 291 |
| 88 | 3300025910 | Ga0207684_10050976 | Ga0207684_100509763 | 291 |
| 89 | 3300025922 | Ga0207646_10011732 | Ga0207646_100117324 | 291 |
| 90 | 3300035171 | Ga0373946_0058651 | Ga0373946_0058651_97_1005 | 291 |
| 91 | 3300035410 | Ga0373924_0039916 | Ga0373924_0039916_360_1256 | 291 |
| 92 | 3300049572 | Ga0501036_0015733 | Ga0501036_0015733_5197_6126 | 291 |
| 93 | 3300049575 | Ga0501039_0026765 | Ga0501039_0026765_724_1653 | 291 |
| 94 | 3300049578 | Ga0501042_0273122 | Ga0501042_0273122_115_1044 | 291 |
| 95 | 3300049579 | Ga0501043_0011729 | Ga0501043_0011729_5038_5967 | 291 |
| 96 | 3300049582 | Ga0501048_0002555 | Ga0501048_0002555_485_1414 | 291 |
| 97 | 3300049590 | Ga0501074_0010957 | Ga0501074_0010957_472_1401 | 291 |
| 98 | 3300005445 | Ga0070708_100365267 | Ga0070708_1003652672 | 292 |
| 99 | 3300005536 | Ga0070697_100054446 | Ga0070697_1000544463 | 292 |
| 100 | 3300021388 | Ga0213875_10108994 | Ga0213875_101089942 | 292 |
| 101 | 3300035113 | Ga0373936_0000658 | Ga0373936_0000658_2837_3775 | 292 |
| 102 | 3300035724 | Ga0373933_0039109 | Ga0373933_0039109_1626_2564 | 292 |
| 103 | 3300036401 | Ga0373937_0018617 | Ga0373937_0018617_697_1635 | 292 |
| 104 | 3300037068 | Ga0373925_0004888 | Ga0373925_0004888_4906_5841 | 292 |
| 105 | 3300046454 | Ga0495592_0040207 | Ga0495592_0040207_2346_3284 | 292 |
| 106 | 3300046473 | Ga0495582_0006336 | Ga0495582_0006336_873_1811 | 292 |
| 107 | 3300046531 | Ga0495665_0001675 | Ga0495665_0001675_4775_5713 | 292 |
| 108 | 3300046543 | Ga0495645_0127914 | Ga0495645_0127914_188_1126 | 292 |
| 109 | 3300046678 | Ga0495599_0057864 | Ga0495599_0057864_459_1397 | 292 |
| 110 | 3300046689 | Ga0495613_0026830 | Ga0495613_0026830_391_1329 | 292 |
| 111 | 3300046809 | Ga0495600_0078532 | Ga0495600_0078532_98_1036 | 292 |
| 112 | 3300047319 | Ga0495674_0315112 | Ga0495674_0315112_226_1164 | 292 |
| 113 | 3300047322 | Ga0495680_0271414 | Ga0495680_0271414_162_1100 | 292 |
| 114 | 3300047444 | Ga0495675_0011132 | Ga0495675_0011132_2357_3295 | 292 |
| 115 | 3300047673 | Ga0495593_0003456 | Ga0495593_0003456_4731_5669 | 292 |
| 116 | 3300048088 | Ga0495602_0248870 | Ga0495602_0248870_226_1164 | 292 |
| 117 | 3300048089 | Ga0495614_0026542 | Ga0495614_0026542_79_1017 | 292 |
| 118 | 3300053084 | Ga0495595_0001862 | Ga0495595_0001862_538_1476 | 292 |
| 119 | 3300005435 | Ga0070714_100070656 | Ga0070714_1000706563 | 293 |
| 120 | 3300005435 | Ga0070714_100153490 | Ga0070714_1001534901 | 293 |
| 121 | 3300006175 | Ga0070712_100234444 | Ga0070712_1002344442 | 293 |
| 122 | 3300006914 | Ga0075436_100015916 | Ga0075436_1000159164 | 293 |
| 123 | 3300025929 | Ga0207664_10131254 | Ga0207664_101312541 | 293 |
| 124 | 3300025929 | Ga0207664_10254658 | Ga0207664_102546582 | 293 |
| 125 | 3300035086 | Ga0373934_0015020 | Ga0373934_0015020_1616_2551 | 293 |
| 126 | 3300035119 | Ga0373956_0178041 | Ga0373956_0178041_10_912 | 293 |
| 127 | 3300035120 | Ga0373957_0010754 | Ga0373957_0010754_1861_2796 | 293 |
| 128 | 3300035172 | Ga0373955_0075410 | Ga0373955_0075410_386_1321 | 293 |
| 129 | 3300036401 | Ga0373937_0083059 | Ga0373937_0083059_386_1321 | 293 |
| 130 | 3300046462 | Ga0495651_0032595 | Ga0495651_0032595_1630_2565 | 293 |
| 131 | 3300046463 | Ga0495653_0038051 | Ga0495653_0038051_682_1617 | 293 |
| 132 | 3300046516 | Ga0495628_0085074 | Ga0495628_0085074_385_1320 | 293 |
| 133 | 3300046559 | Ga0495667_0028667 | Ga0495667_0028667_2103_3038 | 293 |
| 134 | 3300046675 | Ga0495657_0010513 | Ga0495657_0010513_5319_6254 | 293 |
| 135 | 3300046678 | Ga0495599_0047629 | Ga0495599_0047629_919_1854 | 293 |
| 136 | 3300046679 | Ga0495623_0026024 | Ga0495623_0026024_314_1249 | 293 |
| 137 | 3300047317 | Ga0495604_0176505 | Ga0495604_0176505_385_1320 | 293 |
| 138 | 3300047322 | Ga0495680_0010774 | Ga0495680_0010774_3515_4450 | 293 |
| 139 | iso_pu_bacteria | 2582580736 | 2583150766 | 293 |
| 140 | 3300010375 | Ga0105239_10232709 | Ga0105239_102327092 | 294 |
| 141 | 3300025944 | Ga0207661_10102770 | Ga0207661_101027702 | 294 |
| 142 | 3300035086 | Ga0373934_0101136 | Ga0373934_0101136_116_1054 | 294 |
| 143 | 3300035117 | Ga0373953_0004371 | Ga0373953_0004371_2223_3161 | 294 |
| 144 | 3300035692 | Ga0373935_0144653 | Ga0373935_0144653_539_1477 | 294 |
| 145 | 3300035725 | Ga0373947_0016645 | Ga0373947_0016645_2775_3713 | 294 |
| 146 | 3300037068 | Ga0373925_0082540 | Ga0373925_0082540_524_1462 | 294 |
| 147 | 3300046459 | Ga0495629_0001760 | Ga0495629_0001760_15030_15968 | 294 |
| 148 | 3300046461 | Ga0495641_0005560 | Ga0495641_0005560_1603_2541 | 294 |
| 149 | 3300046475 | Ga0495639_0077951 | Ga0495639_0077951_528_1466 | 294 |
| 150 | 3300046476 | Ga0495662_0006551 | Ga0495662_0006551_33_971 | 294 |
| 151 | 3300046526 | Ga0495666_0036024 | Ga0495666_0036024_875_1813 | 294 |
| 152 | 3300046535 | Ga0495586_0000770 | Ga0495586_0000770_6919_7857 | 294 |
| 153 | 3300046680 | Ga0495646_0040299 | Ga0495646_0040299_601_1539 | 294 |
| 154 | 3300047315 | Ga0495581_0017563 | Ga0495581_0017563_198_1136 | 294 |
| 155 | 3300049581 | Ga0501047_0052858 | Ga0501047_0052858_1444_2379 | 294 |
| 156 | 3300053078 | Ga0495612_0010475 | Ga0495612_0010475_1904_2842 | 294 |
| 157 | 3300005445 | Ga0070708_100245703 | Ga0070708_1002457032 | 295 |
| 158 | 3300005468 | Ga0070707_100013259 | Ga0070707_1000132591 | 295 |
| 159 | 3300006852 | Ga0075433_10502800 | Ga0075433_105028002 | 295 |
| 160 | 3300025922 | Ga0207646_10291039 | Ga0207646_102910392 | 295 |
| 161 | 3300044765 | Ga0466970_0035109 | Ga0466970_0035109_622_1557 | 295 |
| 162 | 3300045049 | Ga0466959_0025353 | Ga0466959_0025353_3350_4267 | 295 |
| 163 | 3300046529 | Ga0495652_0132979 | Ga0495652_0132979_609_1517 | 295 |
| 164 | 3300046543 | Ga0495645_0167411 | Ga0495645_0167411_466_1374 | 295 |
| 165 | 3300046679 | Ga0495623_0108609 | Ga0495623_0108609_275_1183 | 295 |
| 166 | 3300048903 | Ga0496100_0037975 | Ga0496100_0037975_62_970 | 295 |
| 167 | 3300048904 | Ga0496101_0076351 | Ga0496101_0076351_232_1140 | 295 |
| 168 | 3300048908 | Ga0496105_0005277 | Ga0496105_0005277_7002_7910 | 295 |
| 169 | 3300048917 | Ga0496114_0112501 | Ga0496114_0112501_435_1343 | 295 |
| 170 | 3300048918 | Ga0496115_0219651 | Ga0496115_0219651_614_1522 | 295 |
| 171 | 3300053085 | Ga0495619_0084816 | Ga0495619_0084816_23_931 | 295 |
| 172 | 3300005467 | Ga0070706_100032714 | Ga0070706_1000327145 | 296 |
| 173 | 3300005471 | Ga0070698_100000354 | Ga0070698_10000035431 | 296 |
| 174 | 3300006175 | Ga0070712_100249606 | Ga0070712_1002496061 | 296 |
| 175 | 3300006852 | Ga0075433_10029032 | Ga0075433_100290322 | 296 |
| 176 | 3300006914 | Ga0075436_100153832 | Ga0075436_1001538322 | 296 |
| 177 | 3300007076 | Ga0075435_100062323 | Ga0075435_1000623232 | 296 |
| 178 | 3300025910 | Ga0207684_10134300 | Ga0207684_101343002 | 296 |
| 179 | 3300035691 | Ga0373931_0201794 | Ga0373931_0201794_236_1159 | 296 |
| 180 | 3300048912 | Ga0496109_0209077 | Ga0496109_0209077_509_1435 | 296 |
| 181 | 3300048913 | Ga0496110_0408330 | Ga0496110_0408330_114_1040 | 296 |
| 182 | 3300048914 | Ga0496111_0176556 | Ga0496111_0176556_629_1555 | 296 |
| 183 | 3300048917 | Ga0496114_0060981 | Ga0496114_0060981_1766_2677 | 296 |
| 184 | 3300050513 | nmdc:mga0rr50_11102_c1 | nmdc:mga0rr50_11102_c1_3740_4663 | 296 |
| 185 | 3300050515 | nmdc:mga0a205_15328_c1 | nmdc:mga0a205_15328_c1_4801_5724 | 296 |
| 186 | iso_pu_bacteria | 2866612099 | 2866618542 | 296 |
| 187 | iso_pu_bacteria | 8057568493 | 8057568665 | 296 |
| 188 | 3300005467 | Ga0070706_100011229 | Ga0070706_1000112294 | 297 |
| 189 | 3300005468 | Ga0070707_100019079 | Ga0070707_1000190792 | 297 |
| 190 | 3300005471 | Ga0070698_100030880 | Ga0070698_1000308802 | 297 |
| 191 | 3300021388 | Ga0213875_10008834 | Ga0213875_100088343 | 297 |
| 192 | 3300025922 | Ga0207646_10018634 | Ga0207646_100186344 | 297 |
| 193 | 3300031456 | Ga0307513_10002805 | Ga0307513_100028058 | 297 |
| 194 | 3300031727 | Ga0316576_10064077 | Ga0316576_100640773 | 297 |
| 195 | 3300031728 | Ga0316578_10020449 | Ga0316578_100204493 | 297 |
| 196 | 3300033179 | Ga0307507_10006423 | Ga0307507_1000642315 | 297 |
| 197 | 3300033180 | Ga0307510_10035918 | Ga0307510_100359184 | 297 |
| 198 | 3300035398 | Ga0316574_0092496 | Ga0316574_0092496_112_1038 | 297 |
| 199 | 3300036712 | Ga0316584_0170690 | Ga0316584_0170690_465_1391 | 297 |
| 200 | 3300037853 | Ga0436364_0024071 | Ga0436364_0024071_4469_5398 | 297 |
| 201 | 3300037853 | Ga0436364_0508196 | Ga0436364_0508196_859_1788 | 297 |
| 202 | 3300044901 | Ga0466960_0202586 | Ga0466960_0202586_88_1035 | 297 |
| 203 | iso_pu_bacteria | 2861520306 | 2861520937 | 297 |
| 204 | iso_pu_bacteria | 2897561785 | 2897563531 | 297 |
| 205 | iso_pu_bacteria | 8003314358 | 8003318618 | 297 |
| 206 | iso_pu_bacteria | 8056060235 | 8056062017 | 297 |
| 207 | 3300005366 | Ga0070659_100308763 | Ga0070659_1003087632 | 298 |
| 208 | 3300005434 | Ga0070709_10158972 | Ga0070709_101589722 | 298 |
| 209 | 3300005435 | Ga0070714_100000233 | Ga0070714_10000023310 | 298 |
| 210 | 3300005436 | Ga0070713_100085970 | Ga0070713_1000859702 | 298 |
| 211 | 3300005444 | Ga0070694_100157903 | Ga0070694_1001579032 | 298 |
| 212 | 3300005467 | Ga0070706_100007633 | Ga0070706_1000076336 | 298 |
| 213 | 3300005468 | Ga0070707_100001697 | Ga0070707_10000169720 | 298 |
| 214 | 3300005471 | Ga0070698_100046363 | Ga0070698_1000463633 | 298 |
| 215 | 3300005843 | Ga0068860_100213654 | Ga0068860_1002136542 | 298 |
| 216 | 3300006173 | Ga0070716_100129002 | Ga0070716_1001290022 | 298 |
| 217 | 3300009176 | Ga0105242_10300151 | Ga0105242_103001512 | 298 |
| 218 | 3300013105 | Ga0157369_10567519 | Ga0157369_105675191 | 298 |
| 219 | 3300021388 | Ga0213875_10064588 | Ga0213875_100645882 | 298 |
| 220 | 3300025907 | Ga0207645_10065213 | Ga0207645_100652133 | 298 |
| 221 | 3300025910 | Ga0207684_10002393 | Ga0207684_100023933 | 298 |
| 222 | 3300025922 | Ga0207646_10000470 | Ga0207646_100004703 | 298 |
| 223 | 3300025929 | Ga0207664_10005791 | Ga0207664_100057916 | 298 |
| 224 | 3300025929 | Ga0207664_10259524 | Ga0207664_102595242 | 298 |
| 225 | 3300026089 | Ga0207648_10445194 | Ga0207648_104451942 | 298 |
| 226 | 3300026118 | Ga0207675_100034633 | Ga0207675_1000346333 | 298 |
| 227 | 3300031824 | Ga0307413_10076820 | Ga0307413_100768203 | 298 |
| 228 | 3300031852 | Ga0307410_10281961 | Ga0307410_102819612 | 298 |
| 229 | 3300032005 | Ga0307411_10004211 | Ga0307411_100042116 | 298 |
| 230 | 3300035083 | Ga0373926_0006644 | Ga0373926_0006644_1511_2440 | 298 |
| 231 | 3300035086 | Ga0373934_0075102 | Ga0373934_0075102_118_1047 | 298 |
| 232 | 3300035089 | Ga0373944_0000075 | Ga0373944_0000075_1009_1938 | 298 |
| 233 | 3300035111 | Ga0373923_0015425 | Ga0373923_0015425_717_1646 | 298 |
| 234 | 3300035113 | Ga0373936_0026351 | Ga0373936_0026351_124_1053 | 298 |
| 235 | 3300035118 | Ga0373954_0014957 | Ga0373954_0014957_1337_2266 | 298 |
| 236 | 3300035171 | Ga0373946_0081526 | Ga0373946_0081526_118_1047 | 298 |
| 237 | 3300035410 | Ga0373924_0091688 | Ga0373924_0091688_216_1145 | 298 |
| 238 | 3300035695 | Ga0373927_0006482 | Ga0373927_0006482_6039_6968 | 298 |
| 239 | 3300035725 | Ga0373947_0196726 | Ga0373947_0196726_243_1172 | 298 |
| 240 | 3300037068 | Ga0373925_0041056 | Ga0373925_0041056_1152_2081 | 298 |
| 241 | 3300037853 | Ga0436364_0838834 | Ga0436364_0838834_1309_2238 | 298 |
| 242 | 3300039450 | Ga0436363_0123638 | Ga0436363_0123638_1268_2212 | 298 |
| 243 | 3300045976 | Ga0466967_0418207 | Ga0466967_0418207_263_1192 | 298 |
| 244 | 3300046454 | Ga0495592_0126492 | Ga0495592_0126492_132_1061 | 298 |
| 245 | 3300046455 | Ga0495603_0027264 | Ga0495603_0027264_1483_2412 | 298 |
| 246 | 3300046459 | Ga0495629_0022645 | Ga0495629_0022645_987_1916 | 298 |
| 247 | 3300046461 | Ga0495641_0021555 | Ga0495641_0021555_965_1894 | 298 |
| 248 | 3300046462 | Ga0495651_0011089 | Ga0495651_0011089_1033_1962 | 298 |
| 249 | 3300046463 | Ga0495653_0084554 | Ga0495653_0084554_184_1113 | 298 |
| 250 | 3300046473 | Ga0495582_0000170 | Ga0495582_0000170_33459_34388 | 298 |
| 251 | 3300046475 | Ga0495639_0011896 | Ga0495639_0011896_2454_3383 | 298 |
| 252 | 3300046476 | Ga0495662_0025748 | Ga0495662_0025748_1052_1981 | 298 |
| 253 | 3300046477 | Ga0495664_0063161 | Ga0495664_0063161_334_1263 | 298 |
| 254 | 3300046499 | Ga0495594_0050605 | Ga0495594_0050605_370_1299 | 298 |
| 255 | 3300046511 | Ga0495608_0062096 | Ga0495608_0062096_1170_2099 | 298 |
| 256 | 3300046514 | Ga0495618_0026002 | Ga0495618_0026002_1037_1966 | 298 |
| 257 | 3300046516 | Ga0495628_0088682 | Ga0495628_0088682_1225_2154 | 298 |
| 258 | 3300046517 | Ga0495630_0010732 | Ga0495630_0010732_1034_1963 | 298 |
| 259 | 3300046526 | Ga0495666_0043575 | Ga0495666_0043575_1093_2022 | 298 |
| 260 | 3300046529 | Ga0495652_0101328 | Ga0495652_0101328_371_1300 | 298 |
| 261 | 3300046531 | Ga0495665_0059618 | Ga0495665_0059618_371_1300 | 298 |
| 262 | 3300046533 | Ga0495640_0069489 | Ga0495640_0069489_243_1172 | 298 |
| 263 | 3300046535 | Ga0495586_0032003 | Ga0495586_0032003_859_1788 | 298 |
| 264 | 3300046536 | Ga0495587_0040454 | Ga0495587_0040454_1126_2055 | 298 |
| 265 | 3300046543 | Ga0495645_0022860 | Ga0495645_0022860_1035_1964 | 298 |
| 266 | 3300046559 | Ga0495667_0044082 | Ga0495667_0044082_1058_1987 | 298 |
| 267 | 3300046642 | Ga0495634_0173599 | Ga0495634_0173599_371_1300 | 298 |
| 268 | 3300046663 | Ga0495635_0061600 | Ga0495635_0061600_1278_2207 | 298 |
| 269 | 3300046674 | Ga0495588_0053162 | Ga0495588_0053162_132_1061 | 298 |
| 270 | 3300046675 | Ga0495657_0070479 | Ga0495657_0070479_132_1061 | 298 |
| 271 | 3300046678 | Ga0495599_0042915 | Ga0495599_0042915_860_1789 | 298 |
| 272 | 3300046679 | Ga0495623_0054938 | Ga0495623_0054938_1315_2244 | 298 |
| 273 | 3300046680 | Ga0495646_0057155 | Ga0495646_0057155_371_1300 | 298 |
| 274 | 3300046681 | Ga0495647_0003856 | Ga0495647_0003856_1340_2269 | 298 |
| 275 | 3300046683 | Ga0495658_0007391 | Ga0495658_0007391_3481_4410 | 298 |
| 276 | 3300046689 | Ga0495613_0008412 | Ga0495613_0008412_951_1880 | 298 |
| 277 | 3300046690 | Ga0495624_0030199 | Ga0495624_0030199_1515_2444 | 298 |
| 278 | 3300047317 | Ga0495604_0017300 | Ga0495604_0017300_1043_1972 | 298 |
| 279 | 3300047319 | Ga0495674_0006999 | Ga0495674_0006999_8709_9638 | 298 |
| 280 | 3300047321 | Ga0495676_0015518 | Ga0495676_0015518_4452_5381 | 298 |
| 281 | 3300047322 | Ga0495680_0067018 | Ga0495680_0067018_593_1522 | 298 |
| 282 | 3300047471 | Ga0495684_0092719 | Ga0495684_0092719_371_1300 | 298 |
| 283 | 3300047673 | Ga0495593_0000136 | Ga0495593_0000136_1059_1988 | 298 |
| 284 | 3300048088 | Ga0495602_0131576 | Ga0495602_0131576_882_1811 | 298 |
| 285 | 3300049571 | Ga0501034_0006125 | Ga0501034_0006125_7013_7933 | 298 |
| 286 | 3300049579 | Ga0501043_0128347 | Ga0501043_0128347_388_1308 | 298 |
| 287 | 3300049586 | Ga0501070_0016609 | Ga0501070_0016609_3435_4355 | 298 |
| 288 | 3300049587 | Ga0501071_0001502 | Ga0501071_0001502_5302_6222 | 298 |
| 289 | 3300053078 | Ga0495612_0073500 | Ga0495612_0073500_371_1300 | 298 |
| 290 | 3300053084 | Ga0495595_0028808 | Ga0495595_0028808_1016_1945 | 298 |
| 291 | 3300053085 | Ga0495619_0010100 | Ga0495619_0010100_4096_5025 | 298 |
| 292 | 3300054114 | Ga0501084_0111943 | Ga0501084_0111943_252_1172 | 298 |
| 293 | iso_pu_bacteria | 2675903060 | 2676487879 | 298 |
| 294 | iso_pu_bacteria | 2856741275 | 2856741556 | 298 |
| 295 | iso_pu_bacteria | 2873314349 | 2873320761 | 298 |
| 296 | iso_pu_bacteria | 2884693830 | 2884697596 | 298 |
| 297 | iso_pu_bacteria | 2891395885 | 2891403043 | 298 |
| 298 | iso_pu_bacteria | 2891554331 | 2891554634 | 298 |
| 299 | iso_pu_bacteria | 2891562705 | 2891564594 | 298 |
| 300 | iso_pu_bacteria | 2895427314 | 2895438158 | 298 |
| 301 | iso_pu_bacteria | 2895442618 | 2895447610 | 298 |
| 302 | iso_pu_bacteria | 3002998708 | 3003001703 | 298 |
| 303 | iso_pu_bacteria | 8053945823 | 8053947366 | 298 |
| 304 | iso_pu_bacteria | 8055066027 | 8055067401 | 298 |
| 305 | 3300013307 | Ga0157372_10168403 | Ga0157372_101684031 | 299 |
| 306 | 3300035111 | Ga0373923_0020174 | Ga0373923_0020174_1404_2336 | 299 |
| 307 | 3300035113 | Ga0373936_0004327 | Ga0373936_0004327_2334_3266 | 299 |
| 308 | 3300035117 | Ga0373953_0031725 | Ga0373953_0031725_237_1169 | 299 |
| 309 | 3300035118 | Ga0373954_0018042 | Ga0373954_0018042_1125_2057 | 299 |
| 310 | 3300035119 | Ga0373956_0128086 | Ga0373956_0128086_57_989 | 299 |
| 311 | 3300035120 | Ga0373957_0014026 | Ga0373957_0014026_1529_2461 | 299 |
| 312 | 3300035170 | Ga0373943_0009966 | Ga0373943_0009966_2231_3163 | 299 |
| 313 | 3300035172 | Ga0373955_0009966 | Ga0373955_0009966_3443_4375 | 299 |
| 314 | 3300035410 | Ga0373924_0015754 | Ga0373924_0015754_829_1761 | 299 |
| 315 | 3300035692 | Ga0373935_0023766 | Ga0373935_0023766_97_1029 | 299 |
| 316 | 3300035695 | Ga0373927_0067045 | Ga0373927_0067045_1053_1985 | 299 |
| 317 | 3300035724 | Ga0373933_0003186 | Ga0373933_0003186_4004_4936 | 299 |
| 318 | 3300035725 | Ga0373947_0065562 | Ga0373947_0065562_231_1163 | 299 |
| 319 | 3300036401 | Ga0373937_0015734 | Ga0373937_0015734_1106_2038 | 299 |
| 320 | 3300037068 | Ga0373925_0123952 | Ga0373925_0123952_700_1632 | 299 |
| 321 | 3300041453 | Ga0451797_1022337 | Ga0451797_1022337_121_1056 | 299 |
| 322 | 3300046454 | Ga0495592_0054148 | Ga0495592_0054148_711_1643 | 299 |
| 323 | 3300046455 | Ga0495603_0021873 | Ga0495603_0021873_1628_2560 | 299 |
| 324 | 3300046459 | Ga0495629_0005374 | Ga0495629_0005374_4983_5915 | 299 |
| 325 | 3300046459 | Ga0495629_0017003 | Ga0495629_0017003_4106_5038 | 299 |
| 326 | 3300046461 | Ga0495641_0005130 | Ga0495641_0005130_2757_3689 | 299 |
| 327 | 3300046461 | Ga0495641_0030028 | Ga0495641_0030028_1549_2481 | 299 |
| 328 | 3300046462 | Ga0495651_0083604 | Ga0495651_0083604_585_1517 | 299 |
| 329 | 3300046462 | Ga0495651_0308360 | Ga0495651_0308360_19_951 | 299 |
| 330 | 3300046463 | Ga0495653_0061928 | Ga0495653_0061928_566_1498 | 299 |
| 331 | 3300046472 | Ga0495580_0017409 | Ga0495580_0017409_1654_2586 | 299 |
| 332 | 3300046473 | Ga0495582_0006953 | Ga0495582_0006953_1365_2297 | 299 |
| 333 | 3300046473 | Ga0495582_0008724 | Ga0495582_0008724_881_1813 | 299 |
| 334 | 3300046475 | Ga0495639_0008262 | Ga0495639_0008262_2758_3690 | 299 |
| 335 | 3300046476 | Ga0495662_0008050 | Ga0495662_0008050_3370_4302 | 299 |
| 336 | 3300046477 | Ga0495664_0013115 | Ga0495664_0013115_2245_3177 | 299 |
| 337 | 3300046499 | Ga0495594_0125521 | Ga0495594_0125521_210_1142 | 299 |
| 338 | 3300046514 | Ga0495618_0016506 | Ga0495618_0016506_259_1191 | 299 |
| 339 | 3300046514 | Ga0495618_0018264 | Ga0495618_0018264_132_1064 | 299 |
| 340 | 3300046516 | Ga0495628_0017420 | Ga0495628_0017420_2273_3205 | 299 |
| 341 | 3300046517 | Ga0495630_0026872 | Ga0495630_0026872_1858_2790 | 299 |
| 342 | 3300046517 | Ga0495630_0037601 | Ga0495630_0037601_1735_2667 | 299 |
| 343 | 3300046526 | Ga0495666_0036327 | Ga0495666_0036327_1404_2336 | 299 |
| 344 | 3300046526 | Ga0495666_0059048 | Ga0495666_0059048_272_1204 | 299 |
| 345 | 3300046529 | Ga0495652_0025699 | Ga0495652_0025699_4153_5085 | 299 |
| 346 | 3300046529 | Ga0495652_0077246 | Ga0495652_0077246_1321_2253 | 299 |
| 347 | 3300046531 | Ga0495665_0006142 | Ga0495665_0006142_4184_5116 | 299 |
| 348 | 3300046533 | Ga0495640_0016998 | Ga0495640_0016998_3037_3969 | 299 |
| 349 | 3300046533 | Ga0495640_0078904 | Ga0495640_0078904_907_1839 | 299 |
| 350 | 3300046536 | Ga0495587_0069686 | Ga0495587_0069686_531_1463 | 299 |
| 351 | 3300046543 | Ga0495645_0016394 | Ga0495645_0016394_566_1498 | 299 |
| 352 | 3300046559 | Ga0495667_0046493 | Ga0495667_0046493_1802_2734 | 299 |
| 353 | 3300046559 | Ga0495667_0055691 | Ga0495667_0055691_907_1839 | 299 |
| 354 | 3300046642 | Ga0495634_0002978 | Ga0495634_0002978_5712_6644 | 299 |
| 355 | 3300046642 | Ga0495634_0014358 | Ga0495634_0014358_3451_4383 | 299 |
| 356 | 3300046663 | Ga0495635_0015511 | Ga0495635_0015511_3069_4001 | 299 |
| 357 | 3300046663 | Ga0495635_0039866 | Ga0495635_0039866_1449_2381 | 299 |
| 358 | 3300046675 | Ga0495657_0044847 | Ga0495657_0044847_353_1285 | 299 |
| 359 | 3300046678 | Ga0495599_0017903 | Ga0495599_0017903_2574_3506 | 299 |
| 360 | 3300046679 | Ga0495623_0012270 | Ga0495623_0012270_2993_3925 | 299 |
| 361 | 3300046680 | Ga0495646_0043835 | Ga0495646_0043835_1453_2385 | 299 |
| 362 | 3300046681 | Ga0495647_0044458 | Ga0495647_0044458_171_1103 | 299 |
| 363 | 3300046683 | Ga0495658_0004488 | Ga0495658_0004488_4108_5040 | 299 |
| 364 | 3300046683 | Ga0495658_0030966 | Ga0495658_0030966_132_1064 | 299 |
| 365 | 3300046689 | Ga0495613_0016300 | Ga0495613_0016300_1718_2650 | 299 |
| 366 | 3300046689 | Ga0495613_0094101 | Ga0495613_0094101_753_1685 | 299 |
| 367 | 3300046690 | Ga0495624_0076136 | Ga0495624_0076136_713_1645 | 299 |
| 368 | 3300046809 | Ga0495600_0042917 | Ga0495600_0042917_1517_2449 | 299 |
| 369 | 3300047315 | Ga0495581_0008289 | Ga0495581_0008289_3807_4739 | 299 |
| 370 | 3300047315 | Ga0495581_0041389 | Ga0495581_0041389_349_1281 | 299 |
| 371 | 3300047317 | Ga0495604_0010017 | Ga0495604_0010017_6220_7152 | 299 |
| 372 | 3300047321 | Ga0495676_0078730 | Ga0495676_0078730_365_1297 | 299 |
| 373 | 3300047322 | Ga0495680_0025569 | Ga0495680_0025569_2364_3296 | 299 |
| 374 | 3300047322 | Ga0495680_0064653 | Ga0495680_0064653_1094_2026 | 299 |
| 375 | 3300047444 | Ga0495675_0002898 | Ga0495675_0002898_7814_8746 | 299 |
| 376 | 3300047471 | Ga0495684_0005679 | Ga0495684_0005679_4720_5652 | 299 |
| 377 | 3300047471 | Ga0495684_0133570 | Ga0495684_0133570_152_1084 | 299 |
| 378 | 3300047673 | Ga0495593_0021281 | Ga0495593_0021281_158_1090 | 299 |
| 379 | 3300048088 | Ga0495602_0162280 | Ga0495602_0162280_33_965 | 299 |
| 380 | 3300048089 | Ga0495614_0005800 | Ga0495614_0005800_524_1456 | 299 |
| 381 | 3300053077 | Ga0495601_0063692 | Ga0495601_0063692_620_1552 | 299 |
| 382 | 3300053078 | Ga0495612_0009756 | Ga0495612_0009756_1010_1942 | 299 |
| 383 | 3300053084 | Ga0495595_0032393 | Ga0495595_0032393_982_1914 | 299 |
| 384 | 3300053085 | Ga0495619_0065193 | Ga0495619_0065193_245_1177 | 299 |
| 385 | 3300005339 | Ga0070660_100050200 | Ga0070660_1000502002 | 300 |
| 386 | 3300005345 | Ga0070692_10020517 | Ga0070692_100205173 | 300 |
| 387 | 3300005367 | Ga0070667_100251380 | Ga0070667_1002513802 | 300 |
| 388 | 3300005437 | Ga0070710_10174549 | Ga0070710_101745492 | 300 |
| 389 | 3300005445 | Ga0070708_100011212 | Ga0070708_1000112123 | 300 |
| 390 | 3300005445 | Ga0070708_100089473 | Ga0070708_1000894733 | 300 |
| 391 | 3300005467 | Ga0070706_100130336 | Ga0070706_1001303363 | 300 |
| 392 | 3300005468 | Ga0070707_100026781 | Ga0070707_1000267813 | 300 |
| 393 | 3300005471 | Ga0070698_100029177 | Ga0070698_1000291773 | 300 |
| 394 | 3300005471 | Ga0070698_100171262 | Ga0070698_1001712622 | 300 |
| 395 | 3300005518 | Ga0070699_100102490 | Ga0070699_1001024902 | 300 |
| 396 | 3300005530 | Ga0070679_100193216 | Ga0070679_1001932162 | 300 |
| 397 | 3300005535 | Ga0070684_100054966 | Ga0070684_1000549663 | 300 |
| 398 | 3300005536 | Ga0070697_100076148 | Ga0070697_1000761483 | 300 |
| 399 | 3300005546 | Ga0070696_100092001 | Ga0070696_1000920012 | 300 |
| 400 | 3300005618 | Ga0068864_100138610 | Ga0068864_1001386102 | 300 |
| 401 | 3300005841 | Ga0068863_100106839 | Ga0068863_1001068392 | 300 |
| 402 | 3300006028 | Ga0070717_10128022 | Ga0070717_101280223 | 300 |
| 403 | 3300006028 | Ga0070717_10427000 | Ga0070717_104270001 | 300 |
| 404 | 3300006871 | Ga0075434_100262195 | Ga0075434_1002621952 | 300 |
| 405 | 3300006914 | Ga0075436_100050761 | Ga0075436_1000507612 | 300 |
| 406 | 3300007076 | Ga0075435_100452294 | Ga0075435_1004522941 | 300 |
| 407 | 3300007788 | Ga0099795_10057637 | Ga0099795_100576372 | 300 |
| 408 | 3300009177 | Ga0105248_10192061 | Ga0105248_101920613 | 300 |
| 409 | 3300009551 | Ga0105238_10145996 | Ga0105238_101459963 | 300 |
| 410 | 3300013100 | Ga0157373_10150422 | Ga0157373_101504222 | 300 |
| 411 | 3300021388 | Ga0213875_10000907 | Ga0213875_1000090721 | 300 |
| 412 | 3300021388 | Ga0213875_10010026 | Ga0213875_100100262 | 300 |
| 413 | 3300025898 | Ga0207692_10069895 | Ga0207692_100698952 | 300 |
| 414 | 3300025900 | Ga0207710_10073569 | Ga0207710_100735692 | 300 |
| 415 | 3300025901 | Ga0207688_10010686 | Ga0207688_100106863 | 300 |
| 416 | 3300025903 | Ga0207680_10024971 | Ga0207680_100249713 | 300 |
| 417 | 3300025906 | Ga0207699_10073926 | Ga0207699_100739262 | 300 |
| 418 | 3300025908 | Ga0207643_10030097 | Ga0207643_100300973 | 300 |
| 419 | 3300025910 | Ga0207684_10126107 | Ga0207684_101261073 | 300 |
| 420 | 3300025915 | Ga0207693_10243551 | Ga0207693_102435512 | 300 |
| 421 | 3300025916 | Ga0207663_10044674 | Ga0207663_100446742 | 300 |
| 422 | 3300025919 | Ga0207657_10057686 | Ga0207657_100576863 | 300 |
| 423 | 3300025920 | Ga0207649_10079747 | Ga0207649_100797473 | 300 |
| 424 | 3300025921 | Ga0207652_10057211 | Ga0207652_100572112 | 300 |
| 425 | 3300025929 | Ga0207664_10129162 | Ga0207664_101291623 | 300 |
| 426 | 3300025939 | Ga0207665_10265994 | Ga0207665_102659942 | 300 |
| 427 | 3300025940 | Ga0207691_10043717 | Ga0207691_100437173 | 300 |
| 428 | 3300025942 | Ga0207689_10013841 | Ga0207689_100138414 | 300 |
| 429 | 3300025944 | Ga0207661_10024207 | Ga0207661_100242073 | 300 |
| 430 | 3300025945 | Ga0207679_10098501 | Ga0207679_100985012 | 300 |
| 431 | 3300025960 | Ga0207651_10129231 | Ga0207651_101292312 | 300 |
| 432 | 3300026067 | Ga0207678_10044649 | Ga0207678_100446493 | 300 |
| 433 | 3300026078 | Ga0207702_10027569 | Ga0207702_100275693 | 300 |
| 434 | 3300026116 | Ga0207674_10059346 | Ga0207674_100593463 | 300 |
| 435 | 3300026121 | Ga0207683_10016543 | Ga0207683_100165433 | 300 |
| 436 | 3300034816 | Ga0373930_0001178 | Ga0373930_0001178_2660_3589 | 300 |
| 437 | 3300034957 | Ga0373938_0003804 | Ga0373938_0003804_820_1749 | 300 |
| 438 | 3300035086 | Ga0373934_0007737 | Ga0373934_0007737_1433_2362 | 300 |
| 439 | 3300035115 | Ga0373941_0018312 | Ga0373941_0018312_172_1101 | 300 |
| 440 | 3300035119 | Ga0373956_0018381 | Ga0373956_0018381_1636_2565 | 300 |
| 441 | 3300035410 | Ga0373924_0121162 | Ga0373924_0121162_161_1090 | 300 |
| 442 | 3300036401 | Ga0373937_0018453 | Ga0373937_0018453_3860_4789 | 300 |
| 443 | 3300037853 | Ga0436364_0185475 | Ga0436364_0185475_17782_18708 | 300 |
| 444 | 3300037853 | Ga0436364_0319187 | Ga0436364_0319187_587_1516 | 300 |
| 445 | 3300037853 | Ga0436364_0789302 | Ga0436364_0789302_1122_2051 | 300 |
| 446 | 3300039447 | Ga0436361_0712461 | Ga0436361_0712461_28_957 | 300 |
| 447 | 3300039453 | Ga0436362_0802341 | Ga0436362_0802341_31_960 | 300 |
| 448 | 3300046462 | Ga0495651_0023401 | Ga0495651_0023401_3477_4406 | 300 |
| 449 | 3300046462 | Ga0495651_0069936 | Ga0495651_0069936_282_1211 | 300 |
| 450 | 3300046463 | Ga0495653_0008333 | Ga0495653_0008333_5854_6783 | 300 |
| 451 | 3300046477 | Ga0495664_0015657 | Ga0495664_0015657_1034_1963 | 300 |
| 452 | 3300046511 | Ga0495608_0014598 | Ga0495608_0014598_21_950 | 300 |
| 453 | 3300046511 | Ga0495608_0127546 | Ga0495608_0127546_269_1198 | 300 |
| 454 | 3300046529 | Ga0495652_0214721 | Ga0495652_0214721_426_1355 | 300 |
| 455 | 3300046533 | Ga0495640_0037892 | Ga0495640_0037892_706_1635 | 300 |
| 456 | 3300046559 | Ga0495667_0022555 | Ga0495667_0022555_1612_2541 | 300 |
| 457 | 3300046559 | Ga0495667_0053794 | Ga0495667_0053794_525_1454 | 300 |
| 458 | 3300046663 | Ga0495635_0010435 | Ga0495635_0010435_3157_4086 | 300 |
| 459 | 3300046663 | Ga0495635_0129509 | Ga0495635_0129509_297_1226 | 300 |
| 460 | 3300046675 | Ga0495657_0014848 | Ga0495657_0014848_959_1888 | 300 |
| 461 | 3300046675 | Ga0495657_0065967 | Ga0495657_0065967_1331_2260 | 300 |
| 462 | 3300046809 | Ga0495600_0168474 | Ga0495600_0168474_378_1307 | 300 |
| 463 | 3300046809 | Ga0495600_0239586 | Ga0495600_0239586_88_1017 | 300 |
| 464 | 3300047322 | Ga0495680_0006561 | Ga0495680_0006561_3860_4789 | 300 |
| 465 | 3300047322 | Ga0495680_0037933 | Ga0495680_0037933_2464_3393 | 300 |
| 466 | 3300047471 | Ga0495684_0069081 | Ga0495684_0069081_1329_2258 | 300 |
| 467 | 3300047471 | Ga0495684_0073022 | Ga0495684_0073022_344_1273 | 300 |
| 468 | 3300048088 | Ga0495602_0071319 | Ga0495602_0071319_543_1472 | 300 |
| 469 | 3300048903 | Ga0496100_0127913 | Ga0496100_0127913_559_1488 | 300 |
| 470 | 3300048904 | Ga0496101_0088950 | Ga0496101_0088950_890_1819 | 300 |
| 471 | 3300048906 | Ga0496103_0045674 | Ga0496103_0045674_1599_2528 | 300 |
| 472 | 3300048908 | Ga0496105_0096498 | Ga0496105_0096498_1019_1948 | 300 |
| 473 | 3300048913 | Ga0496110_0034760 | Ga0496110_0034760_244_1173 | 300 |
| 474 | 3300048914 | Ga0496111_0030500 | Ga0496111_0030500_721_1650 | 300 |
| 475 | 3300048917 | Ga0496114_0127089 | Ga0496114_0127089_934_1863 | 300 |
| 476 | 3300048918 | Ga0496115_0154748 | Ga0496115_0154748_746_1675 | 300 |
| 477 | 3300049824 | Ga0501045_0079731 | Ga0501045_0079731_1113_2051 | 300 |
| 478 | 3300050512 | nmdc:mga0n895_287565_c1 | nmdc:mga0n895_287565_c1_159_1088 | 300 |
| 479 | 3300005339 | Ga0070660_100023868 | Ga0070660_1000238682 | 301 |
| 480 | 3300005341 | Ga0070691_10077329 | Ga0070691_100773292 | 301 |
| 481 | 3300005435 | Ga0070714_100361212 | Ga0070714_1003612122 | 301 |
| 482 | 3300005436 | Ga0070713_100035570 | Ga0070713_1000355703 | 301 |
| 483 | 3300005455 | Ga0070663_100004550 | Ga0070663_1000045503 | 301 |
| 484 | 3300005455 | Ga0070663_100017400 | Ga0070663_1000174004 | 301 |
| 485 | 3300005455 | Ga0070663_100044808 | Ga0070663_1000448082 | 301 |
| 486 | 3300005458 | Ga0070681_10485848 | Ga0070681_104858481 | 301 |
| 487 | 3300005535 | Ga0070684_100263535 | Ga0070684_1002635352 | 301 |
| 488 | 3300005564 | Ga0070664_100610693 | Ga0070664_1006106932 | 301 |
| 489 | 3300005616 | Ga0068852_100263261 | Ga0068852_1002632612 | 301 |
| 490 | 3300006173 | Ga0070716_100100957 | Ga0070716_1001009573 | 301 |
| 491 | 3300009093 | Ga0105240_10353704 | Ga0105240_103537042 | 301 |
| 492 | 3300013105 | Ga0157369_10300786 | Ga0157369_103007862 | 301 |
| 493 | 3300020081 | Ga0206354_11532852 | Ga0206354_115328522 | 301 |
| 494 | 3300020082 | Ga0206353_10338168 | Ga0206353_103381682 | 301 |
| 495 | 3300020082 | Ga0206353_10667712 | Ga0206353_106677124 | 301 |
| 496 | 3300025905 | Ga0207685_10088056 | Ga0207685_100880562 | 301 |
| 497 | 3300025906 | Ga0207699_10039319 | Ga0207699_100393192 | 301 |
| 498 | 3300025906 | Ga0207699_10168067 | Ga0207699_101680672 | 301 |
| 499 | 3300025912 | Ga0207707_10027336 | Ga0207707_100273364 | 301 |
| 500 | 3300025912 | Ga0207707_10257049 | Ga0207707_102570492 | 301 |
| 501 | 3300025921 | Ga0207652_10108366 | Ga0207652_101083663 | 301 |
| 502 | 3300025929 | Ga0207664_10011377 | Ga0207664_100113773 | 301 |
| 503 | 3300025929 | Ga0207664_10134532 | Ga0207664_101345322 | 301 |
| 504 | 3300025944 | Ga0207661_10344993 | Ga0207661_103449931 | 301 |
| 505 | 3300026067 | Ga0207678_10000248 | Ga0207678_1000024817 | 301 |
| 506 | 3300026067 | Ga0207678_10062668 | Ga0207678_100626684 | 301 |
| 507 | 3300026067 | Ga0207678_10082610 | Ga0207678_100826101 | 301 |
| 508 | 3300026116 | Ga0207674_10252945 | Ga0207674_102529452 | 301 |
| 509 | 3300028379 | Ga0268266_10148750 | Ga0268266_101487502 | 301 |
| 510 | 3300033547 | Ga0316212_1003253 | Ga0316212_10032532 | 301 |
| 511 | 3300035089 | Ga0373944_0002184 | Ga0373944_0002184_3896_4828 | 301 |
| 512 | 3300035111 | Ga0373923_0004555 | Ga0373923_0004555_2944_3876 | 301 |
| 513 | 3300035113 | Ga0373936_0000869 | Ga0373936_0000869_1814_2746 | 301 |
| 514 | 3300035116 | Ga0373945_0000067 | Ga0373945_0000067_20043_20975 | 301 |
| 515 | 3300035170 | Ga0373943_0001486 | Ga0373943_0001486_8139_9071 | 301 |
| 516 | 3300035171 | Ga0373946_0000202 | Ga0373946_0000202_10626_11558 | 301 |
| 517 | 3300035172 | Ga0373955_0050746 | Ga0373955_0050746_194_1126 | 301 |
| 518 | 3300035695 | Ga0373927_0000281 | Ga0373927_0000281_28351_29283 | 301 |
| 519 | 3300035724 | Ga0373933_0099600 | Ga0373933_0099600_793_1725 | 301 |
| 520 | 3300035725 | Ga0373947_0000793 | Ga0373947_0000793_2592_3524 | 301 |
| 521 | 3300037068 | Ga0373925_0004641 | Ga0373925_0004641_945_1877 | 301 |
| 522 | 3300044694 | Ga0466963_0088295 | Ga0466963_0088295_886_1818 | 301 |
| 523 | 3300044694 | Ga0466963_0173756 | Ga0466963_0173756_317_1246 | 301 |
| 524 | 3300045976 | Ga0466967_0041438 | Ga0466967_0041438_750_1682 | 301 |
| 525 | 3300046463 | Ga0495653_0010622 | Ga0495653_0010622_644_1576 | 301 |
| 526 | 3300046477 | Ga0495664_0000599 | Ga0495664_0000599_8341_9273 | 301 |
| 527 | 3300046517 | Ga0495630_0079075 | Ga0495630_0079075_359_1291 | 301 |
| 528 | 3300046529 | Ga0495652_0005238 | Ga0495652_0005238_7572_8504 | 301 |
| 529 | 3300046531 | Ga0495665_0047625 | Ga0495665_0047625_1126_2058 | 301 |
| 530 | 3300046642 | Ga0495634_0047925 | Ga0495634_0047925_488_1420 | 301 |
| 531 | 3300046663 | Ga0495635_0002055 | Ga0495635_0002055_5545_6477 | 301 |
| 532 | 3300046678 | Ga0495599_0069504 | Ga0495599_0069504_232_1164 | 301 |
| 533 | 3300046690 | Ga0495624_0002573 | Ga0495624_0002573_4007_4939 | 301 |
| 534 | 3300047319 | Ga0495674_0000849 | Ga0495674_0000849_5996_6928 | 301 |
| 535 | 3300047471 | Ga0495684_0001960 | Ga0495684_0001960_4992_5924 | 301 |
| 536 | 3300047673 | Ga0495593_0019355 | Ga0495593_0019355_152_1084 | 301 |
| 537 | iso_pu_bacteria | 2855683550 | 2855684701 | 301 |
| 538 | 3300005367 | Ga0070667_100057101 | Ga0070667_1000571013 | 302 |
| 539 | 3300005434 | Ga0070709_10006198 | Ga0070709_100061982 | 302 |
| 540 | 3300005437 | Ga0070710_10016077 | Ga0070710_100160772 | 302 |
| 541 | 3300005445 | Ga0070708_100171792 | Ga0070708_1001717922 | 302 |
| 542 | 3300005467 | Ga0070706_100040104 | Ga0070706_1000401041 | 302 |
| 543 | 3300005467 | Ga0070706_100122538 | Ga0070706_1001225382 | 302 |
| 544 | 3300005467 | Ga0070706_100283553 | Ga0070706_1002835532 | 302 |
| 545 | 3300005471 | Ga0070698_100000192 | Ga0070698_10000019217 | 302 |
| 546 | 3300005471 | Ga0070698_100001213 | Ga0070698_10000121315 | 302 |
| 547 | 3300005471 | Ga0070698_100078855 | Ga0070698_1000788552 | 302 |
| 548 | 3300005471 | Ga0070698_100095373 | Ga0070698_1000953733 | 302 |
| 549 | 3300006038 | Ga0075365_10160326 | Ga0075365_101603261 | 302 |
| 550 | 3300006173 | Ga0070716_100000929 | Ga0070716_1000009294 | 302 |
| 551 | 3300013104 | Ga0157370_10215715 | Ga0157370_102157152 | 302 |
| 552 | 3300025898 | Ga0207692_10032927 | Ga0207692_100329271 | 302 |
| 553 | 3300025906 | Ga0207699_10000446 | Ga0207699_100004464 | 302 |
| 554 | 3300025910 | Ga0207684_10039423 | Ga0207684_100394233 | 302 |
| 555 | 3300025910 | Ga0207684_10239876 | Ga0207684_102398762 | 302 |
| 556 | 3300025928 | Ga0207700_10012751 | Ga0207700_100127512 | 302 |
| 557 | 3300025929 | Ga0207664_10012680 | Ga0207664_100126804 | 302 |
| 558 | 3300025939 | Ga0207665_10003733 | Ga0207665_100037334 | 302 |
| 559 | 3300025986 | Ga0207658_10210997 | Ga0207658_102109973 | 302 |
| 560 | 3300028381 | Ga0268264_10342306 | Ga0268264_103423061 | 302 |
| 561 | 3300028800 | Ga0265338_10006079 | Ga0265338_100060797 | 302 |
| 562 | 3300037853 | Ga0436364_1268560 | Ga0436364_1268560_109_1044 | 302 |
| 563 | 3300044684 | Ga0466966_0016405 | Ga0466966_0016405_3192_4121 | 302 |
| 564 | 3300044693 | Ga0466961_0060354 | Ga0466961_0060354_442_1371 | 302 |
| 565 | 3300044719 | Ga0466971_0012412 | Ga0466971_0012412_1762_2691 | 302 |
| 566 | 3300045836 | Ga0466958_0008864 | Ga0466958_0008864_2571_3500 | 302 |
| 567 | 3300046476 | Ga0495662_0162506 | Ga0495662_0162506_62_991 | 302 |
| 568 | 3300046517 | Ga0495630_0241311 | Ga0495630_0241311_18_953 | 302 |
| 569 | 3300046675 | Ga0495657_0036799 | Ga0495657_0036799_1729_2667 | 302 |
| 570 | 3300048918 | Ga0496115_0091767 | Ga0496115_0091767_428_1363 | 302 |
| 571 | 3300049581 | Ga0501047_0016843 | Ga0501047_0016843_1912_2841 | 302 |
| 572 | 3300061719 | Ga0466962_0064072 | Ga0466962_0064072_320_1249 | 302 |
| 573 | iso_pu_bacteria | 2622736605 | 2623498622 | 302 |
| 574 | 3300005355 | Ga0070671_100055465 | Ga0070671_1000554652 | 303 |
| 575 | 3300005434 | Ga0070709_10025119 | Ga0070709_100251193 | 303 |
| 576 | 3300005434 | Ga0070709_10039650 | Ga0070709_100396504 | 303 |
| 577 | 3300005435 | Ga0070714_100001824 | Ga0070714_10000182410 | 303 |
| 578 | 3300005435 | Ga0070714_100053550 | Ga0070714_1000535504 | 303 |
| 579 | 3300005436 | Ga0070713_100002913 | Ga0070713_1000029135 | 303 |
| 580 | 3300005437 | Ga0070710_10044759 | Ga0070710_100447593 | 303 |
| 581 | 3300005439 | Ga0070711_100074086 | Ga0070711_1000740861 | 303 |
| 582 | 3300005467 | Ga0070706_100005571 | Ga0070706_1000055716 | 303 |
| 583 | 3300005467 | Ga0070706_100502102 | Ga0070706_1005021022 | 303 |
| 584 | 3300005614 | Ga0068856_100013479 | Ga0068856_1000134797 | 303 |
| 585 | 3300005614 | Ga0068856_100076702 | Ga0068856_1000767022 | 303 |
| 586 | 3300005841 | Ga0068863_100093634 | Ga0068863_1000936342 | 303 |
| 587 | 3300006028 | Ga0070717_10027822 | Ga0070717_100278223 | 303 |
| 588 | 3300006163 | Ga0070715_10001118 | Ga0070715_100011186 | 303 |
| 589 | 3300006173 | Ga0070716_100000371 | Ga0070716_10000037115 | 303 |
| 590 | 3300006175 | Ga0070712_100037447 | Ga0070712_1000374472 | 303 |
| 591 | 3300006237 | Ga0097621_100328477 | Ga0097621_1003284772 | 303 |
| 592 | 3300006871 | Ga0075434_100133418 | Ga0075434_1001334183 | 303 |
| 593 | 3300009098 | Ga0105245_10023602 | Ga0105245_100236022 | 303 |
| 594 | 3300009174 | Ga0105241_10372626 | Ga0105241_103726261 | 303 |
| 595 | 3300013105 | Ga0157369_10058003 | Ga0157369_100580032 | 303 |
| 596 | 3300013308 | Ga0157375_10158031 | Ga0157375_101580312 | 303 |
| 597 | 3300014325 | Ga0163163_10374853 | Ga0163163_103748532 | 303 |
| 598 | 3300014968 | Ga0157379_10099483 | Ga0157379_100994832 | 303 |
| 599 | 3300025898 | Ga0207692_10001266 | Ga0207692_100012662 | 303 |
| 600 | 3300025905 | Ga0207685_10003173 | Ga0207685_100031733 | 303 |
| 601 | 3300025906 | Ga0207699_10003388 | Ga0207699_100033882 | 303 |
| 602 | 3300025906 | Ga0207699_10015622 | Ga0207699_100156223 | 303 |
| 603 | 3300025910 | Ga0207684_10175753 | Ga0207684_101757532 | 303 |
| 604 | 3300025910 | Ga0207684_10446368 | Ga0207684_104463681 | 303 |
| 605 | 3300025912 | Ga0207707_10452165 | Ga0207707_104521651 | 303 |
| 606 | 3300025915 | Ga0207693_10018227 | Ga0207693_100182272 | 303 |
| 607 | 3300025915 | Ga0207693_10041001 | Ga0207693_100410013 | 303 |
| 608 | 3300025915 | Ga0207693_10125945 | Ga0207693_101259453 | 303 |
| 609 | 3300025916 | Ga0207663_10052332 | Ga0207663_100523322 | 303 |
| 610 | 3300025928 | Ga0207700_10008058 | Ga0207700_100080584 | 303 |
| 611 | 3300025928 | Ga0207700_10013250 | Ga0207700_100132504 | 303 |
| 612 | 3300025928 | Ga0207700_10038639 | Ga0207700_100386392 | 303 |
| 613 | 3300025928 | Ga0207700_10059302 | Ga0207700_100593022 | 303 |
| 614 | 3300025928 | Ga0207700_10386641 | Ga0207700_103866411 | 303 |
| 615 | 3300025929 | Ga0207664_10005359 | Ga0207664_100053594 | 303 |
| 616 | 3300025929 | Ga0207664_10033493 | Ga0207664_100334934 | 303 |
| 617 | 3300025931 | Ga0207644_10072463 | Ga0207644_100724632 | 303 |
| 618 | 3300025939 | Ga0207665_10000786 | Ga0207665_100007864 | 303 |
| 619 | 3300025939 | Ga0207665_10008276 | Ga0207665_100082762 | 303 |
| 620 | 3300025939 | Ga0207665_10165935 | Ga0207665_101659352 | 303 |
| 621 | 3300025939 | Ga0207665_10198216 | Ga0207665_101982162 | 303 |
| 622 | 3300026023 | Ga0207677_10040536 | Ga0207677_100405364 | 303 |
| 623 | 3300026078 | Ga0207702_10298704 | Ga0207702_102987041 | 303 |
| 624 | 3300026095 | Ga0207676_10013845 | Ga0207676_100138452 | 303 |
| 625 | 3300026116 | Ga0207674_10076793 | Ga0207674_100767934 | 303 |
| 626 | 3300035089 | Ga0373944_0025259 | Ga0373944_0025259_665_1597 | 303 |
| 627 | 3300035115 | Ga0373941_0022921 | Ga0373941_0022921_461_1393 | 303 |
| 628 | 3300035116 | Ga0373945_0120000 | Ga0373945_0120000_35_979 | 303 |
| 629 | 3300035118 | Ga0373954_0123655 | Ga0373954_0123655_180_1112 | 303 |
| 630 | 3300035170 | Ga0373943_0055712 | Ga0373943_0055712_574_1506 | 303 |
| 631 | 3300035242 | Ga0373962_0045062 | Ga0373962_0045062_131_1063 | 303 |
| 632 | 3300035692 | Ga0373935_0047093 | Ga0373935_0047093_1534_2466 | 303 |
| 633 | 3300035724 | Ga0373933_0003103 | Ga0373933_0003103_4164_5096 | 303 |
| 634 | 3300035725 | Ga0373947_0178481 | Ga0373947_0178481_286_1218 | 303 |
| 635 | 3300036401 | Ga0373937_0006376 | Ga0373937_0006376_2808_3740 | 303 |
| 636 | 3300037068 | Ga0373925_0002004 | Ga0373925_0002004_7215_8147 | 303 |
| 637 | 3300037068 | Ga0373925_0106044 | Ga0373925_0106044_1028_1972 | 303 |
| 638 | 3300037068 | Ga0373925_0266745 | Ga0373925_0266745_165_1097 | 303 |
| 639 | 3300037466 | Ga0395898_0164765 | Ga0395898_0164765_763_1710 | 303 |
| 640 | 3300038443 | Ga0395901_0012456 | Ga0395901_0012456_1930_2877 | 303 |
| 641 | 3300044694 | Ga0466963_0085983 | Ga0466963_0085983_767_1708 | 303 |
| 642 | 3300045976 | Ga0466967_0036146 | Ga0466967_0036146_1393_2340 | 303 |
| 643 | 3300046454 | Ga0495592_0131181 | Ga0495592_0131181_649_1581 | 303 |
| 644 | 3300046455 | Ga0495603_0131661 | Ga0495603_0131661_212_1144 | 303 |
| 645 | 3300046459 | Ga0495629_0042465 | Ga0495629_0042465_2193_3125 | 303 |
| 646 | 3300046461 | Ga0495641_0162921 | Ga0495641_0162921_23_955 | 303 |
| 647 | 3300046462 | Ga0495651_0002138 | Ga0495651_0002138_1265_2197 | 303 |
| 648 | 3300046463 | Ga0495653_0001719 | Ga0495653_0001719_3938_4870 | 303 |
| 649 | 3300046476 | Ga0495662_0019779 | Ga0495662_0019779_1769_2701 | 303 |
| 650 | 3300046477 | Ga0495664_0011357 | Ga0495664_0011357_560_1504 | 303 |
| 651 | 3300046477 | Ga0495664_0068708 | Ga0495664_0068708_62_994 | 303 |
| 652 | 3300046511 | Ga0495608_0000839 | Ga0495608_0000839_13902_14834 | 303 |
| 653 | 3300046511 | Ga0495608_0099691 | Ga0495608_0099691_350_1282 | 303 |
| 654 | 3300046516 | Ga0495628_0012903 | Ga0495628_0012903_139_1071 | 303 |
| 655 | 3300046516 | Ga0495628_0237378 | Ga0495628_0237378_342_1274 | 303 |
| 656 | 3300046516 | Ga0495628_0316839 | Ga0495628_0316839_21_953 | 303 |
| 657 | 3300046517 | Ga0495630_0083624 | Ga0495630_0083624_269_1201 | 303 |
| 658 | 3300046517 | Ga0495630_0227664 | Ga0495630_0227664_138_1070 | 303 |
| 659 | 3300046529 | Ga0495652_0020665 | Ga0495652_0020665_4187_5119 | 303 |
| 660 | 3300046529 | Ga0495652_0082199 | Ga0495652_0082199_1362_2294 | 303 |
| 661 | 3300046533 | Ga0495640_0045625 | Ga0495640_0045625_26_958 | 303 |
| 662 | 3300046536 | Ga0495587_0014596 | Ga0495587_0014596_2596_3528 | 303 |
| 663 | 3300046536 | Ga0495587_0015977 | Ga0495587_0015977_223_1155 | 303 |
| 664 | 3300046543 | Ga0495645_0004770 | Ga0495645_0004770_1767_2699 | 303 |
| 665 | 3300046543 | Ga0495645_0076362 | Ga0495645_0076362_744_1688 | 303 |
| 666 | 3300046543 | Ga0495645_0104236 | Ga0495645_0104236_936_1868 | 303 |
| 667 | 3300046559 | Ga0495667_0000281 | Ga0495667_0000281_27313_28245 | 303 |
| 668 | 3300046642 | Ga0495634_0086480 | Ga0495634_0086480_280_1212 | 303 |
| 669 | 3300046642 | Ga0495634_0197209 | Ga0495634_0197209_111_1043 | 303 |
| 670 | 3300046663 | Ga0495635_0030979 | Ga0495635_0030979_1717_2649 | 303 |
| 671 | 3300046663 | Ga0495635_0168354 | Ga0495635_0168354_92_1024 | 303 |
| 672 | 3300046675 | Ga0495657_0000699 | Ga0495657_0000699_22522_23454 | 303 |
| 673 | 3300046675 | Ga0495657_0068044 | Ga0495657_0068044_191_1123 | 303 |
| 674 | 3300046678 | Ga0495599_0079535 | Ga0495599_0079535_862_1794 | 303 |
| 675 | 3300046678 | Ga0495599_0096107 | Ga0495599_0096107_728_1660 | 303 |
| 676 | 3300046809 | Ga0495600_0008139 | Ga0495600_0008139_77_1009 | 303 |
| 677 | 3300047317 | Ga0495604_0008600 | Ga0495604_0008600_5057_5989 | 303 |
| 678 | 3300047319 | Ga0495674_0001294 | Ga0495674_0001294_16342_17274 | 303 |
| 679 | 3300047319 | Ga0495674_0019700 | Ga0495674_0019700_328_1272 | 303 |
| 680 | 3300047319 | Ga0495674_0039622 | Ga0495674_0039622_1061_1993 | 303 |
| 681 | 3300047322 | Ga0495680_0028154 | Ga0495680_0028154_132_1064 | 303 |
| 682 | 3300047322 | Ga0495680_0123848 | Ga0495680_0123848_592_1524 | 303 |
| 683 | 3300047471 | Ga0495684_0007105 | Ga0495684_0007105_1564_2496 | 303 |
| 684 | 3300047471 | Ga0495684_0067939 | Ga0495684_0067939_1299_2231 | 303 |
| 685 | 3300048088 | Ga0495602_0068898 | Ga0495602_0068898_791_1723 | 303 |
| 686 | 3300048903 | Ga0496100_0149208 | Ga0496100_0149208_222_1154 | 303 |
| 687 | 3300048904 | Ga0496101_0068244 | Ga0496101_0068244_87_1019 | 303 |
| 688 | 3300048905 | Ga0496102_0094771 | Ga0496102_0094771_685_1617 | 303 |
| 689 | 3300048907 | Ga0496104_0016612 | Ga0496104_0016612_3781_4713 | 303 |
| 690 | 3300048907 | Ga0496104_0032704 | Ga0496104_0032704_1698_2630 | 303 |
| 691 | 3300048908 | Ga0496105_0038817 | Ga0496105_0038817_1837_2769 | 303 |
| 692 | 3300048911 | Ga0496108_0008607 | Ga0496108_0008607_4123_5055 | 303 |
| 693 | 3300048911 | Ga0496108_0008967 | Ga0496108_0008967_2235_3167 | 303 |
| 694 | 3300048913 | Ga0496110_0072228 | Ga0496110_0072228_676_1608 | 303 |
| 695 | 3300048916 | Ga0496113_0053761 | Ga0496113_0053761_1831_2763 | 303 |
| 696 | 3300048917 | Ga0496114_0021193 | Ga0496114_0021193_2679_3611 | 303 |
| 697 | 3300048918 | Ga0496115_0033734 | Ga0496115_0033734_2428_3360 | 303 |
| 698 | 3300050512 | nmdc:mga0n895_243142_c1 | nmdc:mga0n895_243142_c1_257_1189 | 303 |
| 699 | 3300050513 | nmdc:mga0rr50_201197_c1 | nmdc:mga0rr50_201197_c1_444_1376 | 303 |
| 700 | 3300053077 | Ga0495601_0080485 | Ga0495601_0080485_330_1274 | 303 |
| 701 | 3300053084 | Ga0495595_0027349 | Ga0495595_0027349_478_1410 | 303 |
| 702 | 3300053084 | Ga0495595_0127474 | Ga0495595_0127474_27_959 | 303 |
| 703 | 3300053085 | Ga0495619_0172140 | Ga0495619_0172140_387_1319 | 303 |
| 704 | 3300005445 | Ga0070708_100098949 | Ga0070708_1000989491 | 304 |
| 705 | 3300005467 | Ga0070706_100003471 | Ga0070706_10000347111 | 304 |
| 706 | 3300005468 | Ga0070707_100020535 | Ga0070707_1000205351 | 304 |
| 707 | 3300005471 | Ga0070698_100005834 | Ga0070698_1000058345 | 304 |
| 708 | 3300005536 | Ga0070697_100005992 | Ga0070697_1000059928 | 304 |
| 709 | 3300025910 | Ga0207684_10001618 | Ga0207684_100016186 | 304 |
| 710 | 3300025922 | Ga0207646_10001715 | Ga0207646_100017154 | 304 |
| 711 | 3300025928 | Ga0207700_10004620 | Ga0207700_100046202 | 304 |
| 712 | 3300035083 | Ga0373926_0018293 | Ga0373926_0018293_846_1784 | 304 |
| 713 | 3300035086 | Ga0373934_0000159 | Ga0373934_0000159_14472_15407 | 304 |
| 714 | 3300035117 | Ga0373953_0000089 | Ga0373953_0000089_7904_8839 | 304 |
| 715 | 3300035118 | Ga0373954_0009771 | Ga0373954_0009771_739_1674 | 304 |
| 716 | 3300035119 | Ga0373956_0004682 | Ga0373956_0004682_406_1341 | 304 |
| 717 | 3300035120 | Ga0373957_0000438 | Ga0373957_0000438_1147_2082 | 304 |
| 718 | 3300035172 | Ga0373955_0000024 | Ga0373955_0000024_26687_27622 | 304 |
| 719 | 3300035172 | Ga0373955_0198687 | Ga0373955_0198687_239_1174 | 304 |
| 720 | 3300035410 | Ga0373924_0001904 | Ga0373924_0001904_2083_3018 | 304 |
| 721 | 3300035692 | Ga0373935_0050424 | Ga0373935_0050424_936_1874 | 304 |
| 722 | 3300035724 | Ga0373933_0000153 | Ga0373933_0000153_15658_16593 | 304 |
| 723 | 3300035724 | Ga0373933_0099413 | Ga0373933_0099413_781_1716 | 304 |
| 724 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_209635_210573 | 304 |
| 725 | 3300036401 | Ga0373937_0000333 | Ga0373937_0000333_11309_12244 | 304 |
| 726 | 3300036401 | Ga0373937_0312084 | Ga0373937_0312084_167_1102 | 304 |
| 727 | 3300036459 | Ga0372808_005037 | Ga0372808_005037_600_1547 | 304 |
| 728 | 3300046454 | Ga0495592_0000304 | Ga0495592_0000304_8034_8969 | 304 |
| 729 | 3300046462 | Ga0495651_0000252 | Ga0495651_0000252_8074_9009 | 304 |
| 730 | 3300046463 | Ga0495653_0012189 | Ga0495653_0012189_1536_2471 | 304 |
| 731 | 3300046511 | Ga0495608_0000101 | Ga0495608_0000101_32523_33458 | 304 |
| 732 | 3300046516 | Ga0495628_0000327 | Ga0495628_0000327_13923_14858 | 304 |
| 733 | 3300046529 | Ga0495652_0000775 | Ga0495652_0000775_11927_12862 | 304 |
| 734 | 3300046536 | Ga0495587_0000228 | Ga0495587_0000228_8061_8996 | 304 |
| 735 | 3300046543 | Ga0495645_0046798 | Ga0495645_0046798_974_1909 | 304 |
| 736 | 3300046559 | Ga0495667_0000742 | Ga0495667_0000742_15254_16189 | 304 |
| 737 | 3300046675 | Ga0495657_0000156 | Ga0495657_0000156_28229_29164 | 304 |
| 738 | 3300046678 | Ga0495599_0000097 | Ga0495599_0000097_32416_33351 | 304 |
| 739 | 3300046679 | Ga0495623_0000471 | Ga0495623_0000471_20846_21781 | 304 |
| 740 | 3300046679 | Ga0495623_0025222 | Ga0495623_0025222_1525_2460 | 304 |
| 741 | 3300046680 | Ga0495646_0027767 | Ga0495646_0027767_833_1768 | 304 |
| 742 | 3300047317 | Ga0495604_0000196 | Ga0495604_0000196_22530_23465 | 304 |
| 743 | 3300047322 | Ga0495680_0000226 | Ga0495680_0000226_28200_29135 | 304 |
| 744 | 3300047444 | Ga0495675_0002108 | Ga0495675_0002108_2118_3053 | 304 |
| 745 | 3300048088 | Ga0495602_0000172 | Ga0495602_0000172_28073_29008 | 304 |
| 746 | 3300053084 | Ga0495595_0021214 | Ga0495595_0021214_1441_2376 | 304 |
| 747 | iso_pu_bacteria | 8055172936 | 8055178842 | 304 |
| 748 | 3300005434 | Ga0070709_10000346 | Ga0070709_100003466 | 306 |
| 749 | 3300005435 | Ga0070714_100005412 | Ga0070714_1000054125 | 306 |
| 750 | 3300005436 | Ga0070713_100000759 | Ga0070713_1000007595 | 306 |
| 751 | 3300005439 | Ga0070711_100031410 | Ga0070711_1000314102 | 306 |
| 752 | 3300006028 | Ga0070717_10002685 | Ga0070717_100026854 | 306 |
| 753 | 3300006163 | Ga0070715_10003853 | Ga0070715_100038533 | 306 |
| 754 | 3300006173 | Ga0070716_100003249 | Ga0070716_1000032496 | 306 |
| 755 | 3300025898 | Ga0207692_10000123 | Ga0207692_100001236 | 306 |
| 756 | 3300025905 | Ga0207685_10002387 | Ga0207685_100023875 | 306 |
| 757 | 3300025906 | Ga0207699_10000829 | Ga0207699_100008296 | 306 |
| 758 | 3300025916 | Ga0207663_10005217 | Ga0207663_100052174 | 306 |
| 759 | 3300025928 | Ga0207700_10000891 | Ga0207700_1000089113 | 306 |
| 760 | 3300025929 | Ga0207664_10000224 | Ga0207664_100002246 | 306 |
| 761 | 3300025939 | Ga0207665_10003910 | Ga0207665_100039102 | 306 |
| 762 | 3300037418 | Ga0395900_0020198 | Ga0395900_0020198_5112_6050 | 306 |
| 763 | 3300044694 | Ga0466963_0158470 | Ga0466963_0158470_368_1306 | 306 |
| 764 | 3300045976 | Ga0466967_0063218 | Ga0466967_0063218_1896_2834 | 306 |
| 765 | 3300045976 | Ga0466967_0113449 | Ga0466967_0113449_1338_2285 | 307 |
| 766 | 3300006844 | Ga0075428_100072304 | Ga0075428_1000723045 | 308 |
| 767 | 3300006852 | Ga0075433_10044691 | Ga0075433_100446912 | 308 |
| 768 | 3300006914 | Ga0075436_100081820 | Ga0075436_1000818202 | 308 |
| 769 | 3300007076 | Ga0075435_100206439 | Ga0075435_1002064392 | 308 |
| 770 | 3300009094 | Ga0111539_10040160 | Ga0111539_100401604 | 308 |
| 771 | 3300009147 | Ga0114129_10009348 | Ga0114129_100093488 | 308 |
| 772 | 3300027907 | Ga0207428_10171894 | Ga0207428_101718942 | 308 |
| 773 | 3300035691 | Ga0373931_0140175 | Ga0373931_0140175_318_1289 | 308 |
| 774 | 3300050507 | nmdc:mga05p37_50945_c1 | nmdc:mga05p37_50945_c1_1509_2480 | 308 |
| 775 | 3300050511 | nmdc:mga08y16_318615_c1 | nmdc:mga08y16_318615_c1_592_1563 | 308 |
| 776 | 3300050513 | nmdc:mga0rr50_50841_c1 | nmdc:mga0rr50_50841_c1_748_1719 | 308 |
| 777 | 3300050514 | nmdc:mga08x19_8618_c1 | nmdc:mga08x19_8618_c1_1137_2108 | 308 |
| 778 | 3300050515 | nmdc:mga0a205_55652_c1 | nmdc:mga0a205_55652_c1_320_1291 | 308 |
| 779 | 3300005329 | Ga0070683_100185827 | Ga0070683_1001858272 | 309 |
| 780 | 3300020082 | Ga0206353_11752212 | Ga0206353_117522122 | 309 |
| 781 | 3300031852 | Ga0307410_10188909 | Ga0307410_101889092 | 309 |
| 782 | 3300031995 | Ga0307409_100038159 | Ga0307409_1000381594 | 309 |
| 783 | 3300032002 | Ga0307416_100010532 | Ga0307416_1000105324 | 309 |
| 784 | 3300032126 | Ga0307415_100076642 | Ga0307415_1000766423 | 309 |
| 785 | 3300045049 | Ga0466959_0158798 | Ga0466959_0158798_589_1536 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.8871 | 23 | 70 |
| 1prz-assembly1.cif.gz_A | crystal structure of pseudouridine synthase rlud catalytic module | 0.8859 | 82 | 308 |
| 7pic-assembly1.cif.gz_C | 70s ribosome with p/e-site trna in spectinomycin-treated mycoplasma pneumoniae cells | 0.8825 | 23 | 71 |
| 7aqc-assembly1.cif.gz_Y | structure of the bacterial rqc complex (decoding state) | 0.8818 | 24 | 73 |
| 1v9f-assembly1.cif.gz_A | crystal structure of catalytic domain of pseudouridine synthase rlud from escherichia coli | 0.8814 | 82 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ3_3_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9871 | 12 | 74 | 3.10.290.10 |
| af_P9WHQ3_81_307_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.974 | 89 | 307 | 3.30.2350.10 |
| af_Q2FZ78_82_304_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.945 | 94 | 309 | 3.30.2350.10 |
| af_P9WHQ3_3_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9428 | 12 | 74 | 3.10.290.10 |
| af_I1JSZ4_206_438_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9369 | 134 | 309 | 3.30.2350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448UT97-F1-model_v4 | Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) | 0.9904 | 147 | 308 |
GO:0000455
GO:0003723 GO:0160140 |
| AF-A0A3D2VKT9-F1-model_v4 | RNA pseudouridine synthase | 0.9883 | 187 | 309 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A6J6GGR7-F1-model_v4 | Unannotated protein | 0.9843 | 180 | 309 |
GO:0000455
GO:0003723 GO:0009982 |
| AF-A0A3D2VKT9-F1-model_v4 | RNA pseudouridine synthase | 0.9804 | 187 | 309 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A317Z3S0-F1-model_v4 | RluA family pseudouridine synthase | 0.9644 | 169 | 241 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar