F480682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 292 | 1566 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300053077|Ga0495601_0061995|Ga0495601_0061995_24_605 |
| Length | 193 |
| Sequence | VFDWNEGKKTGDPQRAEKVGQKQMYSSLGVMSNLGILIPAVESRTAEYAAIYNEHRHRVYSLAFWMTDNELVAEQVAANVFLRAFASSASPRTEHIDQAFLDLVRELTPVGALTLKSRVSQAKSILGNIKRVHLERAVVQLPATEKLIFLLHDVEGYDHQRIARLLGIDENESQFGLHQARVEIRELVSRMLW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 61 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 62 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 63 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 79 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 137 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 206 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 207 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 222 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 223 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 226 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 231 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.06 |
| Metatranscriptomes | 55.94 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.32 |
| Rhizosphere | 96.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 58.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495601_0061995 | 3300053077 | Bacteria | 2374 |
| 2 | Ga0007416J51690_1125985 | 3300003577 | Unclassified | 569 |
| 3 | Ga0007429J51699_1046483 | 3300003579 | Unclassified | 592 |
| 4 | Ga0032354_1059976 | 3300003693 | Unclassified | 813 |
| 5 | Ga0032354_1066097 | 3300003693 | Unclassified | 580 |
| 6 | Ga0006780_1016482 | 3300003735 | Unclassified | 592 |
| 7 | Ga0058863_11153212 | 3300004799 | Unclassified | 577 |
| 8 | Ga0058863_11569050 | 3300004799 | Unclassified | 588 |
| 9 | Ga0058863_11754875 | 3300004799 | Bacteria | 1436 |
| 10 | Ga0058863_11857806 | 3300004799 | Unclassified | 563 |
| 11 | Ga0058863_11863930 | 3300004799 | Bacteria | 586 |
| 12 | Ga0058863_11925810 | 3300004799 | Unclassified | 597 |
| 13 | Ga0058863_11956713 | 3300004799 | Bacteria | 595 |
| 14 | Ga0058861_10019025 | 3300004800 | Unclassified | 574 |
| 15 | Ga0058861_10089434 | 3300004800 | Unclassified | 567 |
| 16 | Ga0058861_11718966 | 3300004800 | Bacteria | 614 |
| 17 | Ga0058861_11893838 | 3300004800 | Unclassified | 553 |
| 18 | Ga0058861_11992514 | 3300004800 | Unclassified | 562 |
| 19 | Ga0058861_12063548 | 3300004800 | Bacteria | 1373 |
| 20 | Ga0058861_12071100 | 3300004800 | Unclassified | 610 |
| 21 | Ga0058860_11668191 | 3300004801 | Unclassified | 597 |
| 22 | Ga0058862_10027633 | 3300004803 | Unclassified | 583 |
| 23 | Ga0058862_10083027 | 3300004803 | Bacteria | 560 |
| 24 | Ga0058862_10237800 | 3300004803 | Bacteria | 2106 |
| 25 | Ga0058862_10283175 | 3300004803 | Unclassified | 617 |
| 26 | Ga0058862_12242859 | 3300004803 | Unclassified | 549 |
| 27 | Ga0058862_12489290 | 3300004803 | Bacteria | 743 |
| 28 | Ga0058862_12634582 | 3300004803 | Bacteria | 626 |
| 29 | Ga0058862_12712853 | 3300004803 | Unclassified | 562 |
| 30 | Ga0058862_12773325 | 3300004803 | Unclassified | 585 |
| 31 | Ga0070658_10230147 | 3300005327 | Bacteria | 1569 |
| 32 | Ga0070658_10457363 | 3300005327 | Unclassified | 1100 |
| 33 | Ga0070683_100041128 | 3300005329 | Unclassified | 4250 |
| 34 | Ga0070683_100041418 | 3300005329 | Bacteria | 4237 |
| 35 | Ga0070690_100241760 | 3300005330 | Bacteria | 1273 |
| 36 | Ga0070690_100537349 | 3300005330 | Unclassified | 879 |
| 37 | Ga0070670_100656103 | 3300005331 | Unclassified | 941 |
| 38 | Ga0070666_10329544 | 3300005335 | Unclassified | 1090 |
| 39 | Ga0070680_100283498 | 3300005336 | Bacteria | 1404 |
| 40 | Ga0068868_100405333 | 3300005338 | Bacteria | 1177 |
| 41 | Ga0068868_100406854 | 3300005338 | Unclassified | 1175 |
| 42 | Ga0070692_10160211 | 3300005345 | Bacteria | 1289 |
| 43 | Ga0070675_101051753 | 3300005354 | Unclassified | 748 |
| 44 | Ga0070671_100090975 | 3300005355 | Bacteria | 2555 |
| 45 | Ga0070673_100716788 | 3300005364 | Unclassified | 919 |
| 46 | Ga0070709_10143169 | 3300005434 | Unclassified | 1644 |
| 47 | Ga0070709_10193338 | 3300005434 | Unclassified | 1437 |
| 48 | Ga0070709_10241844 | 3300005434 | Bacteria | 1296 |
| 49 | Ga0070709_10295725 | 3300005434 | Bacteria | 1181 |
| 50 | Ga0070709_10307965 | 3300005434 | Unclassified | 1158 |
| 51 | Ga0070709_10396058 | 3300005434 | Bacteria | 1030 |
| 52 | Ga0070714_100067263 | 3300005435 | Bacteria | 3088 |
| 53 | Ga0070714_100071436 | 3300005435 | Bacteria | 3001 |
| 54 | Ga0070714_100111923 | 3300005435 | Bacteria | 2418 |
| 55 | Ga0070713_100080440 | 3300005436 | Bacteria | 2779 |
| 56 | Ga0070713_100939842 | 3300005436 | Unclassified | 832 |
| 57 | Ga0070713_101092901 | 3300005436 | Unclassified | 771 |
| 58 | Ga0070710_10219717 | 3300005437 | Unclassified | 1208 |
| 59 | Ga0070710_10291360 | 3300005437 | Bacteria | 1062 |
| 60 | Ga0070711_100014595 | 3300005439 | Bacteria | 4950 |
| 61 | Ga0070711_100100718 | 3300005439 | Bacteria | 2101 |
| 62 | Ga0070711_100161418 | 3300005439 | Unclassified | 1699 |
| 63 | Ga0070678_100056639 | 3300005456 | Bacteria | 2868 |
| 64 | Ga0070681_10001396 | 3300005458 | Bacteria | 21186 |
| 65 | Ga0070681_10056421 | 3300005458 | Bacteria | 3909 |
| 66 | Ga0070681_10139225 | 3300005458 | Bacteria | 2357 |
| 67 | Ga0070681_10878977 | 3300005458 | Bacteria | 814 |
| 68 | Ga0070679_100018579 | 3300005530 | Bacteria | 6748 |
| 69 | Ga0070679_100508429 | 3300005530 | Bacteria | 1149 |
| 70 | Ga0070684_100036417 | 3300005535 | Unclassified | 4216 |
| 71 | Ga0068853_100017419 | 3300005539 | Bacteria | 5931 |
| 72 | Ga0068853_100020247 | 3300005539 | Bacteria | 5531 |
| 73 | Ga0068853_101200063 | 3300005539 | Unclassified | 733 |
| 74 | Ga0070686_100180238 | 3300005544 | Bacteria | 1500 |
| 75 | Ga0070693_100014801 | 3300005547 | Unclassified | 4006 |
| 76 | Ga0070693_100164901 | 3300005547 | Bacteria | 1414 |
| 77 | Ga0070665_101138883 | 3300005548 | Unclassified | 791 |
| 78 | Ga0070665_101169895 | 3300005548 | Unclassified | 780 |
| 79 | Ga0068855_100034709 | 3300005563 | Bacteria | 6012 |
| 80 | Ga0068855_100168097 | 3300005563 | Bacteria | 2485 |
| 81 | Ga0070664_100432939 | 3300005564 | Unclassified | 1206 |
| 82 | Ga0070664_100840159 | 3300005564 | Bacteria | 860 |
| 83 | Ga0068857_100018237 | 3300005577 | Bacteria | 6155 |
| 84 | Ga0068857_100239934 | 3300005577 | Unclassified | 1659 |
| 85 | Ga0068857_100251315 | 3300005577 | Unclassified | 1621 |
| 86 | Ga0068857_100316382 | 3300005577 | Unclassified | 1441 |
| 87 | Ga0068854_100132878 | 3300005578 | Unclassified | 1902 |
| 88 | Ga0068856_100148746 | 3300005614 | Unclassified | 2350 |
| 89 | Ga0068856_100228289 | 3300005614 | Bacteria | 1877 |
| 90 | Ga0068856_100398165 | 3300005614 | Bacteria | 1397 |
| 91 | Ga0068856_100595336 | 3300005614 | Unclassified | 1127 |
| 92 | Ga0068852_100005898 | 3300005616 | Bacteria | 8807 |
| 93 | Ga0068852_100804858 | 3300005616 | Unclassified | 954 |
| 94 | Ga0068864_100047589 | 3300005618 | Bacteria | 3684 |
| 95 | Ga0068864_100399507 | 3300005618 | Unclassified | 1306 |
| 96 | Ga0068866_10112667 | 3300005718 | Unclassified | 1521 |
| 97 | Ga0068866_11093237 | 3300005718 | Unclassified | 571 |
| 98 | Ga0068851_10052675 | 3300005834 | Bacteria | 2070 |
| 99 | Ga0068870_10383864 | 3300005840 | Unclassified | 910 |
| 100 | Ga0068863_100142939 | 3300005841 | Bacteria | 2287 |
| 101 | Ga0068863_100192694 | 3300005841 | Bacteria | 1959 |
| 102 | Ga0068858_100307487 | 3300005842 | Bacteria | 1513 |
| 103 | Ga0068858_100755837 | 3300005842 | Unclassified | 947 |
| 104 | Ga0070717_10003492 | 3300006028 | Bacteria | 11253 |
| 105 | Ga0070717_10047404 | 3300006028 | Bacteria | 3521 |
| 106 | Ga0070717_10103474 | 3300006028 | Bacteria | 2421 |
| 107 | Ga0070717_10177364 | 3300006028 | Bacteria | 1856 |
| 108 | Ga0070717_10359686 | 3300006028 | Unclassified | 1303 |
| 109 | Ga0070717_10870042 | 3300006028 | Unclassified | 820 |
| 110 | Ga0070715_10014640 | 3300006163 | Bacteria | 2908 |
| 111 | Ga0070716_100087012 | 3300006173 | Bacteria | 1881 |
| 112 | Ga0070716_100250721 | 3300006173 | Unclassified | 1206 |
| 113 | Ga0070716_100293879 | 3300006173 | Unclassified | 1127 |
| 114 | Ga0070716_100699147 | 3300006173 | Unclassified | 774 |
| 115 | Ga0070712_100003189 | 3300006175 | Bacteria | 10102 |
| 116 | Ga0070712_100092032 | 3300006175 | Bacteria | 2223 |
| 117 | Ga0070712_100393733 | 3300006175 | Unclassified | 1143 |
| 118 | Ga0070712_100572288 | 3300006175 | Unclassified | 954 |
| 119 | Ga0068871_100237694 | 3300006358 | Unclassified | 1583 |
| 120 | Ga0075434_100210190 | 3300006871 | Bacteria | 1966 |
| 121 | Ga0105240_10147767 | 3300009093 | Bacteria | 2802 |
| 122 | Ga0105240_10580189 | 3300009093 | Unclassified | 1237 |
| 123 | Ga0105245_10003224 | 3300009098 | Bacteria | 14616 |
| 124 | Ga0105245_10298715 | 3300009098 | Bacteria | 1579 |
| 125 | Ga0105247_10326128 | 3300009101 | Unclassified | 1073 |
| 126 | Ga0105247_10589003 | 3300009101 | Unclassified | 823 |
| 127 | Ga0105241_10097073 | 3300009174 | Unclassified | 2335 |
| 128 | Ga0105241_10134299 | 3300009174 | Bacteria | 2007 |
| 129 | Ga0105242_10101416 | 3300009176 | Bacteria | 2439 |
| 130 | Ga0105248_10176504 | 3300009177 | Bacteria | 2407 |
| 131 | Ga0105237_10028852 | 3300009545 | Bacteria | 5646 |
| 132 | Ga0105237_10530865 | 3300009545 | Bacteria | 1183 |
| 133 | Ga0105237_11038725 | 3300009545 | Bacteria | 826 |
| 134 | Ga0105238_10012728 | 3300009551 | Bacteria | 8492 |
