F480668

General Info

Members Datasets Scaffolds Average Seq Length
783 322 758 266

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0021621|Ga0395899_0021621_1684_2574
Length 296
Sequence LAFEACGPDNRLLAHPRGTAVYVDNASVPARKPVTVPGLRAMKAQGRKIVMLTAYDASFAWQLEAAGVDVALVGDSLGMVVQGHRSTLPVTLDDMAYHTRAVARGLTSTLLIADLPFMADRDVAHSLEAAARLVGEAGAAAVKIEGAAPHILDAIATLSARAVPVCAHLGLTPQSVHKFGGFRIQGREQEAADRVLSEALAVQSAGADLLVLEGVPSALGDRITRAVQIPVIGIGAGPHCDGQVLVIYDMLGITPGKRPKFSKDFLAGRNAVGEAIAAFAEDVRSGAFPAPEHCFD

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
8 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
9 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
10 2734482264 Dyella sp. AD052 Isolate Unclassified
11 2738543009 Luteibacter sp. OK325 Isolate Unclassified
12 2739367700 Dyella sp. YR388 Isolate Unclassified
13 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
14 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
15 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
16 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
17 2884411467 Dyella sp. AD56 Isolate Rhizosphere
18 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
19 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
20 2919085039 Luteibacter sp. 1214 Isolate Unclassified
21 2919404418 Luteibacter sp. 3190 Isolate Unclassified
22 2928963466 Dyella japonica 1073 Isolate Unclassified
23 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
24 2941471342 Luteibacter sp. 621 Isolate Unclassified
25 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
115 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
190 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
191 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
211 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
212 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
217 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
218 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
318 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
319 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 1.53
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 0
Rhizoplane 2.55
Rhizosphere 71.14
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005728 3300001979 Bacteria 5226
2 JGI24739J22299_10001151 3300001989 Bacteria 9883
3 JGI24739J22299_10012267 3300001989 Bacteria 3147
4 JGI24737J22298_10015018 3300001990 Bacteria 2508
5 JGI24738J21930_10000954 3300002075 Bacteria 8293
6 JGI25156J39149_1004146 3300002705 Bacteria 4497
7 JGI25156J39149_1010840 3300002705 Bacteria 2109
8 JGI25162J39368_1000226 3300002737 Bacteria 57732
9 JGI25162J39368_1000311 3300002737 Bacteria 43163
10 JGI25162J39368_1000790 3300002737 Bacteria 21152
11 JGI25162J39368_1001503 3300002737 Bacteria 12152
12 JGI25162J39368_1004324 3300002737 Bacteria 3368
13 JGI25157J39369_1000345 3300002741 Bacteria 32775
14 JGI25157J39369_1000541 3300002741 Bacteria 22715
15 JGI25157J39369_1001083 3300002741 Bacteria 12255
16 JGI25157J39369_1002119 3300002741 Bacteria 5579
17 JGI25157J39369_1002687 3300002741 Bacteria 4140
18 JGI25163J39215_1000171 3300002771 Bacteria 25502
19 JGI25164J39214_1000035 3300002772 Bacteria 139987
20 JGI25164J39214_1000214 3300002772 Bacteria 47762
21 JGI25164J39214_1000742 3300002772 Bacteria 12152
22 JGI25164J39214_1000752 3300002772 Bacteria 12009
23 JGI25165J46597_1000226 3300003214 Bacteria 78481
24 JGI25165J46597_1000260 3300003214 Bacteria 70453
25 JGI25165J46597_1001473 3300003214 Bacteria 12149
26 JGI25165J46597_1003296 3300003214 Bacteria 4142
27 rootH1_10016990 3300003316 Bacteria 2562
28 rootH2_10004402 3300003320 Bacteria 19303
29 Ga0006562J51391_1022736 3300003578 Bacteria 5703
30 Ga0006562J51391_1022737 3300003578 Bacteria 3470
31 Ga0006562J51391_1106400 3300003578 Bacteria 3790
32 Ga0006562J51391_1106401 3300003578 Bacteria 3620
33 Ga0055538_1002052 3300003751 Bacteria 3245
34 Ga0055539_1003463 3300003752 Bacteria 2206
35 Ga0055533_1002036 3300003756 Bacteria 4902
36 Ga0055525_1000452 3300003759 Bacteria 23636
37 Ga0055527_1000082 3300003760 Bacteria 75048
38 Ga0055527_1000907 3300003760 Bacteria 7517
39 Ga0055535_1000143 3300003761 Bacteria 75049
40 Ga0055535_1000323 3300003761 Bacteria 48370
41 Ga0055535_1000593 3300003761 Bacteria 29891
42 Ga0055535_1002180 3300003761 Bacteria 7513
43 Ga0055535_1002438 3300003761 Bacteria 6511
44 Ga0055542_1000067 3300003762 Bacteria 154585
45 Ga0055542_1000190 3300003762 Bacteria 75049
46 Ga0055542_1000275 3300003762 Bacteria 57732
47 Ga0055542_1000622 3300003762 Bacteria 29891
48 Ga0055542_1002065 3300003762 Bacteria 7517
49 Ga0055542_1002332 3300003762 Bacteria 6511
50 Ga0055529_1000217 3300003763 Bacteria 75049
51 Ga0055529_1000233 3300003763 Bacteria 70453
52 Ga0055529_1000367 3300003763 Bacteria 48920
53 Ga0055529_1001133 3300003763 Bacteria 11354
54 Ga0055543_1020812 3300004625 Bacteria 1201
55 Ga0065165_1000028 3300005262 Bacteria 224430
56 Ga0065165_1001244 3300005262 Bacteria 29035
57 Ga0070658_10001605 3300005327 Bacteria 19114
58 Ga0070683_100168976 3300005329 Bacteria 2075
59 Ga0068869_100004548 3300005334 Bacteria 8636
60 Ga0070666_10000012 3300005335 Bacteria 244720
61 Ga0070666_10168093 3300005335 Bacteria 1535
62 Ga0070680_100295793 3300005336 Bacteria 1372
63 Ga0070680_100332401 3300005336 Bacteria 1291
64 Ga0070682_100001599 3300005337 Bacteria 12628
65 Ga0070682_100005594 3300005337 Bacteria 7003
66 Ga0070660_100016387 3300005339 Bacteria 5378
67 Ga0070689_100010606 3300005340 Bacteria 6570
68 Ga0070691_10040331 3300005341 Bacteria 2206
69 Ga0070661_100042502 3300005344 Bacteria 3318
70 Ga0070661_100050352 3300005344 Bacteria 3047
71 Ga0070661_100050468 3300005344 Bacteria 3044
72 Ga0070661_100072708 3300005344 Bacteria 2531
73 Ga0070692_10045384 3300005345 Bacteria 2266
74 Ga0070692_10153602 3300005345 Bacteria 1313
75 Ga0070668_100103313 3300005347 Bacteria 2261
76 Ga0070659_100043525 3300005366 Bacteria 3511
77 Ga0070659_100118427 3300005366 Bacteria 2142
78 Ga0070667_100000041 3300005367 Bacteria 170008
79 Ga0070667_100013273 3300005367 Bacteria 6805
80 Ga0070667_100122410 3300005367 Bacteria 2264
81 Ga0070667_100485351 3300005367 Bacteria 1131
82 Ga0070714_100000650 3300005435 Bacteria 24670
83 Ga0070713_100000697 3300005436 Bacteria 21613
84 Ga0070663_100000080 3300005455 Bacteria 42856
85 Ga0070663_100043617 3300005455 Bacteria 3157
86 Ga0070681_10000422 3300005458 Bacteria 34427
87 Ga0070681_10004784 3300005458 Bacteria 12975
88 Ga0070685_10007572 3300005466 Bacteria 5557
89 Ga0070685_10115922 3300005466 Bacteria 1657
90 Ga0070679_100008773 3300005530 Bacteria 9536
91 Ga0070679_100033998 3300005530 Bacteria 5050
92 Ga0070679_100035082 3300005530 Bacteria 4975
93 Ga0070679_100136895 3300005530 Bacteria 2430
94 Ga0070679_100269264 3300005530 Bacteria 1658
95 Ga0068853_100006935 3300005539 Bacteria 9045
96 Ga0068853_100013978 3300005539 Bacteria 6566
97 Ga0068853_100036801 3300005539 Bacteria 4162
98 Ga0068853_100059765 3300005539 Bacteria 3293
99 Ga0068853_100165200 3300005539 Bacteria 2000
100 Ga0068853_100174863 3300005539 Bacteria 1944
101 Ga0068853_100286720 3300005539 Bacteria 1519
102 Ga0070672_100000967 3300005543 Bacteria 17369
103 Ga0070696_100006770 3300005546 Bacteria 7651
104 Ga0070693_100002525 3300005547 Bacteria 8435
105 Ga0070665_100000062 3300005548 Bacteria 220304
106 Ga0070665_100011046 3300005548 Bacteria 9126
107 Ga0070665_100012001 3300005548 Bacteria 8741
108 Ga0070665_100015833 3300005548 Bacteria 7571
109 Ga0068855_100000186 3300005563 Bacteria 79655
110 Ga0068855_100003219 3300005563 Bacteria 19978
111 Ga0068855_100035273 3300005563 Bacteria 5958
112 Ga0068855_100055852 3300005563 Bacteria 4635
113 Ga0068855_100068209 3300005563 Bacteria 4141
114 Ga0068855_100151751 3300005563 Bacteria 2634
115 Ga0068855_100434603 3300005563 Bacteria 1434
116 Ga0068857_100002448 3300005577 Bacteria 15165
117 Ga0068857_100012794 3300005577 Bacteria 7313
118 Ga0068857_100024073 3300005577 Bacteria 5360
119 Ga0068857_100309750 3300005577 Bacteria 1456
120 Ga0068854_100000486 3300005578 Bacteria 24257
121 Ga0068854_100010548 3300005578 Bacteria 5994
122 Ga0068854_100040225 3300005578 Bacteria 3298
123 Ga0068854_100307736 3300005578 Bacteria 1284
124 Ga0068856_100002830 3300005614 Bacteria 17768
125 Ga0068856_100011894 3300005614 Bacteria 8427
126 Ga0068856_100137208 3300005614 Bacteria 2452
127 Ga0068856_100259666 3300005614 Bacteria 1752
128 Ga0068852_100024421 3300005616 Bacteria 4884
129 Ga0068852_100095568 3300005616 Bacteria 2669
130 Ga0068852_100109245 3300005616 Bacteria 2511
131 Ga0068852_100309565 3300005616 Bacteria 1531
132 Ga0068852_100371509 3300005616 Bacteria 1401
133 Ga0068859_100000704 3300005617 Bacteria 33583
134 Ga0068861_100071323 3300005719 Bacteria 2693
135 Ga0068851_10001144 3300005834 Bacteria 11493
136 Ga0068851_10022152 3300005834 Bacteria 3092
137 Ga0068858_100399759 3300005842 Bacteria 1320
138 Ga0068860_100250787 3300005843 Bacteria 1724
139 Ga0068860_100386975 3300005843 Bacteria 1381
140 Ga0068862_100001686 3300005844 Bacteria 20019
141 Ga0075369_10034813 3300006186 Bacteria 2138
142 Ga0075369_10043586 3300006186 Bacteria 1926
143 Ga0097621_100034797 3300006237 Bacteria 4021
144 Ga0097621_100499297 3300006237 Bacteria 1102
145 Ga0068865_100001033 3300006881 Bacteria 16026
146 Ga0097620_100000704 3300006931 Bacteria 33583
147 Ga0105240_10003480 3300009093 Bacteria 24428
148 Ga0105240_10005037 3300009093 Bacteria 19823
149 Ga0105240_10014526 3300009093 Bacteria 10749
150 Ga0105240_10018376 3300009093 Bacteria 9389
151 Ga0105240_10112732 3300009093 Bacteria 3287
152 Ga0105240_10280220 3300009093 Bacteria 1915
153 Ga0105247_10018982 3300009101 Bacteria 4130
154 Ga0105241_10041060 3300009174 Bacteria 3494
155 Ga0105241_10178303 3300009174 Bacteria 1760
156 Ga0105241_10560220 3300009174 Bacteria 1027
157 Ga0105242_10002687 3300009176 Bacteria 13910
158 Ga0105248_10010085 3300009177 Bacteria 10402
159 Ga0105248_10125934 3300009177 Bacteria 2890
160 Ga0105237_10000152 3300009545 Bacteria 96802
161 Ga0105237_10054848 3300009545 Bacteria 3993
162 Ga0105237_10055379 3300009545 Bacteria 3972
163 Ga0105237_10059438 3300009545 Bacteria 3824
164 Ga0105237_10101582 3300009545 Bacteria 2868
165 Ga0105238_10000540 3300009551 Bacteria 39588
166 Ga0105238_10014166 3300009551 Bacteria 8064
167 Ga0105238_10051996 3300009551 Bacteria 4119
168 Ga0105238_10062921 3300009551 Bacteria 3711
169 Ga0105238_10106626 3300009551 Bacteria 2783
170 Ga0105238_10113358 3300009551 Bacteria 2691
171 Ga0105238_10150423 3300009551 Bacteria 2303
172 Ga0105249_10000397 3300009553 Bacteria 41963
173 Ga0105239_10000020 3300010375 Bacteria 264435
174 Ga0105239_10002067 3300010375 Bacteria 26031
175 Ga0105239_10018443 3300010375 Bacteria 7707
176 Ga0105239_10021926 3300010375 Bacteria 7041
177 Ga0105239_10065757 3300010375 Bacteria 3983
178 Ga0105239_10074051 3300010375 Bacteria 3744
179 Ga0105239_10092121 3300010375 Bacteria 3345
180 Ga0105239_10160733 3300010375 Bacteria 2509
