F480686

General Info

Members Datasets Scaffolds Average Seq Length
784 415 747 152

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10685547|Ga0070692_106855471
Length 169
Sequence MRAIFRSWRYLMTPLAFAGMLGIASAAELNPAAVIYKLPDQIPWGPVNAAGAQSAVVVGDPTKPGFYMVYNKWTKGNHFSRPHFHPNDRYIVVLQGTWWVGSGPKFDPANTTPMPAGSFVTHIGKQVHWDGAKDEDAVLLIMGEGPATSGDRSWQRAKALQQSQTVAHD

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2791355199
12 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
13 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
14 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
19 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
20 2904699407
21 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
22 2906610324
23 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
24 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
25 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
26 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
27 2922425934
28 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
34 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
230 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
253 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
254 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
255 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
258 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
394 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
400 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
406 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
407 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
408 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
409 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
410 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
411 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
412 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
413 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
414 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
415 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0.26
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 2.81
Rhizoplane 7.14
Rhizosphere 68.11
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10023466 3300002239 Bacteria 979
2 JGI24742J22300_10020375 3300002244 Bacteria 1130
3 JGI25406J46586_10037413 3300003203 Bacteria 1750
4 JGI25153J46596_10014910 3300003215 Bacteria 3199
5 JGI25153J46596_10111780 3300003215 Bacteria 627
6 JGI25153J46596_10141221 3300003215 Bacteria 525
7 JGI25160J50197_1003785 3300003354 Bacteria 6659
8 JGI25160J50197_1029609 3300003354 Bacteria 1444
9 JGI25404J52841_10002694 3300003659 Bacteria 3397
10 JGI25404J52841_10006830 3300003659 Bacteria 2398
11 JGI25404J52841_10013781 3300003659 Bacteria 1754
12 JGI25404J52841_10018919 3300003659 Bacteria 1492
13 JGI25404J52841_10034671 3300003659 Bacteria 1075
14 Ga0058860_11691766 3300004801 Bacteria 599
15 Ga0065165_1003606 3300005262 Bacteria 10627
16 Ga0065704_10690125 3300005289 Bacteria 565
17 Ga0070690_100092879 3300005330 Bacteria 1990
18 Ga0070670_100281566 3300005331 Bacteria 1452
19 Ga0070670_100416175 3300005331 Bacteria 1188
20 Ga0068869_100033336 3300005334 Bacteria 3635
21 Ga0068869_100430185 3300005334 Bacteria 1090
22 Ga0068869_100433352 3300005334 Bacteria 1087
23 Ga0068869_100484397 3300005334 Bacteria 1030
24 Ga0068869_100749825 3300005334 Bacteria 836
25 Ga0070666_10586418 3300005335 Bacteria 813
26 Ga0070682_100154996 3300005337 Bacteria 1576
27 Ga0070682_100389529 3300005337 Bacteria 1051
28 Ga0068868_100243267 3300005338 Bacteria 1512
29 Ga0070660_100444955 3300005339 Bacteria 1075
30 Ga0070661_100298254 3300005344 Bacteria 1254
31 Ga0070692_10685547 3300005345 Bacteria 688
32 Ga0070668_100012999 3300005347 Bacteria 6198
33 Ga0070668_100053665 3300005347 Bacteria 3108
34 Ga0070668_100058160 3300005347 Bacteria 2990
35 Ga0070668_100349174 3300005347 Bacteria 1251
36 Ga0070668_100616470 3300005347 Bacteria 951
37 Ga0070669_100337342 3300005353 Bacteria 1221
38 Ga0070675_100415254 3300005354 Bacteria 1202
39 Ga0070671_100216959 3300005355 Bacteria 1623
40 Ga0070671_100222154 3300005355 Bacteria 1602
41 Ga0070674_100278587 3300005356 Bacteria 1325
42 Ga0070674_100362813 3300005356 Bacteria 1173
43 Ga0070673_100051954 3300005364 Bacteria 3213
44 Ga0070673_100888930 3300005364 Bacteria 826
45 Ga0070688_100079031 3300005365 Bacteria 2124
46 Ga0070688_100173392 3300005365 Bacteria 1490
47 Ga0070667_100771820 3300005367 Bacteria 892
48 Ga0070703_10244751 3300005406 Bacteria 725
49 Ga0070709_10003312 3300005434 Bacteria 8668
50 Ga0070709_11225185 3300005434 Bacteria 604
51 Ga0070714_100261240 3300005435 Bacteria 1603
52 Ga0070713_100001422 3300005436 Bacteria 15343
53 Ga0070713_100018220 3300005436 Bacteria 5335
54 Ga0070713_100204510 3300005436 Bacteria 1785
55 Ga0070710_10004827 3300005437 Bacteria 6376
56 Ga0070710_10269295 3300005437 Bacteria 1101
57 Ga0070701_10175530 3300005438 Bacteria 1251
58 Ga0070711_100002142 3300005439 Bacteria 11198
59 Ga0070705_101185137 3300005440 Bacteria 629
60 Ga0070700_100107418 3300005441 Bacteria 1850
61 Ga0070700_100115143 3300005441 Bacteria 1793
62 Ga0070663_100003220 3300005455 Bacteria 9382
63 Ga0070663_100048983 3300005455 Bacteria 2998
64 Ga0070663_100297645 3300005455 Bacteria 1290
65 Ga0070678_100004494 3300005456 Bacteria 7914
66 Ga0070678_100288382 3300005456 Bacteria 1391
67 Ga0070678_100527550 3300005456 Bacteria 1045
68 Ga0070662_100066064 3300005457 Bacteria 2653
69 Ga0070662_100508162 3300005457 Bacteria 1006
70 Ga0070662_101022000 3300005457 Bacteria 708
71 Ga0070681_10137788 3300005458 Bacteria 2370
72 Ga0068867_100023064 3300005459 Bacteria 4454
73 Ga0068867_100272666 3300005459 Bacteria 1384
74 Ga0068867_100329399 3300005459 Bacteria 1268
75 Ga0070706_100275569 3300005467 Bacteria 1570
76 Ga0070706_100357193 3300005467 Bacteria 1362
77 Ga0070698_100706138 3300005471 Bacteria 951
78 Ga0070699_101293634 3300005518 Bacteria 669
79 Ga0070684_100361993 3300005535 Bacteria 1335
80 Ga0070684_101014832 3300005535 Bacteria 779
81 Ga0068853_100286156 3300005539 Bacteria 1520
82 Ga0068853_100381106 3300005539 Bacteria 1317
83 Ga0068853_100417547 3300005539 Bacteria 1258
84 Ga0068853_100494917 3300005539 Bacteria 1154
85 Ga0068853_101322429 3300005539 Bacteria 697
86 Ga0070686_100023591 3300005544 Bacteria 3679
87 Ga0070686_100085499 3300005544 Bacteria 2098
88 Ga0070696_100317270 3300005546 Bacteria 1198
89 Ga0070665_100003438 3300005548 Bacteria 16894
90 Ga0070665_100004774 3300005548 Bacteria 14113
91 Ga0070665_100005873 3300005548 Bacteria 12581
92 Ga0070665_100072877 3300005548 Bacteria 3442
93 Ga0070665_100085408 3300005548 Bacteria 3161
94 Ga0070665_100143770 3300005548 Bacteria 2388
95 Ga0070665_100172272 3300005548 Bacteria 2165
96 Ga0070665_100431501 3300005548 Bacteria 1327
97 Ga0068855_100338462 3300005563 Bacteria 1660
98 Ga0068855_100616514 3300005563 Bacteria 1169
99 Ga0070664_100023548 3300005564 Bacteria 5088
100 Ga0070664_100088114 3300005564 Bacteria 2684
101 Ga0070664_100557801 3300005564 Bacteria 1059
102 Ga0068854_100096778 3300005578 Bacteria 2206
103 Ga0070702_101029207 3300005615 Bacteria 654
104 Ga0068852_100365789 3300005616 Bacteria 1412
105 Ga0068859_100154620 3300005617 Bacteria 2370
106 Ga0068859_100158290 3300005617 Bacteria 2343
107 Ga0068859_101421438 3300005617 Bacteria 765
108 Ga0068859_102126853 3300005617 Bacteria 619
109 Ga0068864_100006935 3300005618 Bacteria 9294
110 Ga0068864_100086971 3300005618 Bacteria 2751
111 Ga0068864_101774345 3300005618 Bacteria 622
112 Ga0068866_10095643 3300005718 Bacteria 1627
113 Ga0068866_10300203 3300005718 Bacteria 1003
114 Ga0068861_100125962 3300005719 Bacteria 2072
115 Ga0068851_10199555 3300005834 Bacteria 1116
116 Ga0068863_100352419 3300005841 Bacteria 1433
117 Ga0068863_100377167 3300005841 Bacteria 1385
118 Ga0068863_102226000 3300005841 Unclassified 558
119 Ga0068858_100295509 3300005842 Bacteria 1545
120 Ga0068858_100488808 3300005842 Bacteria 1188
121 Ga0068860_100020202 3300005843 Bacteria 6455
122 Ga0068860_100078781 3300005843 Bacteria 3133
123 Ga0068860_100082501 3300005843 Bacteria 3057
124 Ga0068860_100105179 3300005843 Bacteria 2695
125 Ga0068862_100043104 3300005844 Bacteria 3846
126 Ga0068862_100075313 3300005844 Bacteria 2919
127 Ga0068862_100186183 3300005844 Bacteria 1866
128 Ga0068862_100422331 3300005844 Bacteria 1251
129 Ga0068862_100430201 3300005844 Bacteria 1240
130 Ga0068862_100716423 3300005844 Bacteria 970
131 Ga0081455_10027369 3300005937 Bacteria 5225
132 Ga0081455_10035127 3300005937 Bacteria 4484
133 Ga0081455_10048375 3300005937 Bacteria 3675
134 Ga0081540_1000593 3300005983 Bacteria 34646
135 Ga0081540_1004374 3300005983 Bacteria 10802
136 Ga0081540_1006150 3300005983 Bacteria 8811
137 Ga0081540_1006500 3300005983 Bacteria 8497
138 Ga0081540_1010157 3300005983 Bacteria 6406
139 Ga0081540_1026322 3300005983 Bacteria 3323
140 Ga0081540_1030811 3300005983 Bacteria 2964
141 Ga0081540_1040425 3300005983 Bacteria 2431
142 Ga0081539_10000540 3300005985 Bacteria 78243
143 Ga0070717_10053957 3300006028 Bacteria 3313
144 Ga0075365_10022471 3300006038 Bacteria 3952
145 Ga0075365_10023658 3300006038 Bacteria 3867
146 Ga0075365_10049826 3300006038 Bacteria 2760
147 Ga0075365_10071461 3300006038 Bacteria 2336
148 Ga0075368_10003916 3300006042 Bacteria 5011
149 Ga0075368_10067536 3300006042 Bacteria 1439
150 Ga0075363_100002441 3300006048 Bacteria 7595
151 Ga0075363_100060854 3300006048 Bacteria 2034
152 Ga0075363_100273612 3300006048 Bacteria 976
153 Ga0075364_10033031 3300006051 Bacteria 3329
154 Ga0075364_10228067 3300006051 Bacteria 1265
155 Ga0075432_10031095 3300006058 Bacteria 1848
156 Ga0070715_10006335 3300006163 Bacteria 4018
157 Ga0070715_10033991 3300006163 Bacteria 2087
158 Ga0070712_100008393 3300006175 Bacteria 6495
159 Ga0070712_100057991 3300006175 Bacteria 2722
160 Ga0070712_100135255 3300006175 Bacteria 1873
161 Ga0075362_10085363 3300006177 Bacteria 1459
162 Ga0075362_10219645 3300006177 Bacteria 928
163 Ga0075367_10025995 3300006178 Bacteria 3315
164 Ga0075367_10055799 3300006178 Bacteria 2345
165 Ga0075367_10528429 3300006178 Bacteria 749
166 Ga0075369_10004104 3300006186 Bacteria 5361
167 Ga0075369_10014424 3300006186 Bacteria 3156
168 Ga0075369_10019245 3300006186 Bacteria 2786
169 Ga0075369_10019721 3300006186 Bacteria 2756
170 Ga0075369_10033206 3300006186 Bacteria 2186
171 Ga0075369_10099537 3300006186 Bacteria 1303
172 Ga0075366_10017253 3300006195 Bacteria 4153
173 Ga0075366_10023675 3300006195 Bacteria 3578
174 Ga0075366_10121023 3300006195 Bacteria 1577
175 Ga0075366_10467346 3300006195 Bacteria 779
176 Ga0097621_100208875 3300006237 Bacteria 1698
177 Ga0097621_100720634 3300006237 Bacteria 919
178 Ga0075370_10002280 3300006353 Bacteria 8846