| 135 | Ga0105238_10214584 | 3300009551 | Bacteria | 1901 |
| 136 | Ga0105238_10313147 | 3300009551 | Bacteria | 1555 |
| 137 | Ga0105238_10374500 | 3300009551 | Unclassified | 1414 |
| 138 | Ga0105238_10390939 | 3300009551 | Unclassified | 1383 |
| 139 | Ga0130087_1024887 | 3300009828 | Unclassified | 566 |
| 140 | Ga0130086_1003611 | 3300009829 | Unclassified | 586 |
| 141 | Ga0130086_1096415 | 3300009829 | Unclassified | 566 |
| 142 | Ga0130086_1108030 | 3300009829 | Unclassified | 586 |
| 143 | Ga0130084_1008471 | 3300009835 | Unclassified | 586 |
| 144 | Ga0130084_1035078 | 3300009835 | Unclassified | 566 |
| 145 | Ga0130084_1073972 | 3300009835 | Unclassified | 586 |
| 146 | Ga0130085_1011334 | 3300009850 | Unclassified | 586 |
| 147 | Ga0130085_1020795 | 3300009850 | Unclassified | 586 |
| 148 | Ga0130085_1090748 | 3300009850 | Unclassified | 566 |
| 149 | Ga0105239_10070517 | 3300010375 | Unclassified | 3839 |
| 150 | Ga0105239_10253965 | 3300010375 | Unclassified | 1975 |
| 151 | Ga0105239_10609311 | 3300010375 | Unclassified | 1246 |
| 152 | Ga0154014_125304 | 3300013052 | Bacteria | 587 |
| 153 | Ga0154012_100378 | 3300013059 | Bacteria | 544 |
| 154 | Ga0154010_108346 | 3300013062 | Bacteria | 597 |
| 155 | Ga0154010_109350 | 3300013062 | Bacteria | 581 |
| 156 | Ga0157369_10024546 | 3300013105 | Bacteria | 6704 |
| 157 | Ga0157369_10238596 | 3300013105 | Unclassified | 1899 |
| 158 | Ga0157369_10310442 | 3300013105 | Bacteria | 1640 |
| 159 | Ga0157374_10075515 | 3300013296 | Bacteria | 3184 |
| 160 | Ga0157374_10101998 | 3300013296 | Unclassified | 2751 |
| 161 | Ga0157374_10722069 | 3300013296 | Unclassified | 1010 |
| 162 | Ga0157378_10038740 | 3300013297 | Bacteria | 4226 |
| 163 | Ga0163162_10342186 | 3300013306 | Bacteria | 1628 |
| 164 | Ga0157372_10218573 | 3300013307 | Bacteria | 2209 |
| 165 | Ga0163163_10005110 | 3300014325 | Bacteria | 11314 |
| 166 | Ga0163163_10011221 | 3300014325 | Bacteria | 8118 |
| 167 | Ga0163163_10490279 | 3300014325 | Unclassified | 1290 |
| 168 | Ga0157379_10255024 | 3300014968 | Unclassified | 1593 |
| 169 | Ga0197907_10792033 | 3300020069 | Unclassified | 597 |
| 170 | Ga0197907_10964357 | 3300020069 | Bacteria | 576 |
| 171 | Ga0197907_11333336 | 3300020069 | Unclassified | 575 |
| 172 | Ga0197907_11354473 | 3300020069 | Bacteria | 557 |
| 173 | Ga0206356_10074769 | 3300020070 | Unclassified | 647 |
| 174 | Ga0206356_10336812 | 3300020070 | Unclassified | 569 |
| 175 | Ga0206356_11462292 | 3300020070 | Bacteria | 742 |
| 176 | Ga0206356_11609040 | 3300020070 | Unclassified | 694 |
| 177 | Ga0206349_1410711 | 3300020075 | Bacteria | 615 |
| 178 | Ga0206349_1909049 | 3300020075 | Unclassified | 562 |
| 179 | Ga0206355_1389164 | 3300020076 | Bacteria | 596 |
| 180 | Ga0206355_1390066 | 3300020076 | Unclassified | 833 |
| 181 | Ga0206351_10276108 | 3300020077 | Unclassified | 696 |
| 182 | Ga0206351_10372442 | 3300020077 | Bacteria | 586 |
| 183 | Ga0206352_10076735 | 3300020078 | Unclassified | 602 |
| 184 | Ga0206352_10163759 | 3300020078 | Unclassified | 552 |
| 185 | Ga0206352_10212782 | 3300020078 | Unclassified | 553 |
| 186 | Ga0206352_10536618 | 3300020078 | Bacteria | 604 |
| 187 | Ga0206352_10591758 | 3300020078 | Bacteria | 582 |
| 188 | Ga0206352_10644806 | 3300020078 | Unclassified | 573 |
| 189 | Ga0206352_10736554 | 3300020078 | Bacteria | 595 |
| 190 | Ga0206352_11173103 | 3300020078 | Unclassified | 691 |
| 191 | Ga0206350_10837566 | 3300020080 | Unclassified | 610 |
| 192 | Ga0206350_11473213 | 3300020080 | Bacteria | 579 |
| 193 | Ga0206350_11578846 | 3300020080 | Bacteria | 1087 |
| 194 | Ga0206354_10341010 | 3300020081 | Unclassified | 698 |
| 195 | Ga0206354_10524267 | 3300020081 | Unclassified | 579 |
| 196 | Ga0206354_10631412 | 3300020081 | Bacteria | 598 |
| 197 | Ga0206354_10841452 | 3300020081 | Unclassified | 594 |
| 198 | Ga0206354_11328234 | 3300020081 | Bacteria | 581 |
| 199 | Ga0206353_10847012 | 3300020082 | Unclassified | 603 |
| 200 | Ga0206353_11428091 | 3300020082 | Unclassified | 580 |
| 201 | Ga0206353_11826493 | 3300020082 | Bacteria | 706 |
| 202 | Ga0206353_11916467 | 3300020082 | Bacteria | 680 |
| 203 | Ga0154015_1047633 | 3300020610 | Bacteria | 604 |
| 204 | Ga0154015_1494084 | 3300020610 | Unclassified | 601 |
| 205 | Ga0213874_10056524 | 3300021377 | Bacteria | 1218 |
| 206 | Ga0224712_10178751 | 3300022467 | Bacteria | 955 |
| 207 | Ga0224712_10251876 | 3300022467 | Unclassified | 816 |
| 208 | Ga0224712_10361390 | 3300022467 | Bacteria | 687 |
| 209 | Ga0224712_10447537 | 3300022467 | Bacteria | 620 |
| 210 | Ga0224712_10459180 | 3300022467 | Bacteria | 612 |
| 211 | Ga0224712_10481673 | 3300022467 | Unclassified | 598 |
| 212 | Ga0224712_10520943 | 3300022467 | Bacteria | 576 |
| 213 | Ga0224712_10529898 | 3300022467 | Bacteria | 571 |
| 214 | Ga0207692_10070139 | 3300025898 | Bacteria | 1843 |
| 215 | Ga0207692_10742143 | 3300025898 | Unclassified | 639 |
| 216 | Ga0207642_10170071 | 3300025899 | Bacteria | 1178 |
| 217 | Ga0207685_10467421 | 3300025905 | Bacteria | 659 |
| 218 | Ga0207699_10046180 | 3300025906 | Bacteria | 2546 |
| 219 | Ga0207699_10167299 | 3300025906 | Bacteria | 1468 |
| 220 | Ga0207699_10176214 | 3300025906 | Bacteria | 1434 |
| 221 | Ga0207699_10320730 | 3300025906 | Bacteria | 1087 |
| 222 | Ga0207654_10598379 | 3300025911 | Unclassified | 787 |
| 223 | Ga0207707_10007113 | 3300025912 | Bacteria | 9749 |
| 224 | Ga0207707_10284644 | 3300025912 | Bacteria | 1431 |
| 225 | Ga0207693_10005503 | 3300025915 | Bacteria | 10546 |
| 226 | Ga0207693_10016893 | 3300025915 | Bacteria | 5827 |
| 227 | Ga0207693_10224792 | 3300025915 | Unclassified | 1474 |
| 228 | Ga0207693_10226264 | 3300025915 | Bacteria | 1469 |
| 229 | Ga0207693_10470511 | 3300025915 | Unclassified | 982 |
| 230 | Ga0207693_10476679 | 3300025915 | Unclassified | 974 |
| 231 | Ga0207663_10013069 | 3300025916 | Bacteria | 4504 |
| 232 | Ga0207663_10342040 | 3300025916 | Bacteria | 1130 |
| 233 | Ga0207663_10694674 | 3300025916 | Unclassified | 805 |
| 234 | Ga0207663_11251750 | 3300025916 | Unclassified | 598 |
| 235 | Ga0207663_11270033 | 3300025916 | Unclassified | 593 |
| 236 | Ga0207660_10320944 | 3300025917 | Bacteria | 1237 |
| 237 | Ga0207660_10543633 | 3300025917 | Bacteria | 944 |
| 238 | Ga0207652_10558705 | 3300025921 | Bacteria | 1028 |
| 239 | Ga0207694_10230704 | 3300025924 | Bacteria | 1512 |
| 240 | Ga0207694_10499827 | 3300025924 | Unclassified | 1018 |
| 241 | Ga0207694_10673376 | 3300025924 | Bacteria | 872 |
| 242 | Ga0207650_10682474 | 3300025925 | Unclassified | 867 |
| 243 | Ga0207687_10116806 | 3300025927 | Unclassified | 1989 |
| 244 | Ga0207700_10010236 | 3300025928 | Bacteria | 5902 |
| 245 | Ga0207700_10163481 | 3300025928 | Bacteria | 1851 |
| 246 | Ga0207700_10335473 | 3300025928 | Unclassified | 1313 |
| 247 | Ga0207700_10581044 | 3300025928 | Unclassified | 996 |
| 248 | Ga0207700_10664467 | 3300025928 | Unclassified | 929 |
| 249 | Ga0207700_10827495 | 3300025928 | Bacteria | 828 |
| 250 | Ga0207700_10915988 | 3300025928 | Bacteria | 785 |
| 251 | Ga0207700_11153895 | 3300025928 | Bacteria | 692 |
| 252 | Ga0207664_10064248 | 3300025929 | Bacteria | 2935 |
| 253 | Ga0207664_10098537 | 3300025929 | Unclassified | 2410 |
| 254 | Ga0207664_10118065 | 3300025929 | Bacteria | 2215 |
| 255 | Ga0207644_10587400 | 3300025931 | Unclassified | 924 |
| 256 | Ga0207686_10045126 | 3300025934 | Bacteria | 2711 |
| 257 | Ga0207665_10032057 | 3300025939 | Bacteria | 3479 |
| 258 | Ga0207665_10113860 | 3300025939 | Bacteria | 1904 |
| 259 | Ga0207665_10127202 | 3300025939 | Bacteria | 1805 |
| 260 | Ga0207665_10386801 | 3300025939 | Unclassified | 1063 |
| 261 | Ga0207711_10076202 | 3300025941 | Bacteria | 2920 |
| 262 | Ga0207661_10002790 | 3300025944 | Bacteria | 12045 |
| 263 | Ga0207661_10242446 | 3300025944 | Bacteria | 1600 |
| 264 | Ga0207661_10829030 | 3300025944 | Bacteria | 851 |
| 265 | Ga0207679_10123927 | 3300025945 | Unclassified | 2062 |
| 266 | Ga0207667_10133202 | 3300025949 | Bacteria | 2560 |
| 267 | Ga0207667_10169442 | 3300025949 | Unclassified | 2244 |
| 268 | Ga0207703_10379035 | 3300026035 | Bacteria | 1308 |
| 269 | Ga0207703_10722026 | 3300026035 | Unclassified | 948 |
| 270 | Ga0207639_10089433 | 3300026041 | Bacteria | 2460 |
| 271 | Ga0207702_10217429 | 3300026078 | Unclassified | 1779 |
| 272 | Ga0207702_10943367 | 3300026078 | Bacteria | 855 |
| 273 | Ga0207641_10160382 | 3300026088 | Bacteria | 2044 |
| 274 | Ga0207676_10327406 | 3300026095 | Bacteria | 1409 |
| 275 | Ga0207674_10017483 | 3300026116 | Bacteria | 7824 |
| 276 | Ga0207674_10187854 | 3300026116 | Bacteria | 2016 |
| 277 | Ga0207674_10255385 | 3300026116 | Bacteria | 1700 |
| 278 | Ga0207698_10430474 | 3300026142 | Unclassified | 1269 |
| 279 | Ga0207698_11114346 | 3300026142 | Unclassified | 802 |
| 280 | Ga0268266_11370098 | 3300028379 | Unclassified | 683 |
| 281 | Ga0265338_10231841 | 3300028800 | Bacteria | 1373 |
| 282 | Ga0265339_10095425 | 3300031249 | Bacteria | 1554 |
| 283 | Ga0307408_100052338 | 3300031548 | Bacteria | 2945 |
| 284 | Ga0307405_10049306 | 3300031731 | Bacteria | 2602 |
| 285 | Ga0307413_10270103 | 3300031824 | Unclassified | 1273 |
| 286 | Ga0307410_10009378 | 3300031852 | Bacteria | 5487 |
| 287 | Ga0307410_10071919 | 3300031852 | Bacteria | 2400 |
| 288 | Ga0307410_11102025 | 3300031852 | Unclassified | 688 |
| 289 | Ga0307406_10226904 | 3300031901 | Unclassified | 1392 |