181 Ga0105239_10207563 3300010375 Bacteria 2195
182 Ga0157314_1000632 3300012500 Bacteria 3166
183 Ga0157373_10004922 3300013100 Bacteria 10056
184 Ga0157373_10014435 3300013100 Bacteria 5791
185 Ga0157373_10083316 3300013100 Bacteria 2254
186 Ga0157371_10004575 3300013102 Bacteria 12028
187 Ga0157371_10009024 3300013102 Bacteria 7882
188 Ga0157371_10108571 3300013102 Bacteria 1969
189 Ga0157370_10002917 3300013104 Bacteria 20365
190 Ga0157370_10006899 3300013104 Bacteria 12425
191 Ga0157370_10019459 3300013104 Bacteria 6809
192 Ga0157370_10029301 3300013104 Bacteria 5405
193 Ga0157370_10186698 3300013104 Bacteria 1924
194 Ga0157370_10191511 3300013104 Bacteria 1898
195 Ga0157370_10387572 3300013104 Bacteria 1287
196 Ga0157369_10000025 3300013105 Bacteria 225515
197 Ga0157369_10010299 3300013105 Bacteria 10664
198 Ga0157369_10015839 3300013105 Bacteria 8493
199 Ga0157369_10035517 3300013105 Bacteria 5464
200 Ga0157369_10218828 3300013105 Bacteria 1994
201 Ga0157369_10322123 3300013105 Bacteria 1607
202 Ga0157374_10099188 3300013296 Bacteria 2790
203 Ga0157378_10000130 3300013297 Bacteria 72949
204 Ga0157378_10607040 3300013297 Bacteria 1106
205 Ga0163162_10000015 3300013306 Bacteria 261996
206 Ga0163162_10006135 3300013306 Bacteria 11637
207 Ga0163162_10006951 3300013306 Bacteria 10972
208 Ga0163162_10164229 3300013306 Bacteria 2344
209 Ga0157372_10004575 3300013307 Bacteria 14715
210 Ga0157372_10007258 3300013307 Bacteria 11800
211 Ga0157372_10007377 3300013307 Bacteria 11699
212 Ga0157372_10050828 3300013307 Bacteria 4611
213 Ga0157372_10062380 3300013307 Bacteria 4176
214 Ga0157372_10076003 3300013307 Bacteria 3791
215 Ga0157372_10906394 3300013307 Bacteria 1023
216 Ga0157375_10001402 3300013308 Bacteria 20789
217 Ga0157375_10004646 3300013308 Bacteria 11935
218 Ga0157375_10093170 3300013308 Bacteria 3078
219 Ga0163163_10000143 3300014325 Bacteria 74622
220 Ga0182008_10000899 3300014497 Bacteria 20662
221 Ga0182008_10018678 3300014497 Bacteria 3588
222 Ga0182008_10037194 3300014497 Bacteria 2435
223 Ga0157376_10036909 3300014969 Bacteria 3962
224 Ga0157376_10195451 3300014969 Bacteria 1858
225 Ga0157376_10310487 3300014969 Bacteria 1496
226 Ga0182006_1000072 3300015261 Bacteria 133681
227 Ga0182006_1001852 3300015261 Bacteria 12129
228 Ga0182006_1091044 3300015261 Bacteria 1098
229 Ga0182007_10011710 3300015262 Bacteria 3405
230 Ga0182007_10012397 3300015262 Bacteria 3279
231 Ga0182007_10026592 3300015262 Bacteria 2003
232 Ga0182005_1000080 3300015265 Bacteria 76011
233 Ga0182005_1000551 3300015265 Bacteria 18847
234 Ga0182005_1004616 3300015265 Bacteria 4417
235 Ga0182005_1020416 3300015265 Bacteria 1823
236 Ga0183369_1006 3300015685 Bacteria 449058
237 Ga0183368_1003 3300015687 Bacteria 1276390
238 Ga0163161_10005653 3300017792 Bacteria 8670
239 Ga0206354_10548849 3300020081 Bacteria 2935
240 Ga0206354_11478949 3300020081 Bacteria 939
241 Ga0206353_10099980 3300020082 Bacteria 1533
242 Ga0206353_11983330 3300020082 Bacteria 1882
243 Ga0209435_104917 3300025206 Bacteria 1501
244 Ga0209435_104988 3300025206 Bacteria 1490
245 Ga0209760_100210 3300025207 Bacteria 26868
246 Ga0209784_100068 3300025224 Bacteria 152526
247 Ga0209566_102599 3300025225 Bacteria 3216
248 Ga0209674_100012 3300025226 Bacteria 950162
249 Ga0209674_100119 3300025226 Bacteria 135468
250 Ga0209674_100514 3300025226 Bacteria 15759
251 Ga0209674_101641 3300025226 Bacteria 5600
252 Ga0209674_102919 3300025226 Bacteria 3377
253 Ga0209672_100007 3300025228 Bacteria 959482
254 Ga0209672_100016 3300025228 Bacteria 522604
255 Ga0209672_100058 3300025228 Bacteria 211992
256 Ga0209672_100357 3300025228 Bacteria 28997
257 Ga0209672_100963 3300025228 Bacteria 12793
258 Ga0209563_100051 3300025230 Bacteria 340545
259 Ga0207427_100033 3300025231 Bacteria 338459
260 Ga0207427_100156 3300025231 Bacteria 77311
261 Ga0207427_100312 3300025231 Bacteria 33663
262 Ga0207427_100334 3300025231 Bacteria 31251
263 Ga0209437_100105 3300025233 Bacteria 220034
264 Ga0209437_100126 3300025233 Bacteria 192521
265 Ga0209437_100139 3300025233 Bacteria 172506
266 Ga0209437_100147 3300025233 Bacteria 161997
267 Ga0209437_100154 3300025233 Bacteria 153383
268 Ga0209437_102097 3300025233 Bacteria 4040
269 Ga0209437_110221 3300025233 Bacteria 1441
270 Ga0209258_100012 3300025242 Bacteria 825544
271 Ga0209258_100046 3300025242 Bacteria 369794
272 Ga0209258_100049 3300025242 Bacteria 358328
273 Ga0209258_100095 3300025242 Bacteria 223270
274 Ga0209258_100245 3300025242 Bacteria 100255
275 Ga0209258_107072 3300025242 Bacteria 1695
276 Ga0209646_1000517 3300025246 Bacteria 17280
277 Ga0209646_1001172 3300025246 Bacteria 7615
278 Ga0209646_1004456 3300025246 Bacteria 2550
279 Ga0209026_1000099 3300025250 Bacteria 161750
280 Ga0209026_1000140 3300025250 Bacteria 115081
281 Ga0209026_1000405 3300025250 Bacteria 38212
282 Ga0209026_1000726 3300025250 Bacteria 19324
283 Ga0209026_1002617 3300025250 Bacteria 6580
284 Ga0209677_101338 3300025253 Bacteria 10832
285 Ga0209148_1000002 3300025254 Bacteria 2399500
286 Ga0209148_1000010 3300025254 Bacteria 1265567
287 Ga0209148_1000014 3300025254 Bacteria 925277
288 Ga0209148_1000039 3300025254 Bacteria 482479
289 Ga0209148_1000087 3300025254 Bacteria 260905
290 Ga0209148_1000098 3300025254 Bacteria 233172
291 Ga0209148_1002333 3300025254 Bacteria 6746
292 Ga0209759_1000316 3300025256 Bacteria 64846
293 Ga0209759_1000338 3300025256 Bacteria 61744
294 Ga0209759_1001070 3300025256 Bacteria 17937
295 Ga0209759_1006753 3300025256 Bacteria 3804
296 Ga0209129_1001605 3300025258 Bacteria 12325
297 Ga0209129_1002940 3300025258 Bacteria 7790
298 Ga0209233_1000009 3300025261 Bacteria 1265567
299 Ga0209233_1000080 3300025261 Bacteria 338459
300 Ga0209233_1000083 3300025261 Bacteria 336016
301 Ga0209233_1000092 3300025261 Bacteria 308668
302 Ga0209233_1000191 3300025261 Bacteria 127938
303 Ga0209233_1025825 3300025261 Bacteria 1447
304 Ga0209455_1000010 3300025272 Bacteria 959482
305 Ga0209455_1000014 3300025272 Bacteria 806601
306 Ga0209455_1000034 3300025272 Bacteria 483129
307 Ga0209455_1000086 3300025272 Bacteria 244650
308 Ga0209455_1015163 3300025272 Bacteria 1707
309 Ga0209758_1004110 3300025297 Bacteria 12469
310 Ga0209758_1018206 3300025297 Bacteria 3456
311 Ga0209758_1023053 3300025297 Bacteria 2830
312 Ga0207656_10000907 3300025321 Bacteria 9634
313 Ga0207692_10036344 3300025898 Bacteria 2401
314 Ga0207680_10000013 3300025903 Bacteria 244716
315 Ga0207680_10072556 3300025903 Bacteria 2138
316 Ga0207647_10000029 3300025904 Bacteria 109732
317 Ga0207647_10001225 3300025904 Bacteria 19750
318 Ga0207647_10037439 3300025904 Bacteria 3076
319 Ga0207699_10152455 3300025906 Bacteria 1531
320 Ga0207705_10002035 3300025909 Bacteria 15735
321 Ga0207705_10005361 3300025909 Bacteria 9587
322 Ga0207705_10006840 3300025909 Bacteria 8426
323 Ga0207654_10000423 3300025911 Bacteria 24217
324 Ga0207707_10000380 3300025912 Bacteria 46409
325 Ga0207707_10014646 3300025912 Bacteria 6833
326 Ga0207707_10017519 3300025912 Bacteria 6246
327 Ga0207707_10032583 3300025912 Bacteria 4561
328 Ga0207707_10038162 3300025912 Bacteria 4198
329 Ga0207695_10001325 3300025913 Bacteria 41991
330 Ga0207695_10001580 3300025913 Bacteria 37116
331 Ga0207695_10005282 3300025913 Bacteria 17221
332 Ga0207695_10005709 3300025913 Bacteria 16406
333 Ga0207695_10007938 3300025913 Bacteria 13392
334 Ga0207695_10019900 3300025913 Bacteria 7713
335 Ga0207695_10036678 3300025913 Bacteria 5296
336 Ga0207695_10104456 3300025913 Bacteria 2822
337 Ga0207671_10000031 3300025914 Bacteria 247030
338 Ga0207671_10001506 3300025914 Bacteria 26857
339 Ga0207671_10018608 3300025914 Bacteria 5323
340 Ga0207671_10215670 3300025914 Bacteria 1502
341 Ga0207671_10385931 3300025914 Bacteria 1113
342 Ga0207693_10282053 3300025915 Bacteria 1302
343 Ga0207660_10111100 3300025917 Bacteria 2063
344 Ga0207657_10008885 3300025919 Bacteria 10164
345 Ga0207649_10006996 3300025920 Bacteria 6127
346 Ga0207649_10017262 3300025920 Bacteria 4090
347 Ga0207649_10047431 3300025920 Bacteria 2644
348 Ga0207649_10050424 3300025920 Bacteria 2574
349 Ga0207649_10059528 3300025920 Bacteria 2397
350 Ga0207652_10005420 3300025921 Bacteria 10349
351 Ga0207652_10098739 3300025921 Bacteria 2576
352 Ga0207694_10002048 3300025924 Bacteria 16672
353 Ga0207694_10002295 3300025924 Bacteria 15650
354 Ga0207694_10006873 3300025924 Bacteria 8642
355 Ga0207694_10057567 3300025924 Bacteria 3022
356 Ga0207650_10606128 3300025925 Bacteria 921
357 Ga0207700_10000795 3300025928 Bacteria 18225
358 Ga0207664_10000239 3300025929 Bacteria 41739
359 Ga0207664_10095942 3300025929 Bacteria 2440
360 Ga0207690_10000586 3300025932 Bacteria 23543
361 Ga0207690_10000992 3300025932 Bacteria 18165
362 Ga0207690_10034557 3300025932 Bacteria 3258
363 Ga0207690_10064484 3300025932 Bacteria 2501
364 Ga0207690_10082299 3300025932 Bacteria 2251
365 Ga0207706_10052307 3300025933 Bacteria 3606
366 Ga0207686_10003899 3300025934 Bacteria 8000
367 Ga0207670_10003200 3300025936 Bacteria 8671
368 Ga0207669_10505496 3300025937 Bacteria 968
369 Ga0207704_10000937 3300025938 Bacteria 12919
370 Ga0207691_10002689 3300025940 Bacteria 17383
371 Ga0207711_10037344 3300025941 Bacteria 4125
372 Ga0207689_10016448 3300025942 Bacteria 6260
373 Ga0207667_10001044 3300025949 Bacteria 35297
374 Ga0207667_10001074 3300025949 Bacteria 34666
375 Ga0207667_10002386 3300025949 Bacteria 23502
376 Ga0207667_10005225 3300025949 Bacteria 15835
377 Ga0207667_10007269 3300025949 Bacteria 13354
378 Ga0207667_10007692 3300025949 Bacteria 12899
379 Ga0207667_10273056 3300025949 Bacteria 1728
380 Ga0207712_10000843 3300025961 Bacteria 22439
381 Ga0207640_10000485 3300025981 Bacteria 24115
382 Ga0207640_10002635 3300025981 Bacteria 9610
383 Ga0207640_10019244 3300025981 Bacteria 4030
384 Ga0207640_10298746 3300025981 Bacteria 1273
385 Ga0207658_10000028 3300025986 Bacteria 174550
386 Ga0207658_10080038 3300025986 Bacteria 2501
387 Ga0207639_10000315 3300026041 Bacteria 34209
388 Ga0207639_10003518 3300026041 Bacteria 10530
389 Ga0207639_10007989 3300026041 Bacteria 7227
390 Ga0207639_10089944 3300026041 Bacteria 2454
391 Ga0207639_10170293 3300026041 Bacteria 1844
392 Ga0207639_10245351 3300026041 Bacteria 1559
393 Ga0207678_10000112 3300026067 Bacteria 67012
394 Ga0207678_10004531 3300026067 Bacteria 12493
395 Ga0207678_10024343 3300026067 Bacteria 5288
396 Ga0207678_10055903 3300026067 Bacteria 3399
397 Ga0207678_10141476 3300026067 Bacteria 2053
398 Ga0207702_10001547 3300026078 Bacteria 22753
399 Ga0207702_10006560 3300026078 Bacteria 10013
400 Ga0207641_10229369 3300026088 Bacteria 1725
401 Ga0207648_10156589 3300026089 Bacteria 2011
402 Ga0207674_10000685 3300026116 Bacteria 44017
403 Ga0207674_10050096 3300026116 Bacteria 4268
404 Ga0207674_10176265 3300026116 Bacteria 2090
405 Ga0207675_100141217 3300026118 Bacteria 2288
406 Ga0207698_10012151 3300026142 Bacteria 5620
407 Ga0207698_10015607 3300026142 Bacteria 5092
408 Ga0207698_10071842 3300026142 Bacteria 2748