179 Ga0075370_10234718 3300006353 Bacteria 1086
180 Ga0068871_100062631 3300006358 Bacteria 3040
181 Ga0068871_100320918 3300006358 Bacteria 1364
182 Ga0068871_100647796 3300006358 Bacteria 964
183 Ga0075428_100033777 3300006844 Bacteria 5645
184 Ga0075434_100235841 3300006871 Bacteria 1849
185 Ga0075434_100898312 3300006871 Bacteria 901
186 Ga0068865_100108704 3300006881 Bacteria 2042
187 Ga0068865_100127808 3300006881 Bacteria 1900
188 Ga0097620_100154632 3300006931 Bacteria 2370
189 Ga0097620_100158281 3300006931 Bacteria 2343
190 Ga0097620_101421862 3300006931 Bacteria 765
191 Ga0097620_102126787 3300006931 Bacteria 619
192 Ga0105251_10170380 3300009011 Bacteria 981
193 Ga0111539_10728243 3300009094 Bacteria 1155
194 Ga0111539_10860674 3300009094 Bacteria 1055
195 Ga0105245_10008778 3300009098 Bacteria 8814
196 Ga0105245_10011732 3300009098 Bacteria 7624
197 Ga0105245_10679716 3300009098 Bacteria 1061
198 Ga0105245_11757326 3300009098 Bacteria 673
199 Ga0105247_10008803 3300009101 Bacteria 6152
200 Ga0105247_10194054 3300009101 Bacteria 1361
201 Ga0105247_10255359 3300009101 Bacteria 1200
202 Ga0114129_10420482 3300009147 Bacteria 1758
203 Ga0105243_10354044 3300009148 Bacteria 1349
204 Ga0105243_10402347 3300009148 Bacteria 1272
205 Ga0105243_10581085 3300009148 Bacteria 1075
206 Ga0105243_11223449 3300009148 Bacteria 765
207 Ga0105243_11644719 3300009148 Bacteria 670
208 Ga0105241_11337337 3300009174 Bacteria 684
209 Ga0105242_10127123 3300009176 Bacteria 2195
210 Ga0105248_10007744 3300009177 Bacteria 11795
211 Ga0105248_10011201 3300009177 Bacteria 9891
212 Ga0105248_10039465 3300009177 Bacteria 5288
213 Ga0105248_10949390 3300009177 Bacteria 971
214 Ga0105237_10119726 3300009545 Bacteria 2626
215 Ga0105238_10005670 3300009551 Bacteria 12341
216 Ga0105238_10251431 3300009551 Bacteria 1746
217 Ga0105238_10271210 3300009551 Bacteria 1677
218 Ga0105238_10362555 3300009551 Bacteria 1439
219 Ga0105238_10924465 3300009551 Bacteria 891
220 Ga0105238_11495292 3300009551 Bacteria 704
221 Ga0105249_10237224 3300009553 Bacteria 1801
222 Ga0105249_10274242 3300009553 Bacteria 1681
223 Ga0105239_10039057 3300010375 Bacteria 5200
224 Ga0105239_10048870 3300010375 Bacteria 4637
225 Ga0105239_10734712 3300010375 Bacteria 1129
226 Ga0105246_10508993 3300011119 Bacteria 1024
227 Ga0157374_10007080 3300013296 Bacteria 9550
228 Ga0157374_10734357 3300013296 Bacteria 1001
229 Ga0157378_10201301 3300013297 Bacteria 1883
230 Ga0157378_10260073 3300013297 Bacteria 1665
231 Ga0157378_12066608 3300013297 Bacteria 620
232 Ga0163162_10252002 3300013306 Bacteria 1897
233 Ga0163162_10306264 3300013306 Bacteria 1721
234 Ga0163162_10330317 3300013306 Bacteria 1657
235 Ga0163162_10516462 3300013306 Bacteria 1324
236 Ga0157375_10287452 3300013308 Bacteria 1807
237 Ga0157375_10577157 3300013308 Bacteria 1285
238 Ga0157375_10697849 3300013308 Bacteria 1169
239 Ga0157375_11153722 3300013308 Bacteria 908
240 Ga0163163_10102447 3300014325 Bacteria 2886
241 Ga0163163_10108633 3300014325 Bacteria 2801
242 Ga0163163_10252117 3300014325 Bacteria 1815
243 Ga0157380_10035872 3300014326 Bacteria 3833
244 Ga0157380_10606653 3300014326 Bacteria 1084
245 Ga0157377_10089245 3300014745 Bacteria 1817
246 Ga0157379_10176296 3300014968 Bacteria 1930
247 Ga0157379_10184181 3300014968 Bacteria 1887
248 Ga0157379_10201931 3300014968 Bacteria 1798
249 Ga0157379_10550402 3300014968 Bacteria 1073
250 Ga0157376_10440557 3300014969 Bacteria 1269
251 Ga0157376_10487458 3300014969 Bacteria 1209
252 Ga0163161_10042832 3300017792 Bacteria 3258
253 Ga0213874_10009393 3300021377 Bacteria 2417
254 Ga0213876_10003083 3300021384 Bacteria 9650
255 Ga0209233_1011287 3300025261 Bacteria 2636
256 Ga0209564_1002366 3300025295 Bacteria 15161
257 Ga0209758_1006483 3300025297 Bacteria 8380
258 Ga0209758_1009323 3300025297 Bacteria 6127
259 Ga0209758_1013025 3300025297 Bacteria 4582
260 Ga0209758_1026010 3300025297 Bacteria 2549
261 Ga0207426_1000430 3300025302 Bacteria 68540
262 Ga0207426_1000830 3300025302 Bacteria 32990
263 Ga0207426_1038146 3300025302 Bacteria 1515
264 Ga0209257_1064800 3300025304 Bacteria 981
265 Ga0207697_10411676 3300025315 Bacteria 600
266 Ga0207656_10062344 3300025321 Bacteria 1639
267 Ga0207696_1014062 3300025711 Bacteria 2759
268 Ga0207653_10184911 3300025885 Bacteria 781
269 Ga0207692_10004082 3300025898 Bacteria 5757
270 Ga0207710_10020363 3300025900 Bacteria 2836
271 Ga0207688_10032387 3300025901 Bacteria 2889
272 Ga0207688_10090051 3300025901 Bacteria 1761
273 Ga0207647_10153541 3300025904 Bacteria 1345
274 Ga0207685_10006127 3300025905 Bacteria 3247
275 Ga0207685_10162612 3300025905 Bacteria 1020
276 Ga0207699_10004153 3300025906 Bacteria 6931
277 Ga0207699_10004799 3300025906 Bacteria 6469
278 Ga0207643_10030909 3300025908 Bacteria 2984
279 Ga0207705_10337885 3300025909 Bacteria 1159
280 Ga0207684_10195736 3300025910 Bacteria 1744
281 Ga0207684_10252085 3300025910 Bacteria 1523
282 Ga0207654_10062790 3300025911 Bacteria 2178
283 Ga0207654_10480245 3300025911 Bacteria 875
284 Ga0207654_10614650 3300025911 Bacteria 776
285 Ga0207707_10028737 3300025912 Bacteria 4859
286 Ga0207671_10040447 3300025914 Bacteria 3452
287 Ga0207671_10595949 3300025914 Bacteria 881
288 Ga0207693_10004353 3300025915 Bacteria 11975
289 Ga0207693_10012394 3300025915 Bacteria 6888
290 Ga0207693_10067083 3300025915 Bacteria 2809
291 Ga0207663_10004725 3300025916 Bacteria 6806
292 Ga0207649_10170186 3300025920 Bacteria 1517
293 Ga0207649_10186483 3300025920 Bacteria 1456
294 Ga0207652_10191251 3300025921 Bacteria 1841
295 Ga0207652_10908066 3300025921 Bacteria 778
296 Ga0207694_10075049 3300025924 Bacteria 2647
297 Ga0207694_10407468 3300025924 Bacteria 1131
298 Ga0207694_11117301 3300025924 Bacteria 667
299 Ga0207659_10132188 3300025926 Bacteria 1928
300 Ga0207659_10570478 3300025926 Bacteria 963
301 Ga0207687_10024837 3300025927 Bacteria 4006
302 Ga0207687_10025800 3300025927 Bacteria 3933
303 Ga0207687_10585756 3300025927 Bacteria 939
304 Ga0207687_10971523 3300025927 Bacteria 728
305 Ga0207700_10009417 3300025928 Bacteria 6099
306 Ga0207700_10207551 3300025928 Bacteria 1654
307 Ga0207700_10349002 3300025928 Bacteria 1288
308 Ga0207664_10489638 3300025929 Bacteria 1100
309 Ga0207644_10060170 3300025931 Bacteria 2748
310 Ga0207644_10356789 3300025931 Bacteria 1188
311 Ga0207690_10089665 3300025932 Bacteria 2169
312 Ga0207690_10160650 3300025932 Bacteria 1675
313 Ga0207706_10027761 3300025933 Bacteria 5059
314 Ga0207706_10329815 3300025933 Bacteria 1328
315 Ga0207706_10439200 3300025933 Bacteria 1130
316 Ga0207706_10756706 3300025933 Bacteria 828
317 Ga0207686_10836803 3300025934 Bacteria 739
318 Ga0207709_10029974 3300025935 Bacteria 3161
319 Ga0207709_10118109 3300025935 Bacteria 1786
320 Ga0207709_10226252 3300025935 Bacteria 1352
321 Ga0207709_10236466 3300025935 Bacteria 1326
322 Ga0207709_10563603 3300025935 Bacteria 897
323 Ga0207669_10058495 3300025937 Bacteria 2352
324 Ga0207669_10666742 3300025937 Bacteria 852
325 Ga0207704_10076226 3300025938 Bacteria 2148
326 Ga0207704_10190904 3300025938 Bacteria 1490
327 Ga0207665_10175766 3300025939 Bacteria 1548
328 Ga0207691_10317465 3300025940 Bacteria 1336
329 Ga0207711_10018890 3300025941 Bacteria 5732
330 Ga0207711_10055610 3300025941 Bacteria 3398
331 Ga0207711_10122866 3300025941 Bacteria 2319
332 Ga0207711_10201003 3300025941 Bacteria 1818
333 Ga0207711_10879889 3300025941 Bacteria 833
334 Ga0207689_10003039 3300025942 Bacteria 15459
335 Ga0207689_10197151 3300025942 Bacteria 1662
336 Ga0207689_10367921 3300025942 Bacteria 1196
337 Ga0207661_10051455 3300025944 Bacteria 3287
338 Ga0207679_10418985 3300025945 Bacteria 1181
339 Ga0207651_10107402 3300025960 Bacteria 2086
340 Ga0207712_10062247 3300025961 Bacteria 2652
341 Ga0207712_11041460 3300025961 Bacteria 727
342 Ga0207712_11281943 3300025961 Bacteria 655
343 Ga0207668_10025281 3300025972 Bacteria 3841
344 Ga0207668_10189802 3300025972 Bacteria 1627
345 Ga0207668_11241655 3300025972 Bacteria 670
346 Ga0207668_11251327 3300025972 Bacteria 667
347 Ga0207658_10149805 3300025986 Bacteria 1899
348 Ga0207677_10010242 3300026023 Bacteria 5300
349 Ga0207677_11497876 3300026023 Unclassified 623
350 Ga0207703_10095396 3300026035 Bacteria 2509
351 Ga0207703_10453769 3300026035 Bacteria 1198
352 Ga0207703_10512737 3300026035 Bacteria 1127
353 Ga0207639_10098654 3300026041 Bacteria 2355
354 Ga0207639_10409835 3300026041 Bacteria 1223
355 Ga0207678_10014071 3300026067 Bacteria 7036
356 Ga0207678_10042599 3300026067 Bacteria 3932
357 Ga0207678_11521927 3300026067 Bacteria 590
358 Ga0207708_10051349 3300026075 Bacteria 3138
359 Ga0207708_10767841 3300026075 Bacteria 828
360 Ga0207702_10948323 3300026078 Bacteria 853
361 Ga0207641_10081176 3300026088 Bacteria 2816
362 Ga0207641_10333328 3300026088 Bacteria 1442
363 Ga0207641_11409131 3300026088 Unclassified 698
364 Ga0207648_10185634 3300026089 Bacteria 1842
365 Ga0207648_11016727 3300026089 Bacteria 776
366 Ga0207648_11232992 3300026089 Unclassified 703
367 Ga0207676_10048066 3300026095 Bacteria 3310
368 Ga0207676_10524426 3300026095 Bacteria 1128
369 Ga0207674_10090218 3300026116 Bacteria 3056
370 Ga0207674_10743220 3300026116 Bacteria 947
371 Ga0207675_100019856 3300026118 Bacteria 6271
372 Ga0207675_100149033 3300026118 Bacteria 2226
373 Ga0207675_100283907 3300026118 Bacteria 1609
374 Ga0207675_100360595 3300026118 Bacteria 1426
375 Ga0207683_10038321 3300026121 Bacteria 4177
376 Ga0207683_10080281 3300026121 Bacteria 2893
377 Ga0207683_11250932 3300026121 Bacteria 687
378 Ga0207698_10265673 3300026142 Bacteria 1579
379 Ga0209179_1023303 3300027512 Bacteria 1221
380 Ga0209813_10037465 3300027866 Bacteria 1461
381 Ga0209813_10039924 3300027866 Bacteria 1424
382 Ga0207428_10142989 3300027907 Bacteria 1825
383 Ga0207428_10175944 3300027907 Bacteria 1619
384 Ga0268266_10003152 3300028379 Bacteria 16738
385 Ga0268266_10003898 3300028379 Bacteria 14509
386 Ga0268266_10241555 3300028379 Bacteria 1667
387 Ga0268266_10378699 3300028379 Bacteria 1334
388 Ga0268266_10456467 3300028379 Bacteria 1215
389 Ga0268265_10029614 3300028380 Bacteria 3932
390 Ga0268265_10064367 3300028380 Bacteria 2824
391 Ga0268265_10204263 3300028380 Bacteria 1716
392 Ga0268265_10961234 3300028380 Bacteria 842
393 Ga0268265_11736028 3300028380 Bacteria 630
394 Ga0268264_10181238 3300028381 Bacteria 1913
395 Ga0268264_10184418 3300028381 Bacteria 1898
396 Ga0265762_1109151 3300030760 Bacteria 622
397 Ga0265330_10067366 3300031235 Bacteria 1551
398 Ga0265330_10117267 3300031235 Bacteria 1135
399 Ga0265332_10037508 3300031238 Bacteria 2102
400 Ga0265332_10094454 3300031238 Bacteria 1263
401 Ga0265328_10027277 3300031239 Bacteria 2142
402 Ga0265325_10000126 3300031241 Bacteria 52410
403 Ga0265325_10007395 3300031241 Bacteria 6576