| 290 | Ga0307407_10084919 | 3300031903 | Bacteria | 1925 |
| 291 | Ga0307409_100003951 | 3300031995 | Bacteria | 8215 |
| 292 | Ga0307409_100672664 | 3300031995 | Unclassified | 1031 |
| 293 | Ga0307416_100055411 | 3300032002 | Bacteria | 3193 |
| 294 | Ga0307414_10526213 | 3300032004 | Bacteria | 1050 |
| 295 | Ga0307411_10005595 | 3300032005 | Bacteria | 6192 |
| 296 | Ga0307411_10301672 | 3300032005 | Unclassified | 1285 |
| 297 | Ga0307415_100014733 | 3300032126 | Bacteria | 4607 |
| 298 | Ga0373926_0009391 | 3300035083 | Unclassified | 3269 |
| 299 | Ga0373926_0219671 | 3300035083 | Unclassified | 733 |
| 300 | Ga0373944_0011241 | 3300035089 | Bacteria | 2449 |
| 301 | Ga0373944_0072017 | 3300035089 | Bacteria | 1127 |
| 302 | Ga0373923_0016487 | 3300035111 | Unclassified | 2808 |
| 303 | Ga0373936_0004487 | 3300035113 | Bacteria | 5279 |
| 304 | Ga0373945_0084858 | 3300035116 | Bacteria | 1218 |
| 305 | Ga0373956_0278986 | 3300035119 | Unclassified | 795 |
| 306 | Ga0373957_0075782 | 3300035120 | Unclassified | 1322 |
| 307 | Ga0373943_0007587 | 3300035170 | Unclassified | 4873 |
| 308 | Ga0373943_0042606 | 3300035170 | Unclassified | 2200 |
| 309 | Ga0373943_0151619 | 3300035170 | Bacteria | 1256 |
| 310 | Ga0373946_0062284 | 3300035171 | Unclassified | 1590 |
| 311 | Ga0373946_0081816 | 3300035171 | Bacteria | 1415 |
| 312 | Ga0373955_0097793 | 3300035172 | Bacteria | 1681 |
| 313 | Ga0373955_0351889 | 3300035172 | Bacteria | 892 |
| 314 | Ga0373924_0020332 | 3300035410 | Bacteria | 2579 |
| 315 | Ga0373924_0040690 | 3300035410 | Bacteria | 1903 |
| 316 | Ga0373924_0125973 | 3300035410 | Bacteria | 1113 |
| 317 | Ga0373935_0178971 | 3300035692 | Bacteria | 1455 |
| 318 | Ga0373935_0203377 | 3300035692 | Bacteria | 1369 |
| 319 | Ga0373935_0362120 | 3300035692 | Bacteria | 1035 |
| 320 | Ga0373927_0123269 | 3300035695 | Unclassified | 1691 |
| 321 | Ga0373927_0123559 | 3300035695 | Unclassified | 1689 |
| 322 | Ga0373927_0715239 | 3300035695 | Bacteria | 662 |
| 323 | Ga0373933_0163419 | 3300035724 | Bacteria | 1415 |
| 324 | Ga0373933_0383072 | 3300035724 | Bacteria | 916 |
| 325 | Ga0373947_0005790 | 3300035725 | Bacteria | 7208 |
| 326 | Ga0373947_0144886 | 3300035725 | Bacteria | 1526 |
| 327 | Ga0373937_0000094 | 3300036401 | Bacteria | 82254 |
| 328 | Ga0373937_0029630 | 3300036401 | Bacteria | 4958 |
| 329 | Ga0373937_0749119 | 3300036401 | Bacteria | 924 |
| 330 | Ga0373925_0003398 | 3300037068 | Bacteria | 12340 |
| 331 | Ga0373925_0086166 | 3300037068 | Unclassified | 2395 |
| 332 | Ga0373925_0286977 | 3300037068 | Unclassified | 1326 |
| 333 | Ga0436363_0573438 | 3300039450 | Unclassified | 934 |
| 334 | Ga0436363_1183314 | 3300039450 | Bacteria | 1133 |
| 335 | Ga0436363_1419461 | 3300039450 | Bacteria | 2733 |
| 336 | Ga0436362_0667706 | 3300039453 | Bacteria | 686 |
| 337 | Ga0451577_0123387 | 3300042876 | Bacteria | 2321 |
| 338 | Ga0451577_0485398 | 3300042876 | Bacteria | 1122 |
| 339 | Ga0466966_0077021 | 3300044684 | Bacteria | 2082 |
| 340 | Ga0466964_0227288 | 3300044706 | Bacteria | 909 |
| 341 | Ga0453684_1029948 | 3300044712 | Unclassified | 874 |
| 342 | Ga0453684_1500048 | 3300044712 | Unclassified | 695 |
| 343 | Ga0453684_1738926 | 3300044712 | Bacteria | 636 |
| 344 | Ga0466957_0000162 | 3300044842 | Bacteria | 29438 |
| 345 | Ga0466959_0009712 | 3300045049 | Bacteria | 6851 |
| 346 | Ga0451576_0573087 | 3300045051 | Bacteria | 1186 |
| 347 | Ga0451576_0808107 | 3300045051 | Unclassified | 985 |
| 348 | Ga0466958_0011267 | 3300045836 | Bacteria | 5033 |
| 349 | Ga0466967_0087685 | 3300045976 | Bacteria | 2822 |
| 350 | Ga0466967_0268964 | 3300045976 | Bacteria | 1633 |
| 351 | Ga0495651_0037819 | 3300046462 | Bacteria | 3758 |
| 352 | Ga0495651_0096056 | 3300046462 | Bacteria | 2215 |
| 353 | Ga0495651_0641840 | 3300046462 | Unclassified | 666 |
| 354 | Ga0495653_0134125 | 3300046463 | Bacteria | 1749 |
| 355 | Ga0495580_0164206 | 3300046472 | Unclassified | 1536 |
| 356 | Ga0495580_0441725 | 3300046472 | Bacteria | 873 |
| 357 | Ga0495580_0490066 | 3300046472 | Bacteria | 821 |
| 358 | Ga0495582_0681096 | 3300046473 | Bacteria | 595 |
| 359 | Ga0495605_0123203 | 3300046474 | Unclassified | 1174 |
| 360 | Ga0495639_0023160 | 3300046475 | Bacteria | 2728 |
| 361 | Ga0495664_0358423 | 3300046477 | Bacteria | 878 |
| 362 | Ga0495594_0028356 | 3300046499 | Bacteria | 3021 |
| 363 | Ga0495594_0323946 | 3300046499 | Bacteria | 878 |
| 364 | Ga0495630_0426170 | 3300046517 | Unclassified | 1016 |
| 365 | Ga0495665_0018170 | 3300046531 | Bacteria | 3778 |
| 366 | Ga0495587_0099306 | 3300046536 | Bacteria | 1678 |
| 367 | Ga0495622_0216711 | 3300046557 | Unclassified | 849 |
| 368 | Ga0495667_0129853 | 3300046559 | Bacteria | 1626 |
| 369 | Ga0495667_0137351 | 3300046559 | Bacteria | 1576 |
| 370 | Ga0495635_0098131 | 3300046663 | Bacteria | 2003 |
| 371 | Ga0495635_0104193 | 3300046663 | Bacteria | 1939 |
| 372 | Ga0495635_0299464 | 3300046663 | Bacteria | 1078 |
| 373 | Ga0495657_0184882 | 3300046675 | Bacteria | 1277 |
| 374 | Ga0495623_0112412 | 3300046679 | Bacteria | 1649 |
| 375 | Ga0495658_0052178 | 3300046683 | Unclassified | 2318 |
| 376 | Ga0495658_0167457 | 3300046683 | Bacteria | 1358 |
| 377 | Ga0495669_0019412 | 3300046684 | Bacteria | 2934 |
| 378 | Ga0495669_0066863 | 3300046684 | Bacteria | 1633 |
| 379 | Ga0495669_0147914 | 3300046684 | Bacteria | 1111 |
| 380 | Ga0495613_0235751 | 3300046689 | Bacteria | 1281 |
| 381 | Ga0495600_0190410 | 3300046809 | Bacteria | 1319 |
| 382 | Ga0495581_0105393 | 3300047315 | Bacteria | 1638 |
| 383 | Ga0495581_0180686 | 3300047315 | Bacteria | 1234 |
| 384 | Ga0495674_0093358 | 3300047319 | Bacteria | 2568 |
| 385 | Ga0495680_0545292 | 3300047322 | Bacteria | 782 |
| 386 | Ga0495683_0130211 | 3300047323 | Bacteria | 1187 |
| 387 | Ga0495675_0028503 | 3300047444 | Bacteria | 3559 |
| 388 | Ga0495675_0276858 | 3300047444 | Bacteria | 1001 |
| 389 | Ga0495677_0040450 | 3300047445 | Bacteria | 1705 |
| 390 | Ga0495602_0367087 | 3300048088 | Unclassified | 1035 |
| 391 | Ga0495614_0121773 | 3300048089 | Unclassified | 1151 |
| 392 | Ga0496100_0793542 | 3300048903 | Unclassified | 742 |
| 393 | Ga0496102_0261671 | 3300048905 | Unclassified | 1631 |
| 394 | Ga0496103_0298587 | 3300048906 | Bacteria | 1036 |
| 395 | Ga0496104_0026552 | 3300048907 | Bacteria | 5350 |
| 396 | Ga0496104_0109016 | 3300048907 | Bacteria | 2654 |
| 397 | Ga0496105_0008093 | 3300048908 | Bacteria | 8175 |
| 398 | Ga0496108_1405013 | 3300048911 | Unclassified | 584 |
| 399 | Ga0496109_0212653 | 3300048912 | Unclassified | 1818 |
| 400 | Ga0496110_0175271 | 3300048913 | Bacteria | 1946 |
| 401 | Ga0496110_0342494 | 3300048913 | Unclassified | 1362 |
| 402 | Ga0496111_0021192 | 3300048914 | Unclassified | 4534 |
| 403 | Ga0496111_0039057 | 3300048914 | Unclassified | 3402 |
| 404 | Ga0496111_0402820 | 3300048914 | Unclassified | 1011 |
| 405 | Ga0496111_0751844 | 3300048914 | Unclassified | 707 |
| 406 | Ga0496112_0002577 | 3300048915 | Bacteria | 14640 |
| 407 | Ga0496112_0011890 | 3300048915 | Bacteria | 7973 |
| 408 | Ga0496112_0012416 | 3300048915 | Bacteria | 7831 |
| 409 | Ga0496112_0028527 | 3300048915 | Bacteria | 5388 |
| 410 | Ga0496112_0298708 | 3300048915 | Bacteria | 1556 |
| 411 | Ga0496112_0679389 | 3300048915 | Unclassified | 958 |
| 412 | Ga0496113_0012450 | 3300048916 | Bacteria | 5716 |
| 413 | Ga0496113_0093149 | 3300048916 | Bacteria | 2325 |
| 414 | Ga0496113_0211281 | 3300048916 | Unclassified | 1545 |
| 415 | Ga0496115_0387281 | 3300048918 | Unclassified | 1136 |
| 416 | Ga0496115_0496958 | 3300048918 | Unclassified | 981 |
| 417 | Ga0496115_0561762 | 3300048918 | Unclassified | 911 |
| 418 | Ga0501306_054127 | 3300049127 | Unclassified | 649 |
| 419 | Ga0501306_055080 | 3300049127 | Bacteria | 645 |
| 420 | Ga0501308_034773 | 3300049128 | Unclassified | 690 |
| 421 | Ga0501309_054136 | 3300049129 | Unclassified | 635 |
| 422 | Ga0501343_015798 | 3300049132 | Unclassified | 644 |
| 423 | Ga0501304_022188 | 3300049160 | Unclassified | 636 |
| 424 | Ga0501305_061063 | 3300049161 | Unclassified | 649 |
| 425 | Ga0501305_092033 | 3300049161 | Unclassified | 556 |
| 426 | Ga0501307_044904 | 3300049162 | Unclassified | 651 |
| 427 | Ga0501307_045679 | 3300049162 | Unclassified | 647 |
| 428 | Ga0501296_001786 | 3300049519 | Bacteria | 2188 |
| 429 | Ga0501300_012719 | 3300049523 | Unclassified | 1226 |
| 430 | Ga0501311_032580 | 3300049527 | Unclassified | 761 |
| 431 | Ga0501312_041165 | 3300049528 | Unclassified | 756 |
| 432 | Ga0501313_044993 | 3300049529 | Unclassified | 600 |
| 433 | Ga0501314_024307 | 3300049530 | Unclassified | 646 |
| 434 | Ga0501315_042490 | 3300049531 | Unclassified | 692 |
| 435 | Ga0501315_050416 | 3300049531 | Unclassified | 653 |
| 436 | Ga0501318_057564 | 3300049534 | Unclassified | 590 |
| 437 | Ga0501320_033353 | 3300049536 | Unclassified | 649 |
| 438 | Ga0501325_027442 | 3300049541 | Unclassified | 635 |
| 439 | Ga0501332_09417 | 3300049548 | Unclassified | 643 |
| 440 | Ga0501332_09454 | 3300049548 | Unclassified | 642 |
| 441 | Ga0501334_11428 | 3300049550 | Unclassified | 650 |
| 442 | Ga0501336_016652 | 3300049552 | Unclassified | 640 |
| 443 | Ga0501073_0100614 | 3300049589 | Unclassified | 2007 |
| 444 | Ga0501077_0249456 | 3300049593 | Unclassified | 1129 |
| 445 | Ga0501202_039315 | 3300049652 | Unclassified | 1016 |
| 446 | Ga0501214_016005 | 3300049659 | Unclassified | 901 |
| 447 | Ga0501217_060407 | 3300049661 | Bacteria | 1011 |