409 Ga0268266_10000001 3300028379 Bacteria 4040580
410 Ga0268266_10000021 3300028379 Bacteria 522453
411 Ga0268266_10280941 3300028379 Bacteria 1548
412 Ga0268265_10000131 3300028380 Bacteria 95615
413 Ga0268264_10003643 3300028381 Bacteria 13255
414 Ga0268264_10484936 3300028381 Bacteria 1203
415 Ga0268264_10548486 3300028381 Bacteria 1133
416 Ga0307508_10014069 3300031616 Bacteria 7303
417 Ga0316575_10001810 3300031665 Bacteria 7011
418 Ga0316575_10020315 3300031665 Bacteria 2547
419 Ga0316575_10120670 3300031665 Bacteria 1072
420 Ga0316579_10000114 3300031691 Bacteria 21604
421 Ga0316576_10124892 3300031727 Bacteria 1933
422 Ga0316576_10195644 3300031727 Bacteria 1523
423 Ga0307516_10062132 3300031730 Bacteria 3621
424 Ga0316577_10038005 3300031733 Bacteria 2691
425 Ga0316577_10047768 3300031733 Bacteria 2390
426 Ga0307412_10000917 3300031911 Bacteria 16854
427 Ga0307409_100197930 3300031995 Bacteria 1795
428 Ga0316585_10003820 3300032137 Bacteria 4166
429 Ga0316580_10007241 3300032139 Bacteria 3298
430 Ga0316580_10011121 3300032139 Bacteria 2727
431 Ga0316593_10002104 3300032168 Bacteria 4627
432 Ga0316593_10002604 3300032168 Bacteria 4319
433 Ga0307507_10015315 3300033179 Bacteria 9033
434 Ga0307510_10000977 3300033180 Bacteria 30289
435 Ga0307510_10159835 3300033180 Bacteria 1852
436 Ga0316596_1001142 3300033541 Bacteria 5192
437 Ga0316596_1001867 3300033541 Bacteria 4393
438 Ga0316574_0000172 3300035398 Bacteria 21532
439 Ga0373937_0306011 3300036401 Bacteria 1503
440 Ga0316582_0010909 3300036647 Bacteria 5001
441 Ga0316584_0044035 3300036712 Bacteria 3328
442 Ga0395899_0000175 3300037312 Bacteria 95781
443 Ga0395899_0007904 3300037312 Bacteria 8192
444 Ga0395899_0021621 3300037312 Bacteria 4879
445 Ga0395899_0030704 3300037312 Bacteria 4040
446 Ga0395899_0090203 3300037312 Bacteria 2222
447 Ga0395899_0156999 3300037312 Bacteria 1609
448 Ga0395900_0000012 3300037418 Bacteria 401198
449 Ga0395900_0000059 3300037418 Bacteria 205996
450 Ga0395900_0004207 3300037418 Bacteria 15274
451 Ga0395900_0004359 3300037418 Bacteria 15007
452 Ga0395900_0030705 3300037418 Bacteria 5518
453 Ga0395898_0000034 3300037466 Bacteria 356745
454 Ga0395898_0001311 3300037466 Bacteria 36213
455 Ga0395898_0006426 3300037466 Bacteria 12553
456 Ga0395898_0008278 3300037466 Bacteria 11000
457 Ga0395898_0074040 3300037466 Bacteria 3290
458 Ga0395898_0367324 3300037466 Bacteria 1372
459 Ga0395901_0000816 3300038443 Bacteria 34537
460 Ga0395901_0006163 3300038443 Bacteria 12151
461 Ga0395901_0009331 3300038443 Bacteria 9946
462 Ga0395901_0010234 3300038443 Bacteria 9501
463 Ga0395901_0050339 3300038443 Bacteria 4329
464 Ga0395901_0185453 3300038443 Bacteria 2182
465 Ga0395901_0329463 3300038443 Bacteria 1579
466 Ga0395901_0432333 3300038443 Bacteria 1348
467 Ga0439436_0000067 3300041404 Bacteria 29364
468 Ga0439465_0001040 3300041413 Bacteria 8836
469 Ga0451793_0739495 3300041452 Bacteria 3120
470 Ga0451797_0261258 3300041453 Bacteria 1237
471 Ga0451807_0171222 3300041486 Bacteria 4674
472 Ga0451807_0309039 3300041486 Bacteria 1028
473 Ga0451833_0446148 3300041491 Bacteria 1288
474 Ga0451853_0953777 3300041512 Bacteria 2888
475 Ga0451853_1433675 3300041512 Bacteria 1121
476 Ga0439437_001633 3300042000 Bacteria 2371
477 Ga0450908_001144 3300042184 Bacteria 5143
478 Ga0439459_0000055 3300042438 Bacteria 9345
479 Ga0451577_0204182 3300042876 Bacteria 1784
480 Ga0466969_0011574 3300044656 Bacteria 4669
481 Ga0466969_0020653 3300044656 Bacteria 3408
482 Ga0466972_0005739 3300044658 Bacteria 6219
483 Ga0466972_0047788 3300044658 Bacteria 2068
484 Ga0466975_0180042 3300044661 Bacteria 1449
485 Ga0466989_0018571 3300044663 Bacteria 3964
486 Ga0466982_0000013 3300044672 Bacteria 136227
487 Ga0466965_0002807 3300044683 Bacteria 7503
488 Ga0466965_0117981 3300044683 Bacteria 1368
489 Ga0466966_0004686 3300044684 Bacteria 8999
490 Ga0466966_0014630 3300044684 Bacteria 5193
491 Ga0466966_0020702 3300044684 Bacteria 4322
492 Ga0466961_0000967 3300044693 Bacteria 17790
493 Ga0466961_0013541 3300044693 Bacteria 5223
494 Ga0466961_0017074 3300044693 Bacteria 4661
495 Ga0466961_0028265 3300044693 Bacteria 3605
496 Ga0466963_0174554 3300044694 Bacteria 1499
497 Ga0466971_0022747 3300044719 Bacteria 2793
498 Ga0466971_0027748 3300044719 Bacteria 2535
499 Ga0466968_0002450 3300044735 Bacteria 6806
500 Ga0466968_0013890 3300044735 Bacteria 3173
501 Ga0466970_0010342 3300044765 Bacteria 4734
502 Ga0466957_0047688 3300044842 Bacteria 2603
503 Ga0466957_0128323 3300044842 Bacteria 1622
504 Ga0466960_0005543 3300044901 Bacteria 5004
505 Ga0466959_0000068 3300045049 Bacteria 73132
506 Ga0466959_0020265 3300045049 Bacteria 4897
507 Ga0466959_0062198 3300045049 Bacteria 2713
508 Ga0466958_0049101 3300045836 Bacteria 2552
509 Ga0466958_0101272 3300045836 Bacteria 1791
510 Ga0466967_0261737 3300045976 Bacteria 1655
511 Ga0495617_000117 3300046452 Bacteria 54105
512 Ga0495638_0000007 3300046460 Bacteria 602783
513 Ga0495638_0000899 3300046460 Bacteria 30415
514 Ga0495638_0001952 3300046460 Bacteria 17692
515 Ga0495638_0001995 3300046460 Bacteria 17416
516 Ga0495638_0018140 3300046460 Bacteria 4677
517 Ga0495650_0000497 3300046471 Bacteria 59612
518 Ga0495650_0000585 3300046471 Bacteria 50650
519 Ga0495650_0003111 3300046471 Bacteria 12451
520 Ga0495582_0055392 3300046473 Bacteria 2186
521 Ga0495584_0003980 3300046491 Bacteria 7970
522 Ga0495585_0008658 3300046492 Bacteria 6153
523 Ga0495585_0013229 3300046492 Bacteria 4834
524 Ga0495607_0000088 3300046501 Bacteria 95203
525 Ga0495607_0000122 3300046501 Bacteria 81489
526 Ga0495606_0000298 3300046507 Bacteria 85739
527 Ga0495606_0001210 3300046507 Bacteria 36218
528 Ga0495606_0004779 3300046507 Bacteria 13320
529 Ga0495606_0078069 3300046507 Bacteria 2066
530 Ga0495606_0089144 3300046507 Bacteria 1900
531 Ga0495610_0004565 3300046512 Bacteria 10178
532 Ga0495610_0015527 3300046512 Bacteria 4420
533 Ga0495616_0000565 3300046513 Bacteria 28011
534 Ga0495620_0005019 3300046515 Bacteria 7416
535 Ga0495631_0001445 3300046518 Bacteria 14425
536 Ga0495631_0003807 3300046518 Bacteria 8199
537 Ga0495632_0000004 3300046519 Bacteria 381372
538 Ga0495632_0038310 3300046519 Bacteria 2428
539 Ga0495632_0052398 3300046519 Bacteria 2006
540 Ga0495632_0113406 3300046519 Bacteria 1271
541 Ga0495632_0176962 3300046519 Bacteria 978
542 Ga0495648_0005079 3300046524 Bacteria 11041
543 Ga0495648_0009504 3300046524 Bacteria 7516
544 Ga0495665_0085971 3300046531 Bacteria 1653
545 Ga0495586_0117970 3300046535 Bacteria 1481
546 Ga0495609_0003579 3300046538 Bacteria 8834
547 Ga0495597_0104277 3300046542 Bacteria 1193
548 Ga0495622_0012969 3300046557 Bacteria 3867
549 Ga0495668_0012112 3300046616 Bacteria 5130
550 Ga0495611_0000001 3300046648 Bacteria 2628469
551 Ga0495611_0000060 3300046648 Bacteria 77971
552 Ga0495625_0000022 3300046660 Bacteria 278823
553 Ga0495625_0016189 3300046660 Bacteria 5873
554 Ga0495625_0022701 3300046660 Bacteria 4806
555 Ga0495625_0097090 3300046660 Bacteria 2028
556 Ga0495661_0003615 3300046665 Bacteria 11388
557 Ga0495670_0007331 3300046691 Bacteria 5422
558 Ga0495671_0004741 3300046692 Bacteria 8031
559 Ga0495649_0013114 3300046694 Bacteria 4790
560 Ga0495589_0000137 3300046794 Bacteria 67614
561 Ga0495660_0000728 3300046810 Bacteria 25032
562 Ga0495660_0003021 3300046810 Bacteria 10492
563 Ga0495672_0081196 3300047320 Bacteria 1806
564 Ga0495683_0006531 3300047323 Bacteria 6367
565 Ga0495679_000004 3300047446 Bacteria 748056
566 Ga0495673_0000202 3300047469 Bacteria 90523
567 Ga0495673_0000749 3300047469 Bacteria 30861
568 Ga0495681_0070594 3300047470 Bacteria 1583
569 Ga0495686_0000017 3300047472 Bacteria 435554
570 Ga0495686_0001035 3300047472 Bacteria 33368
571 Ga0495686_0002896 3300047472 Bacteria 15405
572 Ga0495686_0024798 3300047472 Bacteria 3935
573 Ga0495626_0153914 3300048091 Bacteria 967
574 Ga0496100_0001258 3300048903 Bacteria 12356
575 Ga0496101_0000491 3300048904 Bacteria 24921
576 Ga0496102_0032706 3300048905 Bacteria 4674
577 Ga0496102_0083022 3300048905 Bacteria 2956
578 Ga0496102_0228311 3300048905 Bacteria 1755
579 Ga0496103_0032821 3300048906 Bacteria 3170
580 Ga0496104_0000016 3300048907 Bacteria 335025
581 Ga0496104_0669353 3300048907 Bacteria 946
582 Ga0496105_0000010 3300048908 Bacteria 309880
583 Ga0496105_0000871 3300048908 Bacteria 20658
584 Ga0496106_0005789 3300048909 Bacteria 9139
585 Ga0496115_0000025 3300048918 Bacteria 151658
586 Ga0496115_0013784 3300048918 Bacteria 6121
587 Ga0496115_0029462 3300048918 Bacteria 4311
588 Ga0496115_0037030 3300048918 Bacteria 3865
589 Ga0496115_0251320 3300048918 Bacteria 1455
590 Ga0496116_0079482 3300048919 Bacteria 2041
591 Ga0496117_0004951 3300048920 Bacteria 14305
592 Ga0496117_0011610 3300048920 Bacteria 7872
593 Ga0496118_0000429 3300048921 Bacteria 69699
594 Ga0496118_0002079 3300048921 Bacteria 28158
595 Ga0496118_0002476 3300048921 Bacteria 24790
596 Ga0496118_0006655 3300048921 Bacteria 12612
597 Ga0496118_0015454 3300048921 Bacteria 7065
598 Ga0496118_0034247 3300048921 Bacteria 4148
599 Ga0496118_0053587 3300048921 Bacteria 3064
600 Ga0496118_0060887 3300048921 Bacteria 2800
601 Ga0496118_0242450 3300048921 Bacteria 1031
602 Ga0496119_0000058 3300048922 Bacteria 173131
603 Ga0496119_0039545 3300048922 Bacteria 3029
604 Ga0496120_0001252 3300048923 Bacteria 31938
605 Ga0496120_0001892 3300048923 Bacteria 23232
606 Ga0496121_0000045 3300048924 Bacteria 336130
607 Ga0496121_0000401 3300048924 Bacteria 86663
608 Ga0496121_0002752 3300048924 Bacteria 26142
609 Ga0496121_0009537 3300048924 Bacteria 11121
610 Ga0496121_0028054 3300048924 Bacteria 5250
611 Ga0496121_0034962 3300048924 Bacteria 4510
612 Ga0496121_0037826 3300048924 Bacteria 4281
613 Ga0496121_0046023 3300048924 Bacteria 3740
614 Ga0496121_0115688 3300048924 Bacteria 2036
615 Ga0496121_0117684 3300048924 Bacteria 2013
616 Ga0496121_0179141 3300048924 Bacteria 1531
617 Ga0496122_0000759 3300048925 Bacteria 62531
618 Ga0496122_0017227 3300048925 Bacteria 6770
619 Ga0496122_0067213 3300048925 Bacteria 2583
620 Ga0496123_0001142 3300048926 Bacteria 39631
621 Ga0496123_0003690 3300048926 Bacteria 16866
622 Ga0496123_0016381 3300048926 Bacteria 6023
623 Ga0496123_0030669 3300048926 Bacteria 3931
624 Ga0496124_0028363 3300048927 Bacteria 5008
625 Ga0496124_0057811 3300048927 Bacteria 3266
626 Ga0496125_0000137 3300048928 Bacteria 160328
627 Ga0496125_0018170 3300048928 Bacteria 6683
628 Ga0496126_0001102 3300048929 Bacteria 45348
629 Ga0496126_0047577 3300048929 Bacteria 3926
630 Ga0496126_0069008 3300048929 Bacteria 3154
631 Ga0496126_0121900 3300048929 Bacteria 2260
632 Ga0496126_0242597 3300048929 Bacteria 1505
633 Ga0496126_0349516 3300048929 Bacteria 1209
634 Ga0495678_000099 3300049459 Bacteria 106223
635 Ga0495678_041137 3300049459 Bacteria 1852
636 Ga0495682_0032976 3300049460 Bacteria 1912
637 Ga0501031_0005632 3300049568 Bacteria 8162
638 Ga0501032_0001939 3300049569 Bacteria 16291
639 Ga0501032_0014972 3300049569 Bacteria 5485