404 Ga0265339_10088248 3300031249 Bacteria 1629
405 Ga0265331_10026787 3300031250 Bacteria 2895
406 Ga0265331_10028361 3300031250 Bacteria 2800
407 Ga0265316_10309092 3300031344 Bacteria 1150
408 Ga0307509_10443893 3300031507 Bacteria 993
409 Ga0307408_100615471 3300031548 Bacteria 967
410 Ga0307508_10000019 3300031616 Bacteria 197575
411 Ga0265314_10054870 3300031711 Bacteria 2755
412 Ga0265314_10095948 3300031711 Bacteria 1919
413 Ga0265342_10000931 3300031712 Bacteria 29084
414 Ga0307405_10017527 3300031731 Bacteria 3932
415 Ga0307405_10156756 3300031731 Bacteria 1608
416 Ga0307406_10168624 3300031901 Bacteria 1582
417 Ga0307407_10681111 3300031903 Bacteria 773
418 Ga0307416_100413224 3300032002 Bacteria 1391
419 Ga0307416_101430000 3300032002 Bacteria 797
420 Ga0307416_101455018 3300032002 Bacteria 791
421 Ga0307414_10708662 3300032004 Bacteria 912
422 Ga0307411_10073467 3300032005 Bacteria 2327
423 Ga0307411_10322343 3300032005 Bacteria 1248
424 Ga0307510_10027051 3300033180 Bacteria 6580
425 Ga0307510_10309560 3300033180 Bacteria 1039
426 Ga0315911_1000005 3300033442 Bacteria 426255
427 Ga0316215_1010673 3300033544 Bacteria 908
428 Ga0373930_0162344 3300034816 Bacteria 566
429 Ga0373929_0027260 3300035085 Bacteria 1199
430 Ga0373934_0106398 3300035086 Bacteria 1136
431 Ga0373944_0288450 3300035089 Bacteria 614
432 Ga0373952_0027347 3300035092 Bacteria 1245
433 Ga0373936_0164665 3300035113 Bacteria 967
434 Ga0373945_0190380 3300035116 Bacteria 848
435 Ga0373956_0074461 3300035119 Bacteria 1552
436 Ga0373957_0119288 3300035120 Bacteria 1067
437 Ga0373955_0175089 3300035172 Bacteria 1271
438 Ga0373924_0369016 3300035410 Bacteria 640
439 Ga0373931_0015543 3300035691 Bacteria 3735
440 Ga0373927_1046129 3300035695 Bacteria 538
441 Ga0373933_0052338 3300035724 Bacteria 2443
442 Ga0373937_0443008 3300036401 Bacteria 1233
443 Ga0373937_1029415 3300036401 Bacteria 772
444 Ga0373925_0087733 3300037068 Bacteria 2375
445 Ga0395898_0642089 3300037466 Bacteria 1004
446 Ga0436365_0298555 3300039437 Bacteria 4051
447 Ga0436365_1134510 3300039437 Bacteria 2102
448 Ga0436365_1933584 3300039437 Bacteria 2150
449 Ga0436360_0696571 3300039438 Bacteria 1563
450 Ga0436361_0805688 3300039447 Bacteria 853
451 Ga0436363_0092706 3300039450 Bacteria 3769
452 Ga0436363_0338950 3300039450 Bacteria 822
453 Ga0451797_0248301 3300041453 Bacteria 541
454 Ga0451798_1121007 3300041458 Bacteria 935
455 Ga0451800_0827803 3300041459 Bacteria 1072
456 Ga0451802_0400802 3300041460 Bacteria 803
457 Ga0451802_1380398 3300041460 Bacteria 555
458 Ga0451802_1497184 3300041460 Bacteria 1748
459 Ga0451807_2173839 3300041486 Bacteria 538
460 Ga0451807_2533860 3300041486 Bacteria 527
461 Ga0451839_0368182 3300041496 Bacteria 523
462 Ga0451839_0711916 3300041496 Bacteria 535
463 Ga0451841_0075291 3300041498 Bacteria 683
464 Ga0451851_0303179 3300041507 Bacteria 535
465 Ga0451843_0395955 3300041509 Bacteria 612
466 Ga0451843_0526573 3300041509 Bacteria 830
467 Ga0451843_0754939 3300041509 Bacteria 652
468 Ga0439458_0057672 3300042157 Bacteria 966
469 Ga0439459_0148240 3300042438 Bacteria 612
470 Ga0466969_0182939 3300044656 Bacteria 959
471 Ga0466966_0036027 3300044684 Bacteria 3196
472 Ga0466963_0178086 3300044694 Bacteria 1484
473 Ga0466970_0136994 3300044765 Bacteria 1347
474 Ga0466970_0257666 3300044765 Bacteria 978
475 Ga0466957_0088986 3300044842 Bacteria 1932
476 Ga0495592_0125386 3300046454 Bacteria 1802
477 Ga0495603_0016800 3300046455 Bacteria 4428
478 Ga0495603_0065464 3300046455 Bacteria 2142
479 Ga0495603_0142030 3300046455 Bacteria 1396
480 Ga0495638_0007000 3300046460 Bacteria 8134
481 Ga0495638_0362084 3300046460 Bacteria 762
482 Ga0495651_0019229 3300046462 Bacteria 5293
483 Ga0495651_0029177 3300046462 Bacteria 4302
484 Ga0495651_0336986 3300046462 Bacteria 1000
485 Ga0495653_0025373 3300046463 Bacteria 4766
486 Ga0495650_0048414 3300046471 Bacteria 1772
487 Ga0495580_0346465 3300046472 Bacteria 1007
488 Ga0495605_0130315 3300046474 Bacteria 1135
489 Ga0495639_0042405 3300046475 Bacteria 2052
490 Ga0495639_0185957 3300046475 Bacteria 1013
491 Ga0495664_0039984 3300046477 Bacteria 2772
492 Ga0495584_0136314 3300046491 Bacteria 1246
493 Ga0495584_0299199 3300046491 Bacteria 817
494 Ga0495585_0092838 3300046492 Bacteria 1624
495 Ga0495594_0195703 3300046499 Bacteria 1152
496 Ga0495606_0368463 3300046507 Bacteria 757
497 Ga0495608_0032554 3300046511 Bacteria 3524
498 Ga0495608_0153699 3300046511 Bacteria 1465
499 Ga0495616_0438066 3300046513 Bacteria 531
500 Ga0495618_0065480 3300046514 Bacteria 2310
501 Ga0495618_0350108 3300046514 Bacteria 910
502 Ga0495628_0039493 3300046516 Bacteria 3775
503 Ga0495628_0319441 3300046516 Bacteria 1146
504 Ga0495630_0252705 3300046517 Bacteria 1347
505 Ga0495631_0089943 3300046518 Bacteria 1322
506 Ga0495631_0107216 3300046518 Bacteria 1201
507 Ga0495631_0175603 3300046518 Bacteria 918
508 Ga0495632_0067050 3300046519 Bacteria 1731
509 Ga0495632_0204527 3300046519 Bacteria 898
510 Ga0495637_0251748 3300046520 Bacteria 636
511 Ga0495644_0024574 3300046523 Bacteria 2292
512 Ga0495644_0029150 3300046523 Bacteria 2086
513 Ga0495648_0118198 3300046524 Bacteria 1430
514 Ga0495648_0176005 3300046524 Bacteria 1092
515 Ga0495663_0088904 3300046525 Bacteria 1005
516 Ga0495652_0057419 3300046529 Bacteria 3300
517 Ga0495652_0094228 3300046529 Bacteria 2442
518 Ga0495654_0438224 3300046530 Bacteria 515
519 Ga0495665_0182574 3300046531 Bacteria 1090
520 Ga0495640_0101039 3300046533 Bacteria 1893
521 Ga0495587_0108070 3300046536 Bacteria 1599
522 Ga0495598_0018355 3300046537 Bacteria 1818
523 Ga0495598_0044218 3300046537 Bacteria 1315
524 Ga0495609_0465892 3300046538 Bacteria 501
525 Ga0495621_0012473 3300046539 Bacteria 2650
526 Ga0495621_0059881 3300046539 Bacteria 1380
527 Ga0495645_0008376 3300046543 Bacteria 7220
528 Ga0495645_0184596 3300046543 Bacteria 1426
529 Ga0495622_0055584 3300046557 Bacteria 1836
530 Ga0495633_0069790 3300046558 Bacteria 1640
531 Ga0495633_0170999 3300046558 Bacteria 1001
532 Ga0495667_0086541 3300046559 Bacteria 2032
533 Ga0495667_0092145 3300046559 Bacteria 1962
534 Ga0495667_0280200 3300046559 Bacteria 1058
535 Ga0495656_0271742 3300046615 Bacteria 861
536 Ga0495668_0108216 3300046616 Bacteria 1520
537 Ga0495634_0109596 3300046642 Bacteria 1776
538 Ga0495611_0152441 3300046648 Bacteria 1079
539 Ga0495635_0042269 3300046663 Bacteria 3147
540 Ga0495635_0174129 3300046663 Bacteria 1463
541 Ga0495659_0016046 3300046664 Bacteria 2467
542 Ga0495661_0174702 3300046665 Bacteria 1143
543 Ga0495588_0014003 3300046674 Bacteria 3832
544 Ga0495657_0004266 3300046675 Bacteria 11432
545 Ga0495657_0129035 3300046675 Bacteria 1585
546 Ga0495657_0583715 3300046675 Bacteria 647
547 Ga0495599_0055253 3300046678 Bacteria 2487
548 Ga0495599_0254774 3300046678 Bacteria 1067
549 Ga0495623_0029788 3300046679 Bacteria 3512
550 Ga0495623_0041617 3300046679 Bacteria 2929
551 Ga0495646_0069844 3300046680 Bacteria 2071
552 Ga0495646_0085685 3300046680 Bacteria 1828
553 Ga0495658_0633221 3300046683 Bacteria 685
554 Ga0495669_0068093 3300046684 Bacteria 1619
555 Ga0495669_0228811 3300046684 Bacteria 892
556 Ga0495613_0215839 3300046689 Bacteria 1348
557 Ga0495613_0510458 3300046689 Bacteria 808
558 Ga0495613_0618919 3300046689 Bacteria 719
559 Ga0495624_0695142 3300046690 Bacteria 604
560 Ga0495670_0072830 3300046691 Bacteria 1741
561 Ga0495671_0162833 3300046692 Bacteria 1085
562 Ga0495671_0219145 3300046692 Bacteria 921
563 Ga0495649_0381518 3300046694 Bacteria 709
564 Ga0495589_0153165 3300046794 Bacteria 1100
565 Ga0495589_0245218 3300046794 Bacteria 838
566 Ga0495600_0043783 3300046809 Bacteria 2919
567 Ga0495600_0106514 3300046809 Bacteria 1826
568 Ga0495581_0016977 3300047315 Bacteria 4230
569 Ga0495581_0377692 3300047315 Bacteria 827
570 Ga0495604_0002177 3300047317 Bacteria 15721
571 Ga0495604_0103953 3300047317 Bacteria 2082
572 Ga0495636_0087796 3300047318 Bacteria 1347
573 Ga0495636_0686768 3300047318 Bacteria 505
574 Ga0495674_0043681 3300047319 Bacteria 3988
575 Ga0495674_0324562 3300047319 Bacteria 1253
576 Ga0495676_0161618 3300047321 Bacteria 1584
577 Ga0495676_0573959 3300047321 Bacteria 736
578 Ga0495680_0019208 3300047322 Bacteria 5780
579 Ga0495680_0127776 3300047322 Bacteria 1870
580 Ga0495675_0024121 3300047444 Bacteria 3877
581 Ga0495675_0036032 3300047444 Bacteria 3157
582 Ga0495677_0118910 3300047445 Bacteria 1007
583 Ga0495677_0189766 3300047445 Bacteria 798
584 Ga0495684_0036990 3300047471 Bacteria 3742
585 Ga0495684_0235673 3300047471 Bacteria 1337
586 Ga0495686_0083913 3300047472 Bacteria 1942
587 Ga0495686_0125776 3300047472 Bacteria 1524
588 Ga0495686_0183592 3300047472 Bacteria 1211
589 Ga0495686_0238229 3300047472 Bacteria 1027
590 Ga0495686_0278801 3300047472 Bacteria 930
591 Ga0495593_0183483 3300047673 Bacteria 1054
592 Ga0495593_0355533 3300047673 Bacteria 732
593 Ga0495602_0250712 3300048088 Bacteria 1319
594 Ga0495602_0775254 3300048088 Bacteria 646
595 Ga0495615_0071328 3300048090 Bacteria 937
596 Ga0495615_0128348 3300048090 Bacteria 739
597 Ga0496100_0205347 3300048903 Bacteria 1438
598 Ga0496100_0788242 3300048903 Bacteria 744
599 Ga0496100_0997064 3300048903 Bacteria 659
600 Ga0496100_1235997 3300048903 Bacteria 589
601 Ga0496101_0216216 3300048904 Bacteria 1486
602 Ga0496101_0222684 3300048904 Bacteria 1464
603 Ga0496101_0726728 3300048904 Bacteria 784
604 Ga0496101_1222100 3300048904 Bacteria 589
605 Ga0496102_0040636 3300048905 Bacteria 4208
606 Ga0496102_0208150 3300048905 Bacteria 1844
607 Ga0496102_0741091 3300048905 Bacteria 905
608 Ga0496103_0059253 3300048906 Bacteria 2379
609 Ga0496103_0280356 3300048906 Bacteria 1072
610 Ga0496103_0394820 3300048906 Bacteria 889
611 Ga0496103_0895903 3300048906 Bacteria 556
612 Ga0496104_0045622 3300048907 Bacteria 4123
613 Ga0496104_0470140 3300048907 Bacteria 1169
614 Ga0496105_0034113 3300048908 Bacteria 4184
615 Ga0496105_1185821 3300048908 Bacteria 563
616 Ga0496107_0681932 3300048910 Bacteria 756
617 Ga0496107_0819452 3300048910 Bacteria 681
618 Ga0496107_1045882 3300048910 Bacteria 591
619 Ga0496108_0287542 3300048911 Bacteria 1431
620 Ga0496109_0045013 3300048912 Bacteria 4005
621 Ga0496109_0074066 3300048912 Bacteria 3130
622 Ga0496110_0057620 3300048913 Bacteria 3420
623 Ga0496110_0113287 3300048913 Bacteria 2439
624 Ga0496110_0162864 3300048913 Bacteria 2022
625 Ga0496110_0263391 3300048913 Bacteria 1569
626 Ga0496110_1136196 3300048913 Bacteria 690
627 Ga0496111_0039606 3300048914 Bacteria 3380
628 Ga0496111_0420607 3300048914 Bacteria 987
629 Ga0496111_0619433 3300048914 Bacteria 791
630 Ga0496111_0918155 3300048914 Bacteria 630
631 Ga0496112_0070815 3300048915 Bacteria 3446
632 Ga0496112_0145529 3300048915 Bacteria 2338
633 Ga0496112_0150309 3300048915 Bacteria 2296
634 Ga0496112_0805286 3300048915 Bacteria 864
