F480686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 415 | 747 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10685547|Ga0070692_106855471 |
| Length | 169 |
| Sequence | MRAIFRSWRYLMTPLAFAGMLGIASAAELNPAAVIYKLPDQIPWGPVNAAGAQSAVVVGDPTKPGFYMVYNKWTKGNHFSRPHFHPNDRYIVVLQGTWWVGSGPKFDPANTTPMPAGSFVTHIGKQVHWDGAKDEDAVLLIMGEGPATSGDRSWQRAKALQQSQTVAHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2791355199 | |||
| 12 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 13 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 14 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 19 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 20 | 2904699407 | |||
| 21 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 22 | 2906610324 | |||
| 23 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 24 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 25 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 26 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 27 | 2922425934 | |||
| 28 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 33 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 34 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 35 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 230 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 258 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 389 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 394 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 397 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 400 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 403 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 404 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 409 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 410 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 411 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 412 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 413 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 414 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 415 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.51 |
| Metatranscriptomes | 0.26 |
| Isolates | 4.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.88 |
| Nodule | 2.81 |
| Rhizoplane | 7.14 |
| Rhizosphere | 68.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10023466 | 3300002239 | Bacteria | 979 |
| 2 | JGI24742J22300_10020375 | 3300002244 | Bacteria | 1130 |
| 3 | JGI25406J46586_10037413 | 3300003203 | Bacteria | 1750 |
| 4 | JGI25153J46596_10014910 | 3300003215 | Bacteria | 3199 |
| 5 | JGI25153J46596_10111780 | 3300003215 | Bacteria | 627 |
| 6 | JGI25153J46596_10141221 | 3300003215 | Bacteria | 525 |
| 7 | JGI25160J50197_1003785 | 3300003354 | Bacteria | 6659 |
| 8 | JGI25160J50197_1029609 | 3300003354 | Bacteria | 1444 |
| 9 | JGI25404J52841_10002694 | 3300003659 | Bacteria | 3397 |
| 10 | JGI25404J52841_10006830 | 3300003659 | Bacteria | 2398 |
| 11 | JGI25404J52841_10013781 | 3300003659 | Bacteria | 1754 |
| 12 | JGI25404J52841_10018919 | 3300003659 | Bacteria | 1492 |
| 13 | JGI25404J52841_10034671 | 3300003659 | Bacteria | 1075 |
| 14 | Ga0058860_11691766 | 3300004801 | Bacteria | 599 |
| 15 | Ga0065165_1003606 | 3300005262 | Bacteria | 10627 |
| 16 | Ga0065704_10690125 | 3300005289 | Bacteria | 565 |
| 17 | Ga0070690_100092879 | 3300005330 | Bacteria | 1990 |
| 18 | Ga0070670_100281566 | 3300005331 | Bacteria | 1452 |
| 19 | Ga0070670_100416175 | 3300005331 | Bacteria | 1188 |
| 20 | Ga0068869_100033336 | 3300005334 | Bacteria | 3635 |
| 21 | Ga0068869_100430185 | 3300005334 | Bacteria | 1090 |
| 22 | Ga0068869_100433352 | 3300005334 | Bacteria | 1087 |
| 23 | Ga0068869_100484397 | 3300005334 | Bacteria | 1030 |
| 24 | Ga0068869_100749825 | 3300005334 | Bacteria | 836 |
| 25 | Ga0070666_10586418 | 3300005335 | Bacteria | 813 |
| 26 | Ga0070682_100154996 | 3300005337 | Bacteria | 1576 |
| 27 | Ga0070682_100389529 | 3300005337 | Bacteria | 1051 |
| 28 | Ga0068868_100243267 | 3300005338 | Bacteria | 1512 |
| 29 | Ga0070660_100444955 | 3300005339 | Bacteria | 1075 |
| 30 | Ga0070661_100298254 | 3300005344 | Bacteria | 1254 |
| 31 | Ga0070692_10685547 | 3300005345 | Bacteria | 688 |
| 32 | Ga0070668_100012999 | 3300005347 | Bacteria | 6198 |
| 33 | Ga0070668_100053665 | 3300005347 | Bacteria | 3108 |
| 34 | Ga0070668_100058160 | 3300005347 | Bacteria | 2990 |
| 35 | Ga0070668_100349174 | 3300005347 | Bacteria | 1251 |
| 36 | Ga0070668_100616470 | 3300005347 | Bacteria | 951 |
| 37 | Ga0070669_100337342 | 3300005353 | Bacteria | 1221 |
| 38 | Ga0070675_100415254 | 3300005354 | Bacteria | 1202 |
| 39 | Ga0070671_100216959 | 3300005355 | Bacteria | 1623 |
| 40 | Ga0070671_100222154 | 3300005355 | Bacteria | 1602 |
| 41 | Ga0070674_100278587 | 3300005356 | Bacteria | 1325 |
| 42 | Ga0070674_100362813 | 3300005356 | Bacteria | 1173 |
| 43 | Ga0070673_100051954 | 3300005364 | Bacteria | 3213 |
| 44 | Ga0070673_100888930 | 3300005364 | Bacteria | 826 |
| 45 | Ga0070688_100079031 | 3300005365 | Bacteria | 2124 |
| 46 | Ga0070688_100173392 | 3300005365 | Bacteria | 1490 |
| 47 | Ga0070667_100771820 | 3300005367 | Bacteria | 892 |
| 48 | Ga0070703_10244751 | 3300005406 | Bacteria | 725 |
| 49 | Ga0070709_10003312 | 3300005434 | Bacteria | 8668 |
| 50 | Ga0070709_11225185 | 3300005434 | Bacteria | 604 |
| 51 | Ga0070714_100261240 | 3300005435 | Bacteria | 1603 |
| 52 | Ga0070713_100001422 | 3300005436 | Bacteria | 15343 |
| 53 | Ga0070713_100018220 | 3300005436 | Bacteria | 5335 |
| 54 | Ga0070713_100204510 | 3300005436 | Bacteria | 1785 |
| 55 | Ga0070710_10004827 | 3300005437 | Bacteria | 6376 |
| 56 | Ga0070710_10269295 | 3300005437 | Bacteria | 1101 |
| 57 | Ga0070701_10175530 | 3300005438 | Bacteria | 1251 |
| 58 | Ga0070711_100002142 | 3300005439 | Bacteria | 11198 |
| 59 | Ga0070705_101185137 | 3300005440 | Bacteria | 629 |
| 60 | Ga0070700_100107418 | 3300005441 | Bacteria | 1850 |
| 61 | Ga0070700_100115143 | 3300005441 | Bacteria | 1793 |
| 62 | Ga0070663_100003220 | 3300005455 | Bacteria | 9382 |
| 63 | Ga0070663_100048983 | 3300005455 | Bacteria | 2998 |
| 64 | Ga0070663_100297645 | 3300005455 | Bacteria | 1290 |
| 65 | Ga0070678_100004494 | 3300005456 | Bacteria | 7914 |
| 66 | Ga0070678_100288382 | 3300005456 | Bacteria | 1391 |
| 67 | Ga0070678_100527550 | 3300005456 | Bacteria | 1045 |
| 68 | Ga0070662_100066064 | 3300005457 | Bacteria | 2653 |
| 69 | Ga0070662_100508162 | 3300005457 | Bacteria | 1006 |
| 70 | Ga0070662_101022000 | 3300005457 | Bacteria | 708 |
| 71 | Ga0070681_10137788 | 3300005458 | Bacteria | 2370 |
| 72 | Ga0068867_100023064 | 3300005459 | Bacteria | 4454 |
| 73 | Ga0068867_100272666 | 3300005459 | Bacteria | 1384 |
| 74 | Ga0068867_100329399 | 3300005459 | Bacteria | 1268 |
| 75 | Ga0070706_100275569 | 3300005467 | Bacteria | 1570 |
| 76 | Ga0070706_100357193 | 3300005467 | Bacteria | 1362 |
| 77 | Ga0070698_100706138 | 3300005471 | Bacteria | 951 |
| 78 | Ga0070699_101293634 | 3300005518 | Bacteria | 669 |
| 79 | Ga0070684_100361993 | 3300005535 | Bacteria | 1335 |
| 80 | Ga0070684_101014832 | 3300005535 | Bacteria | 779 |
| 81 | Ga0068853_100286156 | 3300005539 | Bacteria | 1520 |
| 82 | Ga0068853_100381106 | 3300005539 | Bacteria | 1317 |
| 83 | Ga0068853_100417547 | 3300005539 | Bacteria | 1258 |
| 84 | Ga0068853_100494917 | 3300005539 | Bacteria | 1154 |
| 85 | Ga0068853_101322429 | 3300005539 | Bacteria | 697 |
| 86 | Ga0070686_100023591 | 3300005544 | Bacteria | 3679 |
| 87 | Ga0070686_100085499 | 3300005544 | Bacteria | 2098 |
| 88 | Ga0070696_100317270 | 3300005546 | Bacteria | 1198 |
| 89 | Ga0070665_100003438 | 3300005548 | Bacteria | 16894 |
| 90 | Ga0070665_100004774 | 3300005548 | Bacteria | 14113 |
| 91 | Ga0070665_100005873 | 3300005548 | Bacteria | 12581 |
| 92 | Ga0070665_100072877 | 3300005548 | Bacteria | 3442 |
| 93 | Ga0070665_100085408 | 3300005548 | Bacteria | 3161 |
| 94 | Ga0070665_100143770 | 3300005548 | Bacteria | 2388 |
| 95 | Ga0070665_100172272 | 3300005548 | Bacteria | 2165 |
| 96 | Ga0070665_100431501 | 3300005548 | Bacteria | 1327 |
| 97 | Ga0068855_100338462 | 3300005563 | Bacteria | 1660 |
| 98 | Ga0068855_100616514 | 3300005563 | Bacteria | 1169 |
| 99 | Ga0070664_100023548 | 3300005564 | Bacteria | 5088 |
| 100 | Ga0070664_100088114 | 3300005564 | Bacteria | 2684 |
| 101 | Ga0070664_100557801 | 3300005564 | Bacteria | 1059 |
| 102 | Ga0068854_100096778 | 3300005578 | Bacteria | 2206 |
| 103 | Ga0070702_101029207 | 3300005615 | Bacteria | 654 |
| 104 | Ga0068852_100365789 | 3300005616 | Bacteria | 1412 |
| 105 | Ga0068859_100154620 | 3300005617 | Bacteria | 2370 |
| 106 | Ga0068859_100158290 | 3300005617 | Bacteria | 2343 |
| 107 | Ga0068859_101421438 | 3300005617 | Bacteria | 765 |
| 108 | Ga0068859_102126853 | 3300005617 | Bacteria | 619 |
| 109 | Ga0068864_100006935 | 3300005618 | Bacteria | 9294 |
| 110 | Ga0068864_100086971 | 3300005618 | Bacteria | 2751 |
| 111 | Ga0068864_101774345 | 3300005618 | Bacteria | 622 |
| 112 | Ga0068866_10095643 | 3300005718 | Bacteria | 1627 |
| 113 | Ga0068866_10300203 | 3300005718 | Bacteria | 1003 |
| 114 | Ga0068861_100125962 | 3300005719 | Bacteria | 2072 |
| 115 | Ga0068851_10199555 | 3300005834 | Bacteria | 1116 |
| 116 | Ga0068863_100352419 | 3300005841 | Bacteria | 1433 |
| 117 | Ga0068863_100377167 | 3300005841 | Bacteria | 1385 |
| 118 | Ga0068863_102226000 | 3300005841 | Unclassified | 558 |
| 119 | Ga0068858_100295509 | 3300005842 | Bacteria | 1545 |
| 120 | Ga0068858_100488808 | 3300005842 | Bacteria | 1188 |
| 121 | Ga0068860_100020202 | 3300005843 | Bacteria | 6455 |
| 122 | Ga0068860_100078781 | 3300005843 | Bacteria | 3133 |
| 123 | Ga0068860_100082501 | 3300005843 | Bacteria | 3057 |
| 124 | Ga0068860_100105179 | 3300005843 | Bacteria | 2695 |
| 125 | Ga0068862_100043104 | 3300005844 | Bacteria | 3846 |
| 126 | Ga0068862_100075313 | 3300005844 | Bacteria | 2919 |
| 127 | Ga0068862_100186183 | 3300005844 | Bacteria | 1866 |
| 128 | Ga0068862_100422331 | 3300005844 | Bacteria | 1251 |
| 129 | Ga0068862_100430201 | 3300005844 | Bacteria | 1240 |
| 130 | Ga0068862_100716423 | 3300005844 | Bacteria | 970 |
| 131 | Ga0081455_10027369 | 3300005937 | Bacteria | 5225 |
| 132 | Ga0081455_10035127 | 3300005937 | Bacteria | 4484 |
| 133 | Ga0081455_10048375 | 3300005937 | Bacteria | 3675 |
| 134 | Ga0081540_1000593 | 3300005983 | Bacteria | 34646 |
| 135 | Ga0081540_1004374 | 3300005983 | Bacteria | 10802 |
| 136 | Ga0081540_1006150 | 3300005983 | Bacteria | 8811 |
| 137 | Ga0081540_1006500 | 3300005983 | Bacteria | 8497 |
| 138 | Ga0081540_1010157 | 3300005983 | Bacteria | 6406 |
| 139 | Ga0081540_1026322 | 3300005983 | Bacteria | 3323 |
| 140 | Ga0081540_1030811 | 3300005983 | Bacteria | 2964 |
| 141 | Ga0081540_1040425 | 3300005983 | Bacteria | 2431 |
| 142 | Ga0081539_10000540 | 3300005985 | Bacteria | 78243 |
| 143 | Ga0070717_10053957 | 3300006028 | Bacteria | 3313 |
| 144 | Ga0075365_10022471 | 3300006038 | Bacteria | 3952 |
| 145 | Ga0075365_10023658 | 3300006038 | Bacteria | 3867 |
| 146 | Ga0075365_10049826 | 3300006038 | Bacteria | 2760 |
| 147 | Ga0075365_10071461 | 3300006038 | Bacteria | 2336 |
| 148 | Ga0075368_10003916 | 3300006042 | Bacteria | 5011 |
| 149 | Ga0075368_10067536 | 3300006042 | Bacteria | 1439 |
| 150 | Ga0075363_100002441 | 3300006048 | Bacteria | 7595 |
| 151 | Ga0075363_100060854 | 3300006048 | Bacteria | 2034 |
| 152 | Ga0075363_100273612 | 3300006048 | Bacteria | 976 |
| 153 | Ga0075364_10033031 | 3300006051 | Bacteria | 3329 |
| 154 | Ga0075364_10228067 | 3300006051 | Bacteria | 1265 |
| 155 | Ga0075432_10031095 | 3300006058 | Bacteria | 1848 |
| 156 | Ga0070715_10006335 | 3300006163 | Bacteria | 4018 |
| 157 | Ga0070715_10033991 | 3300006163 | Bacteria | 2087 |
| 158 | Ga0070712_100008393 | 3300006175 | Bacteria | 6495 |
| 159 | Ga0070712_100057991 | 3300006175 | Bacteria | 2722 |
| 160 | Ga0070712_100135255 | 3300006175 | Bacteria | 1873 |
| 161 | Ga0075362_10085363 | 3300006177 | Bacteria | 1459 |
| 162 | Ga0075362_10219645 | 3300006177 | Bacteria | 928 |
| 163 | Ga0075367_10025995 | 3300006178 | Bacteria | 3315 |
| 164 | Ga0075367_10055799 | 3300006178 | Bacteria | 2345 |
| 165 | Ga0075367_10528429 | 3300006178 | Bacteria | 749 |
| 166 | Ga0075369_10004104 | 3300006186 | Bacteria | 5361 |
| 167 | Ga0075369_10014424 | 3300006186 | Bacteria | 3156 |
| 168 | Ga0075369_10019245 | 3300006186 | Bacteria | 2786 |
| 169 | Ga0075369_10019721 | 3300006186 | Bacteria | 2756 |
| 170 | Ga0075369_10033206 | 3300006186 | Bacteria | 2186 |
| 171 | Ga0075369_10099537 | 3300006186 | Bacteria | 1303 |
| 172 | Ga0075366_10017253 | 3300006195 | Bacteria | 4153 |
| 173 | Ga0075366_10023675 | 3300006195 | Bacteria | 3578 |
| 174 | Ga0075366_10121023 | 3300006195 | Bacteria | 1577 |
| 175 | Ga0075366_10467346 | 3300006195 | Bacteria | 779 |
| 176 | Ga0097621_100208875 | 3300006237 | Bacteria | 1698 |
| 177 | Ga0097621_100720634 | 3300006237 | Bacteria | 919 |
| 178 | Ga0075370_10002280 | 3300006353 | Bacteria | 8846 |
| 179 | Ga0075370_10234718 | 3300006353 | Bacteria | 1086 |
| 180 | Ga0068871_100062631 | 3300006358 | Bacteria | 3040 |