640 Ga0501033_0005614 3300049570 Bacteria 9913
641 Ga0501033_0007452 3300049570 Bacteria 8523
642 Ga0501033_0025649 3300049570 Bacteria 4440
643 Ga0501033_0079699 3300049570 Bacteria 2403
644 Ga0501034_0000605 3300049571 Bacteria 56544
645 Ga0501034_0003067 3300049571 Bacteria 19272
646 Ga0501034_0004478 3300049571 Bacteria 15529
647 Ga0501034_0017499 3300049571 Bacteria 7351
648 Ga0501034_0021485 3300049571 Bacteria 6579
649 Ga0501036_0015834 3300049572 Bacteria 6297
650 Ga0501036_0056431 3300049572 Bacteria 3328
651 Ga0501036_0523104 3300049572 Bacteria 986
652 Ga0501037_0001394 3300049573 Bacteria 17733
653 Ga0501037_0015899 3300049573 Bacteria 5541
654 Ga0501037_0039752 3300049573 Bacteria 3462
655 Ga0501037_0362493 3300049573 Bacteria 998
656 Ga0501038_0000141 3300049574 Bacteria 61476
657 Ga0501038_0009677 3300049574 Bacteria 8840
658 Ga0501038_0069413 3300049574 Bacteria 2993
659 Ga0501038_0103298 3300049574 Bacteria 2370
660 Ga0501039_0010357 3300049575 Bacteria 7111
661 Ga0501039_0087333 3300049575 Bacteria 2429
662 Ga0501042_0104785 3300049578 Bacteria 2035
663 Ga0501043_0000840 3300049579 Bacteria 27302
664 Ga0501043_0005095 3300049579 Bacteria 10636
665 Ga0501043_0013050 3300049579 Bacteria 6494
666 Ga0501043_0025582 3300049579 Bacteria 4631
667 Ga0501043_0071548 3300049579 Bacteria 2724
668 Ga0501043_0138949 3300049579 Bacteria 1903
669 Ga0501043_0436075 3300049579 Bacteria 986
670 Ga0501046_0012566 3300049580 Bacteria 7200
671 Ga0501046_0014090 3300049580 Bacteria 6752
672 Ga0501046_0115571 3300049580 Bacteria 2046
673 Ga0501046_0116612 3300049580 Bacteria 2035
674 Ga0501046_0141965 3300049580 Bacteria 1817
675 Ga0501047_0002983 3300049581 Bacteria 16053
676 Ga0501047_0004063 3300049581 Bacteria 13761
677 Ga0501047_0008730 3300049581 Bacteria 9564
678 Ga0501047_0010205 3300049581 Bacteria 8883
679 Ga0501047_0011872 3300049581 Bacteria 8240
680 Ga0501047_0025393 3300049581 Bacteria 5695
681 Ga0501047_0085696 3300049581 Bacteria 3027
682 Ga0501047_0251583 3300049581 Bacteria 1615
683 Ga0501047_0292364 3300049581 Bacteria 1473
684 Ga0501047_0300140 3300049581 Bacteria 1449
685 Ga0501047_0364304 3300049581 Bacteria 1281
686 Ga0501048_0025027 3300049582 Bacteria 4353
687 Ga0501048_0075485 3300049582 Bacteria 2378
688 Ga0501067_0003110 3300049583 Bacteria 9161
689 Ga0501068_0001426 3300049584 Bacteria 12696
690 Ga0501068_0129083 3300049584 Bacteria 1580
691 Ga0501069_0003434 3300049585 Bacteria 8142
692 Ga0501069_0035758 3300049585 Bacteria 2737
693 Ga0501069_0152380 3300049585 Bacteria 1329
694 Ga0501070_0003984 3300049586 Bacteria 12700
695 Ga0501070_0005506 3300049586 Bacteria 10802
696 Ga0501070_0013239 3300049586 Bacteria 6953
697 Ga0501070_0016391 3300049586 Bacteria 6225
698 Ga0501070_0042286 3300049586 Bacteria 3795
699 Ga0501070_0080309 3300049586 Bacteria 2698
700 Ga0501071_0026570 3300049587 Bacteria 4065
701 Ga0501072_0007222 3300049588 Bacteria 8432
702 Ga0501072_0087685 3300049588 Bacteria 2470
703 Ga0501073_0000072 3300049589 Bacteria 62953
704 Ga0501073_0012859 3300049589 Bacteria 6101
705 Ga0501073_0014820 3300049589 Bacteria 5658
706 Ga0501073_0022162 3300049589 Bacteria 4577
707 Ga0501073_0074253 3300049589 Bacteria 2368
708 Ga0501073_0086040 3300049589 Bacteria 2186
709 Ga0501074_0002293 3300049590 Bacteria 13304
710 Ga0501074_0011165 3300049590 Bacteria 6525
711 Ga0501074_0017385 3300049590 Bacteria 5217
712 Ga0501074_0019544 3300049590 Bacteria 4917
713 Ga0501074_0029972 3300049590 Bacteria 3943
714 Ga0501079_0039248 3300049741 Bacteria 3652
715 Ga0501079_0044763 3300049741 Bacteria 3415
716 Ga0501079_0254786 3300049741 Bacteria 1372
717 Ga0501080_0000097 3300049742 Bacteria 59356
718 Ga0501080_0000554 3300049742 Bacteria 29568
719 Ga0501080_0003092 3300049742 Bacteria 14701
720 Ga0501080_0012182 3300049742 Bacteria 7878
721 Ga0501080_0027360 3300049742 Bacteria 5301
722 Ga0501080_0105298 3300049742 Bacteria 2615
723 Ga0501080_0121722 3300049742 Bacteria 2418
724 Ga0501083_0000128 3300049744 Bacteria 51820
725 Ga0501083_0305659 3300049744 Bacteria 1034
726 Ga0501035_0001437 3300049822 Bacteria 24424
727 Ga0501035_0003810 3300049822 Bacteria 14372
728 Ga0501035_0021748 3300049822 Bacteria 5897
729 Ga0501035_0035960 3300049822 Bacteria 4492
730 Ga0501035_0043309 3300049822 Bacteria 4057
731 Ga0501035_0050847 3300049822 Bacteria 3712
732 Ga0501035_0074266 3300049822 Bacteria 3008
733 Ga0501035_0174472 3300049822 Bacteria 1855
734 Ga0501035_0198430 3300049822 Bacteria 1722
735 Ga0501044_0003555 3300049823 Bacteria 17539
736 Ga0501044_0003906 3300049823 Bacteria 16710
737 Ga0501044_0005029 3300049823 Bacteria 14761
738 Ga0501044_0012166 3300049823 Bacteria 9317
739 Ga0501044_0013452 3300049823 Bacteria 8850
740 Ga0501044_0015582 3300049823 Bacteria 8190
741 Ga0501044_0038033 3300049823 Bacteria 5026
742 Ga0501044_0044762 3300049823 Bacteria 4590
743 Ga0501044_0084014 3300049823 Bacteria 3218
744 Ga0501044_0203046 3300049823 Bacteria 1940
745 Ga0501044_0319870 3300049823 Bacteria 1476
746 nmdc:mga0sz30_64337_c1 3300050516 Bacteria 1571
747 Ga0500610_0003839 3300053079 Bacteria 5849
748 Ga0500643_000118 3300053087 Bacteria 82138
749 Ga0500643_003789 3300053087 Bacteria 7077
750 Ga0500651_0000245 3300053093 Bacteria 33226
751 Ga0500651_0042127 3300053093 Bacteria 2877
752 Ga0500555_001900 3300053103 Bacteria 6201
753 Ga0500597_000179 3300053120 Bacteria 13013
754 Ga0500633_0003671 3300053160 Bacteria 3392
755 Ga0500645_001641 3300053730 Bacteria 11022
756 Ga0501082_0057705 3300060353 Bacteria 3344
757 Ga0466962_0003530 3300061719 Bacteria 7453
758 Ga0466962_0007751 3300061719 Bacteria 5145

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100072708 Ga0070661_1000727082 212
2 3300005458 Ga0070681_10004784 Ga0070681_100047843 212
3 3300005530 Ga0070679_100008773 Ga0070679_1000087733 212
4 3300005539 Ga0068853_100013978 Ga0068853_1000139782 212
5 3300013100 Ga0157373_10014435 Ga0157373_100144355 212
6 3300013104 Ga0157370_10029301 Ga0157370_100293012 212
7 3300013307 Ga0157372_10050828 Ga0157372_100508283 212
8 3300025912 Ga0207707_10032583 Ga0207707_100325833 212
9 3300025920 Ga0207649_10017262 Ga0207649_100172624 212
10 3300025921 Ga0207652_10005420 Ga0207652_100054209 212
11 3300038443 Ga0395901_0050339 Ga0395901_0050339_3518_4285 213
12 3300038443 Ga0395901_0432333 Ga0395901_0432333_594_1334 213
13 3300009551 Ga0105238_10150423 Ga0105238_101504232 217
14 3300009093 Ga0105240_10112732 Ga0105240_101127323 221
15 3300002737 JGI25162J39368_1000790 JGI25162J39368_10007909 222
16 3300003762 Ga0055542_1000067 Ga0055542_1000067138 222
17 3300025206 Ga0209435_104988 Ga0209435_1049882 222
18 3300025246 Ga0209646_1004456 Ga0209646_10044563 222
19 3300025256 Ga0209759_1006753 Ga0209759_10067534 222
20 3300045976 Ga0466967_0261737 Ga0466967_0261737_860_1627 222
21 3300046519 Ga0495632_0052398 Ga0495632_0052398_18_782 222
22 3300049742 Ga0501080_0027360 Ga0501080_0027360_373_1182 223
23 3300049744 Ga0501083_0305659 Ga0501083_0305659_68_877 223
24 3300005337 Ga0070682_100001599 Ga0070682_1000015999 224
25 3300005366 Ga0070659_100043525 Ga0070659_1000435253 224
26 3300005539 Ga0068853_100286720 Ga0068853_1002867202 224
27 3300005563 Ga0068855_100151751 Ga0068855_1001517513 224
28 3300005577 Ga0068857_100309750 Ga0068857_1003097502 224
29 3300013100 Ga0157373_10004922 Ga0157373_100049228 224
30 3300013102 Ga0157371_10004575 Ga0157371_1000457510 224
31 3300013104 Ga0157370_10006899 Ga0157370_100068992 224
32 3300013307 Ga0157372_10007377 Ga0157372_1000737710 224
33 3300025932 Ga0207690_10034557 Ga0207690_100345573 224
34 3300025949 Ga0207667_10007269 Ga0207667_1000726910 224
35 3300002737 JGI25162J39368_1000226 JGI25162J39368_100022647 226
36 3300002741 JGI25157J39369_1000345 JGI25157J39369_100034518 226
37 3300002741 JGI25157J39369_1000541 JGI25157J39369_100054120 226
38 3300002772 JGI25164J39214_1000214 JGI25164J39214_100021427 226
39 3300003214 JGI25165J46597_1000260 JGI25165J46597_100026028 226
40 3300003761 Ga0055535_1000323 Ga0055535_100032328 226
41 3300003762 Ga0055542_1000275 Ga0055542_100027547 226
42 3300003763 Ga0055529_1000233 Ga0055529_100023328 226
43 3300049574 Ga0501038_0069413 Ga0501038_0069413_1253_2032 226
44 3300049575 Ga0501039_0087333 Ga0501039_0087333_38_817 226
45 3300049581 Ga0501047_0085696 Ga0501047_0085696_598_1377 226
46 3300049586 Ga0501070_0016391 Ga0501070_0016391_2447_3226 226
47 3300049742 Ga0501080_0121722 Ga0501080_0121722_831_1610 226
48 3300049822 Ga0501035_0050847 Ga0501035_0050847_2738_3517 226
49 iso_pu_bacteria 2953994433 2953995055 226
50 3300009551 Ga0105238_10062921 Ga0105238_100629214 227
51 3300049580 Ga0501046_0116612 Ga0501046_0116612_339_1121 227
52 3300049571 Ga0501034_0017499 Ga0501034_0017499_4501_5322 228
53 3300049589 Ga0501073_0086040 Ga0501073_0086040_218_1039 228
54 3300049590 Ga0501074_0019544 Ga0501074_0019544_996_1817 228
55 3300049742 Ga0501080_0012182 Ga0501080_0012182_2065_2886 228
56 3300013104 Ga0157370_10387572 Ga0157370_103875722 229
57 3300049579 Ga0501043_0025582 Ga0501043_0025582_1605_2426 229
58 3300049580 Ga0501046_0014090 Ga0501046_0014090_4783_5604 229
59 3300049581 Ga0501047_0010205 Ga0501047_0010205_5884_6705 229
60 3300049585 Ga0501069_0152380 Ga0501069_0152380_286_1107 229
61 3300049586 Ga0501070_0042286 Ga0501070_0042286_922_1743 229
62 3300049590 Ga0501074_0029972 Ga0501074_0029972_2056_2877 229
63 3300049742 Ga0501080_0000554 Ga0501080_0000554_17648_18469 229
64 3300060353 Ga0501082_0057705 Ga0501082_0057705_1638_2459 229
65 3300046519 Ga0495632_0176962 Ga0495632_0176962_174_962 230
66 3300048905 Ga0496102_0228311 Ga0496102_0228311_947_1735 230
67 3300048929 Ga0496126_0242597 Ga0496126_0242597_10_798 230
68 3300028381 Ga0268264_10003643 Ga0268264_100036432 232
69 3300002737 JGI25162J39368_1001503 JGI25162J39368_10015035 233
70 3300002741 JGI25157J39369_1002119 JGI25157J39369_10021197 233
71 3300002772 JGI25164J39214_1000742 JGI25164J39214_10007429 233
72 3300003214 JGI25165J46597_1001473 JGI25165J46597_10014735 233
73 3300003756 Ga0055533_1002036 Ga0055533_10020366 233
74 3300005614 Ga0068856_100011894 Ga0068856_1000118947 233
75 3300025226 Ga0209674_100119 Ga0209674_10011948 233
76 3300025226 Ga0209674_102919 Ga0209674_1029194 233
77 3300025228 Ga0209672_100016 Ga0209672_100016382 233
78 3300025231 Ga0207427_100312 Ga0207427_10031223 233
79 3300025233 Ga0209437_100154 Ga0209437_10015422 233
80 3300025242 Ga0209258_100012 Ga0209258_100012523 233
81 3300025253 Ga0209677_101338 Ga0209677_1013384 233
82 3300025254 Ga0209148_1000014 Ga0209148_1000014133 233
83 3300025261 Ga0209233_1000092 Ga0209233_1000092267 233
84 3300025272 Ga0209455_1000014 Ga0209455_100001421 233
85 3300026078 Ga0207702_10001547 Ga0207702_1000154725 233
86 3300002737 JGI25162J39368_1004324 JGI25162J39368_10043242 234
87 3300002741 JGI25157J39369_1002687 JGI25157J39369_10026875 234
88 3300002772 JGI25164J39214_1000752 JGI25164J39214_10007529 234
89 3300003214 JGI25165J46597_1003296 JGI25165J46597_10032964 234
90 3300005436 Ga0070713_100000697 Ga0070713_10000069711 234
91 3300013104 Ga0157370_10019459 Ga0157370_100194599 234
92 3300014497 Ga0182008_10037194 Ga0182008_100371943 234
93 3300015262 Ga0182007_10011710 Ga0182007_100117103 234
94 3300015262 Ga0182007_10026592 Ga0182007_100265922 234
95 3300020081 Ga0206354_11478949 Ga0206354_114789491 234
96 3300020082 Ga0206353_10099980 Ga0206353_100999802 234
97 3300025226 Ga0209674_101641 Ga0209674_1016412 234
98 3300025231 Ga0207427_100334 Ga0207427_10033421 234
99 3300025233 Ga0209437_100139 Ga0209437_100139115 234
100 3300025250 Ga0209026_1000405 Ga0209026_100040527 234
101 3300025261 Ga0209233_1000083 Ga0209233_1000083182 234
102 3300025261 Ga0209233_1000191 Ga0209233_100019130 234
103 3300025898 Ga0207692_10036344 Ga0207692_100363443 234
104 3300025928 Ga0207700_10000795 Ga0207700_1000079520 234
105 3300025929 Ga0207664_10095942 Ga0207664_100959422 234
106 3300031665 Ga0316575_10001810 Ga0316575_100018106 234
107 3300031665 Ga0316575_10120670 Ga0316575_101206702 234
108 3300031691 Ga0316579_10000114 Ga0316579_100001147 234
109 3300031727 Ga0316576_10124892 Ga0316576_101248923 234
110 3300031727 Ga0316576_10195644 Ga0316576_101956441 234
111 3300031733 Ga0316577_10038005 Ga0316577_100380053 234
112 3300031733 Ga0316577_10047768 Ga0316577_100477683 234
113 3300032137 Ga0316585_10003820 Ga0316585_100038202 234
114 3300032139 Ga0316580_10007241 Ga0316580_100072413 234
115 3300032139 Ga0316580_10011121 Ga0316580_100111212 234
116 3300032168 Ga0316593_10002104 Ga0316593_100021042 234
117 3300033541 Ga0316596_1001142 Ga0316596_10011423 234
118 3300033541 Ga0316596_1001867 Ga0316596_10018674 234
119 3300035398 Ga0316574_0000172 Ga0316574_0000172_17170_17970 234
120 3300036647 Ga0316582_0010909 Ga0316582_0010909_3622_4422 234
121 3300036712 Ga0316584_0044035 Ga0316584_0044035_593_1393 234
122 3300037312 Ga0395899_0156999 Ga0395899_0156999_498_1328 234
123 3300038443 Ga0395901_0000816 Ga0395901_0000816_13621_14451 234
124 3300049579 Ga0501043_0071548 Ga0501043_0071548_867_1697 234
125 3300049582 Ga0501048_0025027 Ga0501048_0025027_1847_2677 234
126 3300003760 Ga0055527_1000082 Ga0055527_100008220 235
127 3300003761 Ga0055535_1000143 Ga0055535_100014320 235
128 3300003762 Ga0055542_1000190 Ga0055542_100019056 235
129 3300003763 Ga0055529_1000217 Ga0055529_100021756 235
130 3300009551 Ga0105238_10106626 Ga0105238_101066262 235
131 3300013308 Ga0157375_10093170 Ga0157375_100931702 235
132 3300025250 Ga0209026_1000140 Ga0209026_100014019 235
133 3300025256 Ga0209759_1001070 Ga0209759_100107019 235
134 3300032168 Ga0316593_10002604 Ga0316593_100026045 235
135 3300037312 Ga0395899_0000175 Ga0395899_0000175_26666_27502 235
136 3300037418 Ga0395900_0000012 Ga0395900_0000012_288820_289656 235
137 3300037466 Ga0395898_0000034 Ga0395898_0000034_256345_257181 235
138 3300038443 Ga0395901_0010234 Ga0395901_0010234_6832_7668 235
139 3300044656 Ga0466969_0020653 Ga0466969_0020653_683_1519 235
140 3300044661 Ga0466975_0180042 Ga0466975_0180042_108_944 235
141 3300044684 Ga0466966_0014630 Ga0466966_0014630_1847_2683 235
142 3300044693 Ga0466961_0017074 Ga0466961_0017074_154_990 235
143 3300045049 Ga0466959_0000068 Ga0466959_0000068_57025_57861 235
144 3300045836 Ga0466958_0101272 Ga0466958_0101272_438_1274 235
145 3300005530 Ga0070679_100033998 Ga0070679_1000339983 236
146 3300005546 Ga0070696_100006770 Ga0070696_1000067704 236
147 3300025912 Ga0207707_10014646 Ga0207707_100146464 236
148 3300046460 Ga0495638_0001995 Ga0495638_0001995_2029_2859 237
149 3300046471 Ga0495650_0000585 Ga0495650_0000585_46646_47476 237
150 3300005337 Ga0070682_100005594 Ga0070682_1000055948 238
151 3300005339 Ga0070660_100016387 Ga0070660_1000163877 238
152 3300005539 Ga0068853_100174863 Ga0068853_1001748633 238
153 3300025912 Ga0207707_10017519 Ga0207707_100175195 238
154 3300025912 Ga0207707_10038162 Ga0207707_100381626 238
155 3300025921 Ga0207652_10098739 Ga0207652_100987392 238
156 3300025932 Ga0207690_10000586 Ga0207690_100005863 238
157 3300025932 Ga0207690_10082299 Ga0207690_100822992 238
158 3300026041 Ga0207639_10007989 Ga0207639_100079892 238
159 3300026116 Ga0207674_10176265 Ga0207674_101762652 238
160 3300031995 Ga0307409_100197930 Ga0307409_1001979302 238
161 3300049570 Ga0501033_0079699 Ga0501033_0079699_10_840 238
162 3300049571 Ga0501034_0004478 Ga0501034_0004478_8150_8980 238
163 3300049573 Ga0501037_0015899 Ga0501037_0015899_2700_3530 238
164 3300049586 Ga0501070_0005506 Ga0501070_0005506_8490_9320 238
165 3300049822 Ga0501035_0035960 Ga0501035_0035960_1544_2374 238
166 3300049823 Ga0501044_0005029 Ga0501044_0005029_12279_13109 238
167 iso_pu_bacteria 2818991440 2819563813 238
168 iso_pu_bacteria 2904463128 2904463876 238
169 3300005344 Ga0070661_100050352 Ga0070661_1000503521 239
170 3300005347 Ga0070668_100103313 Ga0070668_1001033133 239
171 3300005367 Ga0070667_100000041 Ga0070667_100000041102 239
172 3300005367 Ga0070667_100013273 Ga0070667_10001327310 239
173 3300005367 Ga0070667_100122410 Ga0070667_1001224103 239
174 3300005367 Ga0070667_100485351 Ga0070667_1004853512 239
175 3300005455 Ga0070663_100000080 Ga0070663_1000000808 239
176 3300005539 Ga0068853_100006935 Ga0068853_10000693511 239
177 3300005539 Ga0068853_100036801 Ga0068853_1000368013 239
178 3300005548 Ga0070665_100000062 Ga0070665_10000006240 239
179 3300005548 Ga0070665_100011046 Ga0070665_1000110468 239
180 3300005548 Ga0070665_100012001 Ga0070665_1000120012 239
181 3300005548 Ga0070665_100015833 Ga0070665_1000158337 239
182 3300005563 Ga0068855_100000186 Ga0068855_10000018623 239
183 3300005563 Ga0068855_100068209 Ga0068855_1000682092 239
184 3300005577 Ga0068857_100012794 Ga0068857_1000127944 239
185 3300005577 Ga0068857_100024073 Ga0068857_1000240733 239
186 3300005617 Ga0068859_100000704 Ga0068859_10000070427 239
187 3300005719 Ga0068861_100071323 Ga0068861_1000713233 239
188 3300005834 Ga0068851_10022152 Ga0068851_100221523 239
189 3300005843 Ga0068860_100386975 Ga0068860_1003869752 239
190 3300005844 Ga0068862_100001686 Ga0068862_10000168610 239
191 3300006237 Ga0097621_100034797 Ga0097621_1000347975 239
192 3300006931 Ga0097620_100000704 Ga0097620_10000070410 239
193 3300009177 Ga0105248_10010085 Ga0105248_100100855 239
194 3300009545 Ga0105237_10059438 Ga0105237_100594382 239
195 3300009553 Ga0105249_10000397 Ga0105249_1000039737 239
196 3300010375 Ga0105239_10002067 Ga0105239_1000206712 239
197 3300010375 Ga0105239_10021926 Ga0105239_100219268 239
198 3300010375 Ga0105239_10065757 Ga0105239_100657573 239
199 3300010375 Ga0105239_10160733 Ga0105239_101607332 239
200 3300013105 Ga0157369_10218828 Ga0157369_102188282 239
201 3300013307 Ga0157372_10007258 Ga0157372_100072585 239
202 3300013307 Ga0157372_10906394 Ga0157372_109063942 239
203 3300025925 Ga0207650_10606128 Ga0207650_106061282 239
204 3300025941 Ga0207711_10037344 Ga0207711_100373445 239
205 3300025949 Ga0207667_10002386 Ga0207667_1000238611 239
206 3300025949 Ga0207667_10273056 Ga0207667_102730562 239
207 3300025961 Ga0207712_10000843 Ga0207712_100008434 239
208 3300025986 Ga0207658_10000028 Ga0207658_1000002862 239
209 3300025986 Ga0207658_10080038 Ga0207658_100800383 239
210 3300026041 Ga0207639_10000315 Ga0207639_1000031510 239
211 3300026041 Ga0207639_10089944 Ga0207639_100899443 239
212 3300026041 Ga0207639_10245351 Ga0207639_102453512 239
213 3300026067 Ga0207678_10000112 Ga0207678_1000011216 239
214 3300026088 Ga0207641_10229369 Ga0207641_102293693 239
215 3300026089 Ga0207648_10156589 Ga0207648_101565893 239
216 3300026116 Ga0207674_10050096 Ga0207674_100500964 239
217 3300026118 Ga0207675_100141217 Ga0207675_1001412173 239
218 3300028379 Ga0268266_10000001 Ga0268266_100000011718 239
219 3300028379 Ga0268266_10280941 Ga0268266_102809413 239
220 3300028380 Ga0268265_10000131 Ga0268265_1000013118 239
221 3300028381 Ga0268264_10548486 Ga0268264_105484862 239
222 3300038443 Ga0395901_0185453 Ga0395901_0185453_868_1713 239
223 3300041512 Ga0451853_0953777 Ga0451853_0953777_1379_2194 239
224 3300044658 Ga0466972_0005739 Ga0466972_0005739_2479_3294 239
225 3300047472 Ga0495686_0002896 Ga0495686_0002896_11564_12379 239
226 3300048918 Ga0496115_0037030 Ga0496115_0037030_2129_2944 239
227 3300048920 Ga0496117_0011610 Ga0496117_0011610_5731_6546 239
228 3300048921 Ga0496118_0000429 Ga0496118_0000429_10568_11383 239
229 3300048921 Ga0496118_0006655 Ga0496118_0006655_6475_7290 239
230 3300048921 Ga0496118_0060887 Ga0496118_0060887_177_992 239
231 3300048924 Ga0496121_0037826 Ga0496121_0037826_2392_3207 239
232 3300048924 Ga0496121_0115688 Ga0496121_0115688_893_1708 239
233 3300048925 Ga0496122_0000759 Ga0496122_0000759_23374_24189 239
234 3300048926 Ga0496123_0001142 Ga0496123_0001142_15443_16258 239
235 3300049568 Ga0501031_0005632 Ga0501031_0005632_7043_7858 239
236 3300049569 Ga0501032_0001939 Ga0501032_0001939_3837_4652 239
237 3300049570 Ga0501033_0007452 Ga0501033_0007452_2662_3477 239
238 3300049571 Ga0501034_0003067 Ga0501034_0003067_15665_16480 239
239 3300049572 Ga0501036_0015834 Ga0501036_0015834_3462_4277 239
240 3300049573 Ga0501037_0001394 Ga0501037_0001394_9579_10394 239
241 3300049574 Ga0501038_0000141 Ga0501038_0000141_8708_9523 239
242 3300049575 Ga0501039_0010357 Ga0501039_0010357_2177_2992 239
243 3300049578 Ga0501042_0104785 Ga0501042_0104785_285_1100 239
244 3300049579 Ga0501043_0000840 Ga0501043_0000840_21441_22256 239
245 3300049579 Ga0501043_0436075 Ga0501043_0436075_120_935 239
246 3300049580 Ga0501046_0012566 Ga0501046_0012566_3965_4780 239
247 3300049581 Ga0501047_0004063 Ga0501047_0004063_2662_3477 239
248 3300049582 Ga0501048_0075485 Ga0501048_0075485_513_1328 239
249 3300049589 Ga0501073_0012859 Ga0501073_0012859_2443_3258 239
250 3300049589 Ga0501073_0074253 Ga0501073_0074253_1114_1929 239
251 3300049742 Ga0501080_0003092 Ga0501080_0003092_11402_12217 239
252 3300049822 Ga0501035_0001437 Ga0501035_0001437_3965_4780 239
253 3300049823 Ga0501044_0003906 Ga0501044_0003906_11931_12746 239
254 3300049823 Ga0501044_0044762 Ga0501044_0044762_310_1125 239
255 3300053079 Ga0500610_0003839 Ga0500610_0003839_505_1320 239
256 3300053087 Ga0500643_003789 Ga0500643_003789_2954_3769 239
257 3300053093 Ga0500651_0042127 Ga0500651_0042127_2003_2818 239
258 3300053120 Ga0500597_000179 Ga0500597_000179_5225_6040 239
259 iso_pu_bacteria 2524614729 2525555823 239
260 iso_pu_bacteria 2537561836 2538833033 239
261 iso_pu_bacteria 2593339238 2595446722 239
262 iso_pu_bacteria 2593339239 2595451777 239
263 iso_pu_bacteria 2627854209 2630650837 239
264 iso_pu_bacteria 2643221562 2643830895 239
265 iso_pu_bacteria 2643221577 2643894163 239
266 iso_pu_bacteria 2643221685 2644476365 239
267 iso_pu_bacteria 2718218334 2721026632 239
268 iso_pu_bacteria 2734482264 2735833375 239
269 iso_pu_bacteria 2738543009 2739229372 239
270 iso_pu_bacteria 2739367700 2739731932 239
271 iso_pu_bacteria 2842914999 2842917886 239
272 iso_pu_bacteria 2842918807 2842919754 239
273 iso_pu_bacteria 2884338543 2884341368 239
274 iso_pu_bacteria 2884411467 2884413337 239
275 iso_pu_bacteria 2895395659 2895396919 239
276 iso_pu_bacteria 2919085039 2919087608 239
277 iso_pu_bacteria 2928963466 2928964630 239
278 iso_pu_bacteria 2939611941 2939614278 239
279 iso_pu_bacteria 2941471342 2941472826 239
280 3300005578 Ga0068854_100307736 Ga0068854_1003077362 240
281 3300009545 Ga0105237_10101582 Ga0105237_101015823 240
282 3300009551 Ga0105238_10051996 Ga0105238_100519962 240
283 3300009551 Ga0105238_10113358 Ga0105238_101133581 240
284 3300013104 Ga0157370_10002917 Ga0157370_1000291716 240
285 3300025914 Ga0207671_10215670 Ga0207671_102156701 240
286 3300025924 Ga0207694_10057567 Ga0207694_100575672 240
287 3300025981 Ga0207640_10298746 Ga0207640_102987462 240
288 3300031665 Ga0316575_10020315 Ga0316575_100203153 240
289 3300042876 Ga0451577_0204182 Ga0451577_0204182_546_1367 240
290 3300005466 Ga0070685_10007572 Ga0070685_100075726 241
291 3300005616 Ga0068852_100024421 Ga0068852_1000244213 241
292 3300006237 Ga0097621_100499297 Ga0097621_1004992971 241
293 3300009093 Ga0105240_10003480 Ga0105240_100034803 241
294 3300009545 Ga0105237_10054848 Ga0105237_100548482 241
295 3300009551 Ga0105238_10014166 Ga0105238_100141664 241
296 3300010375 Ga0105239_10000020 Ga0105239_1000002088 241
297 3300010375 Ga0105239_10018443 Ga0105239_100184432 241
298 3300013297 Ga0157378_10607040 Ga0157378_106070402 241
299 3300014325 Ga0163163_10000143 Ga0163163_1000014319 241
300 3300014969 Ga0157376_10310487 Ga0157376_103104871 241
301 3300025913 Ga0207695_10001325 Ga0207695_1000132526 241
302 3300025914 Ga0207671_10018608 Ga0207671_100186085 241
303 3300025924 Ga0207694_10006873 Ga0207694_100068735 241
304 3300026142 Ga0207698_10012151 Ga0207698_100121516 241
305 3300031730 Ga0307516_10062132 Ga0307516_100621323 241
306 3300048905 Ga0496102_0083022 Ga0496102_0083022_1529_2359 241
307 3300048908 Ga0496105_0000871 Ga0496105_0000871_16401_17231 241
308 3300048909 Ga0496106_0005789 Ga0496106_0005789_3222_4043 241
309 3300048920 Ga0496117_0004951 Ga0496117_0004951_11287_12117 241
310 3300048921 Ga0496118_0002079 Ga0496118_0002079_11107_11937 241
311 3300048921 Ga0496118_0053587 Ga0496118_0053587_1948_2769 241
312 3300048922 Ga0496119_0000058 Ga0496119_0000058_113602_114432 241
313 3300048923 Ga0496120_0001252 Ga0496120_0001252_2219_3049 241
314 3300049569 Ga0501032_0014972 Ga0501032_0014972_766_1587 241
315 3300049571 Ga0501034_0000605 Ga0501034_0000605_50475_51296 241
316 3300049573 Ga0501037_0362493 Ga0501037_0362493_127_948 241
317 3300049574 Ga0501038_0009677 Ga0501038_0009677_5384_6205 241
318 3300049579 Ga0501043_0138949 Ga0501043_0138949_769_1590 241
319 3300049581 Ga0501047_0002983 Ga0501047_0002983_6395_7216 241
320 3300049583 Ga0501067_0003110 Ga0501067_0003110_3117_3938 241
321 3300049584 Ga0501068_0001426 Ga0501068_0001426_7173_7994 241
322 3300049585 Ga0501069_0003434 Ga0501069_0003434_6802_7623 241
323 3300049586 Ga0501070_0003984 Ga0501070_0003984_11233_12054 241
324 3300049588 Ga0501072_0007222 Ga0501072_0007222_3993_4814 241
325 3300049589 Ga0501073_0000072 Ga0501073_0000072_14282_15103 241
326 3300049590 Ga0501074_0002293 Ga0501074_0002293_6398_7219 241
327 3300049741 Ga0501079_0044763 Ga0501079_0044763_2147_2968 241
328 3300049742 Ga0501080_0000097 Ga0501080_0000097_10011_10832 241
329 3300049744 Ga0501083_0000128 Ga0501083_0000128_7019_7840 241
330 3300049822 Ga0501035_0198430 Ga0501035_0198430_849_1670 241
331 3300049823 Ga0501044_0012166 Ga0501044_0012166_1948_2769 241
332 iso_pu_bacteria 2919404418 2919404858 241
333 3300005329 Ga0070683_100168976 Ga0070683_1001689762 242
334 3300005563 Ga0068855_100003219 Ga0068855_1000032193 242
335 3300005578 Ga0068854_100000486 Ga0068854_10000048621 242
336 3300005614 Ga0068856_100002830 Ga0068856_10000283016 242
337 3300005616 Ga0068852_100371509 Ga0068852_1003715092 242
338 3300013297 Ga0157378_10000130 Ga0157378_100001304 242
339 3300013306 Ga0163162_10000015 Ga0163162_1000001582 242
340 3300025911 Ga0207654_10000423 Ga0207654_1000042320 242
341 3300025913 Ga0207695_10019900 Ga0207695_100199006 242
342 3300025949 Ga0207667_10001074 Ga0207667_100010743 242
343 3300025981 Ga0207640_10000485 Ga0207640_100004853 242
344 3300026078 Ga0207702_10006560 Ga0207702_100065607 242
345 3300031616 Ga0307508_10014069 Ga0307508_100140699 242
346 3300033179 Ga0307507_10015315 Ga0307507_100153154 242
347 3300041453 Ga0451797_0261258 Ga0451797_0261258_32_856 242
348 3300041486 Ga0451807_0171222 Ga0451807_0171222_1643_2467 242
349 3300048905 Ga0496102_0032706 Ga0496102_0032706_2833_3657 242
350 3300048906 Ga0496103_0032821 Ga0496103_0032821_981_1805 242
351 3300049572 Ga0501036_0523104 Ga0501036_0523104_20_853 242
352 3300049579 Ga0501043_0013050 Ga0501043_0013050_5250_6083 242
353 3300049581 Ga0501047_0008730 Ga0501047_0008730_7357_8190 242
354 3300049584 Ga0501068_0129083 Ga0501068_0129083_528_1361 242
355 3300049586 Ga0501070_0080309 Ga0501070_0080309_440_1273 242
356 3300049589 Ga0501073_0014820 Ga0501073_0014820_2083_2916 242
357 3300049590 Ga0501074_0011165 Ga0501074_0011165_3081_3914 242
358 3300049742 Ga0501080_0105298 Ga0501080_0105298_817_1650 242
359 3300049823 Ga0501044_0084014 Ga0501044_0084014_353_1186 242
360 3300053093 Ga0500651_0000245 Ga0500651_0000245_22935_23759 242
361 3300002075 JGI24738J21930_10000954 JGI24738J21930_100009545 243
362 3300002705 JGI25156J39149_1004146 JGI25156J39149_10041465 243
363 3300002705 JGI25156J39149_1010840 JGI25156J39149_10108402 243
364 3300002737 JGI25162J39368_1000311 JGI25162J39368_100031128 243
365 3300002741 JGI25157J39369_1001083 JGI25157J39369_10010835 243
366 3300002771 JGI25163J39215_1000171 JGI25163J39215_100017116 243
367 3300002772 JGI25164J39214_1000035 JGI25164J39214_100003537 243
368 3300003214 JGI25165J46597_1000226 JGI25165J46597_100022625 243
369 3300003316 rootH1_10016990 rootH1_100169903 243
370 3300003320 rootH2_10004402 rootH2_100044024 243
371 3300003578 Ga0006562J51391_1022736 Ga0006562J51391_10227364 243
372 3300003578 Ga0006562J51391_1022737 Ga0006562J51391_10227372 243
373 3300003751 Ga0055538_1002052 Ga0055538_10020521 243
374 3300003752 Ga0055539_1003463 Ga0055539_10034633 243
375 3300003759 Ga0055525_1000452 Ga0055525_100045222 243
376 3300003760 Ga0055527_1000907 Ga0055527_10009078 243
377 3300003761 Ga0055535_1000593 Ga0055535_100059322 243
378 3300003761 Ga0055535_1002180 Ga0055535_10021808 243
379 3300003761 Ga0055535_1002438 Ga0055535_10024383 243
380 3300003762 Ga0055542_1000622 Ga0055542_10006227 243
381 3300003762 Ga0055542_1002065 Ga0055542_10020658 243
382 3300003762 Ga0055542_1002332 Ga0055542_10023327 243
383 3300003763 Ga0055529_1000367 Ga0055529_100036746 243
384 3300003763 Ga0055529_1001133 Ga0055529_10011333 243
385 3300004625 Ga0055543_1020812 Ga0055543_10208122 243
386 3300005262 Ga0065165_1001244 Ga0065165_100124411 243
387 3300005334 Ga0068869_100004548 Ga0068869_1000045487 243
388 3300005335 Ga0070666_10168093 Ga0070666_101680931 243
389 3300005336 Ga0070680_100295793 Ga0070680_1002957932 243
390 3300005336 Ga0070680_100332401 Ga0070680_1003324011 243
391 3300005340 Ga0070689_100010606 Ga0070689_1000106063 243
392 3300005341 Ga0070691_10040331 Ga0070691_100403313 243
393 3300005344 Ga0070661_100042502 Ga0070661_1000425024 243
394 3300005344 Ga0070661_100050468 Ga0070661_1000504682 243
395 3300005345 Ga0070692_10045384 Ga0070692_100453842 243
396 3300005345 Ga0070692_10153602 Ga0070692_101536022 243
397 3300005366 Ga0070659_100118427 Ga0070659_1001184272 243
398 3300005435 Ga0070714_100000650 Ga0070714_10000065010 243
399 3300005455 Ga0070663_100043617 Ga0070663_1000436173 243
400 3300005458 Ga0070681_10000422 Ga0070681_100004224 243
401 3300005466 Ga0070685_10115922 Ga0070685_101159222 243
402 3300005530 Ga0070679_100035082 Ga0070679_1000350823 243
403 3300005530 Ga0070679_100136895 Ga0070679_1001368952 243
404 3300005530 Ga0070679_100269264 Ga0070679_1002692642 243
405 3300005539 Ga0068853_100059765 Ga0068853_1000597652 243
406 3300005539 Ga0068853_100165200 Ga0068853_1001652002 243
407 3300005543 Ga0070672_100000967 Ga0070672_10000096716 243
408 3300005547 Ga0070693_100002525 Ga0070693_1000025259 243
409 3300005563 Ga0068855_100035273 Ga0068855_1000352737 243
410 3300005563 Ga0068855_100055852 Ga0068855_1000558525 243
411 3300005563 Ga0068855_100434603 Ga0068855_1004346032 243
412 3300005577 Ga0068857_100002448 Ga0068857_1000024488 243
413 3300005578 Ga0068854_100010548 Ga0068854_1000105485 243
414 3300005578 Ga0068854_100040225 Ga0068854_1000402252 243
415 3300005614 Ga0068856_100137208 Ga0068856_1001372082 243
416 3300005614 Ga0068856_100259666 Ga0068856_1002596662 243
417 3300005616 Ga0068852_100095568 Ga0068852_1000955683 243
418 3300005616 Ga0068852_100109245 Ga0068852_1001092452 243
419 3300005616 Ga0068852_100309565 Ga0068852_1003095652 243
420 3300005834 Ga0068851_10001144 Ga0068851_100011443 243
421 3300005842 Ga0068858_100399759 Ga0068858_1003997592 243
422 3300005843 Ga0068860_100250787 Ga0068860_1002507873 243
423 3300006186 Ga0075369_10034813 Ga0075369_100348133 243
424 3300006186 Ga0075369_10043586 Ga0075369_100435862 243
425 3300006881 Ga0068865_100001033 Ga0068865_1000010339 243
426 3300009093 Ga0105240_10005037 Ga0105240_100050374 243
427 3300009093 Ga0105240_10014526 Ga0105240_100145268 243
428 3300009093 Ga0105240_10280220 Ga0105240_102802202 243
429 3300009101 Ga0105247_10018982 Ga0105247_100189822 243
430 3300009174 Ga0105241_10041060 Ga0105241_100410604 243
431 3300009174 Ga0105241_10178303 Ga0105241_101783033 243
432 3300009174 Ga0105241_10560220 Ga0105241_105602201 243
433 3300009176 Ga0105242_10002687 Ga0105242_100026876 243
434 3300009177 Ga0105248_10125934 Ga0105248_101259344 243
435 3300009545 Ga0105237_10055379 Ga0105237_100553794 243
436 3300010375 Ga0105239_10092121 Ga0105239_100921213 243
437 3300010375 Ga0105239_10207563 Ga0105239_102075632 243
438 3300013100 Ga0157373_10083316 Ga0157373_100833162 243
439 3300013102 Ga0157371_10009024 Ga0157371_1000902410 243
440 3300013102 Ga0157371_10108571 Ga0157371_101085712 243
441 3300013104 Ga0157370_10191511 Ga0157370_101915112 243
442 3300013105 Ga0157369_10000025 Ga0157369_10000025179 243
443 3300013105 Ga0157369_10010299 Ga0157369_100102997 243
444 3300013105 Ga0157369_10015839 Ga0157369_1001583911 243
445 3300013105 Ga0157369_10322123 Ga0157369_103221232 243
446 3300013296 Ga0157374_10099188 Ga0157374_100991882 243
447 3300013306 Ga0163162_10006951 Ga0163162_100069518 243
448 3300013306 Ga0163162_10164229 Ga0163162_101642293 243
449 3300013307 Ga0157372_10004575 Ga0157372_100045757 243
450 3300013307 Ga0157372_10062380 Ga0157372_100623804 243
451 3300013307 Ga0157372_10076003 Ga0157372_100760035 243
452 3300013308 Ga0157375_10001402 Ga0157375_1000140219 243
453 3300013308 Ga0157375_10004646 Ga0157375_100046465 243
454 3300014497 Ga0182008_10000899 Ga0182008_1000089915 243
455 3300014497 Ga0182008_10018678 Ga0182008_100186783 243
456 3300014969 Ga0157376_10036909 Ga0157376_100369093 243
457 3300014969 Ga0157376_10195451 Ga0157376_101954512 243
458 3300015261 Ga0182006_1000072 Ga0182006_100007242 243
459 3300015261 Ga0182006_1001852 Ga0182006_100185210 243
460 3300015261 Ga0182006_1091044 Ga0182006_10910442 243
461 3300015262 Ga0182007_10012397 Ga0182007_100123973 243
462 3300015265 Ga0182005_1000080 Ga0182005_100008028 243
463 3300015265 Ga0182005_1000551 Ga0182005_100055114 243
464 3300015265 Ga0182005_1004616 Ga0182005_10046163 243
465 3300015265 Ga0182005_1020416 Ga0182005_10204162 243
466 3300015687 Ga0183368_1003 Ga0183368_1003877 243
467 3300017792 Ga0163161_10005653 Ga0163161_1000565310 243
468 3300020081 Ga0206354_10548849 Ga0206354_105488492 243
469 3300020082 Ga0206353_11983330 Ga0206353_119833302 243
470 3300025206 Ga0209435_104917 Ga0209435_1049172 243
471 3300025207 Ga0209760_100210 Ga0209760_10021012 243
472 3300025224 Ga0209784_100068 Ga0209784_100068116 243
473 3300025225 Ga0209566_102599 Ga0209566_1025992 243
474 3300025226 Ga0209674_100012 Ga0209674_100012630 243
475 3300025226 Ga0209674_100514 Ga0209674_1005149 243
476 3300025228 Ga0209672_100007 Ga0209672_10000763 243
477 3300025228 Ga0209672_100058 Ga0209672_100058195 243
478 3300025228 Ga0209672_100357 Ga0209672_10035718 243
479 3300025228 Ga0209672_100963 Ga0209672_1009639 243
480 3300025230 Ga0209563_100051 Ga0209563_100051296 243
481 3300025231 Ga0207427_100033 Ga0207427_100033117 243
482 3300025231 Ga0207427_100156 Ga0207427_10015655 243
483 3300025233 Ga0209437_100105 Ga0209437_10010516 243
484 3300025233 Ga0209437_100126 Ga0209437_10012642 243
485 3300025233 Ga0209437_100147 Ga0209437_10014755 243
486 3300025233 Ga0209437_102097 Ga0209437_1020973 243
487 3300025233 Ga0209437_110221 Ga0209437_1102212 243
488 3300025242 Ga0209258_100046 Ga0209258_100046274 243
489 3300025242 Ga0209258_100049 Ga0209258_10004953 243
490 3300025242 Ga0209258_100095 Ga0209258_10009559 243
491 3300025242 Ga0209258_100245 Ga0209258_10024540 243
492 3300025242 Ga0209258_107072 Ga0209258_1070722 243
493 3300025246 Ga0209646_1000517 Ga0209646_100051711 243
494 3300025246 Ga0209646_1001172 Ga0209646_10011723 243
495 3300025250 Ga0209026_1000099 Ga0209026_1000099116 243
496 3300025250 Ga0209026_1000726 Ga0209026_100072611 243
497 3300025250 Ga0209026_1002617 Ga0209026_10026176 243
498 3300025254 Ga0209148_1000002 Ga0209148_10000021474 243
499 3300025254 Ga0209148_1000010 Ga0209148_1000010967 243
500 3300025254 Ga0209148_1000039 Ga0209148_1000039271 243
501 3300025254 Ga0209148_1000087 Ga0209148_100008780 243
502 3300025254 Ga0209148_1000098 Ga0209148_1000098145 243
503 3300025254 Ga0209148_1002333 Ga0209148_10023332 243
504 3300025256 Ga0209759_1000316 Ga0209759_100031642 243
505 3300025256 Ga0209759_1000338 Ga0209759_100033819 243
506 3300025258 Ga0209129_1001605 Ga0209129_100160513 243
507 3300025258 Ga0209129_1002940 Ga0209129_10029403 243
508 3300025261 Ga0209233_1000009 Ga0209233_1000009203 243
509 3300025261 Ga0209233_1000080 Ga0209233_1000080117 243
510 3300025261 Ga0209233_1025825 Ga0209233_10258252 243
511 3300025272 Ga0209455_1000010 Ga0209455_100001063 243
512 3300025272 Ga0209455_1000034 Ga0209455_1000034272 243
513 3300025272 Ga0209455_1000086 Ga0209455_1000086204 243
514 3300025272 Ga0209455_1015163 Ga0209455_10151632 243
515 3300025297 Ga0209758_1004110 Ga0209758_10041108 243
516 3300025297 Ga0209758_1018206 Ga0209758_10182064 243
517 3300025297 Ga0209758_1023053 Ga0209758_10230533 243
518 3300025321 Ga0207656_10000907 Ga0207656_100009078 243
519 3300025903 Ga0207680_10072556 Ga0207680_100725562 243
520 3300025904 Ga0207647_10000029 Ga0207647_1000002927 243
521 3300025904 Ga0207647_10001225 Ga0207647_100012256 243
522 3300025904 Ga0207647_10037439 Ga0207647_100374394 243
523 3300025906 Ga0207699_10152455 Ga0207699_101524552 243
524 3300025909 Ga0207705_10002035 Ga0207705_100020359 243
525 3300025909 Ga0207705_10006840 Ga0207705_100068401 243
526 3300025912 Ga0207707_10000380 Ga0207707_1000038019 243
527 3300025913 Ga0207695_10001580 Ga0207695_100015807 243
528 3300025913 Ga0207695_10005282 Ga0207695_1000528210 243
529 3300025913 Ga0207695_10005709 Ga0207695_1000570915 243
530 3300025913 Ga0207695_10007938 Ga0207695_1000793810 243
531 3300025913 Ga0207695_10036678 Ga0207695_100366783 243
532 3300025913 Ga0207695_10104456 Ga0207695_101044563 243
533 3300025914 Ga0207671_10000031 Ga0207671_10000031164 243
534 3300025914 Ga0207671_10001506 Ga0207671_1000150612 243
535 3300025914 Ga0207671_10385931 Ga0207671_103859312 243
536 3300025915 Ga0207693_10282053 Ga0207693_102820532 243
537 3300025917 Ga0207660_10111100 Ga0207660_101111002 243
538 3300025919 Ga0207657_10008885 Ga0207657_100088853 243
539 3300025920 Ga0207649_10006996 Ga0207649_100069962 243
540 3300025920 Ga0207649_10047431 Ga0207649_100474313 243
541 3300025920 Ga0207649_10050424 Ga0207649_100504241 243
542 3300025920 Ga0207649_10059528 Ga0207649_100595283 243
543 3300025924 Ga0207694_10002048 Ga0207694_1000204810 243
544 3300025929 Ga0207664_10000239 Ga0207664_1000023921 243
545 3300025932 Ga0207690_10000992 Ga0207690_1000099210 243
546 3300025932 Ga0207690_10064484 Ga0207690_100644843 243
547 3300025933 Ga0207706_10052307 Ga0207706_100523072 243
548 3300025934 Ga0207686_10003899 Ga0207686_100038994 243
549 3300025936 Ga0207670_10003200 Ga0207670_100032003 243
550 3300025937 Ga0207669_10505496 Ga0207669_105054962 243
551 3300025938 Ga0207704_10000937 Ga0207704_100009377 243
552 3300025940 Ga0207691_10002689 Ga0207691_1000268915 243
553 3300025942 Ga0207689_10016448 Ga0207689_100164484 243
554 3300025949 Ga0207667_10001044 Ga0207667_1000104431 243
555 3300025949 Ga0207667_10005225 Ga0207667_1000522513 243
556 3300025949 Ga0207667_10007692 Ga0207667_100076926 243
557 3300025981 Ga0207640_10002635 Ga0207640_100026359 243
558 3300025981 Ga0207640_10019244 Ga0207640_100192443 243
559 3300026041 Ga0207639_10003518 Ga0207639_100035182 243
560 3300026041 Ga0207639_10170293 Ga0207639_101702932 243
561 3300026067 Ga0207678_10004531 Ga0207678_100045316 243
562 3300026067 Ga0207678_10024343 Ga0207678_100243435 243
563 3300026067 Ga0207678_10055903 Ga0207678_100559034 243
564 3300026067 Ga0207678_10141476 Ga0207678_101414762 243
565 3300026116 Ga0207674_10000685 Ga0207674_1000068526 243
566 3300026142 Ga0207698_10015607 Ga0207698_100156076 243
567 3300026142 Ga0207698_10071842 Ga0207698_100718423 243
568 3300028381 Ga0268264_10484936 Ga0268264_104849362 243
569 3300031911 Ga0307412_10000917 Ga0307412_1000091715 243
570 3300036401 Ga0373937_0306011 Ga0373937_0306011_295_1122 243
571 3300037312 Ga0395899_0007904 Ga0395899_0007904_6091_6921 243
572 3300037312 Ga0395899_0030704 Ga0395899_0030704_2754_3584 243
573 3300037312 Ga0395899_0090203 Ga0395899_0090203_113_943 243
574 3300037418 Ga0395900_0000059 Ga0395900_0000059_76180_77010 243
575 3300037418 Ga0395900_0004207 Ga0395900_0004207_12368_13198 243
576 3300037418 Ga0395900_0004359 Ga0395900_0004359_754_1584 243
577 3300037418 Ga0395900_0030705 Ga0395900_0030705_2128_2958 243
578 3300037466 Ga0395898_0001311 Ga0395898_0001311_1528_2358 243
579 3300037466 Ga0395898_0006426 Ga0395898_0006426_9563_10393 243
580 3300037466 Ga0395898_0008278 Ga0395898_0008278_9121_9951 243
581 3300037466 Ga0395898_0074040 Ga0395898_0074040_453_1283 243
582 3300037466 Ga0395898_0367324 Ga0395898_0367324_354_1184 243
583 3300038443 Ga0395901_0006163 Ga0395901_0006163_2126_2956 243
584 3300038443 Ga0395901_0009331 Ga0395901_0009331_1340_2170 243
585 3300041404 Ga0439436_0000067 Ga0439436_0000067_7474_8301 243
586 3300041413 Ga0439465_0001040 Ga0439465_0001040_4687_5514 243
587 3300041452 Ga0451793_0739495 Ga0451793_0739495_1455_2285 243
588 3300041491 Ga0451833_0446148 Ga0451833_0446148_412_1239 243
589 3300042000 Ga0439437_001633 Ga0439437_001633_672_1502 243
590 3300042184 Ga0450908_001144 Ga0450908_001144_1167_1994 243
591 3300042438 Ga0439459_0000055 Ga0439459_0000055_474_1304 243
592 3300044656 Ga0466969_0011574 Ga0466969_0011574_2800_3630 243
593 3300044658 Ga0466972_0047788 Ga0466972_0047788_21_851 243
594 3300044663 Ga0466989_0018571 Ga0466989_0018571_2027_2857 243
595 3300044672 Ga0466982_0000013 Ga0466982_0000013_113429_114259 243
596 3300044683 Ga0466965_0117981 Ga0466965_0117981_432_1262 243
597 3300044684 Ga0466966_0004686 Ga0466966_0004686_1444_2274 243
598 3300044684 Ga0466966_0020702 Ga0466966_0020702_2962_3792 243
599 3300044693 Ga0466961_0000967 Ga0466961_0000967_14769_15599 243
600 3300044693 Ga0466961_0028265 Ga0466961_0028265_1752_2582 243
601 3300044694 Ga0466963_0174554 Ga0466963_0174554_643_1473 243
602 3300044719 Ga0466971_0022747 Ga0466971_0022747_905_1735 243
603 3300044735 Ga0466968_0002450 Ga0466968_0002450_3428_4255 243
604 3300044735 Ga0466968_0013890 Ga0466968_0013890_2323_3153 243
605 3300044765 Ga0466970_0010342 Ga0466970_0010342_2501_3331 243
606 3300044842 Ga0466957_0128323 Ga0466957_0128323_309_1139 243
607 3300044901 Ga0466960_0005543 Ga0466960_0005543_2304_3134 243
608 3300045049 Ga0466959_0020265 Ga0466959_0020265_622_1452 243
609 3300045836 Ga0466958_0049101 Ga0466958_0049101_1479_2309 243
610 3300046452 Ga0495617_000117 Ga0495617_000117_21198_22025 243
611 3300046460 Ga0495638_0000007 Ga0495638_0000007_146370_147200 243
612 3300046460 Ga0495638_0000899 Ga0495638_0000899_15575_16402 243
613 3300046460 Ga0495638_0001952 Ga0495638_0001952_14601_15431 243
614 3300046460 Ga0495638_0018140 Ga0495638_0018140_1973_2800 243
615 3300046471 Ga0495650_0003111 Ga0495650_0003111_4349_5176 243
616 3300046473 Ga0495582_0055392 Ga0495582_0055392_1074_1901 243
617 3300046491 Ga0495584_0003980 Ga0495584_0003980_3117_3944 243
618 3300046492 Ga0495585_0008658 Ga0495585_0008658_1056_1883 243
619 3300046492 Ga0495585_0013229 Ga0495585_0013229_2951_3778 243
620 3300046501 Ga0495607_0000088 Ga0495607_0000088_90739_91566 243
621 3300046501 Ga0495607_0000122 Ga0495607_0000122_71856_72683 243
622 3300046507 Ga0495606_0000298 Ga0495606_0000298_64028_64855 243
623 3300046507 Ga0495606_0001210 Ga0495606_0001210_7474_8301 243
624 3300046507 Ga0495606_0004779 Ga0495606_0004779_7325_8152 243
625 3300046507 Ga0495606_0089144 Ga0495606_0089144_653_1480 243
626 3300046512 Ga0495610_0004565 Ga0495610_0004565_2070_2897 243
627 3300046512 Ga0495610_0015527 Ga0495610_0015527_1907_2734 243
628 3300046513 Ga0495616_0000565 Ga0495616_0000565_3012_3839 243
629 3300046515 Ga0495620_0005019 Ga0495620_0005019_4540_5367 243
630 3300046518 Ga0495631_0001445 Ga0495631_0001445_4249_5076 243
631 3300046518 Ga0495631_0003807 Ga0495631_0003807_3158_3985 243
632 3300046519 Ga0495632_0038310 Ga0495632_0038310_604_1431 243
633 3300046519 Ga0495632_0113406 Ga0495632_0113406_310_1137 243
634 3300046524 Ga0495648_0005079 Ga0495648_0005079_8095_8922 243
635 3300046524 Ga0495648_0009504 Ga0495648_0009504_2120_2947 243
636 3300046531 Ga0495665_0085971 Ga0495665_0085971_289_1116 243
637 3300046538 Ga0495609_0003579 Ga0495609_0003579_5748_6575 243
638 3300046542 Ga0495597_0104277 Ga0495597_0104277_155_985 243
639 3300046557 Ga0495622_0012969 Ga0495622_0012969_1247_2077 243
640 3300046616 Ga0495668_0012112 Ga0495668_0012112_3402_4229 243
641 3300046648 Ga0495611_0000001 Ga0495611_0000001_2056521_2057348 243
642 3300046648 Ga0495611_0000060 Ga0495611_0000060_68131_68958 243
643 3300046660 Ga0495625_0000022 Ga0495625_0000022_199451_200278 243
644 3300046660 Ga0495625_0016189 Ga0495625_0016189_3154_3984 243
645 3300046660 Ga0495625_0097090 Ga0495625_0097090_1058_1885 243
646 3300046665 Ga0495661_0003615 Ga0495661_0003615_7039_7866 243
647 3300046691 Ga0495670_0007331 Ga0495670_0007331_3588_4415 243
648 3300046692 Ga0495671_0004741 Ga0495671_0004741_5558_6385 243
649 3300046694 Ga0495649_0013114 Ga0495649_0013114_1983_2813 243
650 3300046794 Ga0495589_0000137 Ga0495589_0000137_10172_10999 243
651 3300046810 Ga0495660_0000728 Ga0495660_0000728_2173_3000 243
652 3300046810 Ga0495660_0003021 Ga0495660_0003021_7456_8283 243
653 3300047320 Ga0495672_0081196 Ga0495672_0081196_782_1627 243
654 3300047323 Ga0495683_0006531 Ga0495683_0006531_3247_4074 243
655 3300047446 Ga0495679_000004 Ga0495679_000004_167271_168098 243
656 3300047469 Ga0495673_0000202 Ga0495673_0000202_2174_3001 243
657 3300047469 Ga0495673_0000749 Ga0495673_0000749_9080_9907 243
658 3300047470 Ga0495681_0070594 Ga0495681_0070594_151_978 243
659 3300047472 Ga0495686_0000017 Ga0495686_0000017_81937_82764 243
660 3300047472 Ga0495686_0001035 Ga0495686_0001035_7517_8344 243
661 3300047472 Ga0495686_0024798 Ga0495686_0024798_1957_2784 243
662 3300048091 Ga0495626_0153914 Ga0495626_0153914_108_935 243
663 3300048903 Ga0496100_0001258 Ga0496100_0001258_2576_3403 243
664 3300048904 Ga0496101_0000491 Ga0496101_0000491_2999_3826 243
665 3300048907 Ga0496104_0000016 Ga0496104_0000016_79576_80403 243
666 3300048907 Ga0496104_0669353 Ga0496104_0669353_11_841 243
667 3300048908 Ga0496105_0000010 Ga0496105_0000010_131226_132053 243
668 3300048918 Ga0496115_0000025 Ga0496115_0000025_123305_124135 243
669 3300048918 Ga0496115_0013784 Ga0496115_0013784_2127_2957 243
670 3300048918 Ga0496115_0029462 Ga0496115_0029462_1377_2207 243
671 3300048918 Ga0496115_0251320 Ga0496115_0251320_607_1437 243
672 3300048919 Ga0496116_0079482 Ga0496116_0079482_1126_1953 243
673 3300048921 Ga0496118_0002476 Ga0496118_0002476_21325_22152 243
674 3300048921 Ga0496118_0015454 Ga0496118_0015454_5151_5978 243
675 3300048921 Ga0496118_0034247 Ga0496118_0034247_1917_2747 243
676 3300048921 Ga0496118_0242450 Ga0496118_0242450_13_843 243
677 3300048922 Ga0496119_0039545 Ga0496119_0039545_1403_2230 243
678 3300048924 Ga0496121_0000045 Ga0496121_0000045_240147_240974 243
679 3300048924 Ga0496121_0000401 Ga0496121_0000401_22752_23582 243
680 3300048924 Ga0496121_0002752 Ga0496121_0002752_21021_21848 243
681 3300048924 Ga0496121_0034962 Ga0496121_0034962_2627_3454 243
682 3300048924 Ga0496121_0117684 Ga0496121_0117684_361_1191 243
683 3300048924 Ga0496121_0179141 Ga0496121_0179141_550_1380 243
684 3300048925 Ga0496122_0017227 Ga0496122_0017227_1146_1973 243
685 3300048925 Ga0496122_0067213 Ga0496122_0067213_813_1640 243
686 3300048926 Ga0496123_0003690 Ga0496123_0003690_8249_9076 243
687 3300048926 Ga0496123_0016381 Ga0496123_0016381_2031_2858 243
688 3300048926 Ga0496123_0030669 Ga0496123_0030669_2031_2858 243
689 3300048927 Ga0496124_0028363 Ga0496124_0028363_2214_3041 243
690 3300048927 Ga0496124_0057811 Ga0496124_0057811_2142_2969 243
691 3300048928 Ga0496125_0018170 Ga0496125_0018170_2627_3454 243
692 3300048929 Ga0496126_0001102 Ga0496126_0001102_25964_26794 243
693 3300048929 Ga0496126_0047577 Ga0496126_0047577_2923_3750 243
694 3300048929 Ga0496126_0069008 Ga0496126_0069008_2077_2907 243
695 3300048929 Ga0496126_0349516 Ga0496126_0349516_250_1080 243
696 3300049459 Ga0495678_000099 Ga0495678_000099_96629_97456 243
697 3300049459 Ga0495678_041137 Ga0495678_041137_82_912 243
698 3300049460 Ga0495682_0032976 Ga0495682_0032976_1020_1847 243
699 3300049570 Ga0501033_0005614 Ga0501033_0005614_5796_6626 243
700 3300049570 Ga0501033_0025649 Ga0501033_0025649_1443_2273 243
701 3300049571 Ga0501034_0021485 Ga0501034_0021485_200_1030 243
702 3300049572 Ga0501036_0056431 Ga0501036_0056431_2240_3070 243
703 3300049573 Ga0501037_0039752 Ga0501037_0039752_1692_2522 243
704 3300049574 Ga0501038_0103298 Ga0501038_0103298_684_1514 243
705 3300049579 Ga0501043_0005095 Ga0501043_0005095_6290_7120 243
706 3300049580 Ga0501046_0141965 Ga0501046_0141965_448_1278 243
707 3300049581 Ga0501047_0011872 Ga0501047_0011872_4151_4981 243
708 3300049581 Ga0501047_0025393 Ga0501047_0025393_3883_4713 243
709 3300049581 Ga0501047_0251583 Ga0501047_0251583_156_986 243
710 3300049581 Ga0501047_0292364 Ga0501047_0292364_298_1128 243
711 3300049581 Ga0501047_0300140 Ga0501047_0300140_31_861 243
712 3300049581 Ga0501047_0364304 Ga0501047_0364304_121_951 243
713 3300049585 Ga0501069_0035758 Ga0501069_0035758_1607_2437 243
714 3300049586 Ga0501070_0013239 Ga0501070_0013239_5308_6138 243
715 3300049587 Ga0501071_0026570 Ga0501071_0026570_1233_2063 243
716 3300049588 Ga0501072_0087685 Ga0501072_0087685_1045_1875 243
717 3300049589 Ga0501073_0022162 Ga0501073_0022162_3245_4075 243
718 3300049590 Ga0501074_0017385 Ga0501074_0017385_2713_3543 243
719 3300049741 Ga0501079_0039248 Ga0501079_0039248_876_1706 243
720 3300049741 Ga0501079_0254786 Ga0501079_0254786_390_1220 243
721 3300049822 Ga0501035_0003810 Ga0501035_0003810_7206_8036 243
722 3300049822 Ga0501035_0021748 Ga0501035_0021748_3219_4049 243
723 3300049822 Ga0501035_0043309 Ga0501035_0043309_2883_3713 243
724 3300049822 Ga0501035_0074266 Ga0501035_0074266_923_1753 243
725 3300049822 Ga0501035_0174472 Ga0501035_0174472_359_1189 243
726 3300049823 Ga0501044_0003555 Ga0501044_0003555_6675_7505 243
727 3300049823 Ga0501044_0013452 Ga0501044_0013452_2906_3736 243
728 3300049823 Ga0501044_0015582 Ga0501044_0015582_3926_4756 243
729 3300049823 Ga0501044_0038033 Ga0501044_0038033_2958_3788 243
730 3300049823 Ga0501044_0203046 Ga0501044_0203046_511_1341 243
731 3300049823 Ga0501044_0319870 Ga0501044_0319870_498_1328 243
732 3300053087 Ga0500643_000118 Ga0500643_000118_78651_79478 243
733 3300053103 Ga0500555_001900 Ga0500555_001900_4498_5325 243
734 3300053160 Ga0500633_0003671 Ga0500633_0003671_203_1030 243
735 3300053730 Ga0500645_001641 Ga0500645_001641_2649_3476 243
736 3300061719 Ga0466962_0003530 Ga0466962_0003530_2546_3376 243
737 3300010375 Ga0105239_10074051 Ga0105239_100740514 245
738 3300050516 nmdc:mga0sz30_64337_c1 nmdc:mga0sz30_64337_c1_484_1317 245
739 3300005327 Ga0070658_10001605 Ga0070658_100016053 247
740 3300005335 Ga0070666_10000012 Ga0070666_10000012172 247
741 3300025903 Ga0207680_10000013 Ga0207680_10000013173 247
742 3300025909 Ga0207705_10005361 Ga0207705_1000536110 247
743 3300025924 Ga0207694_10002295 Ga0207694_100022952 247
744 3300028379 Ga0268266_10000021 Ga0268266_10000021175 247
745 3300033180 Ga0307510_10000977 Ga0307510_1000097712 247
746 3300033180 Ga0307510_10159835 Ga0307510_101598352 247
747 3300005262 Ga0065165_1000028 Ga0065165_1000028107 248
748 3300038443 Ga0395901_0329463 Ga0395901_0329463_192_1037 248
749 3300046519 Ga0495632_0000004 Ga0495632_0000004_266093_266944 248
750 3300013104 Ga0157370_10186698 Ga0157370_101866981 249
751 3300041486 Ga0451807_0309039 Ga0451807_0309039_83_928 249
752 3300041512 Ga0451853_1433675 Ga0451853_1433675_239_1084 249
753 3300046535 Ga0495586_0117970 Ga0495586_0117970_217_1071 249
754 3300015685 Ga0183369_1006 Ga0183369_1006173 257
755 3300046471 Ga0495650_0000497 Ga0495650_0000497_52209_53078 257
756 3300046507 Ga0495606_0078069 Ga0495606_0078069_11_880 257
757 3300048923 Ga0496120_0001892 Ga0496120_0001892_20231_21103 257
758 3300048924 Ga0496121_0046023 Ga0496121_0046023_455_1327 257
759 3300049580 Ga0501046_0115571 Ga0501046_0115571_504_1391 257
760 3300044683 Ga0466965_0002807 Ga0466965_0002807_1210_2097 258
761 3300044693 Ga0466961_0013541 Ga0466961_0013541_2638_3525 258
762 3300044719 Ga0466971_0027748 Ga0466971_0027748_249_1136 258
763 3300044842 Ga0466957_0047688 Ga0466957_0047688_350_1237 258
764 3300045049 Ga0466959_0062198 Ga0466959_0062198_703_1590 258
765 3300061719 Ga0466962_0007751 Ga0466962_0007751_3047_3934 258
766 3300009551 Ga0105238_10000540 Ga0105238_1000054033 260
767 3300013306 Ga0163162_10006135 Ga0163162_100061353 260
768 3300046660 Ga0495625_0022701 Ga0495625_0022701_3226_4110 260
769 3300048924 Ga0496121_0009537 Ga0496121_0009537_7654_8580 260
770 3300048929 Ga0496126_0121900 Ga0496126_0121900_207_1091 260
771 3300001979 JGI24740J21852_10005728 JGI24740J21852_100057285 261
772 3300001989 JGI24739J22299_10001151 JGI24739J22299_100011513 261
773 3300001989 JGI24739J22299_10012267 JGI24739J22299_100122674 261
774 3300001990 JGI24737J22298_10015018 JGI24737J22298_100150184 261
775 3300003578 Ga0006562J51391_1106400 Ga0006562J51391_11064003 261
776 3300003578 Ga0006562J51391_1106401 Ga0006562J51391_11064012 261
777 3300009093 Ga0105240_10018376 Ga0105240_100183768 261
778 3300009545 Ga0105237_10000152 Ga0105237_1000015216 261
779 3300012500 Ga0157314_1000632 Ga0157314_10006324 261
780 3300013105 Ga0157369_10035517 Ga0157369_100355172 261
781 3300037312 Ga0395899_0021621 Ga0395899_0021621_1684_2574 261
782 3300048924 Ga0496121_0028054 Ga0496121_0028054_1878_2762 261
783 3300048928 Ga0496125_0000137 Ga0496125_0000137_121511_122395 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

33

291

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vav-assembly1.cif.gz_J crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9526 29 260
1o68-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.9502 30 260
1m3u-assembly1.cif.gz_I crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate 0.9463 31 261
3vav-assembly1.cif.gz_A crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9423 29 260
3vav-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.9409 29 260
ID Description Score Start End Superfamily
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9409 29 260 3.20.20.60
af_A0A1D6NS82_272_361_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8612 120 175 3.20.20.70
3vavB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8389 29 260 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8238 30 258 3.20.20.60
af_A0A0R0J726_27_197_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8209 30 161 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7C5N9A7-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9675 120 260 GO:0000287
GO:0003864
GO:0005737
GO:0015940
AF-A0A831RG02-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9673 135 261 GO:0000287
GO:0003864
GO:0005737
GO:0015940
AF-A0A1A9UKG6-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9635 120 261 GO:0003864
GO:0008168
GO:0015940
AF-A0A3B9L557-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9619 120 260 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A2E8GWJ6-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9613 32 260 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259

Feature Viewer

pLDDT pTM Quality
83.38 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map