635 Ga0496113_0050080 3300048916 Bacteria 3113
636 Ga0496113_0380833 3300048916 Bacteria 1132
637 Ga0496113_0462183 3300048916 Bacteria 1020
638 Ga0496114_0023467 3300048917 Bacteria 5035
639 Ga0496114_0057971 3300048917 Bacteria 3233
640 Ga0496114_0324909 3300048917 Bacteria 1360
641 Ga0496114_1456792 3300048917 Bacteria 572
642 Ga0496115_0294278 3300048918 Bacteria 1331
643 Ga0496115_0605571 3300048918 Bacteria 871
644 Ga0496117_0168062 3300048920 Bacteria 1276
645 Ga0496117_0375407 3300048920 Bacteria 726
646 Ga0496118_0123062 3300048921 Bacteria 1685
647 Ga0496118_0143537 3300048921 Bacteria 1508
648 Ga0496119_0113969 3300048922 Bacteria 1496
649 Ga0496119_0118063 3300048922 Bacteria 1462
650 Ga0496120_0134679 3300048923 Bacteria 1261
651 Ga0496121_0013527 3300048924 Bacteria 8755
652 Ga0496121_0037099 3300048924 Bacteria 4333
653 Ga0496121_0072545 3300048924 Bacteria 2763
654 Ga0496121_0076964 3300048924 Bacteria 2659
655 Ga0496121_0099080 3300048924 Bacteria 2253
656 Ga0496121_0118170 3300048924 Bacteria 2007
657 Ga0496121_0196370 3300048924 Bacteria 1442
658 Ga0496122_0044396 3300048925 Bacteria 3469
659 Ga0496123_0130783 3300048926 Bacteria 1391
660 Ga0496124_0096386 3300048927 Bacteria 2403
661 Ga0496124_0103264 3300048927 Bacteria 2306
662 Ga0496124_0343461 3300048927 Bacteria 1059
663 Ga0496124_0416229 3300048927 Bacteria 928
664 Ga0496125_0032589 3300048928 Bacteria 4627
665 Ga0496125_0093611 3300048928 Bacteria 2242
666 Ga0496125_0093914 3300048928 Bacteria 2237
667 Ga0496126_0008105 3300048929 Bacteria 11377
668 Ga0496126_0034641 3300048929 Bacteria 4740
669 Ga0496126_0109686 3300048929 Bacteria 2405
670 Ga0496126_0127334 3300048929 Bacteria 2203
671 Ga0496126_0180812 3300048929 Bacteria 1791
672 Ga0496126_0196317 3300048929 Bacteria 1706
673 Ga0496126_0196753 3300048929 Bacteria 1704
674 Ga0496126_0254158 3300048929 Bacteria 1463
675 Ga0496126_0281238 3300048929 Bacteria 1378
676 Ga0496126_0352112 3300048929 Bacteria 1204
677 Ga0496126_0561973 3300048929 Bacteria 904
678 Ga0496126_0579685 3300048929 Bacteria 886
679 Ga0496126_0612613 3300048929 Bacteria 856
680 Ga0501067_0035394 3300049583 Bacteria 2773
681 Ga0501069_0074010 3300049585 Bacteria 1911
682 nmdc:mga03683_647277_c1 3300050489 Bacteria 520
683 nmdc:mga03n38_187226_c1 3300050490 Bacteria 1064
684 nmdc:mga00v17_29441_c1 3300050491 Bacteria 3223
685 nmdc:mga0yw44_117103_c1 3300050492 Bacteria 1713
686 nmdc:mga0yw44_288109_c1 3300050492 Bacteria 1099
687 nmdc:mga0yw44_43667_c1 3300050492 Bacteria 2678
688 nmdc:mga0yw44_520693_c1 3300050492 Bacteria 807
689 nmdc:mga0k408_178394_c1 3300050493 Bacteria 1267
690 nmdc:mga0k408_506532_c1 3300050493 Bacteria 715
691 nmdc:mga0k408_57738_c1 3300050493 Bacteria 2253
692 nmdc:mga06z11_168821_c1 3300050494 Bacteria 1255
693 nmdc:mga06z11_17685_c1 3300050494 Bacteria 3241
694 nmdc:mga06z11_328671_c1 3300050494 Bacteria 913
695 nmdc:mga06z11_3991_c1 3300050494 Bacteria 5759
696 nmdc:mga06z11_41951_c1 3300050494 Bacteria 2292
697 nmdc:mga04h51_14221_c1 3300050495 Bacteria 1460
698 nmdc:mga04h51_63576_c1 3300050495 Bacteria 1271
699 nmdc:mga07m45_254313_c1 3300050496 Bacteria 1022
700 nmdc:mga07m45_2630_c1 3300050496 Bacteria 7147
701 nmdc:mga07m45_672249_c1 3300050496 Bacteria 596
702 nmdc:mga09592_1097526_c1 3300050508 Bacteria 661
703 nmdc:mga08y16_355911_c1 3300050511 Bacteria 1503
704 nmdc:mga0n895_237441_c1 3300050512 Bacteria 1850
705 nmdc:mga0n895_244457_c1 3300050512 Bacteria 1821
706 nmdc:mga0rr50_330318_c1 3300050513 Bacteria 1280
707 nmdc:mga0a205_562102_c1 3300050515 Bacteria 995
708 nmdc:mga0sz30_172578_c1 3300050516 Bacteria 959
709 nmdc:mga0sz30_4621_c1 3300050516 Bacteria 4986
710 nmdc:mga0sz30_64673_c1 3300050516 Bacteria 1567
711 Ga0495601_0465035 3300053077 Bacteria 817
712 Ga0495655_0131318 3300053083 Bacteria 772
713 Ga0495595_0150435 3300053084 Bacteria 1145
714 Ga0495595_0252664 3300053084 Bacteria 883
715 Ga0495619_0111643 3300053085 Bacteria 1868
716 Ga0500651_0039270 3300053093 Bacteria 2980
717 Ga0500641_0039408 3300053096 Bacteria 1903
718 Ga0500650_0169556 3300053098 Bacteria 1004
719 Ga0500654_152975 3300053099 Bacteria 805
720 Ga0500554_024351 3300053102 Bacteria 1714
721 Ga0500556_0038280 3300053104 Bacteria 1673
722 Ga0500556_0071372 3300053104 Bacteria 1298
723 Ga0500562_001337 3300053108 Bacteria 6079
724 Ga0500592_021451 3300053116 Bacteria 1040
725 Ga0500595_010617 3300053119 Bacteria 3650
726 Ga0500595_019616 3300053119 Bacteria 2450
727 Ga0500595_043771 3300053119 Bacteria 1423
728 Ga0500617_126927 3300053124 Bacteria 1044
729 Ga0500621_278494 3300053126 Bacteria 547
730 Ga0500642_0081757 3300053130 Bacteria 1485
731 Ga0500655_065313 3300053133 Bacteria 737
732 Ga0500658_0023186 3300053134 Bacteria 2367
733 Ga0500559_0000713 3300053136 Bacteria 21844
734 Ga0500559_0040415 3300053136 Bacteria 2030
735 Ga0500589_080489 3300053147 Bacteria 1455
736 Ga0500603_000301 3300053150 Bacteria 12973
737 Ga0500616_0029988 3300053153 Bacteria 2989
738 Ga0500622_0093925 3300053156 Bacteria 1484
739 Ga0500633_0239230 3300053160 Bacteria 676
740 Ga0500636_0000517 3300053177 Bacteria 20978
741 Ga0500637_0001543 3300053178 Bacteria 9829
742 Ga0500645_008674 3300053730 Bacteria 3450
743 Ga0500645_052030 3300053730 Bacteria 1194
744 Ga0500609_017002 3300053731 Bacteria 988
745 Ga0500656_025603 3300053732 Bacteria 758
746 Ga0500599_000516 3300053736 Bacteria 4050
747 Ga0500661_007512 3300055283 Bacteria 2013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0343461 Ga0496124_0343461_385_804 128
2 3300005458 Ga0070681_10137788 Ga0070681_101377882 135
3 3300005539 Ga0068853_100417547 Ga0068853_1004175472 135
4 3300025912 Ga0207707_10028737 Ga0207707_100287373 135
5 3300025921 Ga0207652_10191251 Ga0207652_101912512 135
6 3300026041 Ga0207639_10409835 Ga0207639_104098352 135
7 3300046514 Ga0495618_0065480 Ga0495618_0065480_46_459 135
8 3300046689 Ga0495613_0215839 Ga0495613_0215839_37_450 135
9 3300048920 Ga0496117_0168062 Ga0496117_0168062_613_1023 135
10 3300048922 Ga0496119_0113969 Ga0496119_0113969_693_1103 135
11 3300048924 Ga0496121_0013527 Ga0496121_0013527_4570_4980 135
12 3300048927 Ga0496124_0416229 Ga0496124_0416229_439_849 135
13 3300005337 Ga0070682_100389529 Ga0070682_1003895291 136
14 3300035086 Ga0373934_0106398 Ga0373934_0106398_671_1081 136
15 3300035695 Ga0373927_1046129 Ga0373927_1046129_56_466 136
16 3300041496 Ga0451839_0368182 Ga0451839_0368182_103_513 136
17 3300041498 Ga0451841_0075291 Ga0451841_0075291_44_454 136
18 3300044694 Ga0466963_0178086 Ga0466963_0178086_212_628 136
19 3300046475 Ga0495639_0185957 Ga0495639_0185957_580_990 136
20 3300046507 Ga0495606_0368463 Ga0495606_0368463_239_652 136
21 3300046524 Ga0495648_0118198 Ga0495648_0118198_64_477 136
22 3300046525 Ga0495663_0088904 Ga0495663_0088904_21_431 136
23 3300047315 Ga0495581_0377692 Ga0495581_0377692_24_434 136
24 3300047318 Ga0495636_0686768 Ga0495636_0686768_11_421 136
25 3300047472 Ga0495686_0183592 Ga0495686_0183592_767_1177 136
26 3300048903 Ga0496100_1235997 Ga0496100_1235997_22_432 136
27 3300048904 Ga0496101_1222100 Ga0496101_1222100_168_578 136
28 3300048913 Ga0496110_0162864 Ga0496110_0162864_797_1207 136
29 3300048914 Ga0496111_0619433 Ga0496111_0619433_42_452 136
30 3300048915 Ga0496112_0150309 Ga0496112_0150309_924_1334 136
31 3300048916 Ga0496113_0462183 Ga0496113_0462183_171_581 136
32 3300048929 Ga0496126_0281238 Ga0496126_0281238_15_425 136
33 3300053116 Ga0500592_021451 Ga0500592_021451_520_933 136
34 3300053126 Ga0500621_278494 Ga0500621_278494_50_460 136
35 3300013306 Ga0163162_10306264 Ga0163162_103062643 138
36 3300009098 Ga0105245_10008778 Ga0105245_100087783 139
37 3300025945 Ga0207679_10418985 Ga0207679_104189852 139
38 3300027512 Ga0209179_1023303 Ga0209179_10233032 139
39 3300048906 Ga0496103_0059253 Ga0496103_0059253_1847_2305 139
40 iso_pu_bacteria 2906635258 2906638421 139
41 iso_pu_bacteria 2906660503 2906663294 139
42 3300025920 Ga0207649_10170186 Ga0207649_101701862 142
43 3300046519 Ga0495632_0204527 Ga0495632_0204527_121_591 142
44 3300009551 Ga0105238_11495292 Ga0105238_114952921 143
45 3300009553 Ga0105249_10237224 Ga0105249_102372241 143
46 3300035089 Ga0373944_0288450 Ga0373944_0288450_34_468 143
47 3300046455 Ga0495603_0016800 Ga0495603_0016800_2749_3183 143
48 3300046455 Ga0495603_0065464 Ga0495603_0065464_430_861 143
49 3300046475 Ga0495639_0042405 Ga0495639_0042405_1001_1435 143
50 3300046683 Ga0495658_0633221 Ga0495658_0633221_198_632 143
51 3300047321 Ga0495676_0573959 Ga0495676_0573959_205_639 143
52 3300047445 Ga0495677_0189766 Ga0495677_0189766_49_483 143
53 3300048916 Ga0496113_0050080 Ga0496113_0050080_241_678 143
54 3300048928 Ga0496125_0032589 Ga0496125_0032589_283_717 143
55 3300053102 Ga0500554_024351 Ga0500554_024351_895_1326 143
56 3300053150 Ga0500603_000301 Ga0500603_000301_7580_8011 143
57 3300053178 Ga0500637_0001543 Ga0500637_0001543_7072_7503 143
58 3300009011 Ga0105251_10170380 Ga0105251_101703802 144
59 3300009098 Ga0105245_10011732 Ga0105245_100117326 144
60 3300009101 Ga0105247_10008803 Ga0105247_100088035 144
61 3300009101 Ga0105247_10194054 Ga0105247_101940542 144
62 3300009101 Ga0105247_10255359 Ga0105247_102553592 144
63 3300009147 Ga0114129_10420482 Ga0114129_104204822 144
64 3300009148 Ga0105243_10354044 Ga0105243_103540442 144
65 3300009174 Ga0105241_11337337 Ga0105241_113373371 144
66 3300009177 Ga0105248_10007744 Ga0105248_1000774410 144
67 3300009545 Ga0105237_10119726 Ga0105237_101197263 144
68 3300009551 Ga0105238_10251431 Ga0105238_102514312 144
69 3300009551 Ga0105238_10362555 Ga0105238_103625552 144
70 3300009553 Ga0105249_10274242 Ga0105249_102742422 144
71 3300010375 Ga0105239_10048870 Ga0105239_100488703 144
72 3300013296 Ga0157374_10007080 Ga0157374_100070805 144
73 3300013296 Ga0157374_10734357 Ga0157374_107343571 144
74 3300013297 Ga0157378_12066608 Ga0157378_120666081 144
75 3300013306 Ga0163162_10330317 Ga0163162_103303172 144
76 3300013306 Ga0163162_10516462 Ga0163162_105164622 144
77 3300013308 Ga0157375_10287452 Ga0157375_102874522 144
78 3300013308 Ga0157375_11153722 Ga0157375_111537221 144
79 3300014325 Ga0163163_10102447 Ga0163163_101024473 144
80 3300014325 Ga0163163_10108633 Ga0163163_101086332 144
81 3300014325 Ga0163163_10252117 Ga0163163_102521172 144
82 3300014326 Ga0157380_10035872 Ga0157380_100358723 144
83 3300014326 Ga0157380_10606653 Ga0157380_106066532 144
84 3300014745 Ga0157377_10089245 Ga0157377_100892452 144
85 3300014968 Ga0157379_10176296 Ga0157379_101762962 144
86 3300014968 Ga0157379_10550402 Ga0157379_105504022 144
87 3300034816 Ga0373930_0162344 Ga0373930_0162344_14_448 144
88 3300041453 Ga0451797_0248301 Ga0451797_0248301_58_492 144
89 3300041459 Ga0451800_0827803 Ga0451800_0827803_79_513 144
90 3300041460 Ga0451802_0400802 Ga0451802_0400802_122_556 144