| 181 | Ga0068871_100320918 | 3300006358 | Bacteria | 1364 |
| 182 | Ga0068871_100647796 | 3300006358 | Bacteria | 964 |
| 183 | Ga0075428_100033777 | 3300006844 | Bacteria | 5645 |
| 184 | Ga0075434_100235841 | 3300006871 | Bacteria | 1849 |
| 185 | Ga0075434_100898312 | 3300006871 | Bacteria | 901 |
| 186 | Ga0068865_100108704 | 3300006881 | Bacteria | 2042 |
| 187 | Ga0068865_100127808 | 3300006881 | Bacteria | 1900 |
| 188 | Ga0097620_100154632 | 3300006931 | Bacteria | 2370 |
| 189 | Ga0097620_100158281 | 3300006931 | Bacteria | 2343 |
| 190 | Ga0097620_101421862 | 3300006931 | Bacteria | 765 |
| 191 | Ga0097620_102126787 | 3300006931 | Bacteria | 619 |
| 192 | Ga0105251_10170380 | 3300009011 | Bacteria | 981 |
| 193 | Ga0111539_10728243 | 3300009094 | Bacteria | 1155 |
| 194 | Ga0111539_10860674 | 3300009094 | Bacteria | 1055 |
| 195 | Ga0105245_10008778 | 3300009098 | Bacteria | 8814 |
| 196 | Ga0105245_10011732 | 3300009098 | Bacteria | 7624 |
| 197 | Ga0105245_10679716 | 3300009098 | Bacteria | 1061 |
| 198 | Ga0105245_11757326 | 3300009098 | Bacteria | 673 |
| 199 | Ga0105247_10008803 | 3300009101 | Bacteria | 6152 |
| 200 | Ga0105247_10194054 | 3300009101 | Bacteria | 1361 |
| 201 | Ga0105247_10255359 | 3300009101 | Bacteria | 1200 |
| 202 | Ga0114129_10420482 | 3300009147 | Bacteria | 1758 |
| 203 | Ga0105243_10354044 | 3300009148 | Bacteria | 1349 |
| 204 | Ga0105243_10402347 | 3300009148 | Bacteria | 1272 |
| 205 | Ga0105243_10581085 | 3300009148 | Bacteria | 1075 |
| 206 | Ga0105243_11223449 | 3300009148 | Bacteria | 765 |
| 207 | Ga0105243_11644719 | 3300009148 | Bacteria | 670 |
| 208 | Ga0105241_11337337 | 3300009174 | Bacteria | 684 |
| 209 | Ga0105242_10127123 | 3300009176 | Bacteria | 2195 |
| 210 | Ga0105248_10007744 | 3300009177 | Bacteria | 11795 |
| 211 | Ga0105248_10011201 | 3300009177 | Bacteria | 9891 |
| 212 | Ga0105248_10039465 | 3300009177 | Bacteria | 5288 |
| 213 | Ga0105248_10949390 | 3300009177 | Bacteria | 971 |
| 214 | Ga0105237_10119726 | 3300009545 | Bacteria | 2626 |
| 215 | Ga0105238_10005670 | 3300009551 | Bacteria | 12341 |
| 216 | Ga0105238_10251431 | 3300009551 | Bacteria | 1746 |
| 217 | Ga0105238_10271210 | 3300009551 | Bacteria | 1677 |
| 218 | Ga0105238_10362555 | 3300009551 | Bacteria | 1439 |
| 219 | Ga0105238_10924465 | 3300009551 | Bacteria | 891 |
| 220 | Ga0105238_11495292 | 3300009551 | Bacteria | 704 |
| 221 | Ga0105249_10237224 | 3300009553 | Bacteria | 1801 |
| 222 | Ga0105249_10274242 | 3300009553 | Bacteria | 1681 |
| 223 | Ga0105239_10039057 | 3300010375 | Bacteria | 5200 |
| 224 | Ga0105239_10048870 | 3300010375 | Bacteria | 4637 |
| 225 | Ga0105239_10734712 | 3300010375 | Bacteria | 1129 |
| 226 | Ga0105246_10508993 | 3300011119 | Bacteria | 1024 |
| 227 | Ga0157374_10007080 | 3300013296 | Bacteria | 9550 |
| 228 | Ga0157374_10734357 | 3300013296 | Bacteria | 1001 |
| 229 | Ga0157378_10201301 | 3300013297 | Bacteria | 1883 |
| 230 | Ga0157378_10260073 | 3300013297 | Bacteria | 1665 |
| 231 | Ga0157378_12066608 | 3300013297 | Bacteria | 620 |
| 232 | Ga0163162_10252002 | 3300013306 | Bacteria | 1897 |
| 233 | Ga0163162_10306264 | 3300013306 | Bacteria | 1721 |
| 234 | Ga0163162_10330317 | 3300013306 | Bacteria | 1657 |
| 235 | Ga0163162_10516462 | 3300013306 | Bacteria | 1324 |
| 236 | Ga0157375_10287452 | 3300013308 | Bacteria | 1807 |
| 237 | Ga0157375_10577157 | 3300013308 | Bacteria | 1285 |
| 238 | Ga0157375_10697849 | 3300013308 | Bacteria | 1169 |
| 239 | Ga0157375_11153722 | 3300013308 | Bacteria | 908 |
| 240 | Ga0163163_10102447 | 3300014325 | Bacteria | 2886 |
| 241 | Ga0163163_10108633 | 3300014325 | Bacteria | 2801 |
| 242 | Ga0163163_10252117 | 3300014325 | Bacteria | 1815 |
| 243 | Ga0157380_10035872 | 3300014326 | Bacteria | 3833 |
| 244 | Ga0157380_10606653 | 3300014326 | Bacteria | 1084 |
| 245 | Ga0157377_10089245 | 3300014745 | Bacteria | 1817 |
| 246 | Ga0157379_10176296 | 3300014968 | Bacteria | 1930 |
| 247 | Ga0157379_10184181 | 3300014968 | Bacteria | 1887 |
| 248 | Ga0157379_10201931 | 3300014968 | Bacteria | 1798 |
| 249 | Ga0157379_10550402 | 3300014968 | Bacteria | 1073 |
| 250 | Ga0157376_10440557 | 3300014969 | Bacteria | 1269 |
| 251 | Ga0157376_10487458 | 3300014969 | Bacteria | 1209 |
| 252 | Ga0163161_10042832 | 3300017792 | Bacteria | 3258 |
| 253 | Ga0213874_10009393 | 3300021377 | Bacteria | 2417 |
| 254 | Ga0213876_10003083 | 3300021384 | Bacteria | 9650 |
| 255 | Ga0209233_1011287 | 3300025261 | Bacteria | 2636 |
| 256 | Ga0209564_1002366 | 3300025295 | Bacteria | 15161 |
| 257 | Ga0209758_1006483 | 3300025297 | Bacteria | 8380 |
| 258 | Ga0209758_1009323 | 3300025297 | Bacteria | 6127 |
| 259 | Ga0209758_1013025 | 3300025297 | Bacteria | 4582 |
| 260 | Ga0209758_1026010 | 3300025297 | Bacteria | 2549 |
| 261 | Ga0207426_1000430 | 3300025302 | Bacteria | 68540 |
| 262 | Ga0207426_1000830 | 3300025302 | Bacteria | 32990 |
| 263 | Ga0207426_1038146 | 3300025302 | Bacteria | 1515 |
| 264 | Ga0209257_1064800 | 3300025304 | Bacteria | 981 |
| 265 | Ga0207697_10411676 | 3300025315 | Bacteria | 600 |
| 266 | Ga0207656_10062344 | 3300025321 | Bacteria | 1639 |
| 267 | Ga0207696_1014062 | 3300025711 | Bacteria | 2759 |
| 268 | Ga0207653_10184911 | 3300025885 | Bacteria | 781 |
| 269 | Ga0207692_10004082 | 3300025898 | Bacteria | 5757 |
| 270 | Ga0207710_10020363 | 3300025900 | Bacteria | 2836 |
| 271 | Ga0207688_10032387 | 3300025901 | Bacteria | 2889 |
| 272 | Ga0207688_10090051 | 3300025901 | Bacteria | 1761 |
| 273 | Ga0207647_10153541 | 3300025904 | Bacteria | 1345 |
| 274 | Ga0207685_10006127 | 3300025905 | Bacteria | 3247 |
| 275 | Ga0207685_10162612 | 3300025905 | Bacteria | 1020 |
| 276 | Ga0207699_10004153 | 3300025906 | Bacteria | 6931 |
| 277 | Ga0207699_10004799 | 3300025906 | Bacteria | 6469 |
| 278 | Ga0207643_10030909 | 3300025908 | Bacteria | 2984 |
| 279 | Ga0207705_10337885 | 3300025909 | Bacteria | 1159 |
| 280 | Ga0207684_10195736 | 3300025910 | Bacteria | 1744 |
| 281 | Ga0207684_10252085 | 3300025910 | Bacteria | 1523 |
| 282 | Ga0207654_10062790 | 3300025911 | Bacteria | 2178 |
| 283 | Ga0207654_10480245 | 3300025911 | Bacteria | 875 |
| 284 | Ga0207654_10614650 | 3300025911 | Bacteria | 776 |
| 285 | Ga0207707_10028737 | 3300025912 | Bacteria | 4859 |
| 286 | Ga0207671_10040447 | 3300025914 | Bacteria | 3452 |
| 287 | Ga0207671_10595949 | 3300025914 | Bacteria | 881 |
| 288 | Ga0207693_10004353 | 3300025915 | Bacteria | 11975 |
| 289 | Ga0207693_10012394 | 3300025915 | Bacteria | 6888 |
| 290 | Ga0207693_10067083 | 3300025915 | Bacteria | 2809 |
| 291 | Ga0207663_10004725 | 3300025916 | Bacteria | 6806 |
| 292 | Ga0207649_10170186 | 3300025920 | Bacteria | 1517 |
| 293 | Ga0207649_10186483 | 3300025920 | Bacteria | 1456 |
| 294 | Ga0207652_10191251 | 3300025921 | Bacteria | 1841 |
| 295 | Ga0207652_10908066 | 3300025921 | Bacteria | 778 |
| 296 | Ga0207694_10075049 | 3300025924 | Bacteria | 2647 |
| 297 | Ga0207694_10407468 | 3300025924 | Bacteria | 1131 |
| 298 | Ga0207694_11117301 | 3300025924 | Bacteria | 667 |
| 299 | Ga0207659_10132188 | 3300025926 | Bacteria | 1928 |
| 300 | Ga0207659_10570478 | 3300025926 | Bacteria | 963 |
| 301 | Ga0207687_10024837 | 3300025927 | Bacteria | 4006 |
| 302 | Ga0207687_10025800 | 3300025927 | Bacteria | 3933 |
| 303 | Ga0207687_10585756 | 3300025927 | Bacteria | 939 |
| 304 | Ga0207687_10971523 | 3300025927 | Bacteria | 728 |
| 305 | Ga0207700_10009417 | 3300025928 | Bacteria | 6099 |
| 306 | Ga0207700_10207551 | 3300025928 | Bacteria | 1654 |
| 307 | Ga0207700_10349002 | 3300025928 | Bacteria | 1288 |
| 308 | Ga0207664_10489638 | 3300025929 | Bacteria | 1100 |
| 309 | Ga0207644_10060170 | 3300025931 | Bacteria | 2748 |
| 310 | Ga0207644_10356789 | 3300025931 | Bacteria | 1188 |
| 311 | Ga0207690_10089665 | 3300025932 | Bacteria | 2169 |
| 312 | Ga0207690_10160650 | 3300025932 | Bacteria | 1675 |
| 313 | Ga0207706_10027761 | 3300025933 | Bacteria | 5059 |
| 314 | Ga0207706_10329815 | 3300025933 | Bacteria | 1328 |
| 315 | Ga0207706_10439200 | 3300025933 | Bacteria | 1130 |
| 316 | Ga0207706_10756706 | 3300025933 | Bacteria | 828 |
| 317 | Ga0207686_10836803 | 3300025934 | Bacteria | 739 |
| 318 | Ga0207709_10029974 | 3300025935 | Bacteria | 3161 |
| 319 | Ga0207709_10118109 | 3300025935 | Bacteria | 1786 |
| 320 | Ga0207709_10226252 | 3300025935 | Bacteria | 1352 |
| 321 | Ga0207709_10236466 | 3300025935 | Bacteria | 1326 |
| 322 | Ga0207709_10563603 | 3300025935 | Bacteria | 897 |
| 323 | Ga0207669_10058495 | 3300025937 | Bacteria | 2352 |
| 324 | Ga0207669_10666742 | 3300025937 | Bacteria | 852 |
| 325 | Ga0207704_10076226 | 3300025938 | Bacteria | 2148 |
| 326 | Ga0207704_10190904 | 3300025938 | Bacteria | 1490 |
| 327 | Ga0207665_10175766 | 3300025939 | Bacteria | 1548 |
| 328 | Ga0207691_10317465 | 3300025940 | Bacteria | 1336 |
| 329 | Ga0207711_10018890 | 3300025941 | Bacteria | 5732 |
| 330 | Ga0207711_10055610 | 3300025941 | Bacteria | 3398 |
| 331 | Ga0207711_10122866 | 3300025941 | Bacteria | 2319 |
| 332 | Ga0207711_10201003 | 3300025941 | Bacteria | 1818 |
| 333 | Ga0207711_10879889 | 3300025941 | Bacteria | 833 |
| 334 | Ga0207689_10003039 | 3300025942 | Bacteria | 15459 |
| 335 | Ga0207689_10197151 | 3300025942 | Bacteria | 1662 |
| 336 | Ga0207689_10367921 | 3300025942 | Bacteria | 1196 |
| 337 | Ga0207661_10051455 | 3300025944 | Bacteria | 3287 |
| 338 | Ga0207679_10418985 | 3300025945 | Bacteria | 1181 |
| 339 | Ga0207651_10107402 | 3300025960 | Bacteria | 2086 |
| 340 | Ga0207712_10062247 | 3300025961 | Bacteria | 2652 |
| 341 | Ga0207712_11041460 | 3300025961 | Bacteria | 727 |
| 342 | Ga0207712_11281943 | 3300025961 | Bacteria | 655 |
| 343 | Ga0207668_10025281 | 3300025972 | Bacteria | 3841 |
| 344 | Ga0207668_10189802 | 3300025972 | Bacteria | 1627 |
| 345 | Ga0207668_11241655 | 3300025972 | Bacteria | 670 |
| 346 | Ga0207668_11251327 | 3300025972 | Bacteria | 667 |
| 347 | Ga0207658_10149805 | 3300025986 | Bacteria | 1899 |
| 348 | Ga0207677_10010242 | 3300026023 | Bacteria | 5300 |
| 349 | Ga0207677_11497876 | 3300026023 | Unclassified | 623 |
| 350 | Ga0207703_10095396 | 3300026035 | Bacteria | 2509 |
| 351 | Ga0207703_10453769 | 3300026035 | Bacteria | 1198 |
| 352 | Ga0207703_10512737 | 3300026035 | Bacteria | 1127 |
| 353 | Ga0207639_10098654 | 3300026041 | Bacteria | 2355 |
| 354 | Ga0207639_10409835 | 3300026041 | Bacteria | 1223 |
| 355 | Ga0207678_10014071 | 3300026067 | Bacteria | 7036 |
| 356 | Ga0207678_10042599 | 3300026067 | Bacteria | 3932 |
| 357 | Ga0207678_11521927 | 3300026067 | Bacteria | 590 |
| 358 | Ga0207708_10051349 | 3300026075 | Bacteria | 3138 |
| 359 | Ga0207708_10767841 | 3300026075 | Bacteria | 828 |
| 360 | Ga0207702_10948323 | 3300026078 | Bacteria | 853 |
| 361 | Ga0207641_10081176 | 3300026088 | Bacteria | 2816 |
| 362 | Ga0207641_10333328 | 3300026088 | Bacteria | 1442 |
| 363 | Ga0207641_11409131 | 3300026088 | Unclassified | 698 |
| 364 | Ga0207648_10185634 | 3300026089 | Bacteria | 1842 |
| 365 | Ga0207648_11016727 | 3300026089 | Bacteria | 776 |
| 366 | Ga0207648_11232992 | 3300026089 | Unclassified | 703 |
| 367 | Ga0207676_10048066 | 3300026095 | Bacteria | 3310 |
| 368 | Ga0207676_10524426 | 3300026095 | Bacteria | 1128 |
| 369 | Ga0207674_10090218 | 3300026116 | Bacteria | 3056 |
| 370 | Ga0207674_10743220 | 3300026116 | Bacteria | 947 |
| 371 | Ga0207675_100019856 | 3300026118 | Bacteria | 6271 |
| 372 | Ga0207675_100149033 | 3300026118 | Bacteria | 2226 |
| 373 | Ga0207675_100283907 | 3300026118 | Bacteria | 1609 |
| 374 | Ga0207675_100360595 | 3300026118 | Bacteria | 1426 |
| 375 | Ga0207683_10038321 | 3300026121 | Bacteria | 4177 |
| 376 | Ga0207683_10080281 | 3300026121 | Bacteria | 2893 |
| 377 | Ga0207683_11250932 | 3300026121 | Bacteria | 687 |
| 378 | Ga0207698_10265673 | 3300026142 | Bacteria | 1579 |
| 379 | Ga0209179_1023303 | 3300027512 | Bacteria | 1221 |
| 380 | Ga0209813_10037465 | 3300027866 | Bacteria | 1461 |
| 381 | Ga0209813_10039924 | 3300027866 | Bacteria | 1424 |
| 382 | Ga0207428_10142989 | 3300027907 | Bacteria | 1825 |
| 383 | Ga0207428_10175944 | 3300027907 | Bacteria | 1619 |
| 384 | Ga0268266_10003152 | 3300028379 | Bacteria | 16738 |
| 385 | Ga0268266_10003898 | 3300028379 | Bacteria | 14509 |
| 386 | Ga0268266_10241555 | 3300028379 | Bacteria | 1667 |
| 387 | Ga0268266_10378699 | 3300028379 | Bacteria | 1334 |
| 388 | Ga0268266_10456467 | 3300028379 | Bacteria | 1215 |
| 389 | Ga0268265_10029614 | 3300028380 | Bacteria | 3932 |
| 390 | Ga0268265_10064367 | 3300028380 | Bacteria | 2824 |
| 391 | Ga0268265_10204263 | 3300028380 | Bacteria | 1716 |
| 392 | Ga0268265_10961234 | 3300028380 | Bacteria | 842 |
| 393 | Ga0268265_11736028 | 3300028380 | Bacteria | 630 |
| 394 | Ga0268264_10181238 | 3300028381 | Bacteria | 1913 |
| 395 | Ga0268264_10184418 | 3300028381 | Bacteria | 1898 |
| 396 | Ga0265762_1109151 | 3300030760 | Bacteria | 622 |
| 397 | Ga0265330_10067366 | 3300031235 | Bacteria | 1551 |
| 398 | Ga0265330_10117267 | 3300031235 | Bacteria | 1135 |
| 399 | Ga0265332_10037508 | 3300031238 | Bacteria | 2102 |