| 448 | Ga0501233_091902 | 3300049668 | Unclassified | 793 |
| 449 | Ga0501235_051904 | 3300049669 | Unclassified | 951 |
| 450 | Ga0501257_017732 | 3300049686 | Unclassified | 1657 |
| 451 | nmdc:mga0n895_205922_c1 | 3300050512 | Bacteria | 1998 |
| 452 | nmdc:mga08x19_2632_c1 | 3300050514 | Bacteria | 10862 |
| 453 | Ga0495612_0220157 | 3300053078 | Bacteria | 840 |
| 454 | Ga0495619_0052702 | 3300053085 | Unclassified | 2690 |
| 455 | Ga0590071_131483 | 3300059421 | Unclassified | 643 |
| 456 | Ga0587084_058872 | 3300059477 | Unclassified | 699 |
| 457 | Ga0587084_089713 | 3300059477 | Unclassified | 608 |
| 458 | Ga0587084_103982 | 3300059477 | Unclassified | 579 |
| 459 | Ga0587084_104274 | 3300059477 | Unclassified | 578 |
| 460 | Ga0587093_039549 | 3300059478 | Unclassified | 710 |
| 461 | Ga0587093_067423 | 3300059478 | Unclassified | 596 |
| 462 | Ga0587093_068717 | 3300059478 | Unclassified | 592 |
| 463 | Ga0587066_030066 | 3300059490 | Unclassified | 962 |
| 464 | Ga0587066_063512 | 3300059490 | Unclassified | 760 |
| 465 | Ga0587066_063624 | 3300059490 | Unclassified | 759 |
| 466 | Ga0587066_094079 | 3300059490 | Bacteria | 670 |
| 467 | Ga0587066_096395 | 3300059490 | Unclassified | 665 |
| 468 | Ga0587066_102622 | 3300059490 | Bacteria | 652 |
| 469 | Ga0587066_113702 | 3300059490 | Bacteria | 631 |
| 470 | Ga0587066_147653 | 3300059490 | Unclassified | 580 |
| 471 | Ga0587066_148431 | 3300059490 | Unclassified | 579 |
| 472 | Ga0587066_149952 | 3300059490 | Unclassified | 577 |
| 473 | Ga0587066_157573 | 3300059490 | Bacteria | 568 |
| 474 | Ga0587070_060998 | 3300059491 | Bacteria | 780 |
| 475 | Ga0587070_068416 | 3300059491 | Unclassified | 752 |
| 476 | Ga0587070_083802 | 3300059491 | Unclassified | 704 |
| 477 | Ga0587070_100501 | 3300059491 | Unclassified | 665 |
| 478 | Ga0587070_120875 | 3300059491 | Bacteria | 626 |
| 479 | Ga0587070_141037 | 3300059491 | Bacteria | 595 |
| 480 | Ga0587070_145911 | 3300059491 | Unclassified | 589 |
| 481 | Ga0587070_147158 | 3300059491 | Unclassified | 587 |
| 482 | Ga0587070_161511 | 3300059491 | Unclassified | 569 |
| 483 | Ga0587070_163907 | 3300059491 | Unclassified | 567 |
| 484 | Ga0587070_167321 | 3300059491 | Unclassified | 563 |
| 485 | Ga0587073_0037252 | 3300059492 | Bacteria | 1041 |
| 486 | Ga0587073_0085223 | 3300059492 | Unclassified | 793 |
| 487 | Ga0587073_0133708 | 3300059492 | Unclassified | 684 |
| 488 | Ga0587073_0186859 | 3300059492 | Unclassified | 612 |
| 489 | Ga0587073_0195558 | 3300059492 | Unclassified | 603 |
| 490 | Ga0587073_0205124 | 3300059492 | Unclassified | 593 |
| 491 | Ga0587073_0206111 | 3300059492 | Unclassified | 592 |
| 492 | Ga0587073_0208530 | 3300059492 | Unclassified | 590 |
| 493 | Ga0587073_0211106 | 3300059492 | Unclassified | 588 |
| 494 | Ga0587073_0220192 | 3300059492 | Unclassified | 579 |
| 495 | Ga0587073_0223141 | 3300059492 | Bacteria | 577 |
| 496 | Ga0587073_0225630 | 3300059492 | Unclassified | 575 |
| 497 | Ga0587073_0230447 | 3300059492 | Unclassified | 571 |
| 498 | Ga0587073_0230851 | 3300059492 | Unclassified | 570 |
| 499 | Ga0587077_050677 | 3300059493 | Bacteria | 868 |
| 500 | Ga0587077_096055 | 3300059493 | Unclassified | 704 |
| 501 | Ga0587077_110212 | 3300059493 | Unclassified | 673 |
| 502 | Ga0587077_164891 | 3300059493 | Bacteria | 589 |
| 503 | Ga0587077_166369 | 3300059493 | Unclassified | 587 |
| 504 | Ga0587077_166405 | 3300059493 | Unclassified | 587 |
| 505 | Ga0587077_166527 | 3300059493 | Unclassified | 587 |
| 506 | Ga0587077_172410 | 3300059493 | Bacteria | 580 |
| 507 | Ga0587077_174344 | 3300059493 | Unclassified | 578 |
| 508 | Ga0587077_180654 | 3300059493 | Bacteria | 571 |
| 509 | Ga0587080_055252 | 3300059503 | Bacteria | 760 |
| 510 | Ga0587080_069219 | 3300059503 | Unclassified | 703 |
| 511 | Ga0587080_080343 | 3300059503 | Unclassified | 668 |
| 512 | Ga0587080_083528 | 3300059503 | Unclassified | 659 |
| 513 | Ga0587080_121527 | 3300059503 | Bacteria | 579 |
| 514 | Ga0587080_122342 | 3300059503 | Unclassified | 578 |
| 515 | Ga0587080_126539 | 3300059503 | Bacteria | 571 |
| 516 | Ga0587080_127769 | 3300059503 | Unclassified | 569 |
| 517 | Ga0587082_057443 | 3300059504 | Unclassified | 759 |
| 518 | Ga0587082_065759 | 3300059504 | Bacteria | 726 |
| 519 | Ga0587082_067430 | 3300059504 | Unclassified | 720 |
| 520 | Ga0587082_118799 | 3300059504 | Unclassified | 595 |
| 521 | Ga0587082_120500 | 3300059504 | Unclassified | 592 |
| 522 | Ga0587082_125539 | 3300059504 | Unclassified | 584 |
| 523 | Ga0587082_128894 | 3300059504 | Unclassified | 579 |
| 524 | Ga0587082_134513 | 3300059504 | Unclassified | 571 |
| 525 | Ga0587082_134973 | 3300059504 | Unclassified | 570 |
| 526 | Ga0587082_145156 | 3300059504 | Unclassified | 557 |
| 527 | Ga0587082_146202 | 3300059504 | Bacteria | 555 |
| 528 | Ga0587083_0110157 | 3300059505 | Unclassified | 698 |
| 529 | Ga0587083_0121049 | 3300059505 | Unclassified | 676 |
| 530 | Ga0587083_0170512 | 3300059505 | Unclassified | 602 |
| 531 | Ga0587083_0179658 | 3300059505 | Unclassified | 591 |
| 532 | Ga0587083_0188531 | 3300059505 | Bacteria | 582 |
| 533 | Ga0587083_0190060 | 3300059505 | Bacteria | 580 |
| 534 | Ga0587083_0194614 | 3300059505 | Bacteria | 575 |
| 535 | Ga0587085_045480 | 3300059506 | Unclassified | 781 |
| 536 | Ga0587085_060856 | 3300059506 | Unclassified | 714 |
| 537 | Ga0587085_099319 | 3300059506 | Unclassified | 612 |
| 538 | Ga0587085_104802 | 3300059506 | Unclassified | 602 |
| 539 | Ga0587085_112035 | 3300059506 | Unclassified | 589 |
| 540 | Ga0587085_112862 | 3300059506 | Archaea | 588 |
| 541 | Ga0587085_117276 | 3300059506 | Bacteria | 580 |
| 542 | Ga0587085_118999 | 3300059506 | Unclassified | 578 |
| 543 | Ga0587085_123571 | 3300059506 | Bacteria | 571 |
| 544 | Ga0587085_144010 | 3300059506 | Unclassified | 544 |
| 545 | Ga0587086_042556 | 3300059507 | Unclassified | 708 |
| 546 | Ga0587086_050717 | 3300059507 | Unclassified | 668 |
| 547 | Ga0587086_068892 | 3300059507 | Unclassified | 604 |
| 548 | Ga0587086_070961 | 3300059507 | Unclassified | 598 |
| 549 | Ga0587086_077324 | 3300059507 | Unclassified | 581 |
| 550 | Ga0587086_079781 | 3300059507 | Unclassified | 575 |
| 551 | Ga0587086_080741 | 3300059507 | Bacteria | 573 |
| 552 | Ga0587086_081433 | 3300059507 | Bacteria | 571 |
| 553 | Ga0587088_039857 | 3300059508 | Unclassified | 880 |
| 554 | Ga0587088_106652 | 3300059508 | Unclassified | 632 |
| 555 | Ga0587088_120776 | 3300059508 | Unclassified | 606 |
| 556 | Ga0587088_126493 | 3300059508 | Unclassified | 597 |
| 557 | Ga0587088_130854 | 3300059508 | Unclassified | 590 |
| 558 | Ga0587088_146840 | 3300059508 | Bacteria | 567 |
| 559 | Ga0587089_038271 | 3300059509 | Bacteria | 733 |
| 560 | Ga0587089_051049 | 3300059509 | Unclassified | 664 |
| 561 | Ga0587089_061785 | 3300059509 | Unclassified | 621 |
| 562 | Ga0587089_077324 | 3300059509 | Unclassified | 574 |
| 563 | Ga0587089_077664 | 3300059509 | Unclassified | 573 |
| 564 | Ga0587089_085196 | 3300059509 | Unclassified | 555 |
| 565 | Ga0587089_085579 | 3300059509 | Unclassified | 554 |
| 566 | Ga0587089_093358 | 3300059509 | Bacteria | 538 |
| 567 | Ga0587090_045320 | 3300059510 | Bacteria | 788 |
| 568 | Ga0587090_071986 | 3300059510 | Unclassified | 677 |
| 569 | Ga0587090_083658 | 3300059510 | Unclassified | 643 |
| 570 | Ga0587090_104343 | 3300059510 | Unclassified | 597 |
| 571 | Ga0587090_111088 | 3300059510 | Bacteria | 584 |
| 572 | Ga0587090_112484 | 3300059510 | Unclassified | 582 |
| 573 | Ga0587090_118370 | 3300059510 | Unclassified | 572 |
| 574 | Ga0587091_053285 | 3300059511 | Bacteria | 837 |
| 575 | Ga0587091_084196 | 3300059511 | Unclassified | 719 |
| 576 | Ga0587091_091631 | 3300059511 | Unclassified | 699 |
| 577 | Ga0587091_092302 | 3300059511 | Unclassified | 697 |
| 578 | Ga0587091_106509 | 3300059511 | Unclassified | 664 |
| 579 | Ga0587091_144110 | 3300059511 | Unclassified | 599 |
| 580 | Ga0587091_145751 | 3300059511 | Unclassified | 597 |
| 581 | Ga0587091_153210 | 3300059511 | Bacteria | 587 |
| 582 | Ga0587091_153359 | 3300059511 | Bacteria | 587 |
| 583 | Ga0587091_159188 | 3300059511 | Unclassified | 579 |
| 584 | Ga0587091_162388 | 3300059511 | Bacteria | 575 |
| 585 | Ga0587092_064112 | 3300059512 | Unclassified | 694 |
| 586 | Ga0587092_066612 | 3300059512 | Unclassified | 685 |
| 587 | Ga0587092_092801 | 3300059512 | Unclassified | 612 |
| 588 | Ga0587092_104366 | 3300059512 | Unclassified | 588 |
| 589 | Ga0587092_109780 | 3300059512 | Unclassified | 578 |
| 590 | Ga0587092_112906 | 3300059512 | Bacteria | 572 |
| 591 | Ga0587092_120679 | 3300059512 | Bacteria | 560 |
| 592 | Ga0587094_026558 | 3300059513 | Bacteria | 874 |
| 593 | Ga0587094_048723 | 3300059513 | Unclassified | 711 |
| 594 | Ga0587094_079733 | 3300059513 | Unclassified | 603 |
| 595 | Ga0587094_084428 | 3300059513 | Unclassified | 592 |
| 596 | Ga0587094_085978 | 3300059513 | Unclassified | 588 |
| 597 | Ga0587094_088395 | 3300059513 | Unclassified | 583 |
| 598 | Ga0587094_088718 | 3300059513 | Unclassified | 582 |
| 599 | Ga0587094_089715 | 3300059513 | Bacteria | 580 |
| 600 | Ga0587094_090684 | 3300059513 | Unclassified | 578 |
| 601 | Ga0587094_091821 | 3300059513 | Unclassified | 575 |
| 602 | Ga0587094_096526 | 3300059513 | Bacteria | 566 |
| 603 | Ga0587094_109497 | 3300059513 | Bacteria | 542 |
| 604 | Ga0587095_024057 | 3300059514 | Unclassified | 600 |
| 605 | Ga0587095_024707 | 3300059514 | Unclassified | 595 |
| 606 | Ga0587095_027934 | 3300059514 | Unclassified | 572 |
| 607 | Ga0587095_028794 | 3300059514 | Unclassified | 566 |
| 608 | Ga0587097_05320 | 3300059603 | Unclassified | 602 |
| 609 | Ga0587098_051288 | 3300059604 | Unclassified | 627 |
| 610 | Ga0587098_066619 | 3300059604 | Unclassified | 576 |
| 611 | Ga0587098_068402 | 3300059604 | Unclassified | 571 |
| 612 | Ga0587106_019592 | 3300059605 | Unclassified | 989 |
| 613 | Ga0587106_051135 | 3300059605 | Unclassified | 733 |
| 614 | Ga0587106_077312 | 3300059605 | Unclassified | 642 |
| 615 | Ga0587106_094547 | 3300059605 | Unclassified | 602 |
| 616 | Ga0587106_096978 | 3300059605 | Unclassified | 597 |
| 617 | Ga0587106_107345 | 3300059605 | Unclassified | 577 |
| 618 | Ga0587106_108872 | 3300059605 | Unclassified | 575 |
| 619 | Ga0587106_110028 | 3300059605 | Unclassified | 573 |
| 620 | Ga0587106_111830 | 3300059605 | Bacteria | 570 |
| 621 | Ga0587106_119852 | 3300059605 | Unclassified | 557 |
| 622 | Ga0587121_11105 | 3300059606 | Unclassified | 571 |
| 623 | Ga0587121_11124 | 3300059606 | Unclassified | 570 |
| 624 | Ga0587125_049480 | 3300059607 | Unclassified | 589 |
| 625 | Ga0587125_052386 | 3300059607 | Unclassified | 578 |
| 626 | Ga0587129_018526 | 3300059608 | Unclassified | 602 |
| 627 | Ga0587131_010210 | 3300059609 | Unclassified | 665 |
| 628 | Ga0587131_015827 | 3300059609 | Unclassified | 586 |
| 629 | Ga0587131_016483 | 3300059609 | Unclassified | 579 |
| 630 | Ga0587099_035349 | 3300059622 | Unclassified | 623 |
| 631 | Ga0587099_035770 | 3300059622 | Unclassified | 620 |
| 632 | Ga0587099_047428 | 3300059622 | Unclassified | 566 |
| 633 | Ga0587101_036487 | 3300059623 | Unclassified | 792 |
| 634 | Ga0587101_051549 | 3300059623 | Unclassified | 710 |
| 635 | Ga0587101_051741 | 3300059623 | Unclassified | 709 |
| 636 | Ga0587101_093793 | 3300059623 | Bacteria | 587 |
| 637 | Ga0587109_082933 | 3300059624 | Unclassified | 712 |
| 638 | Ga0587109_087549 | 3300059624 | Unclassified | 698 |
| 639 | Ga0587109_153289 | 3300059624 | Unclassified | 571 |
| 640 | Ga0587113_015869 | 3300059625 | Bacteria | 750 |
| 641 | Ga0587113_036428 | 3300059625 | Bacteria | 576 |
| 642 | Ga0587115_049532 | 3300059626 | Unclassified | 679 |
| 643 | Ga0587115_055818 | 3300059626 | Unclassified | 652 |
| 644 | Ga0587115_062197 | 3300059626 | Unclassified | 628 |
| 645 | Ga0587115_076623 | 3300059626 | Unclassified | 586 |
| 646 | Ga0587115_078838 | 3300059626 | Bacteria | 580 |
| 647 | Ga0587115_079041 | 3300059626 | Bacteria | 580 |
| 648 | Ga0587117_044449 | 3300059627 | Unclassified | 718 |
| 649 | Ga0587117_082037 | 3300059627 | Unclassified | 589 |
| 650 | Ga0587122_034369 | 3300059628 | Unclassified | 608 |
| 651 | Ga0587122_040830 | 3300059628 | Unclassified | 576 |
| 652 | Ga0587127_020890 | 3300059629 | Unclassified | 580 |
| 653 | Ga0587128_048278 | 3300059630 | Unclassified | 769 |
| 654 | Ga0587128_051247 | 3300059630 | Bacteria | 754 |
| 655 | Ga0587128_087093 | 3300059630 | Unclassified | 635 |
| 656 | Ga0587128_093621 | 3300059630 | Unclassified | 620 |
| 657 | Ga0587128_103308 | 3300059630 | Unclassified | 600 |
| 658 | Ga0587128_120071 | 3300059630 | Bacteria | 571 |
| 659 | Ga0587128_122555 | 3300059630 | Unclassified | 567 |
| 660 | Ga0587128_129422 | 3300059630 | Unclassified | 557 |
| 661 | Ga0587130_037513 | 3300059631 | Unclassified | 576 |
| 662 | Ga0587062_067526 | 3300059639 | Unclassified | 640 |
| 663 | Ga0587062_085443 | 3300059639 | Unclassified | 593 |
| 664 | Ga0587062_090004 | 3300059639 | Unclassified | 583 |
| 665 | Ga0587062_095361 | 3300059639 | Unclassified | 572 |
| 666 | Ga0587062_095953 | 3300059639 | Unclassified | 571 |
| 667 | Ga0587062_100038 | 3300059639 | Unclassified | 563 |
| 668 | Ga0587067_022486 | 3300059640 | Bacteria | 1098 |
| 669 | Ga0587067_066744 | 3300059640 | Unclassified | 767 |
| 670 | Ga0587067_087332 | 3300059640 | Unclassified | 701 |
| 671 | Ga0587067_126078 | 3300059640 | Unclassified | 620 |
| 672 | Ga0587067_140290 | 3300059640 | Unclassified | 598 |
| 673 | Ga0587067_142336 | 3300059640 | Bacteria | 595 |
| 674 | Ga0587067_148208 | 3300059640 | Unclassified | 587 |
| 675 | Ga0587067_156857 | 3300059640 | Bacteria | 576 |
| 676 | Ga0587067_161360 | 3300059640 | Unclassified | 570 |
| 677 | Ga0587068_051105 | 3300059641 | Bacteria | 774 |
| 678 | Ga0587068_063671 | 3300059641 | Unclassified | 714 |
| 679 | Ga0587068_074249 | 3300059641 | Unclassified | 676 |
| 680 | Ga0587068_112013 | 3300059641 | Unclassified | 584 |
| 681 | Ga0587068_121220 | 3300059641 | Unclassified | 568 |
| 682 | Ga0587069_045009 | 3300059642 | Unclassified | 766 |
| 683 | Ga0587069_055575 | 3300059642 | Unclassified | 716 |
| 684 | Ga0587069_072442 | 3300059642 | Unclassified | 657 |
| 685 | Ga0587069_105738 | 3300059642 | Bacteria | 580 |
| 686 | Ga0587069_105945 | 3300059642 | Unclassified | 580 |
| 687 | Ga0587069_107884 | 3300059642 | Unclassified | 577 |
| 688 | Ga0587072_063000 | 3300059643 | Unclassified | 767 |
| 689 | Ga0587072_080449 | 3300059643 | Unclassified | 703 |
| 690 | Ga0587072_133588 | 3300059643 | Unclassified | 586 |
| 691 | Ga0587072_137283 | 3300059643 | Bacteria | 580 |
| 692 | Ga0587072_138187 | 3300059643 | Unclassified | 579 |
| 693 | Ga0587072_138315 | 3300059643 | Unclassified | 579 |
| 694 | Ga0587075_052182 | 3300059644 | Unclassified | 716 |
| 695 | Ga0587075_059092 | 3300059644 | Unclassified | 687 |
| 696 | Ga0587075_087723 | 3300059644 | Unclassified | 603 |
| 697 | Ga0587075_090059 | 3300059644 | Unclassified | 598 |
| 698 | Ga0587075_092417 | 3300059644 | Unclassified | 593 |
| 699 | Ga0587075_098063 | 3300059644 | Bacteria | 581 |
| 700 | Ga0587075_100211 | 3300059644 | Bacteria | 577 |
| 701 | Ga0587076_058748 | 3300059645 | Unclassified | 770 |
| 702 | Ga0587076_097910 | 3300059645 | Unclassified | 651 |
| 703 | Ga0587076_119305 | 3300059645 | Unclassified | 609 |
| 704 | Ga0587076_131391 | 3300059645 | Unclassified | 590 |
| 705 | Ga0587076_134680 | 3300059645 | Unclassified | 585 |
| 706 | Ga0587076_136376 | 3300059645 | Unclassified | 583 |
| 707 | Ga0587076_136755 | 3300059645 | Unclassified | 582 |
| 708 | Ga0587076_137896 | 3300059645 | Bacteria | 581 |
| 709 | Ga0587076_146616 | 3300059645 | Bacteria | 569 |
| 710 | Ga0587078_031434 | 3300059646 | Unclassified | 718 |
| 711 | Ga0587078_040114 | 3300059646 | Unclassified | 659 |
| 712 | Ga0587078_056923 | 3300059646 | Bacteria | 584 |
| 713 | Ga0587079_060926 | 3300059647 | Bacteria | 818 |
| 714 | Ga0587079_072727 | 3300059647 | Bacteria | 770 |
| 715 | Ga0587079_110331 | 3300059647 | Unclassified | 668 |
| 716 | Ga0587079_122547 | 3300059647 | Unclassified | 644 |
| 717 | Ga0587079_151495 | 3300059647 | Unclassified | 600 |
| 718 | Ga0587079_151796 | 3300059647 | Unclassified | 599 |
| 719 | Ga0587079_153621 | 3300059647 | Unclassified | 597 |
| 720 | Ga0587079_159493 | 3300059647 | Unclassified | 589 |
| 721 | Ga0587079_166905 | 3300059647 | Unclassified | 580 |
| 722 | Ga0587079_173665 | 3300059647 | Bacteria | 572 |
| 723 | Ga0587100_027905 | 3300059648 | Unclassified | 585 |
| 724 | Ga0587100_030063 | 3300059648 | Unclassified | 573 |
| 725 | Ga0587102_015406 | 3300059649 | Bacteria | 812 |
| 726 | Ga0587102_044656 | 3300059649 | Unclassified | 581 |
| 727 | Ga0587102_045400 | 3300059649 | Unclassified | 578 |
| 728 | Ga0587102_048451 | 3300059649 | Bacteria | 567 |
| 729 | Ga0587102_058680 | 3300059649 | Unclassified | 533 |
| 730 | Ga0587104_015254 | 3300059650 | Unclassified | 603 |
| 731 | Ga0587104_016961 | 3300059650 | Unclassified | 583 |
| 732 | Ga0587105_011070 | 3300059651 | Unclassified | 691 |
| 733 | Ga0587105_014368 | 3300059651 | Unclassified | 640 |
| 734 | Ga0587107_040378 | 3300059652 | Unclassified | 751 |
| 735 | Ga0587107_055314 | 3300059652 | Unclassified | 685 |
| 736 | Ga0587107_057693 | 3300059652 | Unclassified | 676 |
| 737 | Ga0587107_082412 | 3300059652 | Unclassified | 607 |
| 738 | Ga0587107_083614 | 3300059652 | Unclassified | 604 |
| 739 | Ga0587107_093493 | 3300059652 | Unclassified | 584 |
| 740 | Ga0587107_101931 | 3300059652 | Unclassified | 569 |
| 741 | Ga0587107_103594 | 3300059652 | Bacteria | 566 |
| 742 | Ga0587107_115023 | 3300059652 | Unclassified | 548 |
| 743 | Ga0587108_014597 | 3300059653 | Unclassified | 700 |
| 744 | Ga0587108_025553 | 3300059653 | Unclassified | 582 |
| 745 | Ga0587108_026947 | 3300059653 | Unclassified | 572 |
| 746 | Ga0587110_031330 | 3300059654 | Unclassified | 649 |
| 747 | Ga0587110_040034 | 3300059654 | Unclassified | 599 |
| 748 | Ga0587110_045820 | 3300059654 | Unclassified | 574 |
| 749 | Ga0587114_037236 | 3300059655 | Unclassified | 773 |
| 750 | Ga0587114_063464 | 3300059655 | Unclassified | 653 |
| 751 | Ga0587114_076553 | 3300059655 | Unclassified | 615 |
| 752 | Ga0587114_081018 | 3300059655 | Unclassified | 604 |
| 753 | Ga0587114_089629 | 3300059655 | Unclassified | 584 |
| 754 | Ga0587114_091154 | 3300059655 | Unclassified | 581 |
| 755 | Ga0587114_094064 | 3300059655 | Unclassified | 575 |
| 756 | Ga0587116_11216 | 3300059656 | Unclassified | 609 |
| 757 | Ga0587118_12045 | 3300059657 | Unclassified | 670 |
| 758 | Ga0587118_15046 | 3300059657 | Unclassified | 616 |
| 759 | Ga0587119_048067 | 3300059658 | Unclassified | 630 |
| 760 | Ga0587119_050101 | 3300059658 | Unclassified | 621 |
| 761 | Ga0587119_061562 | 3300059658 | Unclassified | 579 |
| 762 | Ga0587120_010832 | 3300059659 | Bacteria | 777 |
| 763 | Ga0587124_020725 | 3300059660 | Unclassified | 670 |
| 764 | Ga0587124_032388 | 3300059660 | Unclassified | 582 |
| 765 | Ga0587060_012219 | 3300060243 | Bacteria | 750 |
| 766 | Ga0587060_025228 | 3300060243 | Unclassified | 584 |
| 767 | Ga0587060_027171 | 3300060243 | Bacteria | 569 |
| 768 | Ga0587060_027394 | 3300060243 | Bacteria | 568 |
| 769 | Ga0587065_10816 | 3300060245 | Unclassified | 578 |
| 770 | Ga0587065_11550 | 3300060245 | Bacteria | 564 |
| 771 | Ga0587081_07841 | 3300060246 | Bacteria | 739 |
| 772 | Ga0587071_092887 | 3300060344 | Unclassified | 688 |
| 773 | Ga0587071_110209 | 3300060344 | Unclassified | 647 |
| 774 | Ga0587071_131493 | 3300060344 | Unclassified | 607 |
| 775 | Ga0587071_134638 | 3300060344 | Unclassified | 602 |
| 776 | Ga0587071_145270 | 3300060344 | Unclassified | 586 |
| 777 | Ga0587071_151246 | 3300060344 | Unclassified | 577 |
| 778 | Ga0587071_152577 | 3300060344 | Bacteria | 575 |
| 779 | Ga0587071_156743 | 3300060344 | Bacteria | 570 |
| 780 | Ga0587111_0069790 | 3300060346 | Bacteria | 818 |
| 781 | Ga0587111_0145991 | 3300060346 | Unclassified | 631 |
| 782 | Ga0587111_0181934 | 3300060346 | Unclassified | 585 |
| 783 | Ga0587111_0182678 | 3300060346 | Bacteria | 584 |
| 784 | Ga0495601_0061995 | |||
| 785 | Ga0007416J51690_1125985 | |||
| 786 | Ga0007429J51699_1046483 | |||
| 787 | Ga0032354_1059976 | |||
| 788 | Ga0032354_1066097 | |||
| 789 | Ga0006780_1016482 | |||
| 790 | Ga0058863_11153212 | |||
| 791 | Ga0058863_11569050 | |||
| 792 | Ga0058863_11754875 | |||
| 793 | Ga0058863_11857806 | |||
| 794 | Ga0058863_11863930 | |||
| 795 | Ga0058863_11925810 | |||
| 796 | Ga0058863_11956713 | |||
| 797 | Ga0058861_10019025 | |||
| 798 | Ga0058861_10089434 | |||
| 799 | Ga0058861_11718966 | |||
| 800 | Ga0058861_11893838 | |||
| 801 | Ga0058861_11992514 | |||
| 802 | Ga0058861_12063548 | |||
| 803 | Ga0058861_12071100 | |||
| 804 | Ga0058860_11668191 | |||
| 805 | Ga0058862_10027633 | |||
| 806 | Ga0058862_10083027 | |||
| 807 | Ga0058862_10237800 | |||
| 808 | Ga0058862_10283175 | |||
| 809 | Ga0058862_12242859 | |||
| 810 | Ga0058862_12489290 | |||
| 811 | Ga0058862_12634582 | |||
| 812 | Ga0058862_12712853 | |||
| 813 | Ga0058862_12773325 | |||
| 814 | Ga0070658_10230147 | |||
| 815 | Ga0070658_10457363 | |||
| 816 | Ga0070683_100041128 | |||
| 817 | Ga0070683_100041418 | |||
| 818 | Ga0070690_100241760 | |||
| 819 | Ga0070690_100537349 | |||
| 820 | Ga0070670_100656103 | |||
| 821 | Ga0070666_10329544 | |||
| 822 | Ga0070680_100283498 | |||
| 823 | Ga0068868_100405333 | |||
| 824 | Ga0068868_100406854 | |||
| 825 | Ga0070692_10160211 | |||
| 826 | Ga0070675_101051753 | |||
| 827 | Ga0070671_100090975 | |||
| 828 | Ga0070673_100716788 | |||
| 829 | Ga0070709_10143169 | |||
| 830 | Ga0070709_10193338 | |||
| 831 | Ga0070709_10241844 | |||
| 832 | Ga0070709_10295725 | |||
| 833 | Ga0070709_10307965 | |||
| 834 | Ga0070709_10396058 | |||
| 835 | Ga0070714_100067263 | |||
| 836 | Ga0070714_100071436 | |||
| 837 | Ga0070714_100111923 | |||
| 838 | Ga0070713_100080440 | |||
| 839 | Ga0070713_100939842 | |||
| 840 | Ga0070713_101092901 | |||
| 841 | Ga0070710_10219717 | |||
| 842 | Ga0070710_10291360 | |||
| 843 | Ga0070711_100014595 | |||
| 844 | Ga0070711_100100718 | |||
| 845 | Ga0070711_100161418 | |||
| 846 | Ga0070678_100056639 | |||
| 847 | Ga0070681_10001396 | |||
| 848 | Ga0070681_10056421 | |||
| 849 | Ga0070681_10139225 | |||
| 850 | Ga0070681_10878977 | |||
| 851 | Ga0070679_100018579 | |||
| 852 | Ga0070679_100508429 | |||
| 853 | Ga0070684_100036417 | |||
| 854 | Ga0068853_100017419 | |||
| 855 | Ga0068853_100020247 | |||
| 856 | Ga0068853_101200063 | |||
| 857 | Ga0070686_100180238 | |||
| 858 | Ga0070693_100014801 | |||
| 859 | Ga0070693_100164901 | |||
| 860 | Ga0070665_101138883 | |||
| 861 | Ga0070665_101169895 | |||
| 862 | Ga0068855_100034709 | |||
| 863 | Ga0068855_100168097 | |||
| 864 | Ga0070664_100432939 | |||
| 865 | Ga0070664_100840159 | |||
| 866 | Ga0068857_100018237 | |||
| 867 | Ga0068857_100239934 | |||
| 868 | Ga0068857_100251315 | |||
| 869 | Ga0068857_100316382 | |||
| 870 | Ga0068854_100132878 | |||
| 871 | Ga0068856_100148746 | |||
| 872 | Ga0068856_100228289 | |||
| 873 | Ga0068856_100398165 | |||
| 874 | Ga0068856_100595336 | |||
| 875 | Ga0068852_100005898 | |||
| 876 | Ga0068852_100804858 | |||
| 877 | Ga0068864_100047589 | |||
| 878 | Ga0068864_100399507 | |||
| 879 | Ga0068866_10112667 | |||
| 880 | Ga0068866_11093237 | |||
| 881 | Ga0068851_10052675 | |||
| 882 | Ga0068870_10383864 | |||
| 883 | Ga0068863_100142939 | |||
| 884 | Ga0068863_100192694 | |||
| 885 | Ga0068858_100307487 | |||
| 886 | Ga0068858_100755837 | |||
| 887 | Ga0070717_10003492 | |||
| 888 | Ga0070717_10047404 | |||
| 889 | Ga0070717_10103474 | |||
| 890 | Ga0070717_10177364 | |||
| 891 | Ga0070717_10359686 | |||
| 892 | Ga0070717_10870042 | |||
| 893 | Ga0070715_10014640 | |||
| 894 | Ga0070716_100087012 | |||
| 895 | Ga0070716_100250721 | |||
| 896 | Ga0070716_100293879 | |||
| 897 | Ga0070716_100699147 | |||
| 898 | Ga0070712_100003189 | |||
| 899 | Ga0070712_100092032 | |||
| 900 | Ga0070712_100393733 | |||
| 901 | Ga0070712_100572288 | |||
| 902 | Ga0068871_100237694 | |||
| 903 | Ga0075434_100210190 | |||
| 904 | Ga0105240_10147767 | |||
| 905 | Ga0105240_10580189 | |||
| 906 | Ga0105245_10003224 | |||
| 907 | Ga0105245_10298715 | |||
| 908 | Ga0105247_10326128 | |||
| 909 | Ga0105247_10589003 | |||
| 910 | Ga0105241_10097073 | |||
| 911 | Ga0105241_10134299 | |||
| 912 | Ga0105242_10101416 | |||
| 913 | Ga0105248_10176504 | |||
| 914 | Ga0105237_10028852 | |||
| 915 | Ga0105237_10530865 | |||
| 916 | Ga0105237_11038725 | |||
| 917 | Ga0105238_10012728 | |||
| 918 | Ga0105238_10214584 | |||
| 919 | Ga0105238_10313147 | |||
| 920 | Ga0105238_10374500 | |||
| 921 | Ga0105238_10390939 | |||
| 922 | Ga0130087_1024887 | |||
| 923 | Ga0130086_1003611 | |||
| 924 | Ga0130086_1096415 | |||
| 925 | Ga0130086_1108030 | |||
| 926 | Ga0130084_1008471 | |||
| 927 | Ga0130084_1035078 | |||
| 928 | Ga0130084_1073972 | |||
| 929 | Ga0130085_1011334 | |||
| 930 | Ga0130085_1020795 | |||
| 931 | Ga0130085_1090748 | |||
| 932 | Ga0105239_10070517 | |||
| 933 | Ga0105239_10253965 | |||
| 934 | Ga0105239_10609311 | |||
| 935 | Ga0154014_125304 | |||
| 936 | Ga0154012_100378 | |||
| 937 | Ga0154010_108346 | |||
| 938 | Ga0154010_109350 | |||
| 939 | Ga0157369_10024546 | |||
| 940 | Ga0157369_10238596 | |||
| 941 | Ga0157369_10310442 | |||
| 942 | Ga0157374_10075515 | |||
| 943 | Ga0157374_10101998 | |||
| 944 | Ga0157374_10722069 | |||
| 945 | Ga0157378_10038740 | |||
| 946 | Ga0163162_10342186 | |||
| 947 | Ga0157372_10218573 | |||
| 948 | Ga0163163_10005110 | |||
| 949 | Ga0163163_10011221 | |||
| 950 | Ga0163163_10490279 | |||
| 951 | Ga0157379_10255024 | |||
| 952 | Ga0197907_10792033 | |||
| 953 | Ga0197907_10964357 | |||
| 954 | Ga0197907_11333336 | |||
| 955 | Ga0197907_11354473 | |||
| 956 | Ga0206356_10074769 | |||
| 957 | Ga0206356_10336812 | |||
| 958 | Ga0206356_11462292 | |||
| 959 | Ga0206356_11609040 | |||
| 960 | Ga0206349_1410711 | |||
| 961 | Ga0206349_1909049 | |||
| 962 | Ga0206355_1389164 | |||
| 963 | Ga0206355_1390066 | |||
| 964 | Ga0206351_10276108 | |||
| 965 | Ga0206351_10372442 | |||
| 966 | Ga0206352_10076735 | |||
| 967 | Ga0206352_10163759 | |||
| 968 | Ga0206352_10212782 | |||
| 969 | Ga0206352_10536618 | |||
| 970 | Ga0206352_10591758 | |||
| 971 | Ga0206352_10644806 | |||
| 972 | Ga0206352_10736554 | |||
| 973 | Ga0206352_11173103 | |||
| 974 | Ga0206350_10837566 | |||
| 975 | Ga0206350_11473213 | |||
| 976 | Ga0206350_11578846 | |||
| 977 | Ga0206354_10341010 | |||
| 978 | Ga0206354_10524267 | |||
| 979 | Ga0206354_10631412 | |||
| 980 | Ga0206354_10841452 | |||
| 981 | Ga0206354_11328234 | |||
| 982 | Ga0206353_10847012 | |||
| 983 | Ga0206353_11428091 | |||
| 984 | Ga0206353_11826493 | |||
| 985 | Ga0206353_11916467 | |||
| 986 | Ga0154015_1047633 | |||
| 987 | Ga0154015_1494084 | |||
| 988 | Ga0213874_10056524 | |||
| 989 | Ga0224712_10178751 | |||
| 990 | Ga0224712_10251876 | |||
| 991 | Ga0224712_10361390 | |||
| 992 | Ga0224712_10447537 | |||
| 993 | Ga0224712_10459180 | |||
| 994 | Ga0224712_10481673 | |||
| 995 | Ga0224712_10520943 | |||
| 996 | Ga0224712_10529898 | |||
| 997 | Ga0207692_10070139 | |||
| 998 | Ga0207692_10742143 | |||
| 999 | Ga0207642_10170071 | |||
| 1000 | Ga0207685_10467421 | |||
| 1001 | Ga0207699_10046180 | |||
| 1002 | Ga0207699_10167299 | |||
| 1003 | Ga0207699_10176214 | |||
| 1004 | Ga0207699_10320730 | |||
| 1005 | Ga0207654_10598379 | |||
| 1006 | Ga0207707_10007113 | |||
| 1007 | Ga0207707_10284644 | |||
| 1008 | Ga0207693_10005503 | |||
| 1009 | Ga0207693_10016893 | |||
| 1010 | Ga0207693_10224792 | |||
| 1011 | Ga0207693_10226264 | |||
| 1012 | Ga0207693_10470511 | |||
| 1013 | Ga0207693_10476679 | |||
| 1014 | Ga0207663_10013069 | |||
| 1015 | Ga0207663_10342040 | |||
| 1016 | Ga0207663_10694674 | |||
| 1017 | Ga0207663_11251750 | |||
| 1018 | Ga0207663_11270033 | |||
| 1019 | Ga0207660_10320944 | |||
| 1020 | Ga0207660_10543633 | |||
| 1021 | Ga0207652_10558705 | |||
| 1022 | Ga0207694_10230704 | |||
| 1023 | Ga0207694_10499827 | |||
| 1024 | Ga0207694_10673376 | |||
| 1025 | Ga0207650_10682474 | |||
| 1026 | Ga0207687_10116806 | |||
| 1027 | Ga0207700_10010236 | |||
| 1028 | Ga0207700_10163481 | |||
| 1029 | Ga0207700_10335473 | |||
| 1030 | Ga0207700_10581044 | |||
| 1031 | Ga0207700_10664467 | |||
| 1032 | Ga0207700_10827495 | |||
| 1033 | Ga0207700_10915988 | |||
| 1034 | Ga0207700_11153895 | |||
| 1035 | Ga0207664_10064248 | |||
| 1036 | Ga0207664_10098537 | |||
| 1037 | Ga0207664_10118065 | |||
| 1038 | Ga0207644_10587400 | |||
| 1039 | Ga0207686_10045126 | |||
| 1040 | Ga0207665_10032057 | |||
| 1041 | Ga0207665_10113860 | |||
| 1042 | Ga0207665_10127202 | |||
| 1043 | Ga0207665_10386801 | |||
| 1044 | Ga0207711_10076202 | |||
| 1045 | Ga0207661_10002790 | |||
| 1046 | Ga0207661_10242446 | |||
| 1047 | Ga0207661_10829030 | |||
| 1048 | Ga0207679_10123927 | |||
| 1049 | Ga0207667_10133202 | |||
| 1050 | Ga0207667_10169442 | |||
| 1051 | Ga0207703_10379035 | |||
| 1052 | Ga0207703_10722026 | |||
| 1053 | Ga0207639_10089433 | |||
| 1054 | Ga0207702_10217429 | |||
| 1055 | Ga0207702_10943367 | |||
| 1056 | Ga0207641_10160382 | |||
| 1057 | Ga0207676_10327406 | |||
| 1058 | Ga0207674_10017483 | |||
| 1059 | Ga0207674_10187854 | |||
| 1060 | Ga0207674_10255385 | |||
| 1061 | Ga0207698_10430474 | |||
| 1062 | Ga0207698_11114346 | |||
| 1063 | Ga0268266_11370098 | |||
| 1064 | Ga0265338_10231841 | |||
| 1065 | Ga0265339_10095425 | |||
| 1066 | Ga0307408_100052338 | |||
| 1067 | Ga0307405_10049306 | |||
| 1068 | Ga0307413_10270103 | |||
| 1069 | Ga0307410_10009378 | |||
| 1070 | Ga0307410_10071919 | |||
| 1071 | Ga0307410_11102025 | |||
| 1072 | Ga0307406_10226904 | |||
| 1073 | Ga0307407_10084919 | |||
| 1074 | Ga0307409_100003951 | |||
| 1075 | Ga0307409_100672664 | |||
| 1076 | Ga0307416_100055411 | |||
| 1077 | Ga0307414_10526213 | |||
| 1078 | Ga0307411_10005595 | |||
| 1079 | Ga0307411_10301672 | |||
| 1080 | Ga0307415_100014733 | |||
| 1081 | Ga0373926_0009391 | |||
| 1082 | Ga0373926_0219671 | |||
| 1083 | Ga0373944_0011241 | |||
| 1084 | Ga0373944_0072017 | |||
| 1085 | Ga0373923_0016487 | |||
| 1086 | Ga0373936_0004487 | |||
| 1087 | Ga0373945_0084858 | |||
| 1088 | Ga0373956_0278986 | |||
| 1089 | Ga0373957_0075782 | |||
| 1090 | Ga0373943_0007587 | |||
| 1091 | Ga0373943_0042606 | |||
| 1092 | Ga0373943_0151619 | |||
| 1093 | Ga0373946_0062284 | |||
| 1094 | Ga0373946_0081816 | |||
| 1095 | Ga0373955_0097793 | |||
| 1096 | Ga0373955_0351889 | |||
| 1097 | Ga0373924_0020332 | |||
| 1098 | Ga0373924_0040690 | |||
| 1099 | Ga0373924_0125973 | |||
| 1100 | Ga0373935_0178971 | |||
| 1101 | Ga0373935_0203377 | |||
| 1102 | Ga0373935_0362120 | |||
| 1103 | Ga0373927_0123269 | |||
| 1104 | Ga0373927_0123559 | |||
| 1105 | Ga0373927_0715239 | |||
| 1106 | Ga0373933_0163419 | |||
| 1107 | Ga0373933_0383072 | |||
| 1108 | Ga0373947_0005790 | |||
| 1109 | Ga0373947_0144886 | |||
| 1110 | Ga0373937_0000094 | |||
| 1111 | Ga0373937_0029630 | |||
| 1112 | Ga0373937_0749119 | |||
| 1113 | Ga0373925_0003398 | |||
| 1114 | Ga0373925_0086166 | |||
| 1115 | Ga0373925_0286977 | |||
| 1116 | Ga0436363_0573438 | |||
| 1117 | Ga0436363_1183314 | |||
| 1118 | Ga0436363_1419461 | |||
| 1119 | Ga0436362_0667706 | |||
| 1120 | Ga0451577_0123387 | |||
| 1121 | Ga0451577_0485398 | |||
| 1122 | Ga0466966_0077021 | |||
| 1123 | Ga0466964_0227288 | |||
| 1124 | Ga0453684_1029948 | |||
| 1125 | Ga0453684_1500048 | |||
| 1126 | Ga0453684_1738926 | |||
| 1127 | Ga0466957_0000162 | |||
| 1128 | Ga0466959_0009712 | |||
| 1129 | Ga0451576_0573087 | |||
| 1130 | Ga0451576_0808107 | |||
| 1131 | Ga0466958_0011267 | |||
| 1132 | Ga0466967_0087685 | |||
| 1133 | Ga0466967_0268964 | |||
| 1134 | Ga0495651_0037819 | |||
| 1135 | Ga0495651_0096056 | |||
| 1136 | Ga0495651_0641840 | |||
| 1137 | Ga0495653_0134125 | |||
| 1138 | Ga0495580_0164206 | |||
| 1139 | Ga0495580_0441725 | |||
| 1140 | Ga0495580_0490066 | |||
| 1141 | Ga0495582_0681096 | |||
| 1142 | Ga0495605_0123203 | |||
| 1143 | Ga0495639_0023160 | |||
| 1144 | Ga0495664_0358423 | |||
| 1145 | Ga0495594_0028356 | |||
| 1146 | Ga0495594_0323946 | |||
| 1147 | Ga0495630_0426170 | |||
| 1148 | Ga0495665_0018170 | |||
| 1149 | Ga0495587_0099306 | |||
| 1150 | Ga0495622_0216711 | |||
| 1151 | Ga0495667_0129853 | |||
| 1152 | Ga0495667_0137351 | |||
| 1153 | Ga0495635_0098131 | |||
| 1154 | Ga0495635_0104193 | |||
| 1155 | Ga0495635_0299464 | |||
| 1156 | Ga0495657_0184882 | |||
| 1157 | Ga0495623_0112412 | |||
| 1158 | Ga0495658_0052178 | |||
| 1159 | Ga0495658_0167457 | |||
| 1160 | Ga0495669_0019412 | |||
| 1161 | Ga0495669_0066863 | |||
| 1162 | Ga0495669_0147914 | |||
| 1163 | Ga0495613_0235751 | |||
| 1164 | Ga0495600_0190410 | |||
| 1165 | Ga0495581_0105393 | |||
| 1166 | Ga0495581_0180686 | |||
| 1167 | Ga0495674_0093358 | |||
| 1168 | Ga0495680_0545292 | |||
| 1169 | Ga0495683_0130211 | |||
| 1170 | Ga0495675_0028503 | |||
| 1171 | Ga0495675_0276858 | |||
| 1172 | Ga0495677_0040450 | |||
| 1173 | Ga0495602_0367087 | |||
| 1174 | Ga0495614_0121773 | |||
| 1175 | Ga0496100_0793542 | |||
| 1176 | Ga0496102_0261671 | |||
| 1177 | Ga0496103_0298587 | |||
| 1178 | Ga0496104_0026552 | |||
| 1179 | Ga0496104_0109016 | |||
| 1180 | Ga0496105_0008093 | |||
| 1181 | Ga0496108_1405013 | |||
| 1182 | Ga0496109_0212653 | |||
| 1183 | Ga0496110_0175271 | |||
| 1184 | Ga0496110_0342494 | |||
| 1185 | Ga0496111_0021192 | |||
| 1186 | Ga0496111_0039057 | |||
| 1187 | Ga0496111_0402820 | |||
| 1188 | Ga0496111_0751844 | |||
| 1189 | Ga0496112_0002577 | |||
| 1190 | Ga0496112_0011890 | |||
| 1191 | Ga0496112_0012416 | |||
| 1192 | Ga0496112_0028527 | |||
| 1193 | Ga0496112_0298708 | |||
| 1194 | Ga0496112_0679389 | |||
| 1195 | Ga0496113_0012450 | |||
| 1196 | Ga0496113_0093149 | |||
| 1197 | Ga0496113_0211281 | |||
| 1198 | Ga0496115_0387281 | |||
| 1199 | Ga0496115_0496958 | |||
| 1200 | Ga0496115_0561762 | |||
| 1201 | Ga0501306_054127 | |||
| 1202 | Ga0501306_055080 | |||
| 1203 | Ga0501308_034773 | |||
| 1204 | Ga0501309_054136 | |||
| 1205 | Ga0501343_015798 | |||
| 1206 | Ga0501304_022188 | |||
| 1207 | Ga0501305_061063 | |||
| 1208 | Ga0501305_092033 | |||
| 1209 | Ga0501307_044904 | |||
| 1210 | Ga0501307_045679 | |||
| 1211 | Ga0501296_001786 | |||
| 1212 | Ga0501300_012719 | |||
| 1213 | Ga0501311_032580 | |||
| 1214 | Ga0501312_041165 | |||
| 1215 | Ga0501313_044993 | |||
| 1216 | Ga0501314_024307 | |||
| 1217 | Ga0501315_042490 | |||
| 1218 | Ga0501315_050416 | |||
| 1219 | Ga0501318_057564 | |||
| 1220 | Ga0501320_033353 | |||
| 1221 | Ga0501325_027442 | |||
| 1222 | Ga0501332_09417 | |||
| 1223 | Ga0501332_09454 | |||
| 1224 | Ga0501334_11428 | |||
| 1225 | Ga0501336_016652 | |||
| 1226 | Ga0501073_0100614 | |||
| 1227 | Ga0501077_0249456 | |||
| 1228 | Ga0501202_039315 | |||
| 1229 | Ga0501214_016005 | |||
| 1230 | Ga0501217_060407 | |||
| 1231 | Ga0501233_091902 | |||
| 1232 | Ga0501235_051904 | |||
| 1233 | Ga0501257_017732 | |||
| 1234 | nmdc:mga0n895_205922_c1 | |||
| 1235 | nmdc:mga08x19_2632_c1 | |||
| 1236 | Ga0495612_0220157 | |||
| 1237 | Ga0495619_0052702 | |||
| 1238 | Ga0590071_131483 | |||
| 1239 | Ga0587084_058872 | |||
| 1240 | Ga0587084_089713 | |||
| 1241 | Ga0587084_103982 | |||
| 1242 | Ga0587084_104274 | |||
| 1243 | Ga0587093_039549 | |||
| 1244 | Ga0587093_067423 | |||
| 1245 | Ga0587093_068717 | |||
| 1246 | Ga0587066_030066 | |||
| 1247 | Ga0587066_063512 | |||
| 1248 | Ga0587066_063624 | |||
| 1249 | Ga0587066_094079 | |||
| 1250 | Ga0587066_096395 | |||
| 1251 | Ga0587066_102622 | |||
| 1252 | Ga0587066_113702 | |||
| 1253 | Ga0587066_147653 | |||
| 1254 | Ga0587066_148431 | |||
| 1255 | Ga0587066_149952 | |||
| 1256 | Ga0587066_157573 | |||
| 1257 | Ga0587070_060998 | |||
| 1258 | Ga0587070_068416 | |||
| 1259 | Ga0587070_083802 | |||
| 1260 | Ga0587070_100501 | |||
| 1261 | Ga0587070_120875 | |||
| 1262 | Ga0587070_141037 | |||
| 1263 | Ga0587070_145911 | |||
| 1264 | Ga0587070_147158 | |||
| 1265 | Ga0587070_161511 | |||
| 1266 | Ga0587070_163907 | |||
| 1267 | Ga0587070_167321 | |||
| 1268 | Ga0587073_0037252 | |||
| 1269 | Ga0587073_0085223 | |||
| 1270 | Ga0587073_0133708 | |||
| 1271 | Ga0587073_0186859 | |||
| 1272 | Ga0587073_0195558 | |||
| 1273 | Ga0587073_0205124 | |||
| 1274 | Ga0587073_0206111 | |||
| 1275 | Ga0587073_0208530 | |||
| 1276 | Ga0587073_0211106 | |||
| 1277 | Ga0587073_0220192 | |||
| 1278 | Ga0587073_0223141 | |||
| 1279 | Ga0587073_0225630 | |||
| 1280 | Ga0587073_0230447 | |||
| 1281 | Ga0587073_0230851 | |||
| 1282 | Ga0587077_050677 | |||
| 1283 | Ga0587077_096055 | |||
| 1284 | Ga0587077_110212 | |||
| 1285 | Ga0587077_164891 | |||
| 1286 | Ga0587077_166369 | |||
| 1287 | Ga0587077_166405 | |||
| 1288 | Ga0587077_166527 | |||
| 1289 | Ga0587077_172410 | |||
| 1290 | Ga0587077_174344 | |||
| 1291 | Ga0587077_180654 | |||
| 1292 | Ga0587080_055252 | |||
| 1293 | Ga0587080_069219 | |||
| 1294 | Ga0587080_080343 | |||
| 1295 | Ga0587080_083528 | |||
| 1296 | Ga0587080_121527 | |||
| 1297 | Ga0587080_122342 | |||
| 1298 | Ga0587080_126539 | |||
| 1299 | Ga0587080_127769 | |||
| 1300 | Ga0587082_057443 | |||
| 1301 | Ga0587082_065759 | |||
| 1302 | Ga0587082_067430 | |||
| 1303 | Ga0587082_118799 | |||
| 1304 | Ga0587082_120500 | |||
| 1305 | Ga0587082_125539 | |||
| 1306 | Ga0587082_128894 | |||
| 1307 | Ga0587082_134513 | |||
| 1308 | Ga0587082_134973 | |||
| 1309 | Ga0587082_145156 | |||
| 1310 | Ga0587082_146202 | |||
| 1311 | Ga0587083_0110157 | |||
| 1312 | Ga0587083_0121049 | |||
| 1313 | Ga0587083_0170512 | |||
| 1314 | Ga0587083_0179658 | |||
| 1315 | Ga0587083_0188531 | |||
| 1316 | Ga0587083_0190060 | |||
| 1317 | Ga0587083_0194614 | |||
| 1318 | Ga0587085_045480 | |||
| 1319 | Ga0587085_060856 | |||
| 1320 | Ga0587085_099319 | |||
| 1321 | Ga0587085_104802 | |||
| 1322 | Ga0587085_112035 | |||
| 1323 | Ga0587085_112862 | |||
| 1324 | Ga0587085_117276 | |||
| 1325 | Ga0587085_118999 | |||
| 1326 | Ga0587085_123571 | |||
| 1327 | Ga0587085_144010 | |||
| 1328 | Ga0587086_042556 | |||
| 1329 | Ga0587086_050717 | |||
| 1330 | Ga0587086_068892 | |||
| 1331 | Ga0587086_070961 | |||
| 1332 | Ga0587086_077324 | |||
| 1333 | Ga0587086_079781 | |||
| 1334 | Ga0587086_080741 | |||
| 1335 | Ga0587086_081433 | |||
| 1336 | Ga0587088_039857 | |||
| 1337 | Ga0587088_106652 | |||
| 1338 | Ga0587088_120776 | |||
| 1339 | Ga0587088_126493 | |||
| 1340 | Ga0587088_130854 | |||
| 1341 | Ga0587088_146840 | |||
| 1342 | Ga0587089_038271 | |||
| 1343 | Ga0587089_051049 | |||
| 1344 | Ga0587089_061785 | |||
| 1345 | Ga0587089_077324 | |||
| 1346 | Ga0587089_077664 | |||
| 1347 | Ga0587089_085196 | |||
| 1348 | Ga0587089_085579 | |||
| 1349 | Ga0587089_093358 | |||
| 1350 | Ga0587090_045320 | |||
| 1351 | Ga0587090_071986 | |||
| 1352 | Ga0587090_083658 | |||
| 1353 | Ga0587090_104343 | |||
| 1354 | Ga0587090_111088 | |||
| 1355 | Ga0587090_112484 | |||
| 1356 | Ga0587090_118370 | |||
| 1357 | Ga0587091_053285 | |||
| 1358 | Ga0587091_084196 | |||
| 1359 | Ga0587091_091631 | |||
| 1360 | Ga0587091_092302 | |||
| 1361 | Ga0587091_106509 | |||
| 1362 | Ga0587091_144110 | |||
| 1363 | Ga0587091_145751 | |||
| 1364 | Ga0587091_153210 | |||
| 1365 | Ga0587091_153359 | |||
| 1366 | Ga0587091_159188 | |||
| 1367 | Ga0587091_162388 | |||
| 1368 | Ga0587092_064112 | |||
| 1369 | Ga0587092_066612 | |||
| 1370 | Ga0587092_092801 | |||
| 1371 | Ga0587092_104366 | |||
| 1372 | Ga0587092_109780 | |||
| 1373 | Ga0587092_112906 | |||
| 1374 | Ga0587092_120679 | |||
| 1375 | Ga0587094_026558 | |||
| 1376 | Ga0587094_048723 | |||
| 1377 | Ga0587094_079733 | |||
| 1378 | Ga0587094_084428 | |||
| 1379 | Ga0587094_085978 | |||
| 1380 | Ga0587094_088395 | |||
| 1381 | Ga0587094_088718 | |||
| 1382 | Ga0587094_089715 | |||
| 1383 | Ga0587094_090684 | |||
| 1384 | Ga0587094_091821 | |||
| 1385 | Ga0587094_096526 | |||
| 1386 | Ga0587094_109497 | |||
| 1387 | Ga0587095_024057 | |||
| 1388 | Ga0587095_024707 | |||
| 1389 | Ga0587095_027934 | |||
| 1390 | Ga0587095_028794 | |||
| 1391 | Ga0587097_05320 | |||
| 1392 | Ga0587098_051288 | |||
| 1393 | Ga0587098_066619 | |||
| 1394 | Ga0587098_068402 | |||
| 1395 | Ga0587106_019592 | |||
| 1396 | Ga0587106_051135 | |||
| 1397 | Ga0587106_077312 | |||
| 1398 | Ga0587106_094547 | |||
| 1399 | Ga0587106_096978 | |||
| 1400 | Ga0587106_107345 | |||
| 1401 | Ga0587106_108872 | |||
| 1402 | Ga0587106_110028 | |||
| 1403 | Ga0587106_111830 | |||
| 1404 | Ga0587106_119852 | |||
| 1405 | Ga0587121_11105 | |||
| 1406 | Ga0587121_11124 | |||
| 1407 | Ga0587125_049480 | |||
| 1408 | Ga0587125_052386 | |||
| 1409 | Ga0587129_018526 | |||
| 1410 | Ga0587131_010210 | |||
| 1411 | Ga0587131_015827 | |||
| 1412 | Ga0587131_016483 | |||
| 1413 | Ga0587099_035349 | |||
| 1414 | Ga0587099_035770 | |||
| 1415 | Ga0587099_047428 | |||
| 1416 | Ga0587101_036487 | |||
| 1417 | Ga0587101_051549 | |||
| 1418 | Ga0587101_051741 | |||
| 1419 | Ga0587101_093793 | |||
| 1420 | Ga0587109_082933 | |||
| 1421 | Ga0587109_087549 | |||
| 1422 | Ga0587109_153289 | |||
| 1423 | Ga0587113_015869 | |||
| 1424 | Ga0587113_036428 | |||
| 1425 | Ga0587115_049532 | |||
| 1426 | Ga0587115_055818 | |||
| 1427 | Ga0587115_062197 | |||
| 1428 | Ga0587115_076623 | |||
| 1429 | Ga0587115_078838 | |||
| 1430 | Ga0587115_079041 | |||
| 1431 | Ga0587117_044449 | |||
| 1432 | Ga0587117_082037 | |||
| 1433 | Ga0587122_034369 | |||
| 1434 | Ga0587122_040830 | |||
| 1435 | Ga0587127_020890 | |||
| 1436 | Ga0587128_048278 | |||
| 1437 | Ga0587128_051247 | |||
| 1438 | Ga0587128_087093 | |||
| 1439 | Ga0587128_093621 | |||
| 1440 | Ga0587128_103308 | |||
| 1441 | Ga0587128_120071 | |||
| 1442 | Ga0587128_122555 | |||
| 1443 | Ga0587128_129422 | |||
| 1444 | Ga0587130_037513 | |||
| 1445 | Ga0587062_067526 | |||
| 1446 | Ga0587062_085443 | |||
| 1447 | Ga0587062_090004 | |||
| 1448 | Ga0587062_095361 | |||
| 1449 | Ga0587062_095953 | |||
| 1450 | Ga0587062_100038 | |||
| 1451 | Ga0587067_022486 | |||
| 1452 | Ga0587067_066744 | |||
| 1453 | Ga0587067_087332 | |||
| 1454 | Ga0587067_126078 | |||
| 1455 | Ga0587067_140290 | |||
| 1456 | Ga0587067_142336 | |||
| 1457 | Ga0587067_148208 | |||
| 1458 | Ga0587067_156857 | |||
| 1459 | Ga0587067_161360 | |||
| 1460 | Ga0587068_051105 | |||
| 1461 | Ga0587068_063671 | |||
| 1462 | Ga0587068_074249 | |||
| 1463 | Ga0587068_112013 | |||
| 1464 | Ga0587068_121220 | |||
| 1465 | Ga0587069_045009 | |||
| 1466 | Ga0587069_055575 | |||
| 1467 | Ga0587069_072442 | |||
| 1468 | Ga0587069_105738 | |||
| 1469 | Ga0587069_105945 | |||
| 1470 | Ga0587069_107884 | |||
| 1471 | Ga0587072_063000 | |||
| 1472 | Ga0587072_080449 | |||
| 1473 | Ga0587072_133588 | |||
| 1474 | Ga0587072_137283 | |||
| 1475 | Ga0587072_138187 | |||
| 1476 | Ga0587072_138315 | |||
| 1477 | Ga0587075_052182 | |||
| 1478 | Ga0587075_059092 | |||
| 1479 | Ga0587075_087723 | |||
| 1480 | Ga0587075_090059 | |||
| 1481 | Ga0587075_092417 | |||
| 1482 | Ga0587075_098063 | |||
| 1483 | Ga0587075_100211 | |||
| 1484 | Ga0587076_058748 | |||
| 1485 | Ga0587076_097910 | |||
| 1486 | Ga0587076_119305 | |||
| 1487 | Ga0587076_131391 | |||
| 1488 | Ga0587076_134680 | |||
| 1489 | Ga0587076_136376 | |||
| 1490 | Ga0587076_136755 | |||
| 1491 | Ga0587076_137896 | |||
| 1492 | Ga0587076_146616 | |||
| 1493 | Ga0587078_031434 | |||
| 1494 | Ga0587078_040114 | |||
| 1495 | Ga0587078_056923 | |||
| 1496 | Ga0587079_060926 | |||
| 1497 | Ga0587079_072727 | |||
| 1498 | Ga0587079_110331 | |||
| 1499 | Ga0587079_122547 | |||
| 1500 | Ga0587079_151495 | |||
| 1501 | Ga0587079_151796 | |||
| 1502 | Ga0587079_153621 | |||
| 1503 | Ga0587079_159493 | |||
| 1504 | Ga0587079_166905 | |||
| 1505 | Ga0587079_173665 | |||
| 1506 | Ga0587100_027905 | |||
| 1507 | Ga0587100_030063 | |||
| 1508 | Ga0587102_015406 | |||
| 1509 | Ga0587102_044656 | |||
| 1510 | Ga0587102_045400 | |||
| 1511 | Ga0587102_048451 | |||
| 1512 | Ga0587102_058680 | |||
| 1513 | Ga0587104_015254 | |||
| 1514 | Ga0587104_016961 | |||
| 1515 | Ga0587105_011070 | |||
| 1516 | Ga0587105_014368 | |||
| 1517 | Ga0587107_040378 | |||
| 1518 | Ga0587107_055314 | |||
| 1519 | Ga0587107_057693 | |||
| 1520 | Ga0587107_082412 | |||
| 1521 | Ga0587107_083614 | |||
| 1522 | Ga0587107_093493 | |||
| 1523 | Ga0587107_101931 | |||
| 1524 | Ga0587107_103594 | |||
| 1525 | Ga0587107_115023 | |||
| 1526 | Ga0587108_014597 | |||
| 1527 | Ga0587108_025553 | |||
| 1528 | Ga0587108_026947 | |||
| 1529 | Ga0587110_031330 | |||
| 1530 | Ga0587110_040034 | |||
| 1531 | Ga0587110_045820 | |||
| 1532 | Ga0587114_037236 | |||
| 1533 | Ga0587114_063464 | |||
| 1534 | Ga0587114_076553 | |||
| 1535 | Ga0587114_081018 | |||
| 1536 | Ga0587114_089629 | |||
| 1537 | Ga0587114_091154 | |||
| 1538 | Ga0587114_094064 | |||
| 1539 | Ga0587116_11216 | |||
| 1540 | Ga0587118_12045 | |||
| 1541 | Ga0587118_15046 | |||
| 1542 | Ga0587119_048067 | |||
| 1543 | Ga0587119_050101 | |||
| 1544 | Ga0587119_061562 | |||
| 1545 | Ga0587120_010832 | |||
| 1546 | Ga0587124_020725 | |||
| 1547 | Ga0587124_032388 | |||
| 1548 | Ga0587060_012219 | |||
| 1549 | Ga0587060_025228 | |||
| 1550 | Ga0587060_027171 | |||
| 1551 | Ga0587060_027394 | |||
| 1552 | Ga0587065_10816 | |||
| 1553 | Ga0587065_11550 | |||
| 1554 | Ga0587081_07841 | |||
| 1555 | Ga0587071_092887 | |||
| 1556 | Ga0587071_110209 | |||
| 1557 | Ga0587071_131493 | |||
| 1558 | Ga0587071_134638 | |||
| 1559 | Ga0587071_145270 | |||
| 1560 | Ga0587071_151246 | |||
| 1561 | Ga0587071_152577 | |||
| 1562 | Ga0587071_156743 | |||
| 1563 | Ga0587111_0069790 | |||
| 1564 | Ga0587111_0145991 | |||
| 1565 | Ga0587111_0181934 | |||
| 1566 | Ga0587111_0182678 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hug-assembly6.cif.gz_A | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9793 | 112 | 169 |
| 3hug-assembly2.cif.gz_E | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9745 | 112 | 172 |
| 3hug-assembly1.cif.gz_C | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.973 | 112 | 172 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.972 | 113 | 166 |
| 3hug-assembly6.cif.gz_M | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9691 | 112 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9793 | 112 | 169 | 1.10.10.10 |
| 3hugK00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9785 | 112 | 172 | 1.10.10.10 |
| 3hugI00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9759 | 112 | 172 | 1.10.10.10 |
| 3hugC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.973 | 112 | 172 | 1.10.10.10 |
| 3hugO00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.973 | 112 | 169 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1INQ3-F1-model_v4 | Sigma-24, ECF subfamily | 0.9205 | 10 | 172 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A2W0B7G4-F1-model_v4 | RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein | 0.8998 | 2 | 170 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A838J3X9-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.8904 | 19 | 172 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7V1XWA4-F1-model_v4 | RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein | 0.8876 | 2 | 172 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A2W0B7G4-F1-model_v4 | RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein | 0.8745 | 2 | 170 |
GO:0003677
GO:0006352 GO:0016987 |