91 3300041460 Ga0451802_1380398 Ga0451802_1380398_104_541 144
92 3300041460 Ga0451802_1497184 Ga0451802_1497184_344_778 144
93 3300041486 Ga0451807_2173839 Ga0451807_2173839_32_508 144
94 3300046455 Ga0495603_0142030 Ga0495603_0142030_33_467 144
95 3300046460 Ga0495638_0362084 Ga0495638_0362084_45_479 144
96 3300046471 Ga0495650_0048414 Ga0495650_0048414_1273_1707 144
97 3300046491 Ga0495584_0136314 Ga0495584_0136314_464_898 144
98 3300046491 Ga0495584_0299199 Ga0495584_0299199_89_523 144
99 3300046499 Ga0495594_0195703 Ga0495594_0195703_284_718 144
100 3300046513 Ga0495616_0438066 Ga0495616_0438066_60_494 144
101 3300046518 Ga0495631_0089943 Ga0495631_0089943_402_836 144
102 3300046518 Ga0495631_0107216 Ga0495631_0107216_480_914 144
103 3300046518 Ga0495631_0175603 Ga0495631_0175603_361_795 144
104 3300046519 Ga0495632_0067050 Ga0495632_0067050_49_483 144
105 3300046523 Ga0495644_0029150 Ga0495644_0029150_764_1198 144
106 3300046524 Ga0495648_0176005 Ga0495648_0176005_288_722 144
107 3300046530 Ga0495654_0438224 Ga0495654_0438224_16_450 144
108 3300046537 Ga0495598_0018355 Ga0495598_0018355_11_445 144
109 3300046538 Ga0495609_0465892 Ga0495609_0465892_42_476 144
110 3300046539 Ga0495621_0012473 Ga0495621_0012473_1828_2262 144
111 3300046539 Ga0495621_0059881 Ga0495621_0059881_582_1016 144
112 3300046557 Ga0495622_0055584 Ga0495622_0055584_1331_1765 144
113 3300046558 Ga0495633_0170999 Ga0495633_0170999_156_590 144
114 3300046559 Ga0495667_0280200 Ga0495667_0280200_532_972 144
115 3300046615 Ga0495656_0271742 Ga0495656_0271742_223_657 144
116 3300046616 Ga0495668_0108216 Ga0495668_0108216_218_652 144
117 3300046648 Ga0495611_0152441 Ga0495611_0152441_118_552 144
118 3300046664 Ga0495659_0016046 Ga0495659_0016046_1635_2069 144
119 3300046665 Ga0495661_0174702 Ga0495661_0174702_235_669 144
120 3300046674 Ga0495588_0014003 Ga0495588_0014003_1335_1769 144
121 3300046684 Ga0495669_0068093 Ga0495669_0068093_485_919 144
122 3300046684 Ga0495669_0228811 Ga0495669_0228811_132_566 144
123 3300046691 Ga0495670_0072830 Ga0495670_0072830_1005_1439 144
124 3300046692 Ga0495671_0162833 Ga0495671_0162833_630_1064 144
125 3300046692 Ga0495671_0219145 Ga0495671_0219145_71_505 144
126 3300046694 Ga0495649_0381518 Ga0495649_0381518_43_477 144
127 3300047318 Ga0495636_0087796 Ga0495636_0087796_359_793 144
128 3300047321 Ga0495676_0161618 Ga0495676_0161618_155_589 144
129 3300047445 Ga0495677_0118910 Ga0495677_0118910_200_634 144
130 3300047472 Ga0495686_0083913 Ga0495686_0083913_376_810 144
131 3300047472 Ga0495686_0238229 Ga0495686_0238229_111_545 144
132 3300048090 Ga0495615_0071328 Ga0495615_0071328_155_589 144
133 3300048090 Ga0495615_0128348 Ga0495615_0128348_135_569 144
134 3300048903 Ga0496100_0997064 Ga0496100_0997064_121_555 144
135 3300048904 Ga0496101_0216216 Ga0496101_0216216_827_1261 144
136 3300048905 Ga0496102_0040636 Ga0496102_0040636_1547_1981 144
137 3300048905 Ga0496102_0741091 Ga0496102_0741091_101_535 144
138 3300048906 Ga0496103_0394820 Ga0496103_0394820_50_484 144
139 3300048906 Ga0496103_0895903 Ga0496103_0895903_112_546 144
140 3300048910 Ga0496107_0819452 Ga0496107_0819452_235_669 144
141 3300048912 Ga0496109_0074066 Ga0496109_0074066_2550_2984 144
142 3300048913 Ga0496110_0057620 Ga0496110_0057620_2387_2821 144
143 3300048913 Ga0496110_0263391 Ga0496110_0263391_622_1056 144
144 3300048914 Ga0496111_0420607 Ga0496111_0420607_37_471 144
145 3300048914 Ga0496111_0918155 Ga0496111_0918155_30_464 144
146 3300048917 Ga0496114_1456792 Ga0496114_1456792_11_448 144
147 3300048918 Ga0496115_0294278 Ga0496115_0294278_203_637 144
148 3300048918 Ga0496115_0605571 Ga0496115_0605571_223_657 144
149 3300048920 Ga0496117_0375407 Ga0496117_0375407_216_650 144
150 3300048921 Ga0496118_0143537 Ga0496118_0143537_518_952 144
151 3300048924 Ga0496121_0072545 Ga0496121_0072545_1719_2153 144
152 3300048924 Ga0496121_0099080 Ga0496121_0099080_88_522 144
153 3300048924 Ga0496121_0118170 Ga0496121_0118170_642_1076 144
154 3300048927 Ga0496124_0096386 Ga0496124_0096386_1245_1679 144
155 3300048927 Ga0496124_0103264 Ga0496124_0103264_133_567 144
156 3300048928 Ga0496125_0093611 Ga0496125_0093611_304_738 144
157 3300048928 Ga0496125_0093914 Ga0496125_0093914_513_947 144
158 3300048929 Ga0496126_0034641 Ga0496126_0034641_2145_2579 144
159 3300048929 Ga0496126_0127334 Ga0496126_0127334_1498_1932 144
160 3300048929 Ga0496126_0180812 Ga0496126_0180812_308_742 144
161 3300048929 Ga0496126_0196753 Ga0496126_0196753_1042_1476 144
162 3300048929 Ga0496126_0612613 Ga0496126_0612613_408_842 144
163 3300050489 nmdc:mga03683_647277_c1 nmdc:mga03683_647277_c1_63_497 144
164 3300050490 nmdc:mga03n38_187226_c1 nmdc:mga03n38_187226_c1_110_544 144
165 3300050491 nmdc:mga00v17_29441_c1 nmdc:mga00v17_29441_c1_725_1159 144
166 3300050492 nmdc:mga0yw44_117103_c1 nmdc:mga0yw44_117103_c1_398_832 144
167 3300050492 nmdc:mga0yw44_43667_c1 nmdc:mga0yw44_43667_c1_1585_2019 144
168 3300050492 nmdc:mga0yw44_520693_c1 nmdc:mga0yw44_520693_c1_124_558 144
169 3300050493 nmdc:mga0k408_178394_c1 nmdc:mga0k408_178394_c1_57_491 144
170 3300050493 nmdc:mga0k408_57738_c1 nmdc:mga0k408_57738_c1_777_1211 144
171 3300050494 nmdc:mga06z11_17685_c1 nmdc:mga06z11_17685_c1_639_1073 144
172 3300050494 nmdc:mga06z11_3991_c1 nmdc:mga06z11_3991_c1_948_1382 144
173 3300050495 nmdc:mga04h51_63576_c1 nmdc:mga04h51_63576_c1_68_502 144
174 3300050496 nmdc:mga07m45_254313_c1 nmdc:mga07m45_254313_c1_488_922 144
175 3300050496 nmdc:mga07m45_2630_c1 nmdc:mga07m45_2630_c1_3335_3769 144
176 3300050508 nmdc:mga09592_1097526_c1 nmdc:mga09592_1097526_c1_189_623 144
177 3300050512 nmdc:mga0n895_237441_c1 nmdc:mga0n895_237441_c1_858_1292 144
178 3300050513 nmdc:mga0rr50_330318_c1 nmdc:mga0rr50_330318_c1_639_1073 144
179 3300050515 nmdc:mga0a205_562102_c1 nmdc:mga0a205_562102_c1_22_456 144
180 3300050516 nmdc:mga0sz30_172578_c1 nmdc:mga0sz30_172578_c1_503_937 144
181 3300050516 nmdc:mga0sz30_4621_c1 nmdc:mga0sz30_4621_c1_3118_3552 144
182 3300053083 Ga0495655_0131318 Ga0495655_0131318_26_460 144
183 3300053084 Ga0495595_0252664 Ga0495595_0252664_257_691 144
184 3300053096 Ga0500641_0039408 Ga0500641_0039408_1301_1735 144
185 3300053098 Ga0500650_0169556 Ga0500650_0169556_318_752 144
186 3300053119 Ga0500595_043771 Ga0500595_043771_222_656 144
187 3300053124 Ga0500617_126927 Ga0500617_126927_444_878 144
188 3300053134 Ga0500658_0023186 Ga0500658_0023186_1083_1517 144
189 3300053147 Ga0500589_080489 Ga0500589_080489_485_919 144
190 3300053160 Ga0500633_0239230 Ga0500633_0239230_198_632 144
191 3300053731 Ga0500609_017002 Ga0500609_017002_195_629 144
192 3300053732 Ga0500656_025603 Ga0500656_025603_257_691 144
193 3300005338 Ga0068868_100243267 Ga0068868_1002432671 146
194 3300005364 Ga0070673_100051954 Ga0070673_1000519543 146
195 3300005459 Ga0068867_100272666 Ga0068867_1002726662 146
196 3300005539 Ga0068853_100381106 Ga0068853_1003811062 146
197 3300005544 Ga0070686_100085499 Ga0070686_1000854991 146
198 3300005563 Ga0068855_100338462 Ga0068855_1003384622 146
199 3300005617 Ga0068859_101421438 Ga0068859_1014214382 146
200 3300005618 Ga0068864_100086971 Ga0068864_1000869713 146
201 3300005841 Ga0068863_102226000 Ga0068863_1022260001 146
202 3300006175 Ga0070712_100008393 Ga0070712_1000083936 146
203 3300006358 Ga0068871_100647796 Ga0068871_1006477962 146
204 3300006931 Ga0097620_101421862 Ga0097620_1014218621 146
205 3300009177 Ga0105248_10039465 Ga0105248_100394654 146
206 3300009551 Ga0105238_10271210 Ga0105238_102712102 146
207 3300025915 Ga0207693_10012394 Ga0207693_100123943 146
208 3300025927 Ga0207687_10024837 Ga0207687_100248373 146
209 3300025941 Ga0207711_10055610 Ga0207711_100556103 146
210 3300025960 Ga0207651_10107402 Ga0207651_101074023 146
211 3300026023 Ga0207677_11497876 Ga0207677_114978761 146
212 3300026035 Ga0207703_10453769 Ga0207703_104537692 146
213 3300026088 Ga0207641_11409131 Ga0207641_114091312 146
214 3300026089 Ga0207648_11232992 Ga0207648_112329922 146
215 3300026095 Ga0207676_10524426 Ga0207676_105244262 146
216 3300003659 JGI25404J52841_10002694 JGI25404J52841_100026943 147
217 3300003659 JGI25404J52841_10034671 JGI25404J52841_100346712 147
218 3300005937 Ga0081455_10027369 Ga0081455_100273694 147
219 3300005983 Ga0081540_1004374 Ga0081540_10043742 147
220 3300005983 Ga0081540_1010157 Ga0081540_10101579 147
221 3300006881 Ga0068865_100127808 Ga0068865_1001278082 147
222 3300026121 Ga0207683_11250932 Ga0207683_112509321 147
223 3300031241 Ga0265325_10000126 Ga0265325_100001267 149
224 3300041507 Ga0451851_0303179 Ga0451851_0303179_13_462 149
225 3300009551 Ga0105238_10005670 Ga0105238_1000567014 150
226 iso_pu_bacteria 2513237096 2513655542 150
227 iso_pu_bacteria 2513237137 2513859773 150
228 iso_pu_bacteria 2513237145 2513916380 150
229 iso_pu_bacteria 2517572143 2517890007 150
230 iso_pu_bacteria 2524023228 2524534927 150
231 iso_pu_bacteria 2667528175 2671120962 150
232 iso_pu_bacteria 2791355197 2793068024 150
233 iso_pu_bacteria 2824704595 2824708186 150
234 iso_pu_bacteria 2824753945 2824756777 150
235 iso_pu_bacteria 2824763712 2824767369 150
236 iso_pu_bacteria 2885374607 2885377209 150
237 iso_pu_bacteria 2903748898 2903754476 150
238 iso_pu_bacteria 2904699407 2904711007 150
239 iso_pu_bacteria 2904711408 2904720732 150
240 iso_pu_bacteria 2906610324 2906612238 150
241 iso_pu_bacteria 2908739725 2908740229 150
242 iso_pu_bacteria 2908756301 2908757778 150
243 iso_pu_bacteria 2922425934 2922427066 150
244 iso_pu_bacteria 2935630451 2935633209 150
245 iso_pu_bacteria 2941507105 2941509489 150
246 iso_pu_bacteria 2941515067 2941517318 150
247 iso_pu_bacteria 2941523033 2941526729 150
248 iso_pu_bacteria 3005474847 3005476244 150
249 iso_pu_bacteria 8006933436 8006937547 150
250 iso_pu_bacteria 8006973647 8006977575 150
251 iso_pu_bacteria 8019555841 8019561053 150
252 iso_pu_bacteria 8056689827 8056694771 150
253 3300003215 JGI25153J46596_10014910 JGI25153J46596_100149103 151
254 3300005539 Ga0068853_100286156 Ga0068853_1002861562 151
255 3300006178 Ga0075367_10528429 Ga0075367_105284292 151
256 3300025297 Ga0209758_1013025 Ga0209758_10130254 151
257 3300042157 Ga0439458_0057672 Ga0439458_0057672_35_502 151
258 3300042438 Ga0439459_0148240 Ga0439459_0148240_34_528 151
259 iso_pu_bacteria 2508501128 2509151244 151
260 iso_pu_bacteria 2728368998 2728749075 151
261 iso_pu_bacteria 2791355199 2793080496 151
262 iso_pu_bacteria 2876808645 2876808708 151
263 iso_pu_bacteria 2879110137 2879111973 151
264 iso_pu_bacteria 2889033259 2889034071 151
265 iso_pu_bacteria 8006984368 8006989933 151
266 3300003215 JGI25153J46596_10111780 JGI25153J46596_101117801 152
267 3300025295 Ga0209564_1002366 Ga0209564_100236623 152
268 3300025297 Ga0209758_1006483 Ga0209758_10064834 152
269 3300044765 Ga0466970_0257666 Ga0466970_0257666_420_887 152
270 3300044842 Ga0466957_0088986 Ga0466957_0088986_1239_1706 152
271 3300048921 Ga0496118_0123062 Ga0496118_0123062_156_617 152
272 3300005436 Ga0070713_100204510 Ga0070713_1002045102 153
273 3300005937 Ga0081455_10048375 Ga0081455_100483753 153
274 3300006237 Ga0097621_100720634 Ga0097621_1007206341 153
275 3300009098 Ga0105245_11757326 Ga0105245_117573261 153
276 3300009148 Ga0105243_10581085 Ga0105243_105810851 153
277 3300009177 Ga0105248_10011201 Ga0105248_1001120111 153
278 3300013306 Ga0163162_10252002 Ga0163162_102520022 153
279 3300013308 Ga0157375_10697849 Ga0157375_106978492 153
280 3300014968 Ga0157379_10201931 Ga0157379_102019312 153
281 3300014969 Ga0157376_10440557 Ga0157376_104405572 153
282 3300025927 Ga0207687_10971523 Ga0207687_109715231 153
283 3300025928 Ga0207700_10207551 Ga0207700_102075512 153
284 3300025935 Ga0207709_10563603 Ga0207709_105636032 153
285 3300025939 Ga0207665_10175766 Ga0207665_101757662 153
286 3300025941 Ga0207711_10122866 Ga0207711_101228662 153
287 3300035085 Ga0373929_0027260 Ga0373929_0027260_271_744 153
288 3300035092 Ga0373952_0027347 Ga0373952_0027347_542_1015 153
289 3300035691 Ga0373931_0015543 Ga0373931_0015543_731_1204 153
290 3300048903 Ga0496100_0205347 Ga0496100_0205347_46_519 153
291 3300048904 Ga0496101_0222684 Ga0496101_0222684_217_690 153
292 3300048905 Ga0496102_0208150 Ga0496102_0208150_282_755 153
293 3300048906 Ga0496103_0280356 Ga0496103_0280356_545_1018 153
294 3300048907 Ga0496104_0045622 Ga0496104_0045622_1548_2021 153
295 3300048908 Ga0496105_0034113 Ga0496105_0034113_584_1057 153
296 3300048910 Ga0496107_1045882 Ga0496107_1045882_77_550 153
297 3300048911 Ga0496108_0287542 Ga0496108_0287542_501_974 153
298 3300048912 Ga0496109_0045013 Ga0496109_0045013_1765_2238 153
299 3300048913 Ga0496110_0113287 Ga0496110_0113287_1266_1739 153
300 3300048914 Ga0496111_0039606 Ga0496111_0039606_863_1336 153
301 3300048915 Ga0496112_0070815 Ga0496112_0070815_984_1457 153
302 3300048915 Ga0496112_0145529 Ga0496112_0145529_240_713 153
303 3300048916 Ga0496113_0380833 Ga0496113_0380833_449_922 153
304 3300048917 Ga0496114_0057971 Ga0496114_0057971_2099_2572 153
305 3300048925 Ga0496122_0044396 Ga0496122_0044396_23_487 153
306 3300048929 Ga0496126_0579685 Ga0496126_0579685_280_750 153
307 3300053093 Ga0500651_0039270 Ga0500651_0039270_407_877 153
308 3300053119 Ga0500595_010617 Ga0500595_010617_3079_3564 153
309 3300053119 Ga0500595_019616 Ga0500595_019616_1919_2389 153
310 3300053130 Ga0500642_0081757 Ga0500642_0081757_842_1312 153
311 3300003215 JGI25153J46596_10141221 JGI25153J46596_101412211 154
312 3300003354 JGI25160J50197_1003785 JGI25160J50197_10037858 154
313 3300003354 JGI25160J50197_1029609 JGI25160J50197_10296091 154
314 3300005262 Ga0065165_1003606 Ga0065165_100360616 154
315 3300005467 Ga0070706_100275569 Ga0070706_1002755693 154
316 3300005467 Ga0070706_100357193 Ga0070706_1003571932 154
317 3300005548 Ga0070665_100072877 Ga0070665_1000728774 154
318 3300006186 Ga0075369_10019245 Ga0075369_100192454 154
319 3300006186 Ga0075369_10033206 Ga0075369_100332063 154
320 3300025261 Ga0209233_1011287 Ga0209233_10112873 154
321 3300025297 Ga0209758_1026010 Ga0209758_10260102 154
322 3300025302 Ga0207426_1000430 Ga0207426_100043063 154
323 3300025302 Ga0207426_1000830 Ga0207426_100083046 154
324 3300025302 Ga0207426_1038146 Ga0207426_10381463 154
325 3300025304 Ga0209257_1064800 Ga0209257_10648001 154
326 3300025904 Ga0207647_10153541 Ga0207647_101535412 154
327 3300025910 Ga0207684_10195736 Ga0207684_101957362 154
328 3300025910 Ga0207684_10252085 Ga0207684_102520853 154
329 3300025914 Ga0207671_10040447 Ga0207671_100404471 154
330 3300025921 Ga0207652_10908066 Ga0207652_109080661 154
331 3300025924 Ga0207694_10407468 Ga0207694_104074681 154
332 3300025944 Ga0207661_10051455 Ga0207661_100514552 154
333 3300026067 Ga0207678_11521927 Ga0207678_115219271 154
334 3300028379 Ga0268266_10241555 Ga0268266_102415553 154
335 3300030760 Ga0265762_1109151 Ga0265762_11091511 154
336 3300031238 Ga0265332_10037508 Ga0265332_100375084 154
337 3300031249 Ga0265339_10088248 Ga0265339_100882482 154
338 3300031250 Ga0265331_10026787 Ga0265331_100267872 154
339 3300031712 Ga0265342_10000931 Ga0265342_100009319 154
340 3300033180 Ga0307510_10027051 Ga0307510_100270517 154
341 3300033180 Ga0307510_10309560 Ga0307510_103095601 154
342 3300033442 Ga0315911_1000005 Ga0315911_1000005416 154
343 3300036401 Ga0373937_1029415 Ga0373937_1029415_248_715 154
344 3300039437 Ga0436365_0298555 Ga0436365_0298555_1572_2054 154
345 3300039437 Ga0436365_1933584 Ga0436365_1933584_253_735 154
346 3300039450 Ga0436363_0092706 Ga0436363_0092706_3009_3500 154
347 3300041486 Ga0451807_2533860 Ga0451807_2533860_43_510 154
348 3300044656 Ga0466969_0182939 Ga0466969_0182939_13_507 154
349 3300044684 Ga0466966_0036027 Ga0466966_0036027_2311_2805 154
350 3300044765 Ga0466970_0136994 Ga0466970_0136994_725_1219 154
351 3300046454 Ga0495592_0125386 Ga0495592_0125386_384_851 154
352 3300046460 Ga0495638_0007000 Ga0495638_0007000_7524_7991 154
353 3300046462 Ga0495651_0019229 Ga0495651_0019229_1268_1735 154
354 3300046511 Ga0495608_0032554 Ga0495608_0032554_2205_2672 154
355 3300046516 Ga0495628_0039493 Ga0495628_0039493_3286_3753 154
356 3300046529 Ga0495652_0057419 Ga0495652_0057419_1289_1756 154
357 3300046543 Ga0495645_0184596 Ga0495645_0184596_456_923 154
358 3300046559 Ga0495667_0092145 Ga0495667_0092145_490_957 154
359 3300046663 Ga0495635_0174129 Ga0495635_0174129_892_1359 154
360 3300046675 Ga0495657_0004266 Ga0495657_0004266_10591_11058 154
361 3300046678 Ga0495599_0055253 Ga0495599_0055253_675_1142 154
362 3300046679 Ga0495623_0029788 Ga0495623_0029788_2082_2549 154
363 3300046680 Ga0495646_0085685 Ga0495646_0085685_700_1167 154
364 3300046689 Ga0495613_0510458 Ga0495613_0510458_220_687 154
365 3300046809 Ga0495600_0106514 Ga0495600_0106514_85_552 154
366 3300047317 Ga0495604_0002177 Ga0495604_0002177_10739_11206 154
367 3300047319 Ga0495674_0043681 Ga0495674_0043681_1274_1741 154
368 3300047322 Ga0495680_0019208 Ga0495680_0019208_2564_3031 154
369 3300047444 Ga0495675_0024121 Ga0495675_0024121_346_813 154
370 3300047471 Ga0495684_0235673 Ga0495684_0235673_27_494 154
371 3300047472 Ga0495686_0278801 Ga0495686_0278801_436_903 154
372 3300047673 Ga0495593_0355533 Ga0495593_0355533_151_618 154
373 3300048088 Ga0495602_0250712 Ga0495602_0250712_161_628 154
374 3300048903 Ga0496100_0788242 Ga0496100_0788242_12_479 154
375 3300048904 Ga0496101_0726728 Ga0496101_0726728_24_497 154
376 3300048910 Ga0496107_0681932 Ga0496107_0681932_219_707 154
377 3300048913 Ga0496110_1136196 Ga0496110_1136196_44_508 154
378 3300048915 Ga0496112_0805286 Ga0496112_0805286_195_665 154
379 3300048922 Ga0496119_0118063 Ga0496119_0118063_311_778 154
380 3300048923 Ga0496120_0134679 Ga0496120_0134679_31_498 154
381 3300048924 Ga0496121_0076964 Ga0496121_0076964_1610_2077 154
382 3300048924 Ga0496121_0196370 Ga0496121_0196370_167_637 154
383 3300048929 Ga0496126_0109686 Ga0496126_0109686_407_874 154
384 3300048929 Ga0496126_0196317 Ga0496126_0196317_80_547 154
385 3300048929 Ga0496126_0254158 Ga0496126_0254158_889_1356 154
386 3300048929 Ga0496126_0561973 Ga0496126_0561973_368_856 154
387 3300050494 nmdc:mga06z11_168821_c1 nmdc:mga06z11_168821_c1_441_908 154
388 3300050516 nmdc:mga0sz30_64673_c1 nmdc:mga0sz30_64673_c1_1035_1502 154
389 3300053104 Ga0500556_0038280 Ga0500556_0038280_391_858 154
390 3300053104 Ga0500556_0071372 Ga0500556_0071372_64_531 154
391 3300053108 Ga0500562_001337 Ga0500562_001337_4026_4493 154
392 3300053136 Ga0500559_0040415 Ga0500559_0040415_680_1147 154
393 3300053153 Ga0500616_0029988 Ga0500616_0029988_2441_2908 154
394 3300053156 Ga0500622_0093925 Ga0500622_0093925_423_890 154
395 3300053177 Ga0500636_0000517 Ga0500636_0000517_9442_9909 154
396 3300053730 Ga0500645_052030 Ga0500645_052030_282_749 154
397 3300053736 Ga0500599_000516 Ga0500599_000516_1997_2464 154
398 3300055283 Ga0500661_007512 Ga0500661_007512_452_919 154
399 3300002239 JGI24034J26672_10023466 JGI24034J26672_100234661 155
400 3300002244 JGI24742J22300_10020375 JGI24742J22300_100203752 155
401 3300003203 JGI25406J46586_10037413 JGI25406J46586_100374132 155
402 3300003659 JGI25404J52841_10006830 JGI25404J52841_100068304 155
403 3300003659 JGI25404J52841_10013781 JGI25404J52841_100137812 155
404 3300003659 JGI25404J52841_10018919 JGI25404J52841_100189192 155
405 3300004801 Ga0058860_11691766 Ga0058860_116917661 155
406 3300005289 Ga0065704_10690125 Ga0065704_106901251 155
407 3300005330 Ga0070690_100092879 Ga0070690_1000928792 155
408 3300005331 Ga0070670_100281566 Ga0070670_1002815662 155
409 3300005331 Ga0070670_100416175 Ga0070670_1004161752 155
410 3300005334 Ga0068869_100033336 Ga0068869_1000333362 155
411 3300005334 Ga0068869_100430185 Ga0068869_1004301852 155
412 3300005334 Ga0068869_100433352 Ga0068869_1004333521 155
413 3300005334 Ga0068869_100484397 Ga0068869_1004843972 155
414 3300005334 Ga0068869_100749825 Ga0068869_1007498251 155
415 3300005335 Ga0070666_10586418 Ga0070666_105864181 155
416 3300005337 Ga0070682_100154996 Ga0070682_1001549962 155
417 3300005339 Ga0070660_100444955 Ga0070660_1004449552 155
418 3300005344 Ga0070661_100298254 Ga0070661_1002982542 155
419 3300005345 Ga0070692_10685547 Ga0070692_106855471 155
420 3300005347 Ga0070668_100012999 Ga0070668_1000129995 155
421 3300005347 Ga0070668_100053665 Ga0070668_1000536654 155
422 3300005347 Ga0070668_100058160 Ga0070668_1000581603 155
423 3300005347 Ga0070668_100349174 Ga0070668_1003491742 155
424 3300005347 Ga0070668_100616470 Ga0070668_1006164702 155
425 3300005353 Ga0070669_100337342 Ga0070669_1003373422 155
426 3300005354 Ga0070675_100415254 Ga0070675_1004152542 155
427 3300005355 Ga0070671_100216959 Ga0070671_1002169592 155
428 3300005355 Ga0070671_100222154 Ga0070671_1002221542 155
429 3300005356 Ga0070674_100278587 Ga0070674_1002785872 155
430 3300005356 Ga0070674_100362813 Ga0070674_1003628131 155
431 3300005364 Ga0070673_100888930 Ga0070673_1008889302 155
432 3300005365 Ga0070688_100079031 Ga0070688_1000790311 155
433 3300005365 Ga0070688_100173392 Ga0070688_1001733921 155
434 3300005367 Ga0070667_100771820 Ga0070667_1007718202 155
435 3300005406 Ga0070703_10244751 Ga0070703_102447511 155
436 3300005434 Ga0070709_10003312 Ga0070709_100033125 155
437 3300005434 Ga0070709_11225185 Ga0070709_112251851 155
438 3300005435 Ga0070714_100261240 Ga0070714_1002612402 155
439 3300005436 Ga0070713_100001422 Ga0070713_10000142214 155
440 3300005436 Ga0070713_100018220 Ga0070713_1000182202 155
441 3300005437 Ga0070710_10004827 Ga0070710_100048274 155
442 3300005437 Ga0070710_10269295 Ga0070710_102692952 155
443 3300005438 Ga0070701_10175530 Ga0070701_101755302 155
444 3300005439 Ga0070711_100002142 Ga0070711_10000214211 155
445 3300005440 Ga0070705_101185137 Ga0070705_1011851371 155
446 3300005441 Ga0070700_100107418 Ga0070700_1001074182 155
447 3300005441 Ga0070700_100115143 Ga0070700_1001151432 155
448 3300005455 Ga0070663_100003220 Ga0070663_1000032209 155
449 3300005455 Ga0070663_100048983 Ga0070663_1000489832 155
450 3300005455 Ga0070663_100297645 Ga0070663_1002976452 155
451 3300005456 Ga0070678_100004494 Ga0070678_1000044942 155
452 3300005456 Ga0070678_100288382 Ga0070678_1002883822 155
453 3300005456 Ga0070678_100527550 Ga0070678_1005275502 155
454 3300005457 Ga0070662_100066064 Ga0070662_1000660644 155
455 3300005457 Ga0070662_100508162 Ga0070662_1005081621 155
456 3300005457 Ga0070662_101022000 Ga0070662_1010220001 155
457 3300005459 Ga0068867_100023064 Ga0068867_1000230645 155
458 3300005459 Ga0068867_100329399 Ga0068867_1003293992 155
459 3300005471 Ga0070698_100706138 Ga0070698_1007061382 155
460 3300005518 Ga0070699_101293634 Ga0070699_1012936341 155
461 3300005535 Ga0070684_100361993 Ga0070684_1003619932 155
462 3300005535 Ga0070684_101014832 Ga0070684_1010148321 155
463 3300005539 Ga0068853_100494917 Ga0068853_1004949171 155
464 3300005539 Ga0068853_101322429 Ga0068853_1013224291 155
465 3300005544 Ga0070686_100023591 Ga0070686_1000235912 155
466 3300005546 Ga0070696_100317270 Ga0070696_1003172702 155
467 3300005548 Ga0070665_100003438 Ga0070665_1000034385 155
468 3300005548 Ga0070665_100004774 Ga0070665_10000477411 155
469 3300005548 Ga0070665_100005873 Ga0070665_10000587311 155
470 3300005548 Ga0070665_100085408 Ga0070665_1000854082 155
471 3300005548 Ga0070665_100143770 Ga0070665_1001437703 155
472 3300005548 Ga0070665_100172272 Ga0070665_1001722725 155
473 3300005548 Ga0070665_100431501 Ga0070665_1004315012 155
474 3300005563 Ga0068855_100616514 Ga0068855_1006165141 155
475 3300005564 Ga0070664_100023548 Ga0070664_1000235483 155
476 3300005564 Ga0070664_100088114 Ga0070664_1000881143 155
477 3300005564 Ga0070664_100557801 Ga0070664_1005578012 155
478 3300005578 Ga0068854_100096778 Ga0068854_1000967782 155
479 3300005615 Ga0070702_101029207 Ga0070702_1010292071 155
480 3300005616 Ga0068852_100365789 Ga0068852_1003657892 155
481 3300005617 Ga0068859_100154620 Ga0068859_1001546202 155
482 3300005617 Ga0068859_100158290 Ga0068859_1001582902 155
483 3300005617 Ga0068859_102126853 Ga0068859_1021268531 155
484 3300005618 Ga0068864_100006935 Ga0068864_1000069353 155
485 3300005618 Ga0068864_101774345 Ga0068864_1017743451 155
486 3300005718 Ga0068866_10095643 Ga0068866_100956432 155
487 3300005718 Ga0068866_10300203 Ga0068866_103002031 155
488 3300005719 Ga0068861_100125962 Ga0068861_1001259621 155
489 3300005834 Ga0068851_10199555 Ga0068851_101995552 155
490 3300005841 Ga0068863_100352419 Ga0068863_1003524192 155
491 3300005841 Ga0068863_100377167 Ga0068863_1003771672 155
492 3300005842 Ga0068858_100295509 Ga0068858_1002955092 155
493 3300005842 Ga0068858_100488808 Ga0068858_1004888082 155
494 3300005843 Ga0068860_100020202 Ga0068860_1000202022 155
495 3300005843 Ga0068860_100078781 Ga0068860_1000787814 155
496 3300005843 Ga0068860_100082501 Ga0068860_1000825012 155
497 3300005843 Ga0068860_100105179 Ga0068860_1001051794 155
498 3300005844 Ga0068862_100043104 Ga0068862_1000431044 155
499 3300005844 Ga0068862_100075313 Ga0068862_1000753133 155
500 3300005844 Ga0068862_100186183 Ga0068862_1001861832 155
501 3300005844 Ga0068862_100422331 Ga0068862_1004223312 155
502 3300005844 Ga0068862_100430201 Ga0068862_1004302012 155
503 3300005844 Ga0068862_100716423 Ga0068862_1007164232 155
504 3300005937 Ga0081455_10035127 Ga0081455_100351273 155
505 3300005983 Ga0081540_1000593 Ga0081540_100059327 155
506 3300005983 Ga0081540_1006150 Ga0081540_100615011 155
507 3300005983 Ga0081540_1006500 Ga0081540_10065008 155
508 3300005983 Ga0081540_1026322 Ga0081540_10263225 155
509 3300005983 Ga0081540_1030811 Ga0081540_10308113 155
510 3300005983 Ga0081540_1040425 Ga0081540_10404253 155
511 3300005985 Ga0081539_10000540 Ga0081539_1000054043 155
512 3300006028 Ga0070717_10053957 Ga0070717_100539572 155
513 3300006038 Ga0075365_10022471 Ga0075365_100224716 155
514 3300006038 Ga0075365_10023658 Ga0075365_100236582 155
515 3300006038 Ga0075365_10049826 Ga0075365_100498263 155
516 3300006038 Ga0075365_10071461 Ga0075365_100714612 155
517 3300006042 Ga0075368_10003916 Ga0075368_100039162 155
518 3300006042 Ga0075368_10067536 Ga0075368_100675361 155
519 3300006048 Ga0075363_100002441 Ga0075363_1000024417 155
520 3300006048 Ga0075363_100060854 Ga0075363_1000608542 155
521 3300006048 Ga0075363_100273612 Ga0075363_1002736122 155
522 3300006051 Ga0075364_10033031 Ga0075364_100330313 155
523 3300006051 Ga0075364_10228067 Ga0075364_102280671 155
524 3300006058 Ga0075432_10031095 Ga0075432_100310951 155
525 3300006163 Ga0070715_10006335 Ga0070715_100063352 155
526 3300006163 Ga0070715_10033991 Ga0070715_100339913 155
527 3300006175 Ga0070712_100057991 Ga0070712_1000579913 155
528 3300006175 Ga0070712_100135255 Ga0070712_1001352552 155
529 3300006177 Ga0075362_10085363 Ga0075362_100853632 155
530 3300006177 Ga0075362_10219645 Ga0075362_102196452 155
531 3300006178 Ga0075367_10025995 Ga0075367_100259952 155
532 3300006178 Ga0075367_10055799 Ga0075367_100557992 155
533 3300006186 Ga0075369_10004104 Ga0075369_100041043 155
534 3300006186 Ga0075369_10014424 Ga0075369_100144243 155
535 3300006186 Ga0075369_10019721 Ga0075369_100197212 155
536 3300006186 Ga0075369_10099537 Ga0075369_100995371 155
537 3300006195 Ga0075366_10017253 Ga0075366_100172535 155
538 3300006195 Ga0075366_10023675 Ga0075366_100236755 155
539 3300006195 Ga0075366_10121023 Ga0075366_101210233 155
540 3300006195 Ga0075366_10467346 Ga0075366_104673462 155
541 3300006237 Ga0097621_100208875 Ga0097621_1002088752 155
542 3300006353 Ga0075370_10002280 Ga0075370_100022808 155
543 3300006353 Ga0075370_10234718 Ga0075370_102347182 155
544 3300006358 Ga0068871_100062631 Ga0068871_1000626313 155
545 3300006358 Ga0068871_100320918 Ga0068871_1003209182 155
546 3300006844 Ga0075428_100033777 Ga0075428_1000337773 155
547 3300006871 Ga0075434_100235841 Ga0075434_1002358412 155
548 3300006871 Ga0075434_100898312 Ga0075434_1008983122 155
549 3300006881 Ga0068865_100108704 Ga0068865_1001087042 155
550 3300006931 Ga0097620_100154632 Ga0097620_1001546322 155
551 3300006931 Ga0097620_100158281 Ga0097620_1001582812 155
552 3300006931 Ga0097620_102126787 Ga0097620_1021267871 155
553 3300009094 Ga0111539_10728243 Ga0111539_107282432 155
554 3300009094 Ga0111539_10860674 Ga0111539_108606741 155
555 3300009098 Ga0105245_10679716 Ga0105245_106797162 155
556 3300009148 Ga0105243_10402347 Ga0105243_104023472 155
557 3300009148 Ga0105243_11223449 Ga0105243_112234491 155
558 3300009148 Ga0105243_11644719 Ga0105243_116447191 155
559 3300009176 Ga0105242_10127123 Ga0105242_101271232 155
560 3300009177 Ga0105248_10949390 Ga0105248_109493901 155
561 3300009551 Ga0105238_10924465 Ga0105238_109244651 155
562 3300010375 Ga0105239_10039057 Ga0105239_100390577 155
563 3300010375 Ga0105239_10734712 Ga0105239_107347122 155
564 3300011119 Ga0105246_10508993 Ga0105246_105089932 155
565 3300013297 Ga0157378_10201301 Ga0157378_102013012 155
566 3300013297 Ga0157378_10260073 Ga0157378_102600732 155
567 3300013308 Ga0157375_10577157 Ga0157375_105771571 155
568 3300014968 Ga0157379_10184181 Ga0157379_101841812 155
569 3300014969 Ga0157376_10487458 Ga0157376_104874582 155
570 3300017792 Ga0163161_10042832 Ga0163161_100428325 155
571 3300021377 Ga0213874_10009393 Ga0213874_100093932 155
572 3300021384 Ga0213876_10003083 Ga0213876_100030837 155
573 3300025297 Ga0209758_1009323 Ga0209758_10093234 155
574 3300025315 Ga0207697_10411676 Ga0207697_104116761 155
575 3300025321 Ga0207656_10062344 Ga0207656_100623442 155
576 3300025711 Ga0207696_1014062 Ga0207696_10140622 155
577 3300025885 Ga0207653_10184911 Ga0207653_101849111 155
578 3300025898 Ga0207692_10004082 Ga0207692_100040822 155
579 3300025900 Ga0207710_10020363 Ga0207710_100203635 155
580 3300025901 Ga0207688_10032387 Ga0207688_100323872 155
581 3300025901 Ga0207688_10090051 Ga0207688_100900512 155
582 3300025905 Ga0207685_10006127 Ga0207685_100061272 155
583 3300025905 Ga0207685_10162612 Ga0207685_101626121 155
584 3300025906 Ga0207699_10004153 Ga0207699_100041532 155
585 3300025906 Ga0207699_10004799 Ga0207699_100047993 155
586 3300025908 Ga0207643_10030909 Ga0207643_100309092 155
587 3300025909 Ga0207705_10337885 Ga0207705_103378852 155
588 3300025911 Ga0207654_10062790 Ga0207654_100627902 155
589 3300025911 Ga0207654_10480245 Ga0207654_104802451 155
590 3300025911 Ga0207654_10614650 Ga0207654_106146501 155
591 3300025914 Ga0207671_10595949 Ga0207671_105959491 155
592 3300025915 Ga0207693_10004353 Ga0207693_100043534 155
593 3300025915 Ga0207693_10067083 Ga0207693_100670832 155
594 3300025916 Ga0207663_10004725 Ga0207663_100047255 155
595 3300025920 Ga0207649_10186483 Ga0207649_101864832 155
596 3300025924 Ga0207694_10075049 Ga0207694_100750493 155
597 3300025924 Ga0207694_11117301 Ga0207694_111173011 155
598 3300025926 Ga0207659_10132188 Ga0207659_101321882 155
599 3300025926 Ga0207659_10570478 Ga0207659_105704782 155
600 3300025927 Ga0207687_10025800 Ga0207687_100258003 155
601 3300025927 Ga0207687_10585756 Ga0207687_105857562 155
602 3300025928 Ga0207700_10009417 Ga0207700_100094174 155
603 3300025928 Ga0207700_10349002 Ga0207700_103490022 155
604 3300025929 Ga0207664_10489638 Ga0207664_104896382 155
605 3300025931 Ga0207644_10060170 Ga0207644_100601703 155
606 3300025931 Ga0207644_10356789 Ga0207644_103567892 155
607 3300025932 Ga0207690_10089665 Ga0207690_100896652 155
608 3300025932 Ga0207690_10160650 Ga0207690_101606502 155
609 3300025933 Ga0207706_10027761 Ga0207706_100277615 155
610 3300025933 Ga0207706_10329815 Ga0207706_103298152 155
611 3300025933 Ga0207706_10439200 Ga0207706_104392002 155
612 3300025933 Ga0207706_10756706 Ga0207706_107567062 155
613 3300025934 Ga0207686_10836803 Ga0207686_108368032 155
614 3300025935 Ga0207709_10029974 Ga0207709_100299745 155
615 3300025935 Ga0207709_10118109 Ga0207709_101181092 155
616 3300025935 Ga0207709_10226252 Ga0207709_102262522 155
617 3300025935 Ga0207709_10236466 Ga0207709_102364661 155
618 3300025937 Ga0207669_10058495 Ga0207669_100584952 155
619 3300025937 Ga0207669_10666742 Ga0207669_106667421 155
620 3300025938 Ga0207704_10076226 Ga0207704_100762262 155
621 3300025938 Ga0207704_10190904 Ga0207704_101909042 155
622 3300025940 Ga0207691_10317465 Ga0207691_103174652 155
623 3300025941 Ga0207711_10018890 Ga0207711_100188904 155
624 3300025941 Ga0207711_10201003 Ga0207711_102010032 155
625 3300025941 Ga0207711_10879889 Ga0207711_108798891 155
626 3300025942 Ga0207689_10003039 Ga0207689_100030395 155
627 3300025942 Ga0207689_10197151 Ga0207689_101971512 155
628 3300025942 Ga0207689_10367921 Ga0207689_103679212 155
629 3300025961 Ga0207712_10062247 Ga0207712_100622472 155
630 3300025961 Ga0207712_11041460 Ga0207712_110414601 155
631 3300025961 Ga0207712_11281943 Ga0207712_112819431 155
632 3300025972 Ga0207668_10025281 Ga0207668_100252815 155
633 3300025972 Ga0207668_10189802 Ga0207668_101898022 155
634 3300025972 Ga0207668_11241655 Ga0207668_112416551 155
635 3300025972 Ga0207668_11251327 Ga0207668_112513272 155
636 3300025986 Ga0207658_10149805 Ga0207658_101498052 155
637 3300026023 Ga0207677_10010242 Ga0207677_100102422 155
638 3300026035 Ga0207703_10095396 Ga0207703_100953964 155
639 3300026035 Ga0207703_10512737 Ga0207703_105127371 155
640 3300026041 Ga0207639_10098654 Ga0207639_100986543 155
641 3300026067 Ga0207678_10014071 Ga0207678_100140712 155
642 3300026067 Ga0207678_10042599 Ga0207678_100425995 155
643 3300026075 Ga0207708_10051349 Ga0207708_100513493 155
644 3300026075 Ga0207708_10767841 Ga0207708_107678412 155
645 3300026078 Ga0207702_10948323 Ga0207702_109483232 155
646 3300026088 Ga0207641_10081176 Ga0207641_100811762 155
647 3300026088 Ga0207641_10333328 Ga0207641_103333282 155
648 3300026089 Ga0207648_10185634 Ga0207648_101856342 155
649 3300026089 Ga0207648_11016727 Ga0207648_110167272 155
650 3300026095 Ga0207676_10048066 Ga0207676_100480662 155
651 3300026116 Ga0207674_10090218 Ga0207674_100902183 155
652 3300026116 Ga0207674_10743220 Ga0207674_107432201 155
653 3300026118 Ga0207675_100019856 Ga0207675_1000198562 155
654 3300026118 Ga0207675_100149033 Ga0207675_1001490332 155
655 3300026118 Ga0207675_100283907 Ga0207675_1002839072 155
656 3300026118 Ga0207675_100360595 Ga0207675_1003605952 155
657 3300026121 Ga0207683_10038321 Ga0207683_100383212 155
658 3300026121 Ga0207683_10080281 Ga0207683_100802813 155
659 3300026142 Ga0207698_10265673 Ga0207698_102656732 155
660 3300027866 Ga0209813_10037465 Ga0209813_100374652 155
661 3300027866 Ga0209813_10039924 Ga0209813_100399242 155
662 3300027907 Ga0207428_10142989 Ga0207428_101429892 155
663 3300027907 Ga0207428_10175944 Ga0207428_101759442 155
664 3300028379 Ga0268266_10003152 Ga0268266_100031528 155
665 3300028379 Ga0268266_10003898 Ga0268266_100038987 155
666 3300028379 Ga0268266_10378699 Ga0268266_103786992 155
667 3300028379 Ga0268266_10456467 Ga0268266_104564672 155
668 3300028380 Ga0268265_10029614 Ga0268265_100296142 155
669 3300028380 Ga0268265_10064367 Ga0268265_100643672 155
670 3300028380 Ga0268265_10204263 Ga0268265_102042632 155
671 3300028380 Ga0268265_10961234 Ga0268265_109612342 155
672 3300028380 Ga0268265_11736028 Ga0268265_117360281 155
673 3300028381 Ga0268264_10181238 Ga0268264_101812382 155
674 3300028381 Ga0268264_10184418 Ga0268264_101844183 155
675 3300031235 Ga0265330_10067366 Ga0265330_100673663 155
676 3300031235 Ga0265330_10117267 Ga0265330_101172671 155
677 3300031238 Ga0265332_10094454 Ga0265332_100944542 155
678 3300031239 Ga0265328_10027277 Ga0265328_100272772 155
679 3300031241 Ga0265325_10007395 Ga0265325_100073952 155
680 3300031250 Ga0265331_10028361 Ga0265331_100283613 155
681 3300031344 Ga0265316_10309092 Ga0265316_103090922 155
682 3300031507 Ga0307509_10443893 Ga0307509_104438931 155
683 3300031548 Ga0307408_100615471 Ga0307408_1006154711 155
684 3300031616 Ga0307508_10000019 Ga0307508_10000019150 155
685 3300031711 Ga0265314_10054870 Ga0265314_100548703 155
686 3300031711 Ga0265314_10095948 Ga0265314_100959483 155
687 3300031731 Ga0307405_10017527 Ga0307405_100175274 155
688 3300031731 Ga0307405_10156756 Ga0307405_101567562 155
689 3300031901 Ga0307406_10168624 Ga0307406_101686243 155
690 3300031903 Ga0307407_10681111 Ga0307407_106811111 155
691 3300032002 Ga0307416_100413224 Ga0307416_1004132241 155
692 3300032002 Ga0307416_101430000 Ga0307416_1014300001 155
693 3300032002 Ga0307416_101455018 Ga0307416_1014550181 155
694 3300032004 Ga0307414_10708662 Ga0307414_107086621 155
695 3300032005 Ga0307411_10073467 Ga0307411_100734673 155
696 3300032005 Ga0307411_10322343 Ga0307411_103223431 155
697 3300033544 Ga0316215_1010673 Ga0316215_10106732 155
698 3300035113 Ga0373936_0164665 Ga0373936_0164665_339_809 155
699 3300035116 Ga0373945_0190380 Ga0373945_0190380_303_773 155
700 3300035119 Ga0373956_0074461 Ga0373956_0074461_887_1366 155
701 3300035120 Ga0373957_0119288 Ga0373957_0119288_484_963 155
702 3300035172 Ga0373955_0175089 Ga0373955_0175089_577_1056 155
703 3300035410 Ga0373924_0369016 Ga0373924_0369016_124_603 155
704 3300035724 Ga0373933_0052338 Ga0373933_0052338_585_1070 155
705 3300036401 Ga0373937_0443008 Ga0373937_0443008_201_686 155
706 3300037068 Ga0373925_0087733 Ga0373925_0087733_286_756 155
707 3300037466 Ga0395898_0642089 Ga0395898_0642089_498_971 155
708 3300039437 Ga0436365_1134510 Ga0436365_1134510_105_578 155
709 3300039438 Ga0436360_0696571 Ga0436360_0696571_479_952 155
710 3300039447 Ga0436361_0805688 Ga0436361_0805688_68_562 155
711 3300039450 Ga0436363_0338950 Ga0436363_0338950_261_746 155
712 3300041458 Ga0451798_1121007 Ga0451798_1121007_317_787 155
713 3300041496 Ga0451839_0711916 Ga0451839_0711916_39_506 155
714 3300041509 Ga0451843_0395955 Ga0451843_0395955_118_585 155
715 3300041509 Ga0451843_0526573 Ga0451843_0526573_129_596 155
716 3300041509 Ga0451843_0754939 Ga0451843_0754939_94_573 155
717 3300046462 Ga0495651_0029177 Ga0495651_0029177_1483_1968 155
718 3300046462 Ga0495651_0336986 Ga0495651_0336986_379_858 155
719 3300046463 Ga0495653_0025373 Ga0495653_0025373_274_753 155
720 3300046472 Ga0495580_0346465 Ga0495580_0346465_380_850 155
721 3300046474 Ga0495605_0130315 Ga0495605_0130315_237_704 155
722 3300046477 Ga0495664_0039984 Ga0495664_0039984_918_1397 155
723 3300046492 Ga0495585_0092838 Ga0495585_0092838_282_749 155
724 3300046511 Ga0495608_0153699 Ga0495608_0153699_670_1149 155
725 3300046514 Ga0495618_0350108 Ga0495618_0350108_258_737 155
726 3300046516 Ga0495628_0319441 Ga0495628_0319441_645_1124 155
727 3300046517 Ga0495630_0252705 Ga0495630_0252705_153_632 155
728 3300046520 Ga0495637_0251748 Ga0495637_0251748_67_534 155
729 3300046523 Ga0495644_0024574 Ga0495644_0024574_500_967 155
730 3300046529 Ga0495652_0094228 Ga0495652_0094228_916_1395 155
731 3300046531 Ga0495665_0182574 Ga0495665_0182574_134_604 155
732 3300046533 Ga0495640_0101039 Ga0495640_0101039_417_896 155
733 3300046536 Ga0495587_0108070 Ga0495587_0108070_960_1439 155
734 3300046537 Ga0495598_0044218 Ga0495598_0044218_378_845 155
735 3300046543 Ga0495645_0008376 Ga0495645_0008376_2283_2762 155
736 3300046558 Ga0495633_0069790 Ga0495633_0069790_1124_1591 155
737 3300046559 Ga0495667_0086541 Ga0495667_0086541_945_1424 155
738 3300046642 Ga0495634_0109596 Ga0495634_0109596_909_1388 155
739 3300046663 Ga0495635_0042269 Ga0495635_0042269_2083_2562 155
740 3300046675 Ga0495657_0129035 Ga0495657_0129035_728_1207 155
741 3300046675 Ga0495657_0583715 Ga0495657_0583715_20_505 155
742 3300046678 Ga0495599_0254774 Ga0495599_0254774_510_989 155
743 3300046679 Ga0495623_0041617 Ga0495623_0041617_831_1310 155
744 3300046680 Ga0495646_0069844 Ga0495646_0069844_1134_1613 155
745 3300046689 Ga0495613_0618919 Ga0495613_0618919_167_646 155
746 3300046690 Ga0495624_0695142 Ga0495624_0695142_39_518 155
747 3300046794 Ga0495589_0153165 Ga0495589_0153165_181_648 155
748 3300046794 Ga0495589_0245218 Ga0495589_0245218_62_532 155
749 3300046809 Ga0495600_0043783 Ga0495600_0043783_1406_1885 155
750 3300047315 Ga0495581_0016977 Ga0495581_0016977_3716_4186 155
751 3300047317 Ga0495604_0103953 Ga0495604_0103953_483_962 155
752 3300047319 Ga0495674_0324562 Ga0495674_0324562_202_681 155
753 3300047322 Ga0495680_0127776 Ga0495680_0127776_555_1034 155
754 3300047444 Ga0495675_0036032 Ga0495675_0036032_773_1252 155
755 3300047471 Ga0495684_0036990 Ga0495684_0036990_3117_3596 155
756 3300047472 Ga0495686_0125776 Ga0495686_0125776_252_761 155
757 3300047673 Ga0495593_0183483 Ga0495593_0183483_541_1020 155
758 3300048088 Ga0495602_0775254 Ga0495602_0775254_15_500 155
759 3300048907 Ga0496104_0470140 Ga0496104_0470140_521_988 155
760 3300048908 Ga0496105_1185821 Ga0496105_1185821_34_501 155
761 3300048917 Ga0496114_0023467 Ga0496114_0023467_3095_3562 155
762 3300048917 Ga0496114_0324909 Ga0496114_0324909_408_875 155
763 3300048924 Ga0496121_0037099 Ga0496121_0037099_3575_4048 155
764 3300048926 Ga0496123_0130783 Ga0496123_0130783_446_955 155
765 3300048929 Ga0496126_0008105 Ga0496126_0008105_8462_8971 155
766 3300048929 Ga0496126_0352112 Ga0496126_0352112_128_601 155
767 3300049583 Ga0501067_0035394 Ga0501067_0035394_916_1419 155
768 3300049585 Ga0501069_0074010 Ga0501069_0074010_990_1493 155
769 3300050492 nmdc:mga0yw44_288109_c1 nmdc:mga0yw44_288109_c1_51_518 155
770 3300050493 nmdc:mga0k408_506532_c1 nmdc:mga0k408_506532_c1_125_592 155
771 3300050494 nmdc:mga06z11_328671_c1 nmdc:mga06z11_328671_c1_180_647 155
772 3300050494 nmdc:mga06z11_41951_c1 nmdc:mga06z11_41951_c1_95_562 155
773 3300050495 nmdc:mga04h51_14221_c1 nmdc:mga04h51_14221_c1_364_831 155
774 3300050496 nmdc:mga07m45_672249_c1 nmdc:mga07m45_672249_c1_109_576 155
775 3300050511 nmdc:mga08y16_355911_c1 nmdc:mga08y16_355911_c1_201_668 155
776 3300050512 nmdc:mga0n895_244457_c1 nmdc:mga0n895_244457_c1_307_813 155
777 3300053077 Ga0495601_0465035 Ga0495601_0465035_124_603 155
778 3300053084 Ga0495595_0150435 Ga0495595_0150435_47_526 155
779 3300053085 Ga0495619_0111643 Ga0495619_0111643_558_1037 155
780 3300053099 Ga0500654_152975 Ga0500654_152975_93_572 155
781 3300053133 Ga0500655_065313 Ga0500655_065313_15_494 155
782 3300053136 Ga0500559_0000713 Ga0500559_0000713_6895_7368 155
783 3300053730 Ga0500645_008674 Ga0500645_008674_1025_1492 155
784 iso_pu_bacteria 2513237141 2513887911 155

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.866 52 144
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8537 51 143
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.848 38 143
2q1z-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.8463 37 143
3cjx-assembly11.cif.gz_B crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution 0.8289 51 150
ID Description Score Start End Superfamily
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8643 51 154 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8537 67 146 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8406 66 143 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8348 54 144 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8263 51 145 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8IJW0-F1-model_v4 ChrR-like cupin domain-containing protein 0.9716 59 155
AF-A0A2V8IJW0-F1-model_v4 ChrR-like cupin domain-containing protein 0.9618 59 155
AF-A0A7I7Q2Z2-F1-model_v4 Uncharacterized protein 0.9425 55 153
AF-A0A2V7QDG8-F1-model_v4 Cupin 0.9414 70 153
AF-A0A524IWX1-F1-model_v4 Cupin domain-containing protein 0.9349 53 153

Feature Viewer

pLDDT pTM Quality
89.36 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map