| 400 | Ga0265332_10094454 | 3300031238 | Bacteria | 1263 |
| 401 | Ga0265328_10027277 | 3300031239 | Bacteria | 2142 |
| 402 | Ga0265325_10000126 | 3300031241 | Bacteria | 52410 |
| 403 | Ga0265325_10007395 | 3300031241 | Bacteria | 6576 |
| 404 | Ga0265339_10088248 | 3300031249 | Bacteria | 1629 |
| 405 | Ga0265331_10026787 | 3300031250 | Bacteria | 2895 |
| 406 | Ga0265331_10028361 | 3300031250 | Bacteria | 2800 |
| 407 | Ga0265316_10309092 | 3300031344 | Bacteria | 1150 |
| 408 | Ga0307509_10443893 | 3300031507 | Bacteria | 993 |
| 409 | Ga0307408_100615471 | 3300031548 | Bacteria | 967 |
| 410 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 411 | Ga0265314_10054870 | 3300031711 | Bacteria | 2755 |
| 412 | Ga0265314_10095948 | 3300031711 | Bacteria | 1919 |
| 413 | Ga0265342_10000931 | 3300031712 | Bacteria | 29084 |
| 414 | Ga0307405_10017527 | 3300031731 | Bacteria | 3932 |
| 415 | Ga0307405_10156756 | 3300031731 | Bacteria | 1608 |
| 416 | Ga0307406_10168624 | 3300031901 | Bacteria | 1582 |
| 417 | Ga0307407_10681111 | 3300031903 | Bacteria | 773 |
| 418 | Ga0307416_100413224 | 3300032002 | Bacteria | 1391 |
| 419 | Ga0307416_101430000 | 3300032002 | Bacteria | 797 |
| 420 | Ga0307416_101455018 | 3300032002 | Bacteria | 791 |
| 421 | Ga0307414_10708662 | 3300032004 | Bacteria | 912 |
| 422 | Ga0307411_10073467 | 3300032005 | Bacteria | 2327 |
| 423 | Ga0307411_10322343 | 3300032005 | Bacteria | 1248 |
| 424 | Ga0307510_10027051 | 3300033180 | Bacteria | 6580 |
| 425 | Ga0307510_10309560 | 3300033180 | Bacteria | 1039 |
| 426 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 427 | Ga0316215_1010673 | 3300033544 | Bacteria | 908 |
| 428 | Ga0373930_0162344 | 3300034816 | Bacteria | 566 |
| 429 | Ga0373929_0027260 | 3300035085 | Bacteria | 1199 |
| 430 | Ga0373934_0106398 | 3300035086 | Bacteria | 1136 |
| 431 | Ga0373944_0288450 | 3300035089 | Bacteria | 614 |
| 432 | Ga0373952_0027347 | 3300035092 | Bacteria | 1245 |
| 433 | Ga0373936_0164665 | 3300035113 | Bacteria | 967 |
| 434 | Ga0373945_0190380 | 3300035116 | Bacteria | 848 |
| 435 | Ga0373956_0074461 | 3300035119 | Bacteria | 1552 |
| 436 | Ga0373957_0119288 | 3300035120 | Bacteria | 1067 |
| 437 | Ga0373955_0175089 | 3300035172 | Bacteria | 1271 |
| 438 | Ga0373924_0369016 | 3300035410 | Bacteria | 640 |
| 439 | Ga0373931_0015543 | 3300035691 | Bacteria | 3735 |
| 440 | Ga0373927_1046129 | 3300035695 | Bacteria | 538 |
| 441 | Ga0373933_0052338 | 3300035724 | Bacteria | 2443 |
| 442 | Ga0373937_0443008 | 3300036401 | Bacteria | 1233 |
| 443 | Ga0373937_1029415 | 3300036401 | Bacteria | 772 |
| 444 | Ga0373925_0087733 | 3300037068 | Bacteria | 2375 |
| 445 | Ga0395898_0642089 | 3300037466 | Bacteria | 1004 |
| 446 | Ga0436365_0298555 | 3300039437 | Bacteria | 4051 |
| 447 | Ga0436365_1134510 | 3300039437 | Bacteria | 2102 |
| 448 | Ga0436365_1933584 | 3300039437 | Bacteria | 2150 |
| 449 | Ga0436360_0696571 | 3300039438 | Bacteria | 1563 |
| 450 | Ga0436361_0805688 | 3300039447 | Bacteria | 853 |
| 451 | Ga0436363_0092706 | 3300039450 | Bacteria | 3769 |
| 452 | Ga0436363_0338950 | 3300039450 | Bacteria | 822 |
| 453 | Ga0451797_0248301 | 3300041453 | Bacteria | 541 |
| 454 | Ga0451798_1121007 | 3300041458 | Bacteria | 935 |
| 455 | Ga0451800_0827803 | 3300041459 | Bacteria | 1072 |
| 456 | Ga0451802_0400802 | 3300041460 | Bacteria | 803 |
| 457 | Ga0451802_1380398 | 3300041460 | Bacteria | 555 |
| 458 | Ga0451802_1497184 | 3300041460 | Bacteria | 1748 |
| 459 | Ga0451807_2173839 | 3300041486 | Bacteria | 538 |
| 460 | Ga0451807_2533860 | 3300041486 | Bacteria | 527 |
| 461 | Ga0451839_0368182 | 3300041496 | Bacteria | 523 |
| 462 | Ga0451839_0711916 | 3300041496 | Bacteria | 535 |
| 463 | Ga0451841_0075291 | 3300041498 | Bacteria | 683 |
| 464 | Ga0451851_0303179 | 3300041507 | Bacteria | 535 |
| 465 | Ga0451843_0395955 | 3300041509 | Bacteria | 612 |
| 466 | Ga0451843_0526573 | 3300041509 | Bacteria | 830 |
| 467 | Ga0451843_0754939 | 3300041509 | Bacteria | 652 |
| 468 | Ga0439458_0057672 | 3300042157 | Bacteria | 966 |
| 469 | Ga0439459_0148240 | 3300042438 | Bacteria | 612 |
| 470 | Ga0466969_0182939 | 3300044656 | Bacteria | 959 |
| 471 | Ga0466966_0036027 | 3300044684 | Bacteria | 3196 |
| 472 | Ga0466963_0178086 | 3300044694 | Bacteria | 1484 |
| 473 | Ga0466970_0136994 | 3300044765 | Bacteria | 1347 |
| 474 | Ga0466970_0257666 | 3300044765 | Bacteria | 978 |
| 475 | Ga0466957_0088986 | 3300044842 | Bacteria | 1932 |
| 476 | Ga0495592_0125386 | 3300046454 | Bacteria | 1802 |
| 477 | Ga0495603_0016800 | 3300046455 | Bacteria | 4428 |
| 478 | Ga0495603_0065464 | 3300046455 | Bacteria | 2142 |
| 479 | Ga0495603_0142030 | 3300046455 | Bacteria | 1396 |
| 480 | Ga0495638_0007000 | 3300046460 | Bacteria | 8134 |
| 481 | Ga0495638_0362084 | 3300046460 | Bacteria | 762 |
| 482 | Ga0495651_0019229 | 3300046462 | Bacteria | 5293 |
| 483 | Ga0495651_0029177 | 3300046462 | Bacteria | 4302 |
| 484 | Ga0495651_0336986 | 3300046462 | Bacteria | 1000 |
| 485 | Ga0495653_0025373 | 3300046463 | Bacteria | 4766 |
| 486 | Ga0495650_0048414 | 3300046471 | Bacteria | 1772 |
| 487 | Ga0495580_0346465 | 3300046472 | Bacteria | 1007 |
| 488 | Ga0495605_0130315 | 3300046474 | Bacteria | 1135 |
| 489 | Ga0495639_0042405 | 3300046475 | Bacteria | 2052 |
| 490 | Ga0495639_0185957 | 3300046475 | Bacteria | 1013 |
| 491 | Ga0495664_0039984 | 3300046477 | Bacteria | 2772 |
| 492 | Ga0495584_0136314 | 3300046491 | Bacteria | 1246 |
| 493 | Ga0495584_0299199 | 3300046491 | Bacteria | 817 |
| 494 | Ga0495585_0092838 | 3300046492 | Bacteria | 1624 |
| 495 | Ga0495594_0195703 | 3300046499 | Bacteria | 1152 |
| 496 | Ga0495606_0368463 | 3300046507 | Bacteria | 757 |
| 497 | Ga0495608_0032554 | 3300046511 | Bacteria | 3524 |
| 498 | Ga0495608_0153699 | 3300046511 | Bacteria | 1465 |
| 499 | Ga0495616_0438066 | 3300046513 | Bacteria | 531 |
| 500 | Ga0495618_0065480 | 3300046514 | Bacteria | 2310 |
| 501 | Ga0495618_0350108 | 3300046514 | Bacteria | 910 |
| 502 | Ga0495628_0039493 | 3300046516 | Bacteria | 3775 |
| 503 | Ga0495628_0319441 | 3300046516 | Bacteria | 1146 |
| 504 | Ga0495630_0252705 | 3300046517 | Bacteria | 1347 |
| 505 | Ga0495631_0089943 | 3300046518 | Bacteria | 1322 |
| 506 | Ga0495631_0107216 | 3300046518 | Bacteria | 1201 |
| 507 | Ga0495631_0175603 | 3300046518 | Bacteria | 918 |
| 508 | Ga0495632_0067050 | 3300046519 | Bacteria | 1731 |
| 509 | Ga0495632_0204527 | 3300046519 | Bacteria | 898 |
| 510 | Ga0495637_0251748 | 3300046520 | Bacteria | 636 |
| 511 | Ga0495644_0024574 | 3300046523 | Bacteria | 2292 |
| 512 | Ga0495644_0029150 | 3300046523 | Bacteria | 2086 |
| 513 | Ga0495648_0118198 | 3300046524 | Bacteria | 1430 |
| 514 | Ga0495648_0176005 | 3300046524 | Bacteria | 1092 |
| 515 | Ga0495663_0088904 | 3300046525 | Bacteria | 1005 |
| 516 | Ga0495652_0057419 | 3300046529 | Bacteria | 3300 |
| 517 | Ga0495652_0094228 | 3300046529 | Bacteria | 2442 |
| 518 | Ga0495654_0438224 | 3300046530 | Bacteria | 515 |
| 519 | Ga0495665_0182574 | 3300046531 | Bacteria | 1090 |
| 520 | Ga0495640_0101039 | 3300046533 | Bacteria | 1893 |
| 521 | Ga0495587_0108070 | 3300046536 | Bacteria | 1599 |
| 522 | Ga0495598_0018355 | 3300046537 | Bacteria | 1818 |
| 523 | Ga0495598_0044218 | 3300046537 | Bacteria | 1315 |
| 524 | Ga0495609_0465892 | 3300046538 | Bacteria | 501 |
| 525 | Ga0495621_0012473 | 3300046539 | Bacteria | 2650 |
| 526 | Ga0495621_0059881 | 3300046539 | Bacteria | 1380 |
| 527 | Ga0495645_0008376 | 3300046543 | Bacteria | 7220 |
| 528 | Ga0495645_0184596 | 3300046543 | Bacteria | 1426 |
| 529 | Ga0495622_0055584 | 3300046557 | Bacteria | 1836 |
| 530 | Ga0495633_0069790 | 3300046558 | Bacteria | 1640 |
| 531 | Ga0495633_0170999 | 3300046558 | Bacteria | 1001 |
| 532 | Ga0495667_0086541 | 3300046559 | Bacteria | 2032 |
| 533 | Ga0495667_0092145 | 3300046559 | Bacteria | 1962 |
| 534 | Ga0495667_0280200 | 3300046559 | Bacteria | 1058 |
| 535 | Ga0495656_0271742 | 3300046615 | Bacteria | 861 |
| 536 | Ga0495668_0108216 | 3300046616 | Bacteria | 1520 |
| 537 | Ga0495634_0109596 | 3300046642 | Bacteria | 1776 |
| 538 | Ga0495611_0152441 | 3300046648 | Bacteria | 1079 |
| 539 | Ga0495635_0042269 | 3300046663 | Bacteria | 3147 |
| 540 | Ga0495635_0174129 | 3300046663 | Bacteria | 1463 |
| 541 | Ga0495659_0016046 | 3300046664 | Bacteria | 2467 |
| 542 | Ga0495661_0174702 | 3300046665 | Bacteria | 1143 |
| 543 | Ga0495588_0014003 | 3300046674 | Bacteria | 3832 |
| 544 | Ga0495657_0004266 | 3300046675 | Bacteria | 11432 |
| 545 | Ga0495657_0129035 | 3300046675 | Bacteria | 1585 |
| 546 | Ga0495657_0583715 | 3300046675 | Bacteria | 647 |
| 547 | Ga0495599_0055253 | 3300046678 | Bacteria | 2487 |
| 548 | Ga0495599_0254774 | 3300046678 | Bacteria | 1067 |
| 549 | Ga0495623_0029788 | 3300046679 | Bacteria | 3512 |
| 550 | Ga0495623_0041617 | 3300046679 | Bacteria | 2929 |
| 551 | Ga0495646_0069844 | 3300046680 | Bacteria | 2071 |
| 552 | Ga0495646_0085685 | 3300046680 | Bacteria | 1828 |
| 553 | Ga0495658_0633221 | 3300046683 | Bacteria | 685 |
| 554 | Ga0495669_0068093 | 3300046684 | Bacteria | 1619 |
| 555 | Ga0495669_0228811 | 3300046684 | Bacteria | 892 |
| 556 | Ga0495613_0215839 | 3300046689 | Bacteria | 1348 |
| 557 | Ga0495613_0510458 | 3300046689 | Bacteria | 808 |
| 558 | Ga0495613_0618919 | 3300046689 | Bacteria | 719 |
| 559 | Ga0495624_0695142 | 3300046690 | Bacteria | 604 |
| 560 | Ga0495670_0072830 | 3300046691 | Bacteria | 1741 |
| 561 | Ga0495671_0162833 | 3300046692 | Bacteria | 1085 |
| 562 | Ga0495671_0219145 | 3300046692 | Bacteria | 921 |
| 563 | Ga0495649_0381518 | 3300046694 | Bacteria | 709 |
| 564 | Ga0495589_0153165 | 3300046794 | Bacteria | 1100 |
| 565 | Ga0495589_0245218 | 3300046794 | Bacteria | 838 |
| 566 | Ga0495600_0043783 | 3300046809 | Bacteria | 2919 |
| 567 | Ga0495600_0106514 | 3300046809 | Bacteria | 1826 |
| 568 | Ga0495581_0016977 | 3300047315 | Bacteria | 4230 |
| 569 | Ga0495581_0377692 | 3300047315 | Bacteria | 827 |
| 570 | Ga0495604_0002177 | 3300047317 | Bacteria | 15721 |
| 571 | Ga0495604_0103953 | 3300047317 | Bacteria | 2082 |
| 572 | Ga0495636_0087796 | 3300047318 | Bacteria | 1347 |
| 573 | Ga0495636_0686768 | 3300047318 | Bacteria | 505 |
| 574 | Ga0495674_0043681 | 3300047319 | Bacteria | 3988 |
| 575 | Ga0495674_0324562 | 3300047319 | Bacteria | 1253 |
| 576 | Ga0495676_0161618 | 3300047321 | Bacteria | 1584 |
| 577 | Ga0495676_0573959 | 3300047321 | Bacteria | 736 |
| 578 | Ga0495680_0019208 | 3300047322 | Bacteria | 5780 |
| 579 | Ga0495680_0127776 | 3300047322 | Bacteria | 1870 |
| 580 | Ga0495675_0024121 | 3300047444 | Bacteria | 3877 |
| 581 | Ga0495675_0036032 | 3300047444 | Bacteria | 3157 |
| 582 | Ga0495677_0118910 | 3300047445 | Bacteria | 1007 |
| 583 | Ga0495677_0189766 | 3300047445 | Bacteria | 798 |
| 584 | Ga0495684_0036990 | 3300047471 | Bacteria | 3742 |
| 585 | Ga0495684_0235673 | 3300047471 | Bacteria | 1337 |
| 586 | Ga0495686_0083913 | 3300047472 | Bacteria | 1942 |
| 587 | Ga0495686_0125776 | 3300047472 | Bacteria | 1524 |
| 588 | Ga0495686_0183592 | 3300047472 | Bacteria | 1211 |
| 589 | Ga0495686_0238229 | 3300047472 | Bacteria | 1027 |
| 590 | Ga0495686_0278801 | 3300047472 | Bacteria | 930 |
| 591 | Ga0495593_0183483 | 3300047673 | Bacteria | 1054 |
| 592 | Ga0495593_0355533 | 3300047673 | Bacteria | 732 |
| 593 | Ga0495602_0250712 | 3300048088 | Bacteria | 1319 |
| 594 | Ga0495602_0775254 | 3300048088 | Bacteria | 646 |
| 595 | Ga0495615_0071328 | 3300048090 | Bacteria | 937 |
| 596 | Ga0495615_0128348 | 3300048090 | Bacteria | 739 |
| 597 | Ga0496100_0205347 | 3300048903 | Bacteria | 1438 |
| 598 | Ga0496100_0788242 | 3300048903 | Bacteria | 744 |
| 599 | Ga0496100_0997064 | 3300048903 | Bacteria | 659 |
| 600 | Ga0496100_1235997 | 3300048903 | Bacteria | 589 |
| 601 | Ga0496101_0216216 | 3300048904 | Bacteria | 1486 |
| 602 | Ga0496101_0222684 | 3300048904 | Bacteria | 1464 |
| 603 | Ga0496101_0726728 | 3300048904 | Bacteria | 784 |
| 604 | Ga0496101_1222100 | 3300048904 | Bacteria | 589 |
| 605 | Ga0496102_0040636 | 3300048905 | Bacteria | 4208 |
| 606 | Ga0496102_0208150 | 3300048905 | Bacteria | 1844 |
| 607 | Ga0496102_0741091 | 3300048905 | Bacteria | 905 |
| 608 | Ga0496103_0059253 | 3300048906 | Bacteria | 2379 |
| 609 | Ga0496103_0280356 | 3300048906 | Bacteria | 1072 |
| 610 | Ga0496103_0394820 | 3300048906 | Bacteria | 889 |
| 611 | Ga0496103_0895903 | 3300048906 | Bacteria | 556 |
| 612 | Ga0496104_0045622 | 3300048907 | Bacteria | 4123 |
| 613 | Ga0496104_0470140 | 3300048907 | Bacteria | 1169 |
| 614 | Ga0496105_0034113 | 3300048908 | Bacteria | 4184 |
| 615 | Ga0496105_1185821 | 3300048908 | Bacteria | 563 |
| 616 | Ga0496107_0681932 | 3300048910 | Bacteria | 756 |
| 617 | Ga0496107_0819452 | 3300048910 | Bacteria | 681 |
| 618 | Ga0496107_1045882 | 3300048910 | Bacteria | 591 |
| 619 | Ga0496108_0287542 | 3300048911 | Bacteria | 1431 |
| 620 | Ga0496109_0045013 | 3300048912 | Bacteria | 4005 |
| 621 | Ga0496109_0074066 | 3300048912 | Bacteria | 3130 |
| 622 | Ga0496110_0057620 | 3300048913 | Bacteria | 3420 |
| 623 | Ga0496110_0113287 | 3300048913 | Bacteria | 2439 |
| 624 | Ga0496110_0162864 | 3300048913 | Bacteria | 2022 |
| 625 | Ga0496110_0263391 | 3300048913 | Bacteria | 1569 |
| 626 | Ga0496110_1136196 | 3300048913 | Bacteria | 690 |
| 627 | Ga0496111_0039606 | 3300048914 | Bacteria | 3380 |
| 628 | Ga0496111_0420607 | 3300048914 | Bacteria | 987 |
| 629 | Ga0496111_0619433 | 3300048914 | Bacteria | 791 |
| 630 | Ga0496111_0918155 | 3300048914 | Bacteria | 630 |
| 631 | Ga0496112_0070815 | 3300048915 | Bacteria | 3446 |
| 632 | Ga0496112_0145529 | 3300048915 | Bacteria | 2338 |
| 633 | Ga0496112_0150309 | 3300048915 | Bacteria | 2296 |
| 634 | Ga0496112_0805286 | 3300048915 | Bacteria | 864 |
| 635 | Ga0496113_0050080 | 3300048916 | Bacteria | 3113 |
| 636 | Ga0496113_0380833 | 3300048916 | Bacteria | 1132 |
| 637 | Ga0496113_0462183 | 3300048916 | Bacteria | 1020 |
| 638 | Ga0496114_0023467 | 3300048917 | Bacteria | 5035 |
| 639 | Ga0496114_0057971 | 3300048917 | Bacteria | 3233 |
| 640 | Ga0496114_0324909 | 3300048917 | Bacteria | 1360 |
| 641 | Ga0496114_1456792 | 3300048917 | Bacteria | 572 |
| 642 | Ga0496115_0294278 | 3300048918 | Bacteria | 1331 |
| 643 | Ga0496115_0605571 | 3300048918 | Bacteria | 871 |
| 644 | Ga0496117_0168062 | 3300048920 | Bacteria | 1276 |
| 645 | Ga0496117_0375407 | 3300048920 | Bacteria | 726 |
| 646 | Ga0496118_0123062 | 3300048921 | Bacteria | 1685 |
| 647 | Ga0496118_0143537 | 3300048921 | Bacteria | 1508 |
| 648 | Ga0496119_0113969 | 3300048922 | Bacteria | 1496 |
| 649 | Ga0496119_0118063 | 3300048922 | Bacteria | 1462 |
| 650 | Ga0496120_0134679 | 3300048923 | Bacteria | 1261 |
| 651 | Ga0496121_0013527 | 3300048924 | Bacteria | 8755 |
| 652 | Ga0496121_0037099 | 3300048924 | Bacteria | 4333 |
| 653 | Ga0496121_0072545 | 3300048924 | Bacteria | 2763 |
| 654 | Ga0496121_0076964 | 3300048924 | Bacteria | 2659 |
| 655 | Ga0496121_0099080 | 3300048924 | Bacteria | 2253 |
| 656 | Ga0496121_0118170 | 3300048924 | Bacteria | 2007 |
| 657 | Ga0496121_0196370 | 3300048924 | Bacteria | 1442 |
| 658 | Ga0496122_0044396 | 3300048925 | Bacteria | 3469 |
| 659 | Ga0496123_0130783 | 3300048926 | Bacteria | 1391 |
| 660 | Ga0496124_0096386 | 3300048927 | Bacteria | 2403 |
| 661 | Ga0496124_0103264 | 3300048927 | Bacteria | 2306 |
| 662 | Ga0496124_0343461 | 3300048927 | Bacteria | 1059 |
| 663 | Ga0496124_0416229 | 3300048927 | Bacteria | 928 |
| 664 | Ga0496125_0032589 | 3300048928 | Bacteria | 4627 |
| 665 | Ga0496125_0093611 | 3300048928 | Bacteria | 2242 |
| 666 | Ga0496125_0093914 | 3300048928 | Bacteria | 2237 |
| 667 | Ga0496126_0008105 | 3300048929 | Bacteria | 11377 |
| 668 | Ga0496126_0034641 | 3300048929 | Bacteria | 4740 |
| 669 | Ga0496126_0109686 | 3300048929 | Bacteria | 2405 |
| 670 | Ga0496126_0127334 | 3300048929 | Bacteria | 2203 |
| 671 | Ga0496126_0180812 | 3300048929 | Bacteria | 1791 |
| 672 | Ga0496126_0196317 | 3300048929 | Bacteria | 1706 |
| 673 | Ga0496126_0196753 | 3300048929 | Bacteria | 1704 |
| 674 | Ga0496126_0254158 | 3300048929 | Bacteria | 1463 |
| 675 | Ga0496126_0281238 | 3300048929 | Bacteria | 1378 |
| 676 | Ga0496126_0352112 | 3300048929 | Bacteria | 1204 |
| 677 | Ga0496126_0561973 | 3300048929 | Bacteria | 904 |
| 678 | Ga0496126_0579685 | 3300048929 | Bacteria | 886 |
| 679 | Ga0496126_0612613 | 3300048929 | Bacteria | 856 |
| 680 | Ga0501067_0035394 | 3300049583 | Bacteria | 2773 |
| 681 | Ga0501069_0074010 | 3300049585 | Bacteria | 1911 |
| 682 | nmdc:mga03683_647277_c1 | 3300050489 | Bacteria | 520 |
| 683 | nmdc:mga03n38_187226_c1 | 3300050490 | Bacteria | 1064 |
| 684 | nmdc:mga00v17_29441_c1 | 3300050491 | Bacteria | 3223 |
| 685 | nmdc:mga0yw44_117103_c1 | 3300050492 | Bacteria | 1713 |
| 686 | nmdc:mga0yw44_288109_c1 | 3300050492 | Bacteria | 1099 |
| 687 | nmdc:mga0yw44_43667_c1 | 3300050492 | Bacteria | 2678 |
| 688 | nmdc:mga0yw44_520693_c1 | 3300050492 | Bacteria | 807 |
| 689 | nmdc:mga0k408_178394_c1 | 3300050493 | Bacteria | 1267 |
| 690 | nmdc:mga0k408_506532_c1 | 3300050493 | Bacteria | 715 |
| 691 | nmdc:mga0k408_57738_c1 | 3300050493 | Bacteria | 2253 |
| 692 | nmdc:mga06z11_168821_c1 | 3300050494 | Bacteria | 1255 |
| 693 | nmdc:mga06z11_17685_c1 | 3300050494 | Bacteria | 3241 |
| 694 | nmdc:mga06z11_328671_c1 | 3300050494 | Bacteria | 913 |
| 695 | nmdc:mga06z11_3991_c1 | 3300050494 | Bacteria | 5759 |
| 696 | nmdc:mga06z11_41951_c1 | 3300050494 | Bacteria | 2292 |
| 697 | nmdc:mga04h51_14221_c1 | 3300050495 | Bacteria | 1460 |
| 698 | nmdc:mga04h51_63576_c1 | 3300050495 | Bacteria | 1271 |
| 699 | nmdc:mga07m45_254313_c1 | 3300050496 | Bacteria | 1022 |
| 700 | nmdc:mga07m45_2630_c1 | 3300050496 | Bacteria | 7147 |
| 701 | nmdc:mga07m45_672249_c1 | 3300050496 | Bacteria | 596 |
| 702 | nmdc:mga09592_1097526_c1 | 3300050508 | Bacteria | 661 |
| 703 | nmdc:mga08y16_355911_c1 | 3300050511 | Bacteria | 1503 |
| 704 | nmdc:mga0n895_237441_c1 | 3300050512 | Bacteria | 1850 |
| 705 | nmdc:mga0n895_244457_c1 | 3300050512 | Bacteria | 1821 |
| 706 | nmdc:mga0rr50_330318_c1 | 3300050513 | Bacteria | 1280 |
| 707 | nmdc:mga0a205_562102_c1 | 3300050515 | Bacteria | 995 |
| 708 | nmdc:mga0sz30_172578_c1 | 3300050516 | Bacteria | 959 |
| 709 | nmdc:mga0sz30_4621_c1 | 3300050516 | Bacteria | 4986 |
| 710 | nmdc:mga0sz30_64673_c1 | 3300050516 | Bacteria | 1567 |
| 711 | Ga0495601_0465035 | 3300053077 | Bacteria | 817 |
| 712 | Ga0495655_0131318 | 3300053083 | Bacteria | 772 |
| 713 | Ga0495595_0150435 | 3300053084 | Bacteria | 1145 |
| 714 | Ga0495595_0252664 | 3300053084 | Bacteria | 883 |
| 715 | Ga0495619_0111643 | 3300053085 | Bacteria | 1868 |
| 716 | Ga0500651_0039270 | 3300053093 | Bacteria | 2980 |
| 717 | Ga0500641_0039408 | 3300053096 | Bacteria | 1903 |
| 718 | Ga0500650_0169556 | 3300053098 | Bacteria | 1004 |
| 719 | Ga0500654_152975 | 3300053099 | Bacteria | 805 |
| 720 | Ga0500554_024351 | 3300053102 | Bacteria | 1714 |
| 721 | Ga0500556_0038280 | 3300053104 | Bacteria | 1673 |
| 722 | Ga0500556_0071372 | 3300053104 | Bacteria | 1298 |
| 723 | Ga0500562_001337 | 3300053108 | Bacteria | 6079 |
| 724 | Ga0500592_021451 | 3300053116 | Bacteria | 1040 |
| 725 | Ga0500595_010617 | 3300053119 | Bacteria | 3650 |
| 726 | Ga0500595_019616 | 3300053119 | Bacteria | 2450 |
| 727 | Ga0500595_043771 | 3300053119 | Bacteria | 1423 |
| 728 | Ga0500617_126927 | 3300053124 | Bacteria | 1044 |
| 729 | Ga0500621_278494 | 3300053126 | Bacteria | 547 |
| 730 | Ga0500642_0081757 | 3300053130 | Bacteria | 1485 |
| 731 | Ga0500655_065313 | 3300053133 | Bacteria | 737 |
| 732 | Ga0500658_0023186 | 3300053134 | Bacteria | 2367 |
| 733 | Ga0500559_0000713 | 3300053136 | Bacteria | 21844 |
| 734 | Ga0500559_0040415 | 3300053136 | Bacteria | 2030 |
| 735 | Ga0500589_080489 | 3300053147 | Bacteria | 1455 |
| 736 | Ga0500603_000301 | 3300053150 | Bacteria | 12973 |
| 737 | Ga0500616_0029988 | 3300053153 | Bacteria | 2989 |
| 738 | Ga0500622_0093925 | 3300053156 | Bacteria | 1484 |
| 739 | Ga0500633_0239230 | 3300053160 | Bacteria | 676 |
| 740 | Ga0500636_0000517 | 3300053177 | Bacteria | 20978 |
| 741 | Ga0500637_0001543 | 3300053178 | Bacteria | 9829 |
| 742 | Ga0500645_008674 | 3300053730 | Bacteria | 3450 |
| 743 | Ga0500645_052030 | 3300053730 | Bacteria | 1194 |
| 744 | Ga0500609_017002 | 3300053731 | Bacteria | 988 |
| 745 | Ga0500656_025603 | 3300053732 | Bacteria | 758 |
| 746 | Ga0500599_000516 | 3300053736 | Bacteria | 4050 |
| 747 | Ga0500661_007512 | 3300055283 | Bacteria | 2013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0343461 | Ga0496124_0343461_385_804 | 128 |
| 2 | 3300005458 | Ga0070681_10137788 | Ga0070681_101377882 | 135 |
| 3 | 3300005539 | Ga0068853_100417547 | Ga0068853_1004175472 | 135 |
| 4 | 3300025912 | Ga0207707_10028737 | Ga0207707_100287373 | 135 |
| 5 | 3300025921 | Ga0207652_10191251 | Ga0207652_101912512 | 135 |
| 6 | 3300026041 | Ga0207639_10409835 | Ga0207639_104098352 | 135 |
| 7 | 3300046514 | Ga0495618_0065480 | Ga0495618_0065480_46_459 | 135 |
| 8 | 3300046689 | Ga0495613_0215839 | Ga0495613_0215839_37_450 | 135 |
| 9 | 3300048920 | Ga0496117_0168062 | Ga0496117_0168062_613_1023 | 135 |
| 10 | 3300048922 | Ga0496119_0113969 | Ga0496119_0113969_693_1103 | 135 |
| 11 | 3300048924 | Ga0496121_0013527 | Ga0496121_0013527_4570_4980 | 135 |
| 12 | 3300048927 | Ga0496124_0416229 | Ga0496124_0416229_439_849 | 135 |
| 13 | 3300005337 | Ga0070682_100389529 | Ga0070682_1003895291 | 136 |
| 14 | 3300035086 | Ga0373934_0106398 | Ga0373934_0106398_671_1081 | 136 |
| 15 | 3300035695 | Ga0373927_1046129 | Ga0373927_1046129_56_466 | 136 |
| 16 | 3300041496 | Ga0451839_0368182 | Ga0451839_0368182_103_513 | 136 |
| 17 | 3300041498 | Ga0451841_0075291 | Ga0451841_0075291_44_454 | 136 |
| 18 | 3300044694 | Ga0466963_0178086 | Ga0466963_0178086_212_628 | 136 |
| 19 | 3300046475 | Ga0495639_0185957 | Ga0495639_0185957_580_990 | 136 |
| 20 | 3300046507 | Ga0495606_0368463 | Ga0495606_0368463_239_652 | 136 |
| 21 | 3300046524 | Ga0495648_0118198 | Ga0495648_0118198_64_477 | 136 |
| 22 | 3300046525 | Ga0495663_0088904 | Ga0495663_0088904_21_431 | 136 |
| 23 | 3300047315 | Ga0495581_0377692 | Ga0495581_0377692_24_434 | 136 |
| 24 | 3300047318 | Ga0495636_0686768 | Ga0495636_0686768_11_421 | 136 |
| 25 | 3300047472 | Ga0495686_0183592 | Ga0495686_0183592_767_1177 | 136 |
| 26 | 3300048903 | Ga0496100_1235997 | Ga0496100_1235997_22_432 | 136 |
| 27 | 3300048904 | Ga0496101_1222100 | Ga0496101_1222100_168_578 | 136 |
| 28 | 3300048913 | Ga0496110_0162864 | Ga0496110_0162864_797_1207 | 136 |
| 29 | 3300048914 | Ga0496111_0619433 | Ga0496111_0619433_42_452 | 136 |
| 30 | 3300048915 | Ga0496112_0150309 | Ga0496112_0150309_924_1334 | 136 |
| 31 | 3300048916 | Ga0496113_0462183 | Ga0496113_0462183_171_581 | 136 |
| 32 | 3300048929 | Ga0496126_0281238 | Ga0496126_0281238_15_425 | 136 |
| 33 | 3300053116 | Ga0500592_021451 | Ga0500592_021451_520_933 | 136 |
| 34 | 3300053126 | Ga0500621_278494 | Ga0500621_278494_50_460 | 136 |
| 35 | 3300013306 | Ga0163162_10306264 | Ga0163162_103062643 | 138 |
| 36 | 3300009098 | Ga0105245_10008778 | Ga0105245_100087783 | 139 |
| 37 | 3300025945 | Ga0207679_10418985 | Ga0207679_104189852 | 139 |
| 38 | 3300027512 | Ga0209179_1023303 | Ga0209179_10233032 | 139 |
| 39 | 3300048906 | Ga0496103_0059253 | Ga0496103_0059253_1847_2305 | 139 |
| 40 | iso_pu_bacteria | 2906635258 | 2906638421 | 139 |
| 41 | iso_pu_bacteria | 2906660503 | 2906663294 | 139 |
| 42 | 3300025920 | Ga0207649_10170186 | Ga0207649_101701862 | 142 |
| 43 | 3300046519 | Ga0495632_0204527 | Ga0495632_0204527_121_591 | 142 |
| 44 | 3300009551 | Ga0105238_11495292 | Ga0105238_114952921 | 143 |
| 45 | 3300009553 | Ga0105249_10237224 | Ga0105249_102372241 | 143 |
| 46 | 3300035089 | Ga0373944_0288450 | Ga0373944_0288450_34_468 | 143 |
| 47 | 3300046455 | Ga0495603_0016800 | Ga0495603_0016800_2749_3183 | 143 |
| 48 | 3300046455 | Ga0495603_0065464 | Ga0495603_0065464_430_861 | 143 |
| 49 | 3300046475 | Ga0495639_0042405 | Ga0495639_0042405_1001_1435 | 143 |
| 50 | 3300046683 | Ga0495658_0633221 | Ga0495658_0633221_198_632 | 143 |
| 51 | 3300047321 | Ga0495676_0573959 | Ga0495676_0573959_205_639 | 143 |
| 52 | 3300047445 | Ga0495677_0189766 | Ga0495677_0189766_49_483 | 143 |
| 53 | 3300048916 | Ga0496113_0050080 | Ga0496113_0050080_241_678 | 143 |
| 54 | 3300048928 | Ga0496125_0032589 | Ga0496125_0032589_283_717 | 143 |
| 55 | 3300053102 | Ga0500554_024351 | Ga0500554_024351_895_1326 | 143 |
| 56 | 3300053150 | Ga0500603_000301 | Ga0500603_000301_7580_8011 | 143 |
| 57 | 3300053178 | Ga0500637_0001543 | Ga0500637_0001543_7072_7503 | 143 |
| 58 | 3300009011 | Ga0105251_10170380 | Ga0105251_101703802 | 144 |
| 59 | 3300009098 | Ga0105245_10011732 | Ga0105245_100117326 | 144 |
| 60 | 3300009101 | Ga0105247_10008803 | Ga0105247_100088035 | 144 |
| 61 | 3300009101 | Ga0105247_10194054 | Ga0105247_101940542 | 144 |
| 62 | 3300009101 | Ga0105247_10255359 | Ga0105247_102553592 | 144 |
| 63 | 3300009147 | Ga0114129_10420482 | Ga0114129_104204822 | 144 |
| 64 | 3300009148 | Ga0105243_10354044 | Ga0105243_103540442 | 144 |
| 65 | 3300009174 | Ga0105241_11337337 | Ga0105241_113373371 | 144 |
| 66 | 3300009177 | Ga0105248_10007744 | Ga0105248_1000774410 | 144 |
| 67 | 3300009545 | Ga0105237_10119726 | Ga0105237_101197263 | 144 |
| 68 | 3300009551 | Ga0105238_10251431 | Ga0105238_102514312 | 144 |
| 69 | 3300009551 | Ga0105238_10362555 | Ga0105238_103625552 | 144 |
| 70 | 3300009553 | Ga0105249_10274242 | Ga0105249_102742422 | 144 |
| 71 | 3300010375 | Ga0105239_10048870 | Ga0105239_100488703 | 144 |
| 72 | 3300013296 | Ga0157374_10007080 | Ga0157374_100070805 | 144 |
| 73 | 3300013296 | Ga0157374_10734357 | Ga0157374_107343571 | 144 |
| 74 | 3300013297 | Ga0157378_12066608 | Ga0157378_120666081 | 144 |
| 75 | 3300013306 | Ga0163162_10330317 | Ga0163162_103303172 | 144 |
| 76 | 3300013306 | Ga0163162_10516462 | Ga0163162_105164622 | 144 |
| 77 | 3300013308 | Ga0157375_10287452 | Ga0157375_102874522 | 144 |
| 78 | 3300013308 | Ga0157375_11153722 | Ga0157375_111537221 | 144 |
| 79 | 3300014325 | Ga0163163_10102447 | Ga0163163_101024473 | 144 |
| 80 | 3300014325 | Ga0163163_10108633 | Ga0163163_101086332 | 144 |
| 81 | 3300014325 | Ga0163163_10252117 | Ga0163163_102521172 | 144 |
| 82 | 3300014326 | Ga0157380_10035872 | Ga0157380_100358723 | 144 |
| 83 | 3300014326 | Ga0157380_10606653 | Ga0157380_106066532 | 144 |
| 84 | 3300014745 | Ga0157377_10089245 | Ga0157377_100892452 | 144 |
| 85 | 3300014968 | Ga0157379_10176296 | Ga0157379_101762962 | 144 |
| 86 | 3300014968 | Ga0157379_10550402 | Ga0157379_105504022 | 144 |
| 87 | 3300034816 | Ga0373930_0162344 | Ga0373930_0162344_14_448 | 144 |
| 88 | 3300041453 | Ga0451797_0248301 | Ga0451797_0248301_58_492 | 144 |
| 89 | 3300041459 | Ga0451800_0827803 | Ga0451800_0827803_79_513 | 144 |
| 90 | 3300041460 | Ga0451802_0400802 | Ga0451802_0400802_122_556 | 144 |
| 91 | 3300041460 | Ga0451802_1380398 | Ga0451802_1380398_104_541 | 144 |
| 92 | 3300041460 | Ga0451802_1497184 | Ga0451802_1497184_344_778 | 144 |
| 93 | 3300041486 | Ga0451807_2173839 | Ga0451807_2173839_32_508 | 144 |
| 94 | 3300046455 | Ga0495603_0142030 | Ga0495603_0142030_33_467 | 144 |
| 95 | 3300046460 | Ga0495638_0362084 | Ga0495638_0362084_45_479 | 144 |
| 96 | 3300046471 | Ga0495650_0048414 | Ga0495650_0048414_1273_1707 | 144 |
| 97 | 3300046491 | Ga0495584_0136314 | Ga0495584_0136314_464_898 | 144 |
| 98 | 3300046491 | Ga0495584_0299199 | Ga0495584_0299199_89_523 | 144 |
| 99 | 3300046499 | Ga0495594_0195703 | Ga0495594_0195703_284_718 | 144 |
| 100 | 3300046513 | Ga0495616_0438066 | Ga0495616_0438066_60_494 | 144 |
| 101 | 3300046518 | Ga0495631_0089943 | Ga0495631_0089943_402_836 | 144 |
| 102 | 3300046518 | Ga0495631_0107216 | Ga0495631_0107216_480_914 | 144 |
| 103 | 3300046518 | Ga0495631_0175603 | Ga0495631_0175603_361_795 | 144 |
| 104 | 3300046519 | Ga0495632_0067050 | Ga0495632_0067050_49_483 | 144 |
| 105 | 3300046523 | Ga0495644_0029150 | Ga0495644_0029150_764_1198 | 144 |
| 106 | 3300046524 | Ga0495648_0176005 | Ga0495648_0176005_288_722 | 144 |
| 107 | 3300046530 | Ga0495654_0438224 | Ga0495654_0438224_16_450 | 144 |
| 108 | 3300046537 | Ga0495598_0018355 | Ga0495598_0018355_11_445 | 144 |
| 109 | 3300046538 | Ga0495609_0465892 | Ga0495609_0465892_42_476 | 144 |
| 110 | 3300046539 | Ga0495621_0012473 | Ga0495621_0012473_1828_2262 | 144 |
| 111 | 3300046539 | Ga0495621_0059881 | Ga0495621_0059881_582_1016 | 144 |
| 112 | 3300046557 | Ga0495622_0055584 | Ga0495622_0055584_1331_1765 | 144 |
| 113 | 3300046558 | Ga0495633_0170999 | Ga0495633_0170999_156_590 | 144 |
| 114 | 3300046559 | Ga0495667_0280200 | Ga0495667_0280200_532_972 | 144 |
| 115 | 3300046615 | Ga0495656_0271742 | Ga0495656_0271742_223_657 | 144 |
| 116 | 3300046616 | Ga0495668_0108216 | Ga0495668_0108216_218_652 | 144 |
| 117 | 3300046648 | Ga0495611_0152441 | Ga0495611_0152441_118_552 | 144 |
| 118 | 3300046664 | Ga0495659_0016046 | Ga0495659_0016046_1635_2069 | 144 |
| 119 | 3300046665 | Ga0495661_0174702 | Ga0495661_0174702_235_669 | 144 |
| 120 | 3300046674 | Ga0495588_0014003 | Ga0495588_0014003_1335_1769 | 144 |
| 121 | 3300046684 | Ga0495669_0068093 | Ga0495669_0068093_485_919 | 144 |
| 122 | 3300046684 | Ga0495669_0228811 | Ga0495669_0228811_132_566 | 144 |
| 123 | 3300046691 | Ga0495670_0072830 | Ga0495670_0072830_1005_1439 | 144 |
| 124 | 3300046692 | Ga0495671_0162833 | Ga0495671_0162833_630_1064 | 144 |
| 125 | 3300046692 | Ga0495671_0219145 | Ga0495671_0219145_71_505 | 144 |
| 126 | 3300046694 | Ga0495649_0381518 | Ga0495649_0381518_43_477 | 144 |
| 127 | 3300047318 | Ga0495636_0087796 | Ga0495636_0087796_359_793 | 144 |
| 128 | 3300047321 | Ga0495676_0161618 | Ga0495676_0161618_155_589 | 144 |
| 129 | 3300047445 | Ga0495677_0118910 | Ga0495677_0118910_200_634 | 144 |
| 130 | 3300047472 | Ga0495686_0083913 | Ga0495686_0083913_376_810 | 144 |
| 131 | 3300047472 | Ga0495686_0238229 | Ga0495686_0238229_111_545 | 144 |
| 132 | 3300048090 | Ga0495615_0071328 | Ga0495615_0071328_155_589 | 144 |
| 133 | 3300048090 | Ga0495615_0128348 | Ga0495615_0128348_135_569 | 144 |
| 134 | 3300048903 | Ga0496100_0997064 | Ga0496100_0997064_121_555 | 144 |
| 135 | 3300048904 | Ga0496101_0216216 | Ga0496101_0216216_827_1261 | 144 |
| 136 | 3300048905 | Ga0496102_0040636 | Ga0496102_0040636_1547_1981 | 144 |
| 137 | 3300048905 | Ga0496102_0741091 | Ga0496102_0741091_101_535 | 144 |
| 138 | 3300048906 | Ga0496103_0394820 | Ga0496103_0394820_50_484 | 144 |
| 139 | 3300048906 | Ga0496103_0895903 | Ga0496103_0895903_112_546 | 144 |
| 140 | 3300048910 | Ga0496107_0819452 | Ga0496107_0819452_235_669 | 144 |
| 141 | 3300048912 | Ga0496109_0074066 | Ga0496109_0074066_2550_2984 | 144 |
| 142 | 3300048913 | Ga0496110_0057620 | Ga0496110_0057620_2387_2821 | 144 |
| 143 | 3300048913 | Ga0496110_0263391 | Ga0496110_0263391_622_1056 | 144 |
| 144 | 3300048914 | Ga0496111_0420607 | Ga0496111_0420607_37_471 | 144 |
| 145 | 3300048914 | Ga0496111_0918155 | Ga0496111_0918155_30_464 | 144 |
| 146 | 3300048917 | Ga0496114_1456792 | Ga0496114_1456792_11_448 | 144 |
| 147 | 3300048918 | Ga0496115_0294278 | Ga0496115_0294278_203_637 | 144 |
| 148 | 3300048918 | Ga0496115_0605571 | Ga0496115_0605571_223_657 | 144 |
| 149 | 3300048920 | Ga0496117_0375407 | Ga0496117_0375407_216_650 | 144 |
| 150 | 3300048921 | Ga0496118_0143537 | Ga0496118_0143537_518_952 | 144 |
| 151 | 3300048924 | Ga0496121_0072545 | Ga0496121_0072545_1719_2153 | 144 |
| 152 | 3300048924 | Ga0496121_0099080 | Ga0496121_0099080_88_522 | 144 |
| 153 | 3300048924 | Ga0496121_0118170 | Ga0496121_0118170_642_1076 | 144 |
| 154 | 3300048927 | Ga0496124_0096386 | Ga0496124_0096386_1245_1679 | 144 |
| 155 | 3300048927 | Ga0496124_0103264 | Ga0496124_0103264_133_567 | 144 |
| 156 | 3300048928 | Ga0496125_0093611 | Ga0496125_0093611_304_738 | 144 |
| 157 | 3300048928 | Ga0496125_0093914 | Ga0496125_0093914_513_947 | 144 |
| 158 | 3300048929 | Ga0496126_0034641 | Ga0496126_0034641_2145_2579 | 144 |
| 159 | 3300048929 | Ga0496126_0127334 | Ga0496126_0127334_1498_1932 | 144 |
| 160 | 3300048929 | Ga0496126_0180812 | Ga0496126_0180812_308_742 | 144 |
| 161 | 3300048929 | Ga0496126_0196753 | Ga0496126_0196753_1042_1476 | 144 |
| 162 | 3300048929 | Ga0496126_0612613 | Ga0496126_0612613_408_842 | 144 |
| 163 | 3300050489 | nmdc:mga03683_647277_c1 | nmdc:mga03683_647277_c1_63_497 | 144 |
| 164 | 3300050490 | nmdc:mga03n38_187226_c1 | nmdc:mga03n38_187226_c1_110_544 | 144 |
| 165 | 3300050491 | nmdc:mga00v17_29441_c1 | nmdc:mga00v17_29441_c1_725_1159 | 144 |
| 166 | 3300050492 | nmdc:mga0yw44_117103_c1 | nmdc:mga0yw44_117103_c1_398_832 | 144 |
| 167 | 3300050492 | nmdc:mga0yw44_43667_c1 | nmdc:mga0yw44_43667_c1_1585_2019 | 144 |
| 168 | 3300050492 | nmdc:mga0yw44_520693_c1 | nmdc:mga0yw44_520693_c1_124_558 | 144 |
| 169 | 3300050493 | nmdc:mga0k408_178394_c1 | nmdc:mga0k408_178394_c1_57_491 | 144 |
| 170 | 3300050493 | nmdc:mga0k408_57738_c1 | nmdc:mga0k408_57738_c1_777_1211 | 144 |
| 171 | 3300050494 | nmdc:mga06z11_17685_c1 | nmdc:mga06z11_17685_c1_639_1073 | 144 |
| 172 | 3300050494 | nmdc:mga06z11_3991_c1 | nmdc:mga06z11_3991_c1_948_1382 | 144 |
| 173 | 3300050495 | nmdc:mga04h51_63576_c1 | nmdc:mga04h51_63576_c1_68_502 | 144 |
| 174 | 3300050496 | nmdc:mga07m45_254313_c1 | nmdc:mga07m45_254313_c1_488_922 | 144 |
| 175 | 3300050496 | nmdc:mga07m45_2630_c1 | nmdc:mga07m45_2630_c1_3335_3769 | 144 |
| 176 | 3300050508 | nmdc:mga09592_1097526_c1 | nmdc:mga09592_1097526_c1_189_623 | 144 |
| 177 | 3300050512 | nmdc:mga0n895_237441_c1 | nmdc:mga0n895_237441_c1_858_1292 | 144 |
| 178 | 3300050513 | nmdc:mga0rr50_330318_c1 | nmdc:mga0rr50_330318_c1_639_1073 | 144 |
| 179 | 3300050515 | nmdc:mga0a205_562102_c1 | nmdc:mga0a205_562102_c1_22_456 | 144 |
| 180 | 3300050516 | nmdc:mga0sz30_172578_c1 | nmdc:mga0sz30_172578_c1_503_937 | 144 |
| 181 | 3300050516 | nmdc:mga0sz30_4621_c1 | nmdc:mga0sz30_4621_c1_3118_3552 | 144 |
| 182 | 3300053083 | Ga0495655_0131318 | Ga0495655_0131318_26_460 | 144 |
| 183 | 3300053084 | Ga0495595_0252664 | Ga0495595_0252664_257_691 | 144 |
| 184 | 3300053096 | Ga0500641_0039408 | Ga0500641_0039408_1301_1735 | 144 |
| 185 | 3300053098 | Ga0500650_0169556 | Ga0500650_0169556_318_752 | 144 |
| 186 | 3300053119 | Ga0500595_043771 | Ga0500595_043771_222_656 | 144 |
| 187 | 3300053124 | Ga0500617_126927 | Ga0500617_126927_444_878 | 144 |
| 188 | 3300053134 | Ga0500658_0023186 | Ga0500658_0023186_1083_1517 | 144 |
| 189 | 3300053147 | Ga0500589_080489 | Ga0500589_080489_485_919 | 144 |
| 190 | 3300053160 | Ga0500633_0239230 | Ga0500633_0239230_198_632 | 144 |
| 191 | 3300053731 | Ga0500609_017002 | Ga0500609_017002_195_629 | 144 |
| 192 | 3300053732 | Ga0500656_025603 | Ga0500656_025603_257_691 | 144 |
| 193 | 3300005338 | Ga0068868_100243267 | Ga0068868_1002432671 | 146 |
| 194 | 3300005364 | Ga0070673_100051954 | Ga0070673_1000519543 | 146 |
| 195 | 3300005459 | Ga0068867_100272666 | Ga0068867_1002726662 | 146 |
| 196 | 3300005539 | Ga0068853_100381106 | Ga0068853_1003811062 | 146 |
| 197 | 3300005544 | Ga0070686_100085499 | Ga0070686_1000854991 | 146 |
| 198 | 3300005563 | Ga0068855_100338462 | Ga0068855_1003384622 | 146 |
| 199 | 3300005617 | Ga0068859_101421438 | Ga0068859_1014214382 | 146 |
| 200 | 3300005618 | Ga0068864_100086971 | Ga0068864_1000869713 | 146 |
| 201 | 3300005841 | Ga0068863_102226000 | Ga0068863_1022260001 | 146 |
| 202 | 3300006175 | Ga0070712_100008393 | Ga0070712_1000083936 | 146 |
| 203 | 3300006358 | Ga0068871_100647796 | Ga0068871_1006477962 | 146 |
| 204 | 3300006931 | Ga0097620_101421862 | Ga0097620_1014218621 | 146 |
| 205 | 3300009177 | Ga0105248_10039465 | Ga0105248_100394654 | 146 |
| 206 | 3300009551 | Ga0105238_10271210 | Ga0105238_102712102 | 146 |
| 207 | 3300025915 | Ga0207693_10012394 | Ga0207693_100123943 | 146 |
| 208 | 3300025927 | Ga0207687_10024837 | Ga0207687_100248373 | 146 |
| 209 | 3300025941 | Ga0207711_10055610 | Ga0207711_100556103 | 146 |
| 210 | 3300025960 | Ga0207651_10107402 | Ga0207651_101074023 | 146 |
| 211 | 3300026023 | Ga0207677_11497876 | Ga0207677_114978761 | 146 |
| 212 | 3300026035 | Ga0207703_10453769 | Ga0207703_104537692 | 146 |
| 213 | 3300026088 | Ga0207641_11409131 | Ga0207641_114091312 | 146 |
| 214 | 3300026089 | Ga0207648_11232992 | Ga0207648_112329922 | 146 |
| 215 | 3300026095 | Ga0207676_10524426 | Ga0207676_105244262 | 146 |
| 216 | 3300003659 | JGI25404J52841_10002694 | JGI25404J52841_100026943 | 147 |
| 217 | 3300003659 | JGI25404J52841_10034671 | JGI25404J52841_100346712 | 147 |
| 218 | 3300005937 | Ga0081455_10027369 | Ga0081455_100273694 | 147 |
| 219 | 3300005983 | Ga0081540_1004374 | Ga0081540_10043742 | 147 |
| 220 | 3300005983 | Ga0081540_1010157 | Ga0081540_10101579 | 147 |
| 221 | 3300006881 | Ga0068865_100127808 | Ga0068865_1001278082 | 147 |
| 222 | 3300026121 | Ga0207683_11250932 | Ga0207683_112509321 | 147 |
| 223 | 3300031241 | Ga0265325_10000126 | Ga0265325_100001267 | 149 |
| 224 | 3300041507 | Ga0451851_0303179 | Ga0451851_0303179_13_462 | 149 |
| 225 | 3300009551 | Ga0105238_10005670 | Ga0105238_1000567014 | 150 |
| 226 | iso_pu_bacteria | 2513237096 | 2513655542 | 150 |
| 227 | iso_pu_bacteria | 2513237137 | 2513859773 | 150 |
| 228 | iso_pu_bacteria | 2513237145 | 2513916380 | 150 |
| 229 | iso_pu_bacteria | 2517572143 | 2517890007 | 150 |
| 230 | iso_pu_bacteria | 2524023228 | 2524534927 | 150 |
| 231 | iso_pu_bacteria | 2667528175 | 2671120962 | 150 |
| 232 | iso_pu_bacteria | 2791355197 | 2793068024 | 150 |
| 233 | iso_pu_bacteria | 2824704595 | 2824708186 | 150 |
| 234 | iso_pu_bacteria | 2824753945 | 2824756777 | 150 |
| 235 | iso_pu_bacteria | 2824763712 | 2824767369 | 150 |
| 236 | iso_pu_bacteria | 2885374607 | 2885377209 | 150 |
| 237 | iso_pu_bacteria | 2903748898 | 2903754476 | 150 |
| 238 | iso_pu_bacteria | 2904699407 | 2904711007 | 150 |
| 239 | iso_pu_bacteria | 2904711408 | 2904720732 | 150 |
| 240 | iso_pu_bacteria | 2906610324 | 2906612238 | 150 |
| 241 | iso_pu_bacteria | 2908739725 | 2908740229 | 150 |
| 242 | iso_pu_bacteria | 2908756301 | 2908757778 | 150 |
| 243 | iso_pu_bacteria | 2922425934 | 2922427066 | 150 |
| 244 | iso_pu_bacteria | 2935630451 | 2935633209 | 150 |
| 245 | iso_pu_bacteria | 2941507105 | 2941509489 | 150 |
| 246 | iso_pu_bacteria | 2941515067 | 2941517318 | 150 |
| 247 | iso_pu_bacteria | 2941523033 | 2941526729 | 150 |
| 248 | iso_pu_bacteria | 3005474847 | 3005476244 | 150 |
| 249 | iso_pu_bacteria | 8006933436 | 8006937547 | 150 |
| 250 | iso_pu_bacteria | 8006973647 | 8006977575 | 150 |
| 251 | iso_pu_bacteria | 8019555841 | 8019561053 | 150 |
| 252 | iso_pu_bacteria | 8056689827 | 8056694771 | 150 |
| 253 | 3300003215 | JGI25153J46596_10014910 | JGI25153J46596_100149103 | 151 |
| 254 | 3300005539 | Ga0068853_100286156 | Ga0068853_1002861562 | 151 |
| 255 | 3300006178 | Ga0075367_10528429 | Ga0075367_105284292 | 151 |
| 256 | 3300025297 | Ga0209758_1013025 | Ga0209758_10130254 | 151 |
| 257 | 3300042157 | Ga0439458_0057672 | Ga0439458_0057672_35_502 | 151 |
| 258 | 3300042438 | Ga0439459_0148240 | Ga0439459_0148240_34_528 | 151 |
| 259 | iso_pu_bacteria | 2508501128 | 2509151244 | 151 |
| 260 | iso_pu_bacteria | 2728368998 | 2728749075 | 151 |
| 261 | iso_pu_bacteria | 2791355199 | 2793080496 | 151 |
| 262 | iso_pu_bacteria | 2876808645 | 2876808708 | 151 |
| 263 | iso_pu_bacteria | 2879110137 | 2879111973 | 151 |
| 264 | iso_pu_bacteria | 2889033259 | 2889034071 | 151 |
| 265 | iso_pu_bacteria | 8006984368 | 8006989933 | 151 |
| 266 | 3300003215 | JGI25153J46596_10111780 | JGI25153J46596_101117801 | 152 |
| 267 | 3300025295 | Ga0209564_1002366 | Ga0209564_100236623 | 152 |
| 268 | 3300025297 | Ga0209758_1006483 | Ga0209758_10064834 | 152 |
| 269 | 3300044765 | Ga0466970_0257666 | Ga0466970_0257666_420_887 | 152 |
| 270 | 3300044842 | Ga0466957_0088986 | Ga0466957_0088986_1239_1706 | 152 |
| 271 | 3300048921 | Ga0496118_0123062 | Ga0496118_0123062_156_617 | 152 |
| 272 | 3300005436 | Ga0070713_100204510 | Ga0070713_1002045102 | 153 |
| 273 | 3300005937 | Ga0081455_10048375 | Ga0081455_100483753 | 153 |
| 274 | 3300006237 | Ga0097621_100720634 | Ga0097621_1007206341 | 153 |
| 275 | 3300009098 | Ga0105245_11757326 | Ga0105245_117573261 | 153 |
| 276 | 3300009148 | Ga0105243_10581085 | Ga0105243_105810851 | 153 |
| 277 | 3300009177 | Ga0105248_10011201 | Ga0105248_1001120111 | 153 |
| 278 | 3300013306 | Ga0163162_10252002 | Ga0163162_102520022 | 153 |
| 279 | 3300013308 | Ga0157375_10697849 | Ga0157375_106978492 | 153 |
| 280 | 3300014968 | Ga0157379_10201931 | Ga0157379_102019312 | 153 |
| 281 | 3300014969 | Ga0157376_10440557 | Ga0157376_104405572 | 153 |
| 282 | 3300025927 | Ga0207687_10971523 | Ga0207687_109715231 | 153 |
| 283 | 3300025928 | Ga0207700_10207551 | Ga0207700_102075512 | 153 |
| 284 | 3300025935 | Ga0207709_10563603 | Ga0207709_105636032 | 153 |
| 285 | 3300025939 | Ga0207665_10175766 | Ga0207665_101757662 | 153 |
| 286 | 3300025941 | Ga0207711_10122866 | Ga0207711_101228662 | 153 |
| 287 | 3300035085 | Ga0373929_0027260 | Ga0373929_0027260_271_744 | 153 |
| 288 | 3300035092 | Ga0373952_0027347 | Ga0373952_0027347_542_1015 | 153 |
| 289 | 3300035691 | Ga0373931_0015543 | Ga0373931_0015543_731_1204 | 153 |
| 290 | 3300048903 | Ga0496100_0205347 | Ga0496100_0205347_46_519 | 153 |
| 291 | 3300048904 | Ga0496101_0222684 | Ga0496101_0222684_217_690 | 153 |
| 292 | 3300048905 | Ga0496102_0208150 | Ga0496102_0208150_282_755 | 153 |
| 293 | 3300048906 | Ga0496103_0280356 | Ga0496103_0280356_545_1018 | 153 |
| 294 | 3300048907 | Ga0496104_0045622 | Ga0496104_0045622_1548_2021 | 153 |
| 295 | 3300048908 | Ga0496105_0034113 | Ga0496105_0034113_584_1057 | 153 |
| 296 | 3300048910 | Ga0496107_1045882 | Ga0496107_1045882_77_550 | 153 |
| 297 | 3300048911 | Ga0496108_0287542 | Ga0496108_0287542_501_974 | 153 |
| 298 | 3300048912 | Ga0496109_0045013 | Ga0496109_0045013_1765_2238 | 153 |
| 299 | 3300048913 | Ga0496110_0113287 | Ga0496110_0113287_1266_1739 | 153 |
| 300 | 3300048914 | Ga0496111_0039606 | Ga0496111_0039606_863_1336 | 153 |
| 301 | 3300048915 | Ga0496112_0070815 | Ga0496112_0070815_984_1457 | 153 |
| 302 | 3300048915 | Ga0496112_0145529 | Ga0496112_0145529_240_713 | 153 |
| 303 | 3300048916 | Ga0496113_0380833 | Ga0496113_0380833_449_922 | 153 |
| 304 | 3300048917 | Ga0496114_0057971 | Ga0496114_0057971_2099_2572 | 153 |
| 305 | 3300048925 | Ga0496122_0044396 | Ga0496122_0044396_23_487 | 153 |
| 306 | 3300048929 | Ga0496126_0579685 | Ga0496126_0579685_280_750 | 153 |
| 307 | 3300053093 | Ga0500651_0039270 | Ga0500651_0039270_407_877 | 153 |
| 308 | 3300053119 | Ga0500595_010617 | Ga0500595_010617_3079_3564 | 153 |
| 309 | 3300053119 | Ga0500595_019616 | Ga0500595_019616_1919_2389 | 153 |
| 310 | 3300053130 | Ga0500642_0081757 | Ga0500642_0081757_842_1312 | 153 |
| 311 | 3300003215 | JGI25153J46596_10141221 | JGI25153J46596_101412211 | 154 |
| 312 | 3300003354 | JGI25160J50197_1003785 | JGI25160J50197_10037858 | 154 |
| 313 | 3300003354 | JGI25160J50197_1029609 | JGI25160J50197_10296091 | 154 |
| 314 | 3300005262 | Ga0065165_1003606 | Ga0065165_100360616 | 154 |
| 315 | 3300005467 | Ga0070706_100275569 | Ga0070706_1002755693 | 154 |
| 316 | 3300005467 | Ga0070706_100357193 | Ga0070706_1003571932 | 154 |
| 317 | 3300005548 | Ga0070665_100072877 | Ga0070665_1000728774 | 154 |
| 318 | 3300006186 | Ga0075369_10019245 | Ga0075369_100192454 | 154 |
| 319 | 3300006186 | Ga0075369_10033206 | Ga0075369_100332063 | 154 |
| 320 | 3300025261 | Ga0209233_1011287 | Ga0209233_10112873 | 154 |
| 321 | 3300025297 | Ga0209758_1026010 | Ga0209758_10260102 | 154 |
| 322 | 3300025302 | Ga0207426_1000430 | Ga0207426_100043063 | 154 |
| 323 | 3300025302 | Ga0207426_1000830 | Ga0207426_100083046 | 154 |
| 324 | 3300025302 | Ga0207426_1038146 | Ga0207426_10381463 | 154 |
| 325 | 3300025304 | Ga0209257_1064800 | Ga0209257_10648001 | 154 |
| 326 | 3300025904 | Ga0207647_10153541 | Ga0207647_101535412 | 154 |
| 327 | 3300025910 | Ga0207684_10195736 | Ga0207684_101957362 | 154 |
| 328 | 3300025910 | Ga0207684_10252085 | Ga0207684_102520853 | 154 |
| 329 | 3300025914 | Ga0207671_10040447 | Ga0207671_100404471 | 154 |
| 330 | 3300025921 | Ga0207652_10908066 | Ga0207652_109080661 | 154 |
| 331 | 3300025924 | Ga0207694_10407468 | Ga0207694_104074681 | 154 |
| 332 | 3300025944 | Ga0207661_10051455 | Ga0207661_100514552 | 154 |
| 333 | 3300026067 | Ga0207678_11521927 | Ga0207678_115219271 | 154 |
| 334 | 3300028379 | Ga0268266_10241555 | Ga0268266_102415553 | 154 |
| 335 | 3300030760 | Ga0265762_1109151 | Ga0265762_11091511 | 154 |
| 336 | 3300031238 | Ga0265332_10037508 | Ga0265332_100375084 | 154 |
| 337 | 3300031249 | Ga0265339_10088248 | Ga0265339_100882482 | 154 |
| 338 | 3300031250 | Ga0265331_10026787 | Ga0265331_100267872 | 154 |
| 339 | 3300031712 | Ga0265342_10000931 | Ga0265342_100009319 | 154 |
| 340 | 3300033180 | Ga0307510_10027051 | Ga0307510_100270517 | 154 |
| 341 | 3300033180 | Ga0307510_10309560 | Ga0307510_103095601 | 154 |
| 342 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005416 | 154 |
| 343 | 3300036401 | Ga0373937_1029415 | Ga0373937_1029415_248_715 | 154 |
| 344 | 3300039437 | Ga0436365_0298555 | Ga0436365_0298555_1572_2054 | 154 |
| 345 | 3300039437 | Ga0436365_1933584 | Ga0436365_1933584_253_735 | 154 |
| 346 | 3300039450 | Ga0436363_0092706 | Ga0436363_0092706_3009_3500 | 154 |
| 347 | 3300041486 | Ga0451807_2533860 | Ga0451807_2533860_43_510 | 154 |
| 348 | 3300044656 | Ga0466969_0182939 | Ga0466969_0182939_13_507 | 154 |
| 349 | 3300044684 | Ga0466966_0036027 | Ga0466966_0036027_2311_2805 | 154 |
| 350 | 3300044765 | Ga0466970_0136994 | Ga0466970_0136994_725_1219 | 154 |
| 351 | 3300046454 | Ga0495592_0125386 | Ga0495592_0125386_384_851 | 154 |
| 352 | 3300046460 | Ga0495638_0007000 | Ga0495638_0007000_7524_7991 | 154 |
| 353 | 3300046462 | Ga0495651_0019229 | Ga0495651_0019229_1268_1735 | 154 |
| 354 | 3300046511 | Ga0495608_0032554 | Ga0495608_0032554_2205_2672 | 154 |
| 355 | 3300046516 | Ga0495628_0039493 | Ga0495628_0039493_3286_3753 | 154 |
| 356 | 3300046529 | Ga0495652_0057419 | Ga0495652_0057419_1289_1756 | 154 |
| 357 | 3300046543 | Ga0495645_0184596 | Ga0495645_0184596_456_923 | 154 |
| 358 | 3300046559 | Ga0495667_0092145 | Ga0495667_0092145_490_957 | 154 |
| 359 | 3300046663 | Ga0495635_0174129 | Ga0495635_0174129_892_1359 | 154 |
| 360 | 3300046675 | Ga0495657_0004266 | Ga0495657_0004266_10591_11058 | 154 |
| 361 | 3300046678 | Ga0495599_0055253 | Ga0495599_0055253_675_1142 | 154 |
| 362 | 3300046679 | Ga0495623_0029788 | Ga0495623_0029788_2082_2549 | 154 |
| 363 | 3300046680 | Ga0495646_0085685 | Ga0495646_0085685_700_1167 | 154 |
| 364 | 3300046689 | Ga0495613_0510458 | Ga0495613_0510458_220_687 | 154 |
| 365 | 3300046809 | Ga0495600_0106514 | Ga0495600_0106514_85_552 | 154 |
| 366 | 3300047317 | Ga0495604_0002177 | Ga0495604_0002177_10739_11206 | 154 |
| 367 | 3300047319 | Ga0495674_0043681 | Ga0495674_0043681_1274_1741 | 154 |
| 368 | 3300047322 | Ga0495680_0019208 | Ga0495680_0019208_2564_3031 | 154 |
| 369 | 3300047444 | Ga0495675_0024121 | Ga0495675_0024121_346_813 | 154 |
| 370 | 3300047471 | Ga0495684_0235673 | Ga0495684_0235673_27_494 | 154 |
| 371 | 3300047472 | Ga0495686_0278801 | Ga0495686_0278801_436_903 | 154 |
| 372 | 3300047673 | Ga0495593_0355533 | Ga0495593_0355533_151_618 | 154 |
| 373 | 3300048088 | Ga0495602_0250712 | Ga0495602_0250712_161_628 | 154 |
| 374 | 3300048903 | Ga0496100_0788242 | Ga0496100_0788242_12_479 | 154 |
| 375 | 3300048904 | Ga0496101_0726728 | Ga0496101_0726728_24_497 | 154 |
| 376 | 3300048910 | Ga0496107_0681932 | Ga0496107_0681932_219_707 | 154 |
| 377 | 3300048913 | Ga0496110_1136196 | Ga0496110_1136196_44_508 | 154 |
| 378 | 3300048915 | Ga0496112_0805286 | Ga0496112_0805286_195_665 | 154 |
| 379 | 3300048922 | Ga0496119_0118063 | Ga0496119_0118063_311_778 | 154 |
| 380 | 3300048923 | Ga0496120_0134679 | Ga0496120_0134679_31_498 | 154 |
| 381 | 3300048924 | Ga0496121_0076964 | Ga0496121_0076964_1610_2077 | 154 |
| 382 | 3300048924 | Ga0496121_0196370 | Ga0496121_0196370_167_637 | 154 |
| 383 | 3300048929 | Ga0496126_0109686 | Ga0496126_0109686_407_874 | 154 |
| 384 | 3300048929 | Ga0496126_0196317 | Ga0496126_0196317_80_547 | 154 |
| 385 | 3300048929 | Ga0496126_0254158 | Ga0496126_0254158_889_1356 | 154 |
| 386 | 3300048929 | Ga0496126_0561973 | Ga0496126_0561973_368_856 | 154 |
| 387 | 3300050494 | nmdc:mga06z11_168821_c1 | nmdc:mga06z11_168821_c1_441_908 | 154 |
| 388 | 3300050516 | nmdc:mga0sz30_64673_c1 | nmdc:mga0sz30_64673_c1_1035_1502 | 154 |
| 389 | 3300053104 | Ga0500556_0038280 | Ga0500556_0038280_391_858 | 154 |
| 390 | 3300053104 | Ga0500556_0071372 | Ga0500556_0071372_64_531 | 154 |
| 391 | 3300053108 | Ga0500562_001337 | Ga0500562_001337_4026_4493 | 154 |
| 392 | 3300053136 | Ga0500559_0040415 | Ga0500559_0040415_680_1147 | 154 |
| 393 | 3300053153 | Ga0500616_0029988 | Ga0500616_0029988_2441_2908 | 154 |
| 394 | 3300053156 | Ga0500622_0093925 | Ga0500622_0093925_423_890 | 154 |
| 395 | 3300053177 | Ga0500636_0000517 | Ga0500636_0000517_9442_9909 | 154 |
| 396 | 3300053730 | Ga0500645_052030 | Ga0500645_052030_282_749 | 154 |
| 397 | 3300053736 | Ga0500599_000516 | Ga0500599_000516_1997_2464 | 154 |
| 398 | 3300055283 | Ga0500661_007512 | Ga0500661_007512_452_919 | 154 |
| 399 | 3300002239 | JGI24034J26672_10023466 | JGI24034J26672_100234661 | 155 |
| 400 | 3300002244 | JGI24742J22300_10020375 | JGI24742J22300_100203752 | 155 |
| 401 | 3300003203 | JGI25406J46586_10037413 | JGI25406J46586_100374132 | 155 |
| 402 | 3300003659 | JGI25404J52841_10006830 | JGI25404J52841_100068304 | 155 |
| 403 | 3300003659 | JGI25404J52841_10013781 | JGI25404J52841_100137812 | 155 |
| 404 | 3300003659 | JGI25404J52841_10018919 | JGI25404J52841_100189192 | 155 |
| 405 | 3300004801 | Ga0058860_11691766 | Ga0058860_116917661 | 155 |
| 406 | 3300005289 | Ga0065704_10690125 | Ga0065704_106901251 | 155 |
| 407 | 3300005330 | Ga0070690_100092879 | Ga0070690_1000928792 | 155 |
| 408 | 3300005331 | Ga0070670_100281566 | Ga0070670_1002815662 | 155 |
| 409 | 3300005331 | Ga0070670_100416175 | Ga0070670_1004161752 | 155 |
| 410 | 3300005334 | Ga0068869_100033336 | Ga0068869_1000333362 | 155 |
| 411 | 3300005334 | Ga0068869_100430185 | Ga0068869_1004301852 | 155 |
| 412 | 3300005334 | Ga0068869_100433352 | Ga0068869_1004333521 | 155 |
| 413 | 3300005334 | Ga0068869_100484397 | Ga0068869_1004843972 | 155 |
| 414 | 3300005334 | Ga0068869_100749825 | Ga0068869_1007498251 | 155 |
| 415 | 3300005335 | Ga0070666_10586418 | Ga0070666_105864181 | 155 |
| 416 | 3300005337 | Ga0070682_100154996 | Ga0070682_1001549962 | 155 |
| 417 | 3300005339 | Ga0070660_100444955 | Ga0070660_1004449552 | 155 |
| 418 | 3300005344 | Ga0070661_100298254 | Ga0070661_1002982542 | 155 |
| 419 | 3300005345 | Ga0070692_10685547 | Ga0070692_106855471 | 155 |
| 420 | 3300005347 | Ga0070668_100012999 | Ga0070668_1000129995 | 155 |
| 421 | 3300005347 | Ga0070668_100053665 | Ga0070668_1000536654 | 155 |
| 422 | 3300005347 | Ga0070668_100058160 | Ga0070668_1000581603 | 155 |
| 423 | 3300005347 | Ga0070668_100349174 | Ga0070668_1003491742 | 155 |
| 424 | 3300005347 | Ga0070668_100616470 | Ga0070668_1006164702 | 155 |
| 425 | 3300005353 | Ga0070669_100337342 | Ga0070669_1003373422 | 155 |
| 426 | 3300005354 | Ga0070675_100415254 | Ga0070675_1004152542 | 155 |
| 427 | 3300005355 | Ga0070671_100216959 | Ga0070671_1002169592 | 155 |
| 428 | 3300005355 | Ga0070671_100222154 | Ga0070671_1002221542 | 155 |
| 429 | 3300005356 | Ga0070674_100278587 | Ga0070674_1002785872 | 155 |
| 430 | 3300005356 | Ga0070674_100362813 | Ga0070674_1003628131 | 155 |
| 431 | 3300005364 | Ga0070673_100888930 | Ga0070673_1008889302 | 155 |
| 432 | 3300005365 | Ga0070688_100079031 | Ga0070688_1000790311 | 155 |
| 433 | 3300005365 | Ga0070688_100173392 | Ga0070688_1001733921 | 155 |
| 434 | 3300005367 | Ga0070667_100771820 | Ga0070667_1007718202 | 155 |
| 435 | 3300005406 | Ga0070703_10244751 | Ga0070703_102447511 | 155 |
| 436 | 3300005434 | Ga0070709_10003312 | Ga0070709_100033125 | 155 |
| 437 | 3300005434 | Ga0070709_11225185 | Ga0070709_112251851 | 155 |
| 438 | 3300005435 | Ga0070714_100261240 | Ga0070714_1002612402 | 155 |
| 439 | 3300005436 | Ga0070713_100001422 | Ga0070713_10000142214 | 155 |
| 440 | 3300005436 | Ga0070713_100018220 | Ga0070713_1000182202 | 155 |
| 441 | 3300005437 | Ga0070710_10004827 | Ga0070710_100048274 | 155 |
| 442 | 3300005437 | Ga0070710_10269295 | Ga0070710_102692952 | 155 |
| 443 | 3300005438 | Ga0070701_10175530 | Ga0070701_101755302 | 155 |
| 444 | 3300005439 | Ga0070711_100002142 | Ga0070711_10000214211 | 155 |
| 445 | 3300005440 | Ga0070705_101185137 | Ga0070705_1011851371 | 155 |
| 446 | 3300005441 | Ga0070700_100107418 | Ga0070700_1001074182 | 155 |
| 447 | 3300005441 | Ga0070700_100115143 | Ga0070700_1001151432 | 155 |
| 448 | 3300005455 | Ga0070663_100003220 | Ga0070663_1000032209 | 155 |
| 449 | 3300005455 | Ga0070663_100048983 | Ga0070663_1000489832 | 155 |
| 450 | 3300005455 | Ga0070663_100297645 | Ga0070663_1002976452 | 155 |
| 451 | 3300005456 | Ga0070678_100004494 | Ga0070678_1000044942 | 155 |
| 452 | 3300005456 | Ga0070678_100288382 | Ga0070678_1002883822 | 155 |
| 453 | 3300005456 | Ga0070678_100527550 | Ga0070678_1005275502 | 155 |
| 454 | 3300005457 | Ga0070662_100066064 | Ga0070662_1000660644 | 155 |
| 455 | 3300005457 | Ga0070662_100508162 | Ga0070662_1005081621 | 155 |
| 456 | 3300005457 | Ga0070662_101022000 | Ga0070662_1010220001 | 155 |
| 457 | 3300005459 | Ga0068867_100023064 | Ga0068867_1000230645 | 155 |
| 458 | 3300005459 | Ga0068867_100329399 | Ga0068867_1003293992 | 155 |
| 459 | 3300005471 | Ga0070698_100706138 | Ga0070698_1007061382 | 155 |
| 460 | 3300005518 | Ga0070699_101293634 | Ga0070699_1012936341 | 155 |
| 461 | 3300005535 | Ga0070684_100361993 | Ga0070684_1003619932 | 155 |
| 462 | 3300005535 | Ga0070684_101014832 | Ga0070684_1010148321 | 155 |
| 463 | 3300005539 | Ga0068853_100494917 | Ga0068853_1004949171 | 155 |
| 464 | 3300005539 | Ga0068853_101322429 | Ga0068853_1013224291 | 155 |
| 465 | 3300005544 | Ga0070686_100023591 | Ga0070686_1000235912 | 155 |
| 466 | 3300005546 | Ga0070696_100317270 | Ga0070696_1003172702 | 155 |
| 467 | 3300005548 | Ga0070665_100003438 | Ga0070665_1000034385 | 155 |
| 468 | 3300005548 | Ga0070665_100004774 | Ga0070665_10000477411 | 155 |
| 469 | 3300005548 | Ga0070665_100005873 | Ga0070665_10000587311 | 155 |
| 470 | 3300005548 | Ga0070665_100085408 | Ga0070665_1000854082 | 155 |
| 471 | 3300005548 | Ga0070665_100143770 | Ga0070665_1001437703 | 155 |
| 472 | 3300005548 | Ga0070665_100172272 | Ga0070665_1001722725 | 155 |
| 473 | 3300005548 | Ga0070665_100431501 | Ga0070665_1004315012 | 155 |
| 474 | 3300005563 | Ga0068855_100616514 | Ga0068855_1006165141 | 155 |
| 475 | 3300005564 | Ga0070664_100023548 | Ga0070664_1000235483 | 155 |
| 476 | 3300005564 | Ga0070664_100088114 | Ga0070664_1000881143 | 155 |
| 477 | 3300005564 | Ga0070664_100557801 | Ga0070664_1005578012 | 155 |
| 478 | 3300005578 | Ga0068854_100096778 | Ga0068854_1000967782 | 155 |
| 479 | 3300005615 | Ga0070702_101029207 | Ga0070702_1010292071 | 155 |
| 480 | 3300005616 | Ga0068852_100365789 | Ga0068852_1003657892 | 155 |
| 481 | 3300005617 | Ga0068859_100154620 | Ga0068859_1001546202 | 155 |
| 482 | 3300005617 | Ga0068859_100158290 | Ga0068859_1001582902 | 155 |
| 483 | 3300005617 | Ga0068859_102126853 | Ga0068859_1021268531 | 155 |
| 484 | 3300005618 | Ga0068864_100006935 | Ga0068864_1000069353 | 155 |
| 485 | 3300005618 | Ga0068864_101774345 | Ga0068864_1017743451 | 155 |
| 486 | 3300005718 | Ga0068866_10095643 | Ga0068866_100956432 | 155 |
| 487 | 3300005718 | Ga0068866_10300203 | Ga0068866_103002031 | 155 |
| 488 | 3300005719 | Ga0068861_100125962 | Ga0068861_1001259621 | 155 |
| 489 | 3300005834 | Ga0068851_10199555 | Ga0068851_101995552 | 155 |
| 490 | 3300005841 | Ga0068863_100352419 | Ga0068863_1003524192 | 155 |
| 491 | 3300005841 | Ga0068863_100377167 | Ga0068863_1003771672 | 155 |
| 492 | 3300005842 | Ga0068858_100295509 | Ga0068858_1002955092 | 155 |
| 493 | 3300005842 | Ga0068858_100488808 | Ga0068858_1004888082 | 155 |
| 494 | 3300005843 | Ga0068860_100020202 | Ga0068860_1000202022 | 155 |
| 495 | 3300005843 | Ga0068860_100078781 | Ga0068860_1000787814 | 155 |
| 496 | 3300005843 | Ga0068860_100082501 | Ga0068860_1000825012 | 155 |
| 497 | 3300005843 | Ga0068860_100105179 | Ga0068860_1001051794 | 155 |
| 498 | 3300005844 | Ga0068862_100043104 | Ga0068862_1000431044 | 155 |
| 499 | 3300005844 | Ga0068862_100075313 | Ga0068862_1000753133 | 155 |
| 500 | 3300005844 | Ga0068862_100186183 | Ga0068862_1001861832 | 155 |
| 501 | 3300005844 | Ga0068862_100422331 | Ga0068862_1004223312 | 155 |
| 502 | 3300005844 | Ga0068862_100430201 | Ga0068862_1004302012 | 155 |
| 503 | 3300005844 | Ga0068862_100716423 | Ga0068862_1007164232 | 155 |
| 504 | 3300005937 | Ga0081455_10035127 | Ga0081455_100351273 | 155 |
| 505 | 3300005983 | Ga0081540_1000593 | Ga0081540_100059327 | 155 |
| 506 | 3300005983 | Ga0081540_1006150 | Ga0081540_100615011 | 155 |
| 507 | 3300005983 | Ga0081540_1006500 | Ga0081540_10065008 | 155 |
| 508 | 3300005983 | Ga0081540_1026322 | Ga0081540_10263225 | 155 |
| 509 | 3300005983 | Ga0081540_1030811 | Ga0081540_10308113 | 155 |
| 510 | 3300005983 | Ga0081540_1040425 | Ga0081540_10404253 | 155 |
| 511 | 3300005985 | Ga0081539_10000540 | Ga0081539_1000054043 | 155 |
| 512 | 3300006028 | Ga0070717_10053957 | Ga0070717_100539572 | 155 |
| 513 | 3300006038 | Ga0075365_10022471 | Ga0075365_100224716 | 155 |
| 514 | 3300006038 | Ga0075365_10023658 | Ga0075365_100236582 | 155 |
| 515 | 3300006038 | Ga0075365_10049826 | Ga0075365_100498263 | 155 |
| 516 | 3300006038 | Ga0075365_10071461 | Ga0075365_100714612 | 155 |
| 517 | 3300006042 | Ga0075368_10003916 | Ga0075368_100039162 | 155 |
| 518 | 3300006042 | Ga0075368_10067536 | Ga0075368_100675361 | 155 |
| 519 | 3300006048 | Ga0075363_100002441 | Ga0075363_1000024417 | 155 |
| 520 | 3300006048 | Ga0075363_100060854 | Ga0075363_1000608542 | 155 |
| 521 | 3300006048 | Ga0075363_100273612 | Ga0075363_1002736122 | 155 |
| 522 | 3300006051 | Ga0075364_10033031 | Ga0075364_100330313 | 155 |
| 523 | 3300006051 | Ga0075364_10228067 | Ga0075364_102280671 | 155 |
| 524 | 3300006058 | Ga0075432_10031095 | Ga0075432_100310951 | 155 |
| 525 | 3300006163 | Ga0070715_10006335 | Ga0070715_100063352 | 155 |
| 526 | 3300006163 | Ga0070715_10033991 | Ga0070715_100339913 | 155 |
| 527 | 3300006175 | Ga0070712_100057991 | Ga0070712_1000579913 | 155 |
| 528 | 3300006175 | Ga0070712_100135255 | Ga0070712_1001352552 | 155 |
| 529 | 3300006177 | Ga0075362_10085363 | Ga0075362_100853632 | 155 |
| 530 | 3300006177 | Ga0075362_10219645 | Ga0075362_102196452 | 155 |
| 531 | 3300006178 | Ga0075367_10025995 | Ga0075367_100259952 | 155 |
| 532 | 3300006178 | Ga0075367_10055799 | Ga0075367_100557992 | 155 |
| 533 | 3300006186 | Ga0075369_10004104 | Ga0075369_100041043 | 155 |
| 534 | 3300006186 | Ga0075369_10014424 | Ga0075369_100144243 | 155 |
| 535 | 3300006186 | Ga0075369_10019721 | Ga0075369_100197212 | 155 |
| 536 | 3300006186 | Ga0075369_10099537 | Ga0075369_100995371 | 155 |
| 537 | 3300006195 | Ga0075366_10017253 | Ga0075366_100172535 | 155 |
| 538 | 3300006195 | Ga0075366_10023675 | Ga0075366_100236755 | 155 |
| 539 | 3300006195 | Ga0075366_10121023 | Ga0075366_101210233 | 155 |
| 540 | 3300006195 | Ga0075366_10467346 | Ga0075366_104673462 | 155 |
| 541 | 3300006237 | Ga0097621_100208875 | Ga0097621_1002088752 | 155 |
| 542 | 3300006353 | Ga0075370_10002280 | Ga0075370_100022808 | 155 |
| 543 | 3300006353 | Ga0075370_10234718 | Ga0075370_102347182 | 155 |
| 544 | 3300006358 | Ga0068871_100062631 | Ga0068871_1000626313 | 155 |
| 545 | 3300006358 | Ga0068871_100320918 | Ga0068871_1003209182 | 155 |
| 546 | 3300006844 | Ga0075428_100033777 | Ga0075428_1000337773 | 155 |
| 547 | 3300006871 | Ga0075434_100235841 | Ga0075434_1002358412 | 155 |
| 548 | 3300006871 | Ga0075434_100898312 | Ga0075434_1008983122 | 155 |
| 549 | 3300006881 | Ga0068865_100108704 | Ga0068865_1001087042 | 155 |
| 550 | 3300006931 | Ga0097620_100154632 | Ga0097620_1001546322 | 155 |
| 551 | 3300006931 | Ga0097620_100158281 | Ga0097620_1001582812 | 155 |
| 552 | 3300006931 | Ga0097620_102126787 | Ga0097620_1021267871 | 155 |
| 553 | 3300009094 | Ga0111539_10728243 | Ga0111539_107282432 | 155 |
| 554 | 3300009094 | Ga0111539_10860674 | Ga0111539_108606741 | 155 |
| 555 | 3300009098 | Ga0105245_10679716 | Ga0105245_106797162 | 155 |
| 556 | 3300009148 | Ga0105243_10402347 | Ga0105243_104023472 | 155 |
| 557 | 3300009148 | Ga0105243_11223449 | Ga0105243_112234491 | 155 |
| 558 | 3300009148 | Ga0105243_11644719 | Ga0105243_116447191 | 155 |
| 559 | 3300009176 | Ga0105242_10127123 | Ga0105242_101271232 | 155 |
| 560 | 3300009177 | Ga0105248_10949390 | Ga0105248_109493901 | 155 |
| 561 | 3300009551 | Ga0105238_10924465 | Ga0105238_109244651 | 155 |
| 562 | 3300010375 | Ga0105239_10039057 | Ga0105239_100390577 | 155 |
| 563 | 3300010375 | Ga0105239_10734712 | Ga0105239_107347122 | 155 |
| 564 | 3300011119 | Ga0105246_10508993 | Ga0105246_105089932 | 155 |
| 565 | 3300013297 | Ga0157378_10201301 | Ga0157378_102013012 | 155 |
| 566 | 3300013297 | Ga0157378_10260073 | Ga0157378_102600732 | 155 |
| 567 | 3300013308 | Ga0157375_10577157 | Ga0157375_105771571 | 155 |
| 568 | 3300014968 | Ga0157379_10184181 | Ga0157379_101841812 | 155 |
| 569 | 3300014969 | Ga0157376_10487458 | Ga0157376_104874582 | 155 |
| 570 | 3300017792 | Ga0163161_10042832 | Ga0163161_100428325 | 155 |
| 571 | 3300021377 | Ga0213874_10009393 | Ga0213874_100093932 | 155 |
| 572 | 3300021384 | Ga0213876_10003083 | Ga0213876_100030837 | 155 |
| 573 | 3300025297 | Ga0209758_1009323 | Ga0209758_10093234 | 155 |
| 574 | 3300025315 | Ga0207697_10411676 | Ga0207697_104116761 | 155 |
| 575 | 3300025321 | Ga0207656_10062344 | Ga0207656_100623442 | 155 |
| 576 | 3300025711 | Ga0207696_1014062 | Ga0207696_10140622 | 155 |
| 577 | 3300025885 | Ga0207653_10184911 | Ga0207653_101849111 | 155 |
| 578 | 3300025898 | Ga0207692_10004082 | Ga0207692_100040822 | 155 |
| 579 | 3300025900 | Ga0207710_10020363 | Ga0207710_100203635 | 155 |
| 580 | 3300025901 | Ga0207688_10032387 | Ga0207688_100323872 | 155 |
| 581 | 3300025901 | Ga0207688_10090051 | Ga0207688_100900512 | 155 |
| 582 | 3300025905 | Ga0207685_10006127 | Ga0207685_100061272 | 155 |
| 583 | 3300025905 | Ga0207685_10162612 | Ga0207685_101626121 | 155 |
| 584 | 3300025906 | Ga0207699_10004153 | Ga0207699_100041532 | 155 |
| 585 | 3300025906 | Ga0207699_10004799 | Ga0207699_100047993 | 155 |
| 586 | 3300025908 | Ga0207643_10030909 | Ga0207643_100309092 | 155 |
| 587 | 3300025909 | Ga0207705_10337885 | Ga0207705_103378852 | 155 |
| 588 | 3300025911 | Ga0207654_10062790 | Ga0207654_100627902 | 155 |
| 589 | 3300025911 | Ga0207654_10480245 | Ga0207654_104802451 | 155 |
| 590 | 3300025911 | Ga0207654_10614650 | Ga0207654_106146501 | 155 |
| 591 | 3300025914 | Ga0207671_10595949 | Ga0207671_105959491 | 155 |
| 592 | 3300025915 | Ga0207693_10004353 | Ga0207693_100043534 | 155 |
| 593 | 3300025915 | Ga0207693_10067083 | Ga0207693_100670832 | 155 |
| 594 | 3300025916 | Ga0207663_10004725 | Ga0207663_100047255 | 155 |
| 595 | 3300025920 | Ga0207649_10186483 | Ga0207649_101864832 | 155 |
| 596 | 3300025924 | Ga0207694_10075049 | Ga0207694_100750493 | 155 |
| 597 | 3300025924 | Ga0207694_11117301 | Ga0207694_111173011 | 155 |
| 598 | 3300025926 | Ga0207659_10132188 | Ga0207659_101321882 | 155 |
| 599 | 3300025926 | Ga0207659_10570478 | Ga0207659_105704782 | 155 |
| 600 | 3300025927 | Ga0207687_10025800 | Ga0207687_100258003 | 155 |
| 601 | 3300025927 | Ga0207687_10585756 | Ga0207687_105857562 | 155 |
| 602 | 3300025928 | Ga0207700_10009417 | Ga0207700_100094174 | 155 |
| 603 | 3300025928 | Ga0207700_10349002 | Ga0207700_103490022 | 155 |
| 604 | 3300025929 | Ga0207664_10489638 | Ga0207664_104896382 | 155 |
| 605 | 3300025931 | Ga0207644_10060170 | Ga0207644_100601703 | 155 |
| 606 | 3300025931 | Ga0207644_10356789 | Ga0207644_103567892 | 155 |
| 607 | 3300025932 | Ga0207690_10089665 | Ga0207690_100896652 | 155 |
| 608 | 3300025932 | Ga0207690_10160650 | Ga0207690_101606502 | 155 |
| 609 | 3300025933 | Ga0207706_10027761 | Ga0207706_100277615 | 155 |
| 610 | 3300025933 | Ga0207706_10329815 | Ga0207706_103298152 | 155 |
| 611 | 3300025933 | Ga0207706_10439200 | Ga0207706_104392002 | 155 |
| 612 | 3300025933 | Ga0207706_10756706 | Ga0207706_107567062 | 155 |
| 613 | 3300025934 | Ga0207686_10836803 | Ga0207686_108368032 | 155 |
| 614 | 3300025935 | Ga0207709_10029974 | Ga0207709_100299745 | 155 |
| 615 | 3300025935 | Ga0207709_10118109 | Ga0207709_101181092 | 155 |
| 616 | 3300025935 | Ga0207709_10226252 | Ga0207709_102262522 | 155 |
| 617 | 3300025935 | Ga0207709_10236466 | Ga0207709_102364661 | 155 |
| 618 | 3300025937 | Ga0207669_10058495 | Ga0207669_100584952 | 155 |
| 619 | 3300025937 | Ga0207669_10666742 | Ga0207669_106667421 | 155 |
| 620 | 3300025938 | Ga0207704_10076226 | Ga0207704_100762262 | 155 |
| 621 | 3300025938 | Ga0207704_10190904 | Ga0207704_101909042 | 155 |
| 622 | 3300025940 | Ga0207691_10317465 | Ga0207691_103174652 | 155 |
| 623 | 3300025941 | Ga0207711_10018890 | Ga0207711_100188904 | 155 |
| 624 | 3300025941 | Ga0207711_10201003 | Ga0207711_102010032 | 155 |
| 625 | 3300025941 | Ga0207711_10879889 | Ga0207711_108798891 | 155 |
| 626 | 3300025942 | Ga0207689_10003039 | Ga0207689_100030395 | 155 |
| 627 | 3300025942 | Ga0207689_10197151 | Ga0207689_101971512 | 155 |
| 628 | 3300025942 | Ga0207689_10367921 | Ga0207689_103679212 | 155 |
| 629 | 3300025961 | Ga0207712_10062247 | Ga0207712_100622472 | 155 |
| 630 | 3300025961 | Ga0207712_11041460 | Ga0207712_110414601 | 155 |
| 631 | 3300025961 | Ga0207712_11281943 | Ga0207712_112819431 | 155 |
| 632 | 3300025972 | Ga0207668_10025281 | Ga0207668_100252815 | 155 |
| 633 | 3300025972 | Ga0207668_10189802 | Ga0207668_101898022 | 155 |
| 634 | 3300025972 | Ga0207668_11241655 | Ga0207668_112416551 | 155 |
| 635 | 3300025972 | Ga0207668_11251327 | Ga0207668_112513272 | 155 |
| 636 | 3300025986 | Ga0207658_10149805 | Ga0207658_101498052 | 155 |
| 637 | 3300026023 | Ga0207677_10010242 | Ga0207677_100102422 | 155 |
| 638 | 3300026035 | Ga0207703_10095396 | Ga0207703_100953964 | 155 |
| 639 | 3300026035 | Ga0207703_10512737 | Ga0207703_105127371 | 155 |
| 640 | 3300026041 | Ga0207639_10098654 | Ga0207639_100986543 | 155 |
| 641 | 3300026067 | Ga0207678_10014071 | Ga0207678_100140712 | 155 |
| 642 | 3300026067 | Ga0207678_10042599 | Ga0207678_100425995 | 155 |
| 643 | 3300026075 | Ga0207708_10051349 | Ga0207708_100513493 | 155 |
| 644 | 3300026075 | Ga0207708_10767841 | Ga0207708_107678412 | 155 |
| 645 | 3300026078 | Ga0207702_10948323 | Ga0207702_109483232 | 155 |
| 646 | 3300026088 | Ga0207641_10081176 | Ga0207641_100811762 | 155 |
| 647 | 3300026088 | Ga0207641_10333328 | Ga0207641_103333282 | 155 |
| 648 | 3300026089 | Ga0207648_10185634 | Ga0207648_101856342 | 155 |
| 649 | 3300026089 | Ga0207648_11016727 | Ga0207648_110167272 | 155 |
| 650 | 3300026095 | Ga0207676_10048066 | Ga0207676_100480662 | 155 |
| 651 | 3300026116 | Ga0207674_10090218 | Ga0207674_100902183 | 155 |
| 652 | 3300026116 | Ga0207674_10743220 | Ga0207674_107432201 | 155 |
| 653 | 3300026118 | Ga0207675_100019856 | Ga0207675_1000198562 | 155 |
| 654 | 3300026118 | Ga0207675_100149033 | Ga0207675_1001490332 | 155 |
| 655 | 3300026118 | Ga0207675_100283907 | Ga0207675_1002839072 | 155 |
| 656 | 3300026118 | Ga0207675_100360595 | Ga0207675_1003605952 | 155 |
| 657 | 3300026121 | Ga0207683_10038321 | Ga0207683_100383212 | 155 |
| 658 | 3300026121 | Ga0207683_10080281 | Ga0207683_100802813 | 155 |
| 659 | 3300026142 | Ga0207698_10265673 | Ga0207698_102656732 | 155 |
| 660 | 3300027866 | Ga0209813_10037465 | Ga0209813_100374652 | 155 |
| 661 | 3300027866 | Ga0209813_10039924 | Ga0209813_100399242 | 155 |
| 662 | 3300027907 | Ga0207428_10142989 | Ga0207428_101429892 | 155 |
| 663 | 3300027907 | Ga0207428_10175944 | Ga0207428_101759442 | 155 |
| 664 | 3300028379 | Ga0268266_10003152 | Ga0268266_100031528 | 155 |
| 665 | 3300028379 | Ga0268266_10003898 | Ga0268266_100038987 | 155 |
| 666 | 3300028379 | Ga0268266_10378699 | Ga0268266_103786992 | 155 |
| 667 | 3300028379 | Ga0268266_10456467 | Ga0268266_104564672 | 155 |
| 668 | 3300028380 | Ga0268265_10029614 | Ga0268265_100296142 | 155 |
| 669 | 3300028380 | Ga0268265_10064367 | Ga0268265_100643672 | 155 |
| 670 | 3300028380 | Ga0268265_10204263 | Ga0268265_102042632 | 155 |
| 671 | 3300028380 | Ga0268265_10961234 | Ga0268265_109612342 | 155 |
| 672 | 3300028380 | Ga0268265_11736028 | Ga0268265_117360281 | 155 |
| 673 | 3300028381 | Ga0268264_10181238 | Ga0268264_101812382 | 155 |
| 674 | 3300028381 | Ga0268264_10184418 | Ga0268264_101844183 | 155 |
| 675 | 3300031235 | Ga0265330_10067366 | Ga0265330_100673663 | 155 |
| 676 | 3300031235 | Ga0265330_10117267 | Ga0265330_101172671 | 155 |
| 677 | 3300031238 | Ga0265332_10094454 | Ga0265332_100944542 | 155 |
| 678 | 3300031239 | Ga0265328_10027277 | Ga0265328_100272772 | 155 |
| 679 | 3300031241 | Ga0265325_10007395 | Ga0265325_100073952 | 155 |
| 680 | 3300031250 | Ga0265331_10028361 | Ga0265331_100283613 | 155 |
| 681 | 3300031344 | Ga0265316_10309092 | Ga0265316_103090922 | 155 |
| 682 | 3300031507 | Ga0307509_10443893 | Ga0307509_104438931 | 155 |
| 683 | 3300031548 | Ga0307408_100615471 | Ga0307408_1006154711 | 155 |
| 684 | 3300031616 | Ga0307508_10000019 | Ga0307508_10000019150 | 155 |
| 685 | 3300031711 | Ga0265314_10054870 | Ga0265314_100548703 | 155 |
| 686 | 3300031711 | Ga0265314_10095948 | Ga0265314_100959483 | 155 |
| 687 | 3300031731 | Ga0307405_10017527 | Ga0307405_100175274 | 155 |
| 688 | 3300031731 | Ga0307405_10156756 | Ga0307405_101567562 | 155 |
| 689 | 3300031901 | Ga0307406_10168624 | Ga0307406_101686243 | 155 |
| 690 | 3300031903 | Ga0307407_10681111 | Ga0307407_106811111 | 155 |
| 691 | 3300032002 | Ga0307416_100413224 | Ga0307416_1004132241 | 155 |
| 692 | 3300032002 | Ga0307416_101430000 | Ga0307416_1014300001 | 155 |
| 693 | 3300032002 | Ga0307416_101455018 | Ga0307416_1014550181 | 155 |
| 694 | 3300032004 | Ga0307414_10708662 | Ga0307414_107086621 | 155 |
| 695 | 3300032005 | Ga0307411_10073467 | Ga0307411_100734673 | 155 |
| 696 | 3300032005 | Ga0307411_10322343 | Ga0307411_103223431 | 155 |
| 697 | 3300033544 | Ga0316215_1010673 | Ga0316215_10106732 | 155 |
| 698 | 3300035113 | Ga0373936_0164665 | Ga0373936_0164665_339_809 | 155 |
| 699 | 3300035116 | Ga0373945_0190380 | Ga0373945_0190380_303_773 | 155 |
| 700 | 3300035119 | Ga0373956_0074461 | Ga0373956_0074461_887_1366 | 155 |
| 701 | 3300035120 | Ga0373957_0119288 | Ga0373957_0119288_484_963 | 155 |
| 702 | 3300035172 | Ga0373955_0175089 | Ga0373955_0175089_577_1056 | 155 |
| 703 | 3300035410 | Ga0373924_0369016 | Ga0373924_0369016_124_603 | 155 |
| 704 | 3300035724 | Ga0373933_0052338 | Ga0373933_0052338_585_1070 | 155 |
| 705 | 3300036401 | Ga0373937_0443008 | Ga0373937_0443008_201_686 | 155 |
| 706 | 3300037068 | Ga0373925_0087733 | Ga0373925_0087733_286_756 | 155 |
| 707 | 3300037466 | Ga0395898_0642089 | Ga0395898_0642089_498_971 | 155 |
| 708 | 3300039437 | Ga0436365_1134510 | Ga0436365_1134510_105_578 | 155 |
| 709 | 3300039438 | Ga0436360_0696571 | Ga0436360_0696571_479_952 | 155 |
| 710 | 3300039447 | Ga0436361_0805688 | Ga0436361_0805688_68_562 | 155 |
| 711 | 3300039450 | Ga0436363_0338950 | Ga0436363_0338950_261_746 | 155 |
| 712 | 3300041458 | Ga0451798_1121007 | Ga0451798_1121007_317_787 | 155 |
| 713 | 3300041496 | Ga0451839_0711916 | Ga0451839_0711916_39_506 | 155 |
| 714 | 3300041509 | Ga0451843_0395955 | Ga0451843_0395955_118_585 | 155 |
| 715 | 3300041509 | Ga0451843_0526573 | Ga0451843_0526573_129_596 | 155 |
| 716 | 3300041509 | Ga0451843_0754939 | Ga0451843_0754939_94_573 | 155 |
| 717 | 3300046462 | Ga0495651_0029177 | Ga0495651_0029177_1483_1968 | 155 |
| 718 | 3300046462 | Ga0495651_0336986 | Ga0495651_0336986_379_858 | 155 |
| 719 | 3300046463 | Ga0495653_0025373 | Ga0495653_0025373_274_753 | 155 |
| 720 | 3300046472 | Ga0495580_0346465 | Ga0495580_0346465_380_850 | 155 |
| 721 | 3300046474 | Ga0495605_0130315 | Ga0495605_0130315_237_704 | 155 |
| 722 | 3300046477 | Ga0495664_0039984 | Ga0495664_0039984_918_1397 | 155 |
| 723 | 3300046492 | Ga0495585_0092838 | Ga0495585_0092838_282_749 | 155 |
| 724 | 3300046511 | Ga0495608_0153699 | Ga0495608_0153699_670_1149 | 155 |
| 725 | 3300046514 | Ga0495618_0350108 | Ga0495618_0350108_258_737 | 155 |
| 726 | 3300046516 | Ga0495628_0319441 | Ga0495628_0319441_645_1124 | 155 |
| 727 | 3300046517 | Ga0495630_0252705 | Ga0495630_0252705_153_632 | 155 |
| 728 | 3300046520 | Ga0495637_0251748 | Ga0495637_0251748_67_534 | 155 |
| 729 | 3300046523 | Ga0495644_0024574 | Ga0495644_0024574_500_967 | 155 |
| 730 | 3300046529 | Ga0495652_0094228 | Ga0495652_0094228_916_1395 | 155 |
| 731 | 3300046531 | Ga0495665_0182574 | Ga0495665_0182574_134_604 | 155 |
| 732 | 3300046533 | Ga0495640_0101039 | Ga0495640_0101039_417_896 | 155 |
| 733 | 3300046536 | Ga0495587_0108070 | Ga0495587_0108070_960_1439 | 155 |
| 734 | 3300046537 | Ga0495598_0044218 | Ga0495598_0044218_378_845 | 155 |
| 735 | 3300046543 | Ga0495645_0008376 | Ga0495645_0008376_2283_2762 | 155 |
| 736 | 3300046558 | Ga0495633_0069790 | Ga0495633_0069790_1124_1591 | 155 |
| 737 | 3300046559 | Ga0495667_0086541 | Ga0495667_0086541_945_1424 | 155 |
| 738 | 3300046642 | Ga0495634_0109596 | Ga0495634_0109596_909_1388 | 155 |
| 739 | 3300046663 | Ga0495635_0042269 | Ga0495635_0042269_2083_2562 | 155 |
| 740 | 3300046675 | Ga0495657_0129035 | Ga0495657_0129035_728_1207 | 155 |
| 741 | 3300046675 | Ga0495657_0583715 | Ga0495657_0583715_20_505 | 155 |
| 742 | 3300046678 | Ga0495599_0254774 | Ga0495599_0254774_510_989 | 155 |
| 743 | 3300046679 | Ga0495623_0041617 | Ga0495623_0041617_831_1310 | 155 |
| 744 | 3300046680 | Ga0495646_0069844 | Ga0495646_0069844_1134_1613 | 155 |
| 745 | 3300046689 | Ga0495613_0618919 | Ga0495613_0618919_167_646 | 155 |
| 746 | 3300046690 | Ga0495624_0695142 | Ga0495624_0695142_39_518 | 155 |
| 747 | 3300046794 | Ga0495589_0153165 | Ga0495589_0153165_181_648 | 155 |
| 748 | 3300046794 | Ga0495589_0245218 | Ga0495589_0245218_62_532 | 155 |
| 749 | 3300046809 | Ga0495600_0043783 | Ga0495600_0043783_1406_1885 | 155 |
| 750 | 3300047315 | Ga0495581_0016977 | Ga0495581_0016977_3716_4186 | 155 |
| 751 | 3300047317 | Ga0495604_0103953 | Ga0495604_0103953_483_962 | 155 |
| 752 | 3300047319 | Ga0495674_0324562 | Ga0495674_0324562_202_681 | 155 |
| 753 | 3300047322 | Ga0495680_0127776 | Ga0495680_0127776_555_1034 | 155 |
| 754 | 3300047444 | Ga0495675_0036032 | Ga0495675_0036032_773_1252 | 155 |
| 755 | 3300047471 | Ga0495684_0036990 | Ga0495684_0036990_3117_3596 | 155 |
| 756 | 3300047472 | Ga0495686_0125776 | Ga0495686_0125776_252_761 | 155 |
| 757 | 3300047673 | Ga0495593_0183483 | Ga0495593_0183483_541_1020 | 155 |
| 758 | 3300048088 | Ga0495602_0775254 | Ga0495602_0775254_15_500 | 155 |
| 759 | 3300048907 | Ga0496104_0470140 | Ga0496104_0470140_521_988 | 155 |
| 760 | 3300048908 | Ga0496105_1185821 | Ga0496105_1185821_34_501 | 155 |
| 761 | 3300048917 | Ga0496114_0023467 | Ga0496114_0023467_3095_3562 | 155 |
| 762 | 3300048917 | Ga0496114_0324909 | Ga0496114_0324909_408_875 | 155 |
| 763 | 3300048924 | Ga0496121_0037099 | Ga0496121_0037099_3575_4048 | 155 |
| 764 | 3300048926 | Ga0496123_0130783 | Ga0496123_0130783_446_955 | 155 |
| 765 | 3300048929 | Ga0496126_0008105 | Ga0496126_0008105_8462_8971 | 155 |
| 766 | 3300048929 | Ga0496126_0352112 | Ga0496126_0352112_128_601 | 155 |
| 767 | 3300049583 | Ga0501067_0035394 | Ga0501067_0035394_916_1419 | 155 |
| 768 | 3300049585 | Ga0501069_0074010 | Ga0501069_0074010_990_1493 | 155 |
| 769 | 3300050492 | nmdc:mga0yw44_288109_c1 | nmdc:mga0yw44_288109_c1_51_518 | 155 |
| 770 | 3300050493 | nmdc:mga0k408_506532_c1 | nmdc:mga0k408_506532_c1_125_592 | 155 |
| 771 | 3300050494 | nmdc:mga06z11_328671_c1 | nmdc:mga06z11_328671_c1_180_647 | 155 |
| 772 | 3300050494 | nmdc:mga06z11_41951_c1 | nmdc:mga06z11_41951_c1_95_562 | 155 |
| 773 | 3300050495 | nmdc:mga04h51_14221_c1 | nmdc:mga04h51_14221_c1_364_831 | 155 |
| 774 | 3300050496 | nmdc:mga07m45_672249_c1 | nmdc:mga07m45_672249_c1_109_576 | 155 |
| 775 | 3300050511 | nmdc:mga08y16_355911_c1 | nmdc:mga08y16_355911_c1_201_668 | 155 |
| 776 | 3300050512 | nmdc:mga0n895_244457_c1 | nmdc:mga0n895_244457_c1_307_813 | 155 |
| 777 | 3300053077 | Ga0495601_0465035 | Ga0495601_0465035_124_603 | 155 |
| 778 | 3300053084 | Ga0495595_0150435 | Ga0495595_0150435_47_526 | 155 |
| 779 | 3300053085 | Ga0495619_0111643 | Ga0495619_0111643_558_1037 | 155 |
| 780 | 3300053099 | Ga0500654_152975 | Ga0500654_152975_93_572 | 155 |
| 781 | 3300053133 | Ga0500655_065313 | Ga0500655_065313_15_494 | 155 |
| 782 | 3300053136 | Ga0500559_0000713 | Ga0500559_0000713_6895_7368 | 155 |
| 783 | 3300053730 | Ga0500645_008674 | Ga0500645_008674_1025_1492 | 155 |
| 784 | iso_pu_bacteria | 2513237141 | 2513887911 | 155 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ozj-assembly2.cif.gz_B-3 | crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution | 0.866 | 52 | 144 |
| 3lwc-assembly1.cif.gz_A-2 | crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution | 0.8537 | 51 | 143 |
| 2q1z-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.848 | 38 | 143 |
| 2q1z-assembly2.cif.gz_D | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.8463 | 37 | 143 |
| 3cjx-assembly11.cif.gz_B | crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution | 0.8289 | 51 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q05212_199_307_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8643 | 51 | 154 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8537 | 67 | 146 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8406 | 66 | 143 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8348 | 54 | 144 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8263 | 51 | 145 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IJW0-F1-model_v4 | ChrR-like cupin domain-containing protein | 0.9716 | 59 | 155 |
|
| AF-A0A2V8IJW0-F1-model_v4 | ChrR-like cupin domain-containing protein | 0.9618 | 59 | 155 |
|
| AF-A0A7I7Q2Z2-F1-model_v4 | Uncharacterized protein | 0.9425 | 55 | 153 |
|
| AF-A0A2V7QDG8-F1-model_v4 | Cupin | 0.9414 | 70 | 153 |
|
| AF-A0A524IWX1-F1-model_v4 | Cupin domain-containing protein | 0.9349 | 53 | 153 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar