F480663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 403 | 1566 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10123741|Ga0207428_101237412 |
| Length | 460 |
| Sequence | MHSSPAMAGSEHNNNSSEVMNMPIAKAVLDPVLDPLETASIDELRQHQLDRLRWSLNHAYNNVPLYRQRFDALGVHPDDIKSLEDLAKFPFTTKTDLRDNYPYGMFAVPMNEVVRLHASSGTTGKPTVVGYTQNDIDTWANVVARSIRAAGGRRGDKVHISYGYGLFTGGLGAHYGAERLGCTVIPMSGGQTEKQVQLIKDFQPDIIMVTPSYMLNIADEIERQGIDPHKLALRLGIFGAEPWTAELRSAIEARLGITALDIYGLSEIMGPGVAMECAETKDGPTIWEDHFYPEIIDPVTGEVLPDGQMGELVFTSLSKEALPMIRYRTRDLTRLLPGTARPMRRIDKITGRSDDMLIIRGVNVFPTQIEEQVLKVKQLAECYEIHLYRNGNLDSVDVHVELKAEQQHLSDEQQKAVCGELSKHIKTYIGISSRIVLQPFHSIKRSEGKACHVVDKRPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 35 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 63 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 123 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 128 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 129 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 134 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 135 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 136 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 137 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 138 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 139 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 285 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 289 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 290 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 291 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 292 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 293 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 294 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 295 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 296 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 297 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 298 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 299 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 300 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 301 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 302 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 303 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 304 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 305 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 306 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 307 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 308 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 309 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 310 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 311 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 312 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 313 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 314 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 315 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 316 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 317 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 318 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 319 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 320 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 321 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 322 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 323 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 324 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 325 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 326 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 327 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 328 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 329 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 330 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 331 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 332 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 333 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 334 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 335 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 336 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 337 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 338 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 339 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 340 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 341 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 342 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 343 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 344 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 345 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 346 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 347 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 348 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 349 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 350 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 351 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 352 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 353 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 354 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 355 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 356 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 357 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 358 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 359 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 360 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 361 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 362 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 363 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 364 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 365 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 366 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 367 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 368 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 369 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 370 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 371 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 372 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 373 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 374 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 375 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 376 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 377 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 378 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 379 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 380 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 381 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 382 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 383 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 384 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 385 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 386 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 387 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 388 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 389 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 390 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 391 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 392 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 393 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 394 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 395 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 396 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 397 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 398 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 399 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 400 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 401 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 402 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 403 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.93 |
| Metatranscriptomes | 0.13 |
| Isolates | 14.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 2.43 |
| Rhizoplane | 7.02 |
| Rhizosphere | 73.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207428_10123741 | 3300027907 | Bacteria | 1982 |
| 2 | MRS2a_Contig_7291 | 2124908027 | Bacteria | 8406 |
| 3 | MRS2a_Contig_9136 | 2124908027 | Bacteria | 7420 |
| 4 | SwRhRL2b_contig_2780838 | 2162886007 | Bacteria | 1935 |
| 5 | JGI24739J22299_10028397 | 3300001989 | Bacteria | 1951 |
| 6 | JGI24735J21928_10000368 | 3300002067 | Bacteria | 15723 |
| 7 | JGI24735J21928_10001145 | 3300002067 | Bacteria | 9474 |
| 8 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 9 | Ga0055542_1009065 | 3300003762 | Bacteria | 1899 |
| 10 | Ga0055526_1008543 | 3300003771 | Bacteria | 5084 |
| 11 | Ga0055526_1012329 | 3300003771 | Bacteria | 3745 |
| 12 | Ga0055524_1000402 | 3300003775 | Bacteria | 36997 |
| 13 | Ga0055536_1000014 | 3300003781 | Bacteria | 240624 |
| 14 | Ga0055536_1000158 | 3300003781 | Bacteria | 58733 |
| 15 | Ga0055534_1005186 | 3300003784 | Bacteria | 3564 |
| 16 | Ga0055530_10000009 | 3300003791 | Bacteria | 174044 |
| 17 | Ga0055540_1000342 | 3300003792 | Bacteria | 39754 |
| 18 | Ga0058692_1000010 | 3300003856 | Bacteria | 326761 |
| 19 | JGI25405J52794_10006845 | 3300003911 | Bacteria | 2088 |
| 20 | Ga0065703_1000063 | 3300005272 | Bacteria | 30242 |
| 21 | Ga0065714_10008515 | 3300005288 | Bacteria | 4200 |
| 22 | Ga0065704_10002892 | 3300005289 | Bacteria | 5137 |
| 23 | Ga0065704_10074925 | 3300005289 | Bacteria | 5908 |
| 24 | Ga0065704_10107275 | 3300005289 | Bacteria | 2060 |
| 25 | Ga0070658_10006576 | 3300005327 | Bacteria | 9423 |
| 26 | Ga0070658_10013426 | 3300005327 | Bacteria | 6572 |
| 27 | Ga0070660_100001047 | 3300005339 | Bacteria | 18600 |
| 28 | Ga0070669_100030253 | 3300005353 | Bacteria | 3906 |
| 29 | Ga0070675_100256677 | 3300005354 | Bacteria | 1531 |
| 30 | Ga0070663_100050937 | 3300005455 | Bacteria | 2947 |
| 31 | Ga0070678_100101253 | 3300005456 | Bacteria | 2233 |
| 32 | Ga0068855_100003256 | 3300005563 | Bacteria | 19861 |
| 33 | Ga0068855_100011429 | 3300005563 | Bacteria | 10724 |
| 34 | Ga0068856_100228432 | 3300005614 | Bacteria | 1876 |
| 35 | Ga0081455_10001059 | 3300005937 | Bacteria | 34635 |
| 36 | Ga0081455_10017164 | 3300005937 | Bacteria | 6950 |
| 37 | Ga0081538_10003479 | 3300005981 | Bacteria | 14872 |
| 38 | Ga0081538_10062383 | 3300005981 | Bacteria | 2126 |
| 39 | Ga0075369_10035244 | 3300006186 | Bacteria | 2127 |
| 40 | Ga0075428_100009062 | 3300006844 | Bacteria | 11042 |
| 41 | Ga0075430_100009064 | 3300006846 | Bacteria | 8410 |
| 42 | Ga0075430_100018249 | 3300006846 | Bacteria | 5972 |
| 43 | Ga0075431_100003419 | 3300006847 | Bacteria | 15401 |
| 44 | Ga0075431_100020307 | 3300006847 | Bacteria | 6785 |
| 45 | Ga0075431_100088100 | 3300006847 | Bacteria | 3203 |
| 46 | Ga0075434_100199804 | 3300006871 | Bacteria | 2019 |
| 47 | Ga0075429_100000338 | 3300006880 | Bacteria | 34036 |
| 48 | Ga0075429_100075999 | 3300006880 | Bacteria | 2925 |
| 49 | Ga0099823_1000004 | 3300006944 | Bacteria | 176518 |
| 50 | Ga0079104_1000097 | 3300006946 | Bacteria | 129435 |
| 51 | Ga0105251_10004006 | 3300009011 | Bacteria | 10407 |
| 52 | Ga0105251_10011394 | 3300009011 | Bacteria | 5082 |
| 53 | Ga0105251_10050694 | 3300009011 | Bacteria | 1982 |
| 54 | Ga0105244_10000053 | 3300009036 | Bacteria | 133900 |
| 55 | Ga0105244_10000449 | 3300009036 | Bacteria | 37516 |
| 56 | Ga0105244_10001624 | 3300009036 | Bacteria | 17818 |
| 57 | Ga0105244_10022330 | 3300009036 | Bacteria | 3484 |
| 58 | Ga0105250_10000092 | 3300009092 | Bacteria | 79976 |
| 59 | Ga0105250_10000131 | 3300009092 | Bacteria | 64802 |
| 60 | Ga0111539_10026704 | 3300009094 | Bacteria | 7056 |
| 61 | Ga0111539_10228621 | 3300009094 | Bacteria | 2166 |
| 62 | Ga0105245_10097184 | 3300009098 | Bacteria | 2719 |
| 63 | Ga0105247_10000472 | 3300009101 | Bacteria | 33737 |
| 64 | Ga0114129_10030167 | 3300009147 | Bacteria | 7680 |
| 65 | Ga0114129_10038538 | 3300009147 | Bacteria | 6741 |
| 66 | Ga0105243_10038876 | 3300009148 | Bacteria | 3707 |
| 67 | Ga0105243_10084794 | 3300009148 | Bacteria | 2595 |
| 68 | Ga0105248_10015699 | 3300009177 | Bacteria | 8346 |
| 69 | Ga0105237_10207881 | 3300009545 | Bacteria | 1957 |
| 70 | Ga0105239_10005327 | 3300010375 | Bacteria | 15091 |
| 71 | Ga0105246_10001375 | 3300011119 | Bacteria | 14343 |
| 72 | Ga0157373_10062294 | 3300013100 | Bacteria | 2642 |
| 73 | Ga0157371_10001313 | 3300013102 | Bacteria | 26106 |
| 74 | Ga0157371_10003361 | 3300013102 | Bacteria | 14563 |
| 75 | Ga0157371_10029236 | 3300013102 | Bacteria | 3988 |
| 76 | Ga0157370_10003861 | 3300013104 | Bacteria | 17467 |
| 77 | Ga0157370_10053744 | 3300013104 | Bacteria | 3840 |
| 78 | Ga0157369_10001578 | 3300013105 | Bacteria | 27888 |
| 79 | Ga0157369_10188651 | 3300013105 | Bacteria | 2167 |
| 80 | Ga0157374_10000146 | 3300013296 | Bacteria | 64549 |
| 81 | Ga0163162_10004400 | 3300013306 | Bacteria | 13556 |
| 82 | Ga0163162_10011171 | 3300013306 | Bacteria | 8749 |
| 83 | Ga0163162_10243166 | 3300013306 | Bacteria | 1931 |
| 84 | Ga0157372_10003027 | 3300013307 | Bacteria | 18108 |
| 85 | Ga0157375_10003051 | 3300013308 | Bacteria | 14539 |
| 86 | Ga0157375_10187362 | 3300013308 | Bacteria | 2223 |
| 87 | Ga0182008_10000862 | 3300014497 | Bacteria | 21050 |
| 88 | Ga0182008_10011205 | 3300014497 | Bacteria | 4777 |
| 89 | Ga0182008_10012491 | 3300014497 | Bacteria | 4482 |
| 90 | Ga0182008_10085737 | 3300014497 | Bacteria | 1551 |
| 91 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 92 | Ga0182006_1008045 | 3300015261 | Bacteria | 4791 |
| 93 | Ga0182006_1010339 | 3300015261 | Bacteria | 4150 |
| 94 | Ga0182007_10000030 | 3300015262 | Bacteria | 156866 |
| 95 | Ga0182007_10011317 | 3300015262 | Bacteria | 3477 |
| 96 | Ga0182007_10018956 | 3300015262 | Bacteria | 2482 |
| 97 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 98 | Ga0182005_1009614 | 3300015265 | Bacteria | 2806 |
| 99 | Ga0163161_10041020 | 3300017792 | Bacteria | 3325 |
| 100 | Ga0163161_10045708 | 3300017792 | Bacteria | 3159 |
| 101 | Ga0213872_10000135 | 3300021361 | Bacteria | 67262 |
| 102 | Ga0224712_10000073 | 3300022467 | Bacteria | 15371 |
| 103 | Ga0209672_101017 | 3300025228 | Bacteria | 12156 |
| 104 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 105 | Ga0209148_1000794 | 3300025254 | Bacteria | 23325 |
| 106 | Ga0209565_1000104 | 3300025263 | Bacteria | 124432 |
| 107 | Ga0209675_1000065 | 3300025291 | Bacteria | 174791 |
| 108 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 109 | Ga0209676_1000044 | 3300025292 | Bacteria | 416215 |
| 110 | Ga0209676_1000535 | 3300025292 | Bacteria | 59023 |
| 111 | Ga0209676_1002148 | 3300025292 | Bacteria | 14931 |
| 112 | Ga0209025_1000147 | 3300025294 | Bacteria | 180008 |
| 113 | Ga0209025_1007698 | 3300025294 | Bacteria | 7948 |
| 114 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 115 | Ga0209564_1000080 | 3300025295 | Bacteria | 263547 |
| 116 | Ga0209564_1000253 | 3300025295 | Bacteria | 114335 |
| 117 | Ga0209564_1000923 | 3300025295 | Bacteria | 38212 |
| 118 | Ga0209758_1010657 | 3300025297 | Bacteria | 5464 |
| 119 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 120 | Ga0209050_1000148 | 3300025298 | Bacteria | 164093 |
| 121 | Ga0209256_1000543 | 3300025299 | Bacteria | 54373 |
| 122 | Ga0207426_1003874 | 3300025302 | Bacteria | 7711 |
| 123 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 124 | Ga0209051_1015660 | 3300025303 | Bacteria | 3476 |
| 125 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 126 | Ga0207696_1000160 | 3300025711 | Bacteria | 111012 |
| 127 | Ga0207696_1000225 | 3300025711 | Bacteria | 79995 |
| 128 | Ga0207696_1008385 | 3300025711 | Bacteria | 3962 |
| 129 | Ga0207655_1000049 | 3300025728 | Bacteria | 295872 |
| 130 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 131 | Ga0207655_1000077 | 3300025728 | Bacteria | 219418 |
| 132 | Ga0207655_1000112 | 3300025728 | Bacteria | 170624 |
| 133 | Ga0207655_1000181 | 3300025728 | Bacteria | 112734 |
| 134 | Ga0207655_1005043 | 3300025728 | Bacteria | 9128 |
| 135 | Ga0207713_1000113 | 3300025735 | Bacteria | 132424 |
| 136 | Ga0207713_1000232 | 3300025735 | Bacteria | 74620 |
| 137 | Ga0207713_1000725 | 3300025735 | Bacteria | 30860 |
| 138 | Ga0207713_1002997 | 3300025735 | Bacteria | 11801 |
| 139 | Ga0207713_1006136 | 3300025735 | Bacteria | 7386 |
| 140 | Ga0207713_1006407 | 3300025735 | Bacteria | 7174 |
| 141 | Ga0207713_1010896 | 3300025735 | Bacteria | 4992 |
| 142 | Ga0207713_1013933 | 3300025735 | Bacteria | 4207 |
| 143 | Ga0207713_1014084 | 3300025735 | Bacteria | 4175 |
| 144 | Ga0207713_1032743 | 3300025735 | Bacteria | 2279 |
| 145 | Ga0207710_10000009 | 3300025900 | Bacteria | 485205 |
| 146 | Ga0207647_10001767 | 3300025904 | Bacteria | 16587 |
| 147 | Ga0207705_10000783 | 3300025909 | Bacteria | 26126 |
| 148 | Ga0207705_10002884 | 3300025909 | Bacteria | 13159 |
| 149 | Ga0207705_10014878 | 3300025909 | Bacteria | 5595 |
| 150 | Ga0207657_10009942 | 3300025919 | Bacteria | 9520 |
| 151 | Ga0207659_10196664 | 3300025926 | Bacteria | 1607 |
| 152 | Ga0207687_10053315 | 3300025927 | Bacteria | 2825 |
| 153 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 154 | Ga0207709_10078020 | 3300025935 | Bacteria | 2125 |
| 155 | Ga0207711_10005662 | 3300025941 | Bacteria | 10555 |
| 156 | Ga0207667_10004017 | 3300025949 | Bacteria | 18078 |
| 157 | Ga0207667_10014081 | 3300025949 | Bacteria | 9131 |
| 158 | Ga0207667_10021335 | 3300025949 | Bacteria | 7177 |
| 159 | Ga0207651_10214103 | 3300025960 | Bacteria | 1553 |
| 160 | Ga0207639_10014191 | 3300026041 | Bacteria | 5594 |
| 161 | Ga0207674_10093515 | 3300026116 | Bacteria | 2995 |
| 162 | Ga0207683_10128645 | 3300026121 | Bacteria | 2277 |
| 163 | Ga0207698_10046047 | 3300026142 | Bacteria | 3290 |
| 164 | Ga0209281_1000136 | 3300027111 | Bacteria | 182153 |
| 165 | Ga0209389_1000006 | 3300027296 | Bacteria | 231635 |
| 166 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 167 | Ga0207428_10051686 | 3300027907 | Bacteria | 3285 |
| 168 | Ga0265337_1007535 | 3300028556 | Bacteria | 4065 |
| 169 | Ga0265334_10007864 | 3300028573 | Bacteria | 4560 |
| 170 | Ga0307515_10073804 | 3300028794 | Bacteria | 4576 |
| 171 | Ga0265338_10000547 | 3300028800 | Bacteria | 65836 |
| 172 | Ga0265324_10013494 | 3300029957 | Bacteria | 3046 |
| 173 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 174 | Ga0265316_10018300 | 3300031344 | Bacteria | 6023 |
| 175 | Ga0307508_10112036 | 3300031616 | Bacteria | 2329 |
| 176 | Ga0265314_10012712 | 3300031711 | Bacteria | 6843 |
| 177 | Ga0265314_10061899 | 3300031711 | Bacteria | 2546 |
| 178 | Ga0307405_10056265 | 3300031731 | Bacteria | 2466 |
| 179 | Ga0307405_10069783 | 3300031731 | Bacteria | 2254 |
| 180 | Ga0307410_10021181 | 3300031852 | Bacteria | 3994 |
| 181 | Ga0307406_10014342 | 3300031901 | Bacteria | 4558 |
| 182 | Ga0307407_10020070 | 3300031903 | Bacteria | 3416 |
| 183 | Ga0307407_10022645 | 3300031903 | Bacteria | 3265 |
| 184 | Ga0307409_100001597 | 3300031995 | Bacteria | 11333 |
| 185 | Ga0307409_100014810 | 3300031995 | Bacteria | 5089 |
| 186 | Ga0307414_10117626 | 3300032004 | Bacteria | 2037 |
| 187 | Ga0307415_100001340 | 3300032126 | Bacteria | 11693 |
| 188 | Ga0307415_100071213 | 3300032126 | Bacteria | 2444 |
| 189 | Ga0316584_0104374 | 3300036712 | Bacteria | 2122 |
| 190 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 191 | Ga0395899_0002023 | 3300037312 | Bacteria | 16701 |
| 192 | Ga0395899_0004044 | 3300037312 | Bacteria | 11568 |
| 193 | Ga0395899_0058667 | 3300037312 | Bacteria | 2838 |
| 194 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 195 | Ga0395900_0000411 | 3300037418 | Bacteria | 61659 |
| 196 | Ga0395900_0000615 | 3300037418 | Bacteria | 48234 |
| 197 | Ga0395900_0003488 | 3300037418 | Bacteria | 16976 |
| 198 | Ga0395900_0031034 | 3300037418 | Bacteria | 5489 |
| 199 | Ga0395898_0000679 | 3300037466 | Bacteria | 61481 |
| 200 | Ga0395898_0002992 | 3300037466 | Bacteria | 19185 |
| 201 | Ga0395898_0037443 | 3300037466 | Bacteria | 4812 |
| 202 | Ga0395898_0072984 | 3300037466 | Bacteria | 3315 |
| 203 | Ga0395898_0216905 | 3300037466 | Bacteria | 1825 |
| 204 | Ga0395905_0024855 | 3300037471 | Bacteria | 5653 |
| 205 | Ga0395901_0000053 | 3300038443 | Bacteria | 163807 |
| 206 | Ga0395901_0000084 | 3300038443 | Bacteria | 127737 |
| 207 | Ga0395901_0000328 | 3300038443 | Bacteria | 58470 |
| 208 | Ga0395901_0012510 | 3300038443 | Bacteria | 8611 |
| 209 | Ga0395901_0100538 | 3300038443 | Bacteria | 3033 |
| 210 | Ga0395901_0219019 | 3300038443 | Bacteria | 1990 |
| 211 | Ga0436360_0818816 | 3300039438 | Bacteria | 5902 |
| 212 | Ga0436361_0080101 | 3300039447 | Bacteria | 16464 |
| 213 | Ga0436361_0115159 | 3300039447 | Bacteria | 1266 |
| 214 | Ga0436361_0400312 | 3300039447 | Bacteria | 3036 |
| 215 | Ga0436361_0402857 | 3300039447 | Bacteria | 2305 |
| 216 | Ga0439436_0000475 | 3300041404 | Bacteria | 10357 |
| 217 | Ga0439438_003774 | 3300041405 | Bacteria | 5987 |
| 218 | Ga0439438_011913 | 3300041405 | Bacteria | 2687 |
| 219 | Ga0439447_000206 | 3300041407 | Bacteria | 20774 |
| 220 | Ga0439466_0000216 | 3300041411 | Bacteria | 22651 |
| 221 | Ga0439466_0002842 | 3300041411 | Bacteria | 6772 |
| 222 | Ga0451791_0311755 | 3300041451 | Bacteria | 3403 |
| 223 | Ga0451800_0068730 | 3300041459 | Bacteria | 1730 |
| 224 | Ga0451841_0238766 | 3300041498 | Bacteria | 3330 |
| 225 | Ga0451853_1144978 | 3300041512 | Bacteria | 2727 |
| 226 | Ga0439448_0034629 | 3300042005 | Bacteria | 1614 |
| 227 | Ga0439432_000972 | 3300042006 | Bacteria | 10817 |
| 228 | Ga0439449_0047827 | 3300042007 | Bacteria | 1584 |
| 229 | Ga0439452_000779 | 3300042010 | Bacteria | 15127 |
| 230 | Ga0439456_004376 | 3300042013 | Bacteria | 2854 |
| 231 | Ga0439463_000483 | 3300042016 | Bacteria | 11084 |
| 232 | Ga0450911_003292 | 3300042115 | Bacteria | 2884 |
| 233 | Ga0450922_000045 | 3300042124 | Bacteria | 10921 |
| 234 | Ga0450923_000523 | 3300042125 | Bacteria | 4289 |
| 235 | Ga0450902_000306 | 3300042137 | Bacteria | 5895 |
| 236 | Ga0450904_000071 | 3300042139 | Bacteria | 22967 |
| 237 | Ga0439434_0000751 | 3300042435 | Bacteria | 9322 |
| 238 | Ga0450901_000131 | 3300042533 | Bacteria | 8244 |
| 239 | Ga0450901_002693 | 3300042533 | Bacteria | 1893 |
| 240 | Ga0451577_0008240 | 3300042876 | Bacteria | 10156 |
| 241 | Ga0466977_0002989 | 3300044666 | Bacteria | 7980 |
| 242 | Ga0466966_0093253 | 3300044684 | Bacteria | 1867 |
| 243 | Ga0466966_0145050 | 3300044684 | Bacteria | 1449 |
| 244 | Ga0466961_0006286 | 3300044693 | Bacteria | 7543 |
| 245 | Ga0453684_0048355 | 3300044712 | Bacteria | 5627 |
| 246 | Ga0466957_0107909 | 3300044842 | Bacteria | 1763 |
| 247 | Ga0466960_0101755 | 3300044901 | Bacteria | 1480 |
| 248 | Ga0466959_0082393 | 3300045049 | Bacteria | 2317 |
| 249 | Ga0466959_0087964 | 3300045049 | Bacteria | 2234 |
| 250 | Ga0466967_0016544 | 3300045976 | Bacteria | 5821 |
| 251 | Ga0466967_0072157 | 3300045976 | Bacteria | 3093 |
| 252 | Ga0495617_001890 | 3300046452 | Bacteria | 8821 |
| 253 | Ga0495617_004841 | 3300046452 | Bacteria | 4849 |
| 254 | Ga0495627_000140 | 3300046453 | Bacteria | 86227 |
| 255 | Ga0495627_001874 | 3300046453 | Bacteria | 11094 |
| 256 | Ga0495627_004057 | 3300046453 | Bacteria | 6237 |
| 257 | Ga0495627_018629 | 3300046453 | Bacteria | 2338 |
| 258 | Ga0495603_0024431 | 3300046455 | Bacteria | 3654 |
| 259 | Ga0495603_0045056 | 3300046455 | Bacteria | 2631 |
| 260 | Ga0495590_0001454 | 3300046457 | Bacteria | 10217 |
| 261 | Ga0495590_0015099 | 3300046457 | Bacteria | 2810 |
| 262 | Ga0495590_0019709 | 3300046457 | Bacteria | 2400 |
| 263 | Ga0495591_000026 | 3300046458 | Bacteria | 187482 |
| 264 | Ga0495591_002234 | 3300046458 | Bacteria | 11025 |
| 265 | Ga0495591_009858 | 3300046458 | Bacteria | 3755 |
| 266 | Ga0495591_016944 | 3300046458 | Bacteria | 2517 |
| 267 | Ga0495591_019100 | 3300046458 | Bacteria | 2303 |
| 268 | Ga0495591_020905 | 3300046458 | Bacteria | 2149 |
| 269 | Ga0495638_0000254 | 3300046460 | Bacteria | 72287 |
| 270 | Ga0495638_0000449 | 3300046460 | Bacteria | 49303 |
| 271 | Ga0495638_0003379 | 3300046460 | Bacteria | 12583 |
| 272 | Ga0495638_0006753 | 3300046460 | Bacteria | 8310 |
| 273 | Ga0495638_0047877 | 3300046460 | Bacteria | 2678 |
| 274 | Ga0495638_0071549 | 3300046460 | Bacteria | 2121 |
| 275 | Ga0495653_0000097 | 3300046463 | Bacteria | 72749 |
| 276 | Ga0495653_0043914 | 3300046463 | Bacteria | 3471 |
| 277 | Ga0495650_0000232 | 3300046471 | Bacteria | 113636 |
| 278 | Ga0495650_0001039 | 3300046471 | Bacteria | 31082 |
| 279 | Ga0495650_0007237 | 3300046471 | Bacteria | 6722 |
| 280 | Ga0495650_0007549 | 3300046471 | Bacteria | 6513 |
| 281 | Ga0495650_0015560 | 3300046471 | Bacteria | 3895 |
| 282 | Ga0495605_0000170 | 3300046474 | Bacteria | 82318 |
| 283 | Ga0495605_0000257 | 3300046474 | Bacteria | 62503 |
| 284 | Ga0495605_0000913 | 3300046474 | Bacteria | 20291 |
| 285 | Ga0495605_0001525 | 3300046474 | Bacteria | 15040 |
| 286 | Ga0495605_0003624 | 3300046474 | Bacteria | 9162 |
| 287 | Ga0495605_0004025 | 3300046474 | Bacteria | 8680 |
| 288 | Ga0495605_0004580 | 3300046474 | Bacteria | 8094 |
| 289 | Ga0495605_0005917 | 3300046474 | Bacteria | 7069 |
| 290 | Ga0495664_0031354 | 3300046477 | Bacteria | 3116 |
| 291 | Ga0495664_0049656 | 3300046477 | Bacteria | 2490 |
| 292 | Ga0495584_0000128 | 3300046491 | Bacteria | 52353 |
| 293 | Ga0495584_0004140 | 3300046491 | Bacteria | 7831 |
| 294 | Ga0495584_0011954 | 3300046491 | Bacteria | 4438 |
| 295 | Ga0495585_0000045 | 3300046492 | Bacteria | 123148 |
| 296 | Ga0495585_0000234 | 3300046492 | Bacteria | 57324 |
| 297 | Ga0495585_0001405 | 3300046492 | Bacteria | 18959 |
| 298 | Ga0495585_0001866 | 3300046492 | Bacteria | 15904 |
| 299 | Ga0495585_0007038 | 3300046492 | Bacteria | 6921 |
| 300 | Ga0495585_0008186 | 3300046492 | Bacteria | 6350 |
| 301 | Ga0495594_0004074 | 3300046499 | Bacteria | 7512 |
| 302 | Ga0495594_0009901 | 3300046499 | Bacteria | 4939 |
| 303 | Ga0495596_0000003 | 3300046500 | Bacteria | 186592 |
| 304 | Ga0495607_0000138 | 3300046501 | Bacteria | 77180 |
| 305 | Ga0495607_0000249 | 3300046501 | Bacteria | 57898 |
| 306 | Ga0495607_0000546 | 3300046501 | Bacteria | 36856 |
| 307 | Ga0495607_0002728 | 3300046501 | Bacteria | 14082 |
| 308 | Ga0495607_0019654 | 3300046501 | Bacteria | 4286 |
| 309 | Ga0495607_0051455 | 3300046501 | Bacteria | 2392 |
| 310 | Ga0495607_0053202 | 3300046501 | Bacteria | 2341 |
| 311 | Ga0495583_0002141 | 3300046506 | Bacteria | 17630 |
| 312 | Ga0495583_0003704 | 3300046506 | Bacteria | 11369 |
| 313 | Ga0495606_0000162 | 3300046507 | Bacteria | 117378 |
| 314 | Ga0495606_0000280 | 3300046507 | Bacteria | 88619 |
| 315 | Ga0495606_0000806 | 3300046507 | Bacteria | 47839 |
| 316 | Ga0495606_0000965 | 3300046507 | Bacteria | 42060 |
| 317 | Ga0495606_0001256 | 3300046507 | Bacteria | 35407 |
| 318 | Ga0495606_0003849 | 3300046507 | Bacteria | 15498 |
| 319 | Ga0495606_0003983 | 3300046507 | Bacteria | 15105 |
| 320 | Ga0495606_0008139 | 3300046507 | Bacteria | 9185 |
| 321 | Ga0495606_0009499 | 3300046507 | Bacteria | 8215 |
| 322 | Ga0495606_0010074 | 3300046507 | Bacteria | 7898 |
| 323 | Ga0495606_0060287 | 3300046507 | Bacteria | 2431 |
| 324 | Ga0495610_0001518 | 3300046512 | Bacteria | 20436 |
| 325 | Ga0495610_0003134 | 3300046512 | Bacteria | 13153 |
| 326 | Ga0495610_0006069 | 3300046512 | Bacteria | 8432 |
| 327 | Ga0495610_0006890 | 3300046512 | Bacteria | 7698 |
| 328 | Ga0495610_0010386 | 3300046512 | Bacteria | 5792 |
| 329 | Ga0495610_0022321 | 3300046512 | Bacteria | 3464 |
| 330 | Ga0495616_0025078 | 3300046513 | Bacteria | 3190 |
| 331 | Ga0495616_0064280 | 3300046513 | Bacteria | 1790 |
| 332 | Ga0495620_0000006 | 3300046515 | Bacteria | 273098 |
| 333 | Ga0495620_0002243 | 3300046515 | Bacteria | 11200 |
| 334 | Ga0495620_0002910 | 3300046515 | Bacteria | 9841 |
| 335 | Ga0495620_0024697 | 3300046515 | Bacteria | 2854 |
| 336 | Ga0495628_0000037 | 3300046516 | Bacteria | 109854 |
| 337 | Ga0495628_0009630 | 3300046516 | Bacteria | 8243 |
| 338 | Ga0495630_0009539 | 3300046517 | Bacteria | 6979 |
| 339 | Ga0495631_0000104 | 3300046518 | Bacteria | 55509 |
| 340 | Ga0495631_0001094 | 3300046518 | Bacteria | 16840 |
| 341 | Ga0495631_0040443 | 3300046518 | Bacteria | 2065 |
| 342 | Ga0495632_0000395 | 3300046519 | Bacteria | 41002 |
| 343 | Ga0495632_0000448 | 3300046519 | Bacteria | 39223 |
| 344 | Ga0495632_0001386 | 3300046519 | Bacteria | 20327 |
| 345 | Ga0495632_0003627 | 3300046519 | Bacteria | 10846 |
| 346 | Ga0495632_0045687 | 3300046519 | Bacteria | 2180 |
| 347 | Ga0495632_0065205 | 3300046519 | Bacteria | 1759 |
| 348 | Ga0495637_0000853 | 3300046520 | Bacteria | 19941 |
| 349 | Ga0495637_0001188 | 3300046520 | Bacteria | 15849 |
| 350 | Ga0495637_0007800 | 3300046520 | Bacteria | 5285 |
| 351 | Ga0495637_0013290 | 3300046520 | Bacteria | 3911 |
| 352 | Ga0495637_0020686 | 3300046520 | Bacteria | 3023 |
| 353 | Ga0495637_0039547 | 3300046520 | Bacteria | 2035 |
| 354 | Ga0495643_0000029 | 3300046522 | Bacteria | 261028 |
| 355 | Ga0495643_0000143 | 3300046522 | Bacteria | 114897 |
| 356 | Ga0495643_0000804 | 3300046522 | Bacteria | 34565 |
| 357 | Ga0495643_0009690 | 3300046522 | Bacteria | 5963 |
| 358 | Ga0495643_0024614 | 3300046522 | Bacteria | 3413 |
| 359 | Ga0495643_0046420 | 3300046522 | Bacteria | 2354 |
| 360 | Ga0495643_0058379 | 3300046522 | Bacteria | 2053 |
| 361 | Ga0495644_0000170 | 3300046523 | Bacteria | 30574 |
| 362 | Ga0495648_0000126 | 3300046524 | Bacteria | 90189 |
| 363 | Ga0495648_0000259 | 3300046524 | Bacteria | 59999 |
| 364 | Ga0495648_0003659 | 3300046524 | Bacteria | 13446 |
| 365 | Ga0495648_0005205 | 3300046524 | Bacteria | 10882 |
| 366 | Ga0495648_0008347 | 3300046524 | Bacteria | 8164 |
| 367 | Ga0495648_0059505 | 3300046524 | Bacteria | 2278 |
| 368 | Ga0495666_0000069 | 3300046526 | Bacteria | 40652 |
| 369 | Ga0495666_0003413 | 3300046526 | Bacteria | 8014 |
| 370 | Ga0495666_0008984 | 3300046526 | Bacteria | 4998 |
| 371 | Ga0495642_0000015 | 3300046528 | Bacteria | 121192 |
| 372 | Ga0495642_0004518 | 3300046528 | Bacteria | 5401 |
| 373 | Ga0495654_0001371 | 3300046530 | Bacteria | 16890 |
| 374 | Ga0495654_0003483 | 3300046530 | Bacteria | 9607 |
| 375 | Ga0495654_0014730 | 3300046530 | Bacteria | 4157 |
| 376 | Ga0495654_0016873 | 3300046530 | Bacteria | 3845 |
| 377 | Ga0495654_0017264 | 3300046530 | Bacteria | 3797 |
| 378 | Ga0495654_0018600 | 3300046530 | Bacteria | 3638 |
| 379 | Ga0495654_0058287 | 3300046530 | Bacteria | 1863 |
| 380 | Ga0495654_0061108 | 3300046530 | Bacteria | 1810 |
| 381 | Ga0495587_0001099 | 3300046536 | Bacteria | 17763 |
| 382 | Ga0495609_0000634 | 3300046538 | Bacteria | 27340 |
| 383 | Ga0495609_0005172 | 3300046538 | Bacteria | 6942 |
| 384 | Ga0495609_0060147 | 3300046538 | Bacteria | 1680 |
| 385 | Ga0495597_0000193 | 3300046542 | Bacteria | 55638 |
| 386 | Ga0495597_0000253 | 3300046542 | Bacteria | 48591 |
| 387 | Ga0495597_0000644 | 3300046542 | Bacteria | 28365 |
| 388 | Ga0495597_0040184 | 3300046542 | Bacteria | 2091 |
| 389 | Ga0495597_0046053 | 3300046542 | Bacteria | 1933 |
| 390 | Ga0495597_0083892 | 3300046542 | Bacteria | 1359 |
| 391 | Ga0495645_0048931 | 3300046543 | Bacteria | 3079 |
| 392 | Ga0495622_0001272 | 3300046557 | Bacteria | 12949 |
| 393 | Ga0495622_0037574 | 3300046557 | Bacteria | 2255 |
| 394 | Ga0495622_0037827 | 3300046557 | Bacteria | 2247 |
| 395 | Ga0495633_0000063 | 3300046558 | Bacteria | 141657 |
| 396 | Ga0495633_0000425 | 3300046558 | Bacteria | 43892 |
| 397 | Ga0495633_0000642 | 3300046558 | Bacteria | 32523 |
| 398 | Ga0495633_0013884 | 3300046558 | Bacteria | 4224 |
| 399 | Ga0495668_0000254 | 3300046616 | Bacteria | 76101 |
| 400 | Ga0495668_0000360 | 3300046616 | Bacteria | 60235 |
| 401 | Ga0495668_0001663 | 3300046616 | Bacteria | 20708 |
| 402 | Ga0495668_0001785 | 3300046616 | Bacteria | 19654 |
| 403 | Ga0495634_0000844 | 3300046642 | Bacteria | 29495 |
| 404 | Ga0495625_0006457 | 3300046660 | Bacteria | 10433 |
| 405 | Ga0495625_0006598 | 3300046660 | Bacteria | 10303 |
| 406 | Ga0495625_0013046 | 3300046660 | Bacteria | 6698 |
| 407 | Ga0495625_0016950 | 3300046660 | Bacteria | 5715 |
| 408 | Ga0495625_0024618 | 3300046660 | Bacteria | 4579 |
| 409 | Ga0495625_0034183 | 3300046660 | Bacteria | 3753 |
| 410 | Ga0495635_0007684 | 3300046663 | Bacteria | 7522 |
| 411 | Ga0495661_0000045 | 3300046665 | Bacteria | 148664 |
| 412 | Ga0495661_0000243 | 3300046665 | Bacteria | 62850 |
| 413 | Ga0495661_0014325 | 3300046665 | Bacteria | 5314 |
| 414 | Ga0495661_0016653 | 3300046665 | Bacteria | 4866 |
| 415 | Ga0495588_0002096 | 3300046674 | Bacteria | 8556 |
| 416 | Ga0495588_0012720 | 3300046674 | Bacteria | 3987 |
| 417 | Ga0495588_0081773 | 3300046674 | Bacteria | 1686 |
| 418 | Ga0495623_0005211 | 3300046679 | Bacteria | 8525 |
| 419 | Ga0495623_0006585 | 3300046679 | Bacteria | 7559 |
| 420 | Ga0495623_0018811 | 3300046679 | Bacteria | 4460 |
| 421 | Ga0495646_0006539 | 3300046680 | Bacteria | 7395 |
| 422 | Ga0495646_0008394 | 3300046680 | Bacteria | 6565 |
| 423 | Ga0495646_0034860 | 3300046680 | Bacteria | 3123 |
| 424 | Ga0495613_0007039 | 3300046689 | Bacteria | 8373 |
| 425 | Ga0495670_0000334 | 3300046691 | Bacteria | 22505 |
| 426 | Ga0495670_0002833 | 3300046691 | Bacteria | 8579 |
| 427 | Ga0495670_0025584 | 3300046691 | Bacteria | 2919 |
| 428 | Ga0495671_0001724 | 3300046692 | Bacteria | 14202 |
| 429 | Ga0495671_0004086 | 3300046692 | Bacteria | 8805 |
| 430 | Ga0495671_0004132 | 3300046692 | Bacteria | 8751 |
| 431 | Ga0495671_0004346 | 3300046692 | Bacteria | 8506 |
| 432 | Ga0495671_0016630 | 3300046692 | Bacteria | 3924 |
| 433 | Ga0495671_0022791 | 3300046692 | Bacteria | 3277 |
| 434 | Ga0495671_0028166 | 3300046692 | Bacteria | 2896 |
| 435 | Ga0495671_0057684 | 3300046692 | Bacteria | 1921 |
| 436 | Ga0495649_0003272 | 3300046694 | Bacteria | 11032 |
| 437 | Ga0495649_0004143 | 3300046694 | Bacteria | 9518 |
| 438 | Ga0495649_0004590 | 3300046694 | Bacteria | 8988 |
| 439 | Ga0495649_0008672 | 3300046694 | Bacteria | 6104 |
| 440 | Ga0495649_0008955 | 3300046694 | Bacteria | 5983 |
| 441 | Ga0495649_0009416 | 3300046694 | Bacteria | 5808 |
| 442 | Ga0495649_0012938 | 3300046694 | Bacteria | 4830 |
| 443 | Ga0495649_0049139 | 3300046694 | Bacteria | 2291 |
| 444 | Ga0495589_0000940 | 3300046794 | Bacteria | 17866 |
| 445 | Ga0495589_0004178 | 3300046794 | Bacteria | 7732 |
| 446 | Ga0495589_0004848 | 3300046794 | Bacteria | 7139 |
| 447 | Ga0495589_0048732 | 3300046794 | Bacteria | 2096 |
| 448 | Ga0495600_0012778 | 3300046809 | Bacteria | 5259 |
| 449 | Ga0495660_0000388 | 3300046810 | Bacteria | 38112 |
| 450 | Ga0495660_0005616 | 3300046810 | Bacteria | 7500 |
| 451 | Ga0495660_0005746 | 3300046810 | Bacteria | 7410 |
| 452 | Ga0495660_0015272 | 3300046810 | Bacteria | 4437 |
| 453 | Ga0495660_0022486 | 3300046810 | Bacteria | 3600 |
| 454 | Ga0495604_0002332 | 3300047317 | Bacteria | 15211 |
| 455 | Ga0495604_0016306 | 3300047317 | Bacteria | 5937 |
| 456 | Ga0495672_0000213 | 3300047320 | Bacteria | 82925 |
| 457 | Ga0495672_0001762 | 3300047320 | Bacteria | 20865 |
| 458 | Ga0495672_0002378 | 3300047320 | Bacteria | 17359 |
| 459 | Ga0495672_0002447 | 3300047320 | Bacteria | 17086 |
| 460 | Ga0495672_0002741 | 3300047320 | Bacteria | 15795 |
| 461 | Ga0495680_0000543 | 3300047322 | Bacteria | 42425 |
| 462 | Ga0495680_0038665 | 3300047322 | Bacteria | 3811 |
| 463 | Ga0495683_0000199 | 3300047323 | Bacteria | 56834 |
| 464 | Ga0495683_0000215 | 3300047323 | Bacteria | 54712 |
| 465 | Ga0495683_0006410 | 3300047323 | Bacteria | 6433 |
| 466 | Ga0495683_0042327 | 3300047323 | Bacteria | 2296 |
| 467 | Ga0495687_000419 | 3300047443 | Bacteria | 52487 |
| 468 | Ga0495687_000660 | 3300047443 | Bacteria | 39604 |
| 469 | Ga0495687_000861 | 3300047443 | Bacteria | 32175 |
| 470 | Ga0495687_000898 | 3300047443 | Bacteria | 31229 |
| 471 | Ga0495687_001758 | 3300047443 | Bacteria | 19151 |
| 472 | Ga0495675_0013668 | 3300047444 | Bacteria | 5128 |
| 473 | Ga0495679_001460 | 3300047446 | Bacteria | 13397 |
| 474 | Ga0495679_001962 | 3300047446 | Bacteria | 10968 |
| 475 | Ga0495679_011372 | 3300047446 | Bacteria | 3437 |
| 476 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 477 | Ga0495673_0000084 | 3300047469 | Bacteria | 193599 |
| 478 | Ga0495673_0000251 | 3300047469 | Bacteria | 75046 |
| 479 | Ga0495673_0001757 | 3300047469 | Bacteria | 16508 |
| 480 | Ga0495673_0002092 | 3300047469 | Bacteria | 14560 |
| 481 | Ga0495673_0002608 | 3300047469 | Bacteria | 12533 |
| 482 | Ga0495673_0004328 | 3300047469 | Bacteria | 8938 |
| 483 | Ga0495681_0000122 | 3300047470 | Bacteria | 68461 |
| 484 | Ga0495681_0000180 | 3300047470 | Bacteria | 53731 |
| 485 | Ga0495681_0000291 | 3300047470 | Bacteria | 40021 |
| 486 | Ga0495681_0001803 | 3300047470 | Bacteria | 15758 |
| 487 | Ga0495681_0007282 | 3300047470 | Bacteria | 7101 |
| 488 | Ga0495681_0014418 | 3300047470 | Bacteria | 4530 |
| 489 | Ga0495681_0025807 | 3300047470 | Bacteria | 3070 |
| 490 | Ga0495681_0027142 | 3300047470 | Bacteria | 2967 |
| 491 | Ga0495681_0051538 | 3300047470 | Bacteria | 1935 |
| 492 | Ga0495684_0034027 | 3300047471 | Bacteria | 3909 |
| 493 | Ga0495686_0002239 | 3300047472 | Bacteria | 18677 |
| 494 | Ga0495686_0096893 | 3300047472 | Bacteria | 1784 |
| 495 | Ga0495686_0111350 | 3300047472 | Bacteria | 1641 |
| 496 | Ga0495593_0000146 | 3300047673 | Bacteria | 34680 |
| 497 | Ga0495593_0068764 | 3300047673 | Bacteria | 1842 |
| 498 | Ga0495602_0042772 | 3300048088 | Bacteria | 4124 |
| 499 | Ga0495615_0009385 | 3300048090 | Bacteria | 1923 |
| 500 | Ga0495626_0000055 | 3300048091 | Bacteria | 154219 |
| 501 | Ga0495626_0000108 | 3300048091 | Bacteria | 108112 |
| 502 | Ga0495626_0000131 | 3300048091 | Bacteria | 94532 |
| 503 | Ga0495626_0000528 | 3300048091 | Bacteria | 38040 |
| 504 | Ga0495626_0005464 | 3300048091 | Bacteria | 7424 |
| 505 | Ga0495626_0007044 | 3300048091 | Bacteria | 6312 |
| 506 | Ga0496100_0004201 | 3300048903 | Bacteria | 7600 |
| 507 | Ga0496100_0073008 | 3300048903 | Bacteria | 2295 |
| 508 | Ga0496101_0002436 | 3300048904 | Bacteria | 11436 |
| 509 | Ga0496101_0043592 | 3300048904 | Bacteria | 3207 |
| 510 | Ga0496101_0123231 | 3300048904 | Bacteria | 1962 |
| 511 | Ga0496102_0000052 | 3300048905 | Bacteria | 177388 |
| 512 | Ga0496102_0014354 | 3300048905 | Bacteria | 6882 |
| 513 | Ga0496102_0106682 | 3300048905 | Bacteria | 2607 |
| 514 | Ga0496102_0234858 | 3300048905 | Bacteria | 1728 |
| 515 | Ga0496103_0000280 | 3300048906 | Bacteria | 48189 |
| 516 | Ga0496104_0025801 | 3300048907 | Bacteria | 5419 |
| 517 | Ga0496105_0001511 | 3300048908 | Bacteria | 16442 |
| 518 | Ga0496105_0061014 | 3300048908 | Bacteria | 3111 |
| 519 | Ga0496106_0050136 | 3300048909 | Bacteria | 3146 |
| 520 | Ga0496106_0063384 | 3300048909 | Bacteria | 2809 |
| 521 | Ga0496106_0311616 | 3300048909 | Bacteria | 1263 |
| 522 | Ga0496107_0003109 | 3300048910 | Bacteria | 11038 |
| 523 | Ga0496108_0007231 | 3300048911 | Bacteria | 8997 |
| 524 | Ga0496108_0136028 | 3300048911 | Bacteria | 2114 |
| 525 | Ga0496109_0001861 | 3300048912 | Bacteria | 17481 |
| 526 | Ga0496109_0083507 | 3300048912 | Bacteria | 2946 |
| 527 | Ga0496110_0002932 | 3300048913 | Bacteria | 12919 |
| 528 | Ga0496110_0004438 | 3300048913 | Bacteria | 10877 |
| 529 | Ga0496110_0026602 | 3300048913 | Bacteria | 4953 |
| 530 | Ga0496110_0196507 | 3300048913 | Bacteria | 1832 |
| 531 | Ga0496111_0006752 | 3300048914 | Bacteria | 7475 |
| 532 | Ga0496111_0036578 | 3300048914 | Bacteria | 3511 |
| 533 | Ga0496111_0079791 | 3300048914 | Bacteria | 2388 |
| 534 | Ga0496111_0122623 | 3300048914 | Bacteria | 1920 |
| 535 | Ga0496111_0130734 | 3300048914 | Bacteria | 1857 |
| 536 | Ga0496111_0205885 | 3300048914 | Bacteria | 1462 |
| 537 | Ga0496113_0081645 | 3300048916 | Bacteria | 2478 |
| 538 | Ga0496114_0001260 | 3300048917 | Bacteria | 19144 |
| 539 | Ga0496114_0001641 | 3300048917 | Bacteria | 16981 |
| 540 | Ga0496114_0014586 | 3300048917 | Bacteria | 6313 |
| 541 | Ga0496116_0000967 | 3300048919 | Bacteria | 35447 |
| 542 | Ga0496116_0002130 | 3300048919 | Bacteria | 21076 |
| 543 | Ga0496116_0009926 | 3300048919 | Bacteria | 8051 |
| 544 | Ga0496116_0085727 | 3300048919 | Bacteria | 1935 |
| 545 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 546 | Ga0496117_0000461 | 3300048920 | Bacteria | 68034 |
| 547 | Ga0496117_0000899 | 3300048920 | Bacteria | 45811 |
| 548 | Ga0496117_0001093 | 3300048920 | Bacteria | 40952 |
| 549 | Ga0496117_0006283 | 3300048920 | Bacteria | 12094 |
| 550 | Ga0496117_0013152 | 3300048920 | Bacteria | 7239 |
| 551 | Ga0496117_0014630 | 3300048920 | Bacteria | 6749 |
| 552 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 553 | Ga0496118_0000106 | 3300048921 | Bacteria | 155884 |
| 554 | Ga0496118_0001115 | 3300048921 | Bacteria | 41665 |
| 555 | Ga0496118_0015072 | 3300048921 | Bacteria | 7184 |
| 556 | Ga0496118_0034595 | 3300048921 | Bacteria | 4118 |
| 557 | Ga0496121_0000149 | 3300048924 | Bacteria | 153667 |
| 558 | Ga0496121_0002573 | 3300048924 | Bacteria | 27446 |
| 559 | Ga0496121_0005330 | 3300048924 | Bacteria | 16532 |
| 560 | Ga0496121_0014302 | 3300048924 | Bacteria | 8438 |
| 561 | Ga0496121_0036119 | 3300048924 | Bacteria | 4409 |
| 562 | Ga0496122_0000388 | 3300048925 | Bacteria | 93611 |
| 563 | Ga0496122_0001880 | 3300048925 | Bacteria | 31877 |
| 564 | Ga0496122_0002387 | 3300048925 | Bacteria | 26853 |
| 565 | Ga0496122_0004618 | 3300048925 | Bacteria | 16944 |
| 566 | Ga0496122_0014388 | 3300048925 | Bacteria | 7655 |
| 567 | Ga0496122_0143839 | 3300048925 | Bacteria | 1486 |
| 568 | Ga0496123_0001620 | 3300048926 | Bacteria | 30319 |
| 569 | Ga0496123_0003435 | 3300048926 | Bacteria | 17791 |
| 570 | Ga0496123_0005379 | 3300048926 | Bacteria | 12908 |
| 571 | Ga0496123_0007862 | 3300048926 | Bacteria | 9913 |
| 572 | Ga0496123_0026816 | 3300048926 | Bacteria | 4307 |
| 573 | Ga0496124_0003407 | 3300048927 | Bacteria | 19513 |
| 574 | Ga0496124_0011349 | 3300048927 | Bacteria | 8908 |
| 575 | Ga0496124_0025613 | 3300048927 | Bacteria | 5340 |
| 576 | Ga0496124_0032274 | 3300048927 | Bacteria | 4625 |
| 577 | Ga0496124_0040537 | 3300048927 | Bacteria | 4026 |
| 578 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 579 | Ga0496125_0001343 | 3300048928 | Bacteria | 36244 |
| 580 | Ga0496125_0002932 | 3300048928 | Bacteria | 21477 |
| 581 | Ga0496125_0007570 | 3300048928 | Bacteria | 11532 |
| 582 | Ga0496125_0008277 | 3300048928 | Bacteria | 10920 |
| 583 | Ga0496125_0010628 | 3300048928 | Bacteria | 9294 |
| 584 | Ga0496125_0024083 | 3300048928 | Bacteria | 5605 |
| 585 | Ga0496125_0075969 | 3300048928 | Bacteria | 2596 |
| 586 | Ga0496125_0087409 | 3300048928 | Bacteria | 2354 |
| 587 | Ga0496125_0125215 | 3300048928 | Bacteria | 1823 |
| 588 | Ga0496125_0160935 | 3300048928 | Bacteria | 1525 |
| 589 | Ga0496126_0044237 | 3300048929 | Bacteria | 4102 |
| 590 | Ga0496126_0071812 | 3300048929 | Bacteria | 3080 |
| 591 | Ga0495678_002327 | 3300049459 | Bacteria | 13086 |
| 592 | Ga0495678_006098 | 3300049459 | Bacteria | 6483 |
| 593 | Ga0495678_009347 | 3300049459 | Bacteria | 4857 |
| 594 | Ga0495678_025061 | 3300049459 | Bacteria | 2566 |
| 595 | Ga0495678_037450 | 3300049459 | Bacteria | 1970 |
| 596 | Ga0495678_060134 | 3300049459 | Bacteria | 1430 |
| 597 | Ga0495682_0043250 | 3300049460 | Bacteria | 1649 |
| 598 | Ga0501031_0004484 | 3300049568 | Bacteria | 9057 |
| 599 | Ga0501032_0051988 | 3300049569 | Bacteria | 2761 |
| 600 | Ga0501033_0000203 | 3300049570 | Bacteria | 56963 |
| 601 | Ga0501034_0000055 | 3300049571 | Bacteria | 205427 |
| 602 | Ga0501034_0000199 | 3300049571 | Bacteria | 113624 |
| 603 | Ga0501034_0115763 | 3300049571 | Bacteria | 2669 |
| 604 | Ga0501036_0004256 | 3300049572 | Bacteria | 11545 |
| 605 | Ga0501037_0018830 | 3300049573 | Bacteria | 5087 |
| 606 | Ga0501038_0155506 | 3300049574 | Bacteria | 1862 |
| 607 | Ga0501039_0003555 | 3300049575 | Bacteria | 11678 |
| 608 | Ga0501040_0001416 | 3300049576 | Bacteria | 15172 |
| 609 | Ga0501040_0006631 | 3300049576 | Bacteria | 7514 |
| 610 | Ga0501041_0003671 | 3300049577 | Bacteria | 8827 |
| 611 | Ga0501041_0007438 | 3300049577 | Bacteria | 6433 |
| 612 | Ga0501042_0022030 | 3300049578 | Bacteria | 4448 |
| 613 | Ga0501042_0022537 | 3300049578 | Bacteria | 4399 |
| 614 | Ga0501042_0056212 | 3300049578 | Bacteria | 2808 |
| 615 | Ga0501046_0073243 | 3300049580 | Bacteria | 2658 |
| 616 | Ga0501047_0039298 | 3300049581 | Bacteria | 4577 |
| 617 | Ga0501048_0010542 | 3300049582 | Bacteria | 6896 |
| 618 | Ga0501048_0082309 | 3300049582 | Bacteria | 2270 |
| 619 | Ga0501048_0094169 | 3300049582 | Bacteria | 2113 |
| 620 | Ga0501048_0105150 | 3300049582 | Bacteria | 1992 |
| 621 | Ga0501068_0012250 | 3300049584 | Bacteria | 4852 |
| 622 | Ga0501069_0092999 | 3300049585 | Bacteria | 1706 |
| 623 | Ga0501071_0003577 | 3300049587 | Bacteria | 9728 |
| 624 | Ga0501072_0006753 | 3300049588 | Bacteria | 8717 |
| 625 | Ga0501072_0138757 | 3300049588 | Bacteria | 1938 |
| 626 | Ga0501073_0030972 | 3300049589 | Bacteria | 3819 |
| 627 | Ga0501074_0100962 | 3300049590 | Bacteria | 2065 |
| 628 | Ga0501075_0073844 | 3300049591 | Bacteria | 2579 |
| 629 | Ga0501076_0011201 | 3300049592 | Bacteria | 6675 |
| 630 | Ga0501077_0054662 | 3300049593 | Bacteria | 2535 |
| 631 | Ga0501249_001162 | 3300049679 | Bacteria | 5546 |
| 632 | Ga0501079_0010695 | 3300049741 | Bacteria | 6988 |
| 633 | Ga0501080_0022496 | 3300049742 | Bacteria | 5839 |
| 634 | Ga0501080_0106113 | 3300049742 | Bacteria | 2604 |
| 635 | Ga0501081_0027629 | 3300049743 | Bacteria | 3826 |
| 636 | Ga0501269_000225 | 3300049766 | Bacteria | 16532 |
| 637 | Ga0501035_0001175 | 3300049822 | Bacteria | 27278 |
| 638 | Ga0501035_0057824 | 3300049822 | Bacteria | 3457 |
| 639 | Ga0501035_0070964 | 3300049822 | Bacteria | 3084 |
| 640 | Ga0501044_0074141 | 3300049823 | Bacteria | 3458 |
| 641 | Ga0501045_0001996 | 3300049824 | Bacteria | 13779 |
| 642 | Ga0501045_0031066 | 3300049824 | Bacteria | 3868 |
| 643 | Ga0501045_0099069 | 3300049824 | Bacteria | 2156 |
| 644 | Ga0501045_0119254 | 3300049824 | Bacteria | 1959 |
| 645 | nmdc:mga07m45_123839_c1 | 3300050496 | Bacteria | 1494 |
| 646 | nmdc:mga07m45_20588_c1 | 3300050496 | Bacteria | 3584 |
| 647 | nmdc:mga05p37_15187_c1 | 3300050507 | Bacteria | 9247 |
| 648 | nmdc:mga05p37_15247_c1 | 3300050507 | Bacteria | 9232 |
| 649 | nmdc:mga09592_239_c1 | 3300050508 | Bacteria | 39950 |
| 650 | nmdc:mga09592_4172_c1 | 3300050508 | Bacteria | 11672 |
| 651 | nmdc:mga0qj67_26496_c1 | 3300050509 | Bacteria | 4488 |
| 652 | nmdc:mga0qj67_784_c1 | 3300050509 | Bacteria | 21653 |
| 653 | nmdc:mga06r32_167_c1 | 3300050510 | Bacteria | 51343 |
| 654 | nmdc:mga06r32_186242_c1 | 3300050510 | Bacteria | 2063 |
| 655 | nmdc:mga08y16_18876_c1 | 3300050511 | Bacteria | 7264 |
| 656 | nmdc:mga0a205_44114_c1 | 3300050515 | Bacteria | 4298 |
| 657 | nmdc:mga0sz30_24229_c1 | 3300050516 | Bacteria | 2475 |
| 658 | Ga0500594_0002266 | 3300053118 | Bacteria | 4167 |
| 659 | Ga0500618_000737 | 3300053125 | Bacteria | 18686 |
| 660 | Ga0500659_0000704 | 3300053135 | Bacteria | 21594 |
| 661 | Ga0500586_000366 | 3300053145 | Bacteria | 8990 |
| 662 | Ga0501084_0011649 | 3300054114 | Bacteria | 7280 |
| 663 | Ga0501082_0005855 | 3300060353 | Bacteria | 10674 |
| 664 | Ga0501082_0023752 | 3300060353 | Bacteria | 5286 |
| 665 | Ga0530510_0004711 | 3300061734 | Bacteria | 9435 |
| 666 | Ga0530510_0032672 | 3300061734 | Bacteria | 3745 |
| 667 | 2501075564 | 2501025501 | Bacteria | 7768574 |
| 668 | 2501084000 | 2501025502 | Bacteria | 9641094 |
| 669 | 2501412687 | 2501025504 | Bacteria | 8008976 |
| 670 | 2511093445 | 2510917013 | Bacteria | 9951648 |
| 671 | 2511099894 | 2510917014 | Bacteria | 8296963 |
| 672 | 2511102321 | 2510917015 | Bacteria | 7950052 |
| 673 | 2511265901 | 2511231006 | Bacteria | 6794709 |
| 674 | 2511277462 | 2511231008 | Bacteria | 6624100 |
| 675 | 2511300268 | 2511231012 | Bacteria | 6738011 |
| 676 | 2511322618 | 2511231015 | Bacteria | 6598026 |
| 677 | 2511334577 | 2511231017 | Bacteria | 6503007 |
| 678 | 2511336412 | 2511231018 | Bacteria | 6436256 |
| 679 | 2511343308 | 2511231019 | Bacteria | 6520662 |
| 680 | 2511354793 | 2511231021 | Bacteria | 7302637 |
| 681 | 2511367945 | 2511231023 | Bacteria | 6808468 |
| 682 | 2511376223 | 2511231024 | Bacteria | 5835885 |
| 683 | 2512323788 | 2512047018 | Bacteria | 6663241 |
| 684 | 2513557943 | 2513237082 | Bacteria | 8640282 |
| 685 | 2513565563 | 2513237083 | Bacteria | 8410967 |
| 686 | 2513955389 | 2513237150 | Bacteria | 6553639 |
| 687 | 2516024958 | 2515154189 | Bacteria | 9629850 |
| 688 | 2552747291 | 2551306352 | Bacteria | 3873115 |
| 689 | 2555670106 | 2554235341 | Bacteria | 6867980 |
| 690 | 2566993837 | 2565956761 | Bacteria | 6601618 |
| 691 | 2574431526 | 2574179768 | Bacteria | 4907129 |
| 692 | 2583791955 | 2582580891 | Bacteria | 6800976 |
| 693 | 2597858014 | 2597489887 | Bacteria | 6666321 |
| 694 | 2599352860 | 2599185160 | Bacteria | 6844013 |
| 695 | 2599359205 | 2599185161 | Bacteria | 6960462 |
| 696 | 2599365274 | 2599185162 | Bacteria | 6957254 |
| 697 | 2599371899 | 2599185163 | Bacteria | 6995158 |
| 698 | 2599377968 | 2599185164 | Bacteria | 6841688 |
| 699 | 2599384655 | 2599185165 | Bacteria | 6843250 |
| 700 | 2599390757 | 2599185166 | Bacteria | 6959206 |
| 701 | 2599402942 | 2599185168 | Bacteria | 6997636 |
| 702 | 2599459694 | 2599185181 | Bacteria | 6844519 |
| 703 | 2599465967 | 2599185182 | Bacteria | 6883168 |
| 704 | 2599485045 | 2599185185 | Bacteria | 6652270 |
| 705 | 2599488715 | 2599185186 | Bacteria | 6831633 |
| 706 | 2600212299 | 2599185356 | Bacteria | 6843884 |
| 707 | 2600366585 | 2600254931 | Bacteria | 6734225 |
| 708 | 2601670441 | 2600255292 | Bacteria | 6300551 |
| 709 | 2601772467 | 2600255313 | Bacteria | 6842543 |
| 710 | 2640733706 | 2639762793 | Bacteria | 3943681 |
| 711 | 2643843865 | 2643221565 | Bacteria | 6216018 |
| 712 | 2643851396 | 2643221567 | Bacteria | 4163945 |
| 713 | 2643953167 | 2643221589 | Bacteria | 6250934 |
| 714 | 2644025164 | 2643221602 | Bacteria | 6249926 |
| 715 | 2644138013 | 2643221624 | Bacteria | 4384879 |
| 716 | 2644230438 | 2643221641 | Bacteria | 4490190 |
| 717 | 2671095563 | 2667528171 | Bacteria | 6900659 |
| 718 | 2678230721 | 2675903507 | Bacteria | 3737791 |
| 719 | 2723879542 | 2721755763 | Bacteria | 4464185 |
| 720 | 2739362815 | 2738543034 | Bacteria | 6084756 |
| 721 | 2743737480 | 2740892503 | Bacteria | 6855563 |
| 722 | 2746087356 | 2744054900 | Bacteria | 8399525 |
| 723 | 2746093137 | 2744054901 | Bacteria | 8397047 |
| 724 | 2765584036 | 2765235841 | Bacteria | 6137024 |
| 725 | 2774119984 | 2773857670 | Bacteria | 6407454 |
| 726 | 2774388758 | 2773857761 | Bacteria | 3837365 |
| 727 | 2774438616 | 2773857770 | Bacteria | 3911866 |
| 728 | 2784312085 | 2784132072 | Bacteria | 6596533 |
| 729 | 2807408496 | 2806310737 | Bacteria | 5751088 |
| 730 | 2807456811 | 2806310745 | Bacteria | 5742165 |
| 731 | 2808872791 | 2808606365 | Bacteria | 4301966 |
| 732 | 2808959375 | 2808606382 | Bacteria | 6841132 |
| 733 | 2808973012 | 2808606384 | Bacteria | 8474373 |
| 734 | 2809007822 | 2808606390 | Bacteria | 8476311 |
| 735 | 2809016529 | 2808606391 | Bacteria | 8308166 |
| 736 | 2812367075 | 2811994881 | Bacteria | 6298475 |
| 737 | 2819667740 | 2818991458 | Bacteria | 4794049 |
| 738 | 2819700958 | 2818991464 | Bacteria | 6907494 |
| 739 | 2840881676 | 2840878972 | Bacteria | 5483153 |
| 740 | 2842712045 | 2842711865 | Bacteria | 7155354 |
| 741 | 2844670726 | 2844665904 | Bacteria | 6817974 |
| 742 | 2852617669 | 2852612431 | Bacteria | 6885235 |
| 743 | 2852672967 | 2852667396 | Bacteria | 6885555 |
| 744 | 2857548218 | 2857547612 | Bacteria | 6179999 |
| 745 | 2857566017 | 2857564685 | Bacteria | 6290584 |
| 746 | 2883094889 | 2883087390 | Bacteria | 9532701 |
| 747 | 2885085214 | 2885080285 | Bacteria | 6355622 |
| 748 | 2904536927 | 2904535858 | Bacteria | 6308016 |
| 749 | 2904768221 | 2904765812 | Bacteria | 5369154 |
| 750 | 2904770237 | 2904765812 | Bacteria | 5369154 |
| 751 | 2904775455 | 2904770941 | Bacteria | 5580202 |
| 752 | 2908815521 | 2908811453 | Bacteria | 5478616 |
| 753 | 2912966680 | 2912963787 | Bacteria | 5646108 |
| 754 | 2917073929 | 2917070673 | Bacteria | 6868303 |
| 755 | 2919183611 | 2919182534 | Bacteria | 3907101 |
| 756 | 2919423358 | 2919420072 | Bacteria | 5390363 |
| 757 | 2919435966 | 2919432681 | Bacteria | 5390474 |
| 758 | 2919449109 | 2919446982 | Bacteria | 3994487 |
| 759 | 2919461544 | 2919456309 | Bacteria | 6586567 |
| 760 | 2922555350 | 2922554459 | Bacteria | 6683962 |
| 761 | 2923156521 | 2923153595 | Bacteria | 6870622 |
| 762 | 2923521114 | 2923519811 | Bacteria | 6298479 |
| 763 | 2932412813 | 2932410948 | Bacteria | 6312192 |
| 764 | 2932420328 | 2932416698 | Bacteria | 6315112 |
| 765 | 2935357016 | 2935353572 | Unclassified | 6955622 |
| 766 | 2939642388 | 2939636861 | Bacteria | 6297853 |
| 767 | 2939651636 | 2939651529 | Bacteria | 5895393 |
| 768 | 2945962807 | 2945961074 | Bacteria | 7342064 |
| 769 | 3007395905 | 3007395558 | Bacteria | 6755444 |
| 770 | 3007623231 | 3007619802 | Bacteria | 6411688 |
| 771 | 3007804907 | 3007803356 | Bacteria | 5931491 |
| 772 | 637320471 | 637000220 | Bacteria | 7074893 |
| 773 | 644751631 | 644736347 | Bacteria | 6476522 |
| 774 | 8002746239 | 8002745576 | Bacteria | 4840272 |
| 775 | 8003961952 | 8003955200 | Bacteria | 8601927 |
| 776 | 8011352261 | 8011350971 | Bacteria | 6158957 |
| 777 | 8015690715 | 8015687852 | Bacteria | 6613826 |
| 778 | 8052497326 | 8052494512 | Bacteria | 5765634 |
| 779 | 8055773850 | 8055770955 | Bacteria | 6827675 |
| 780 | 8055880386 | 8055878733 | Bacteria | 5907058 |
| 781 | 8055883728 | 8055878733 | Bacteria | 5907058 |
| 782 | 8056123297 | 8056120720 | Bacteria | 5758328 |
| 783 | 8056181424 | 8056177738 | Bacteria | 6748268 |
| 784 | Ga0207428_10123741 | |||
| 785 | MRS2a_Contig_7291 | |||
| 786 | MRS2a_Contig_9136 | |||
| 787 | SwRhRL2b_contig_2780838 | |||
| 788 | JGI24739J22299_10028397 | |||
| 789 | JGI24735J21928_10000368 | |||
| 790 | JGI24735J21928_10001145 | |||
| 791 | Ga0055525_1000009 | |||
| 792 | Ga0055542_1009065 | |||
| 793 | Ga0055526_1008543 | |||
| 794 | Ga0055526_1012329 | |||
| 795 | Ga0055524_1000402 | |||
| 796 | Ga0055536_1000014 | |||
| 797 | Ga0055536_1000158 | |||
| 798 | Ga0055534_1005186 | |||
| 799 | Ga0055530_10000009 | |||
| 800 | Ga0055540_1000342 | |||
| 801 | Ga0058692_1000010 | |||
| 802 | JGI25405J52794_10006845 | |||
| 803 | Ga0065703_1000063 | |||
| 804 | Ga0065714_10008515 | |||
| 805 | Ga0065704_10002892 | |||
| 806 | Ga0065704_10074925 | |||
| 807 | Ga0065704_10107275 | |||
| 808 | Ga0070658_10006576 | |||
| 809 | Ga0070658_10013426 | |||
| 810 | Ga0070660_100001047 | |||
| 811 | Ga0070669_100030253 | |||
| 812 | Ga0070675_100256677 | |||
| 813 | Ga0070663_100050937 | |||
| 814 | Ga0070678_100101253 | |||
| 815 | Ga0068855_100003256 | |||
| 816 | Ga0068855_100011429 | |||
| 817 | Ga0068856_100228432 | |||
| 818 | Ga0081455_10001059 | |||
| 819 | Ga0081455_10017164 | |||
| 820 | Ga0081538_10003479 | |||
| 821 | Ga0081538_10062383 | |||
| 822 | Ga0075369_10035244 | |||
| 823 | Ga0075428_100009062 | |||
| 824 | Ga0075430_100009064 | |||
| 825 | Ga0075430_100018249 | |||
| 826 | Ga0075431_100003419 | |||
| 827 | Ga0075431_100020307 | |||
| 828 | Ga0075431_100088100 | |||
| 829 | Ga0075434_100199804 | |||
| 830 | Ga0075429_100000338 | |||
| 831 | Ga0075429_100075999 | |||
| 832 | Ga0099823_1000004 | |||
| 833 | Ga0079104_1000097 | |||
| 834 | Ga0105251_10004006 | |||
| 835 | Ga0105251_10011394 | |||
| 836 | Ga0105251_10050694 | |||
| 837 | Ga0105244_10000053 | |||
| 838 | Ga0105244_10000449 | |||
| 839 | Ga0105244_10001624 | |||
| 840 | Ga0105244_10022330 | |||
| 841 | Ga0105250_10000092 | |||
| 842 | Ga0105250_10000131 | |||
| 843 | Ga0111539_10026704 | |||
| 844 | Ga0111539_10228621 | |||
| 845 | Ga0105245_10097184 | |||
| 846 | Ga0105247_10000472 | |||
| 847 | Ga0114129_10030167 | |||
| 848 | Ga0114129_10038538 | |||
| 849 | Ga0105243_10038876 | |||
| 850 | Ga0105243_10084794 | |||
| 851 | Ga0105248_10015699 | |||
| 852 | Ga0105237_10207881 | |||
| 853 | Ga0105239_10005327 | |||
| 854 | Ga0105246_10001375 | |||
| 855 | Ga0157373_10062294 | |||
| 856 | Ga0157371_10001313 | |||
| 857 | Ga0157371_10003361 | |||
| 858 | Ga0157371_10029236 | |||
| 859 | Ga0157370_10003861 | |||
| 860 | Ga0157370_10053744 | |||
| 861 | Ga0157369_10001578 | |||
| 862 | Ga0157369_10188651 | |||
| 863 | Ga0157374_10000146 | |||
| 864 | Ga0163162_10004400 | |||
| 865 | Ga0163162_10011171 | |||
| 866 | Ga0163162_10243166 | |||
| 867 | Ga0157372_10003027 | |||
| 868 | Ga0157375_10003051 | |||
| 869 | Ga0157375_10187362 | |||
| 870 | Ga0182008_10000862 | |||
| 871 | Ga0182008_10011205 | |||
| 872 | Ga0182008_10012491 | |||
| 873 | Ga0182008_10085737 | |||
| 874 | Ga0182006_1000010 | |||
| 875 | Ga0182006_1008045 | |||
| 876 | Ga0182006_1010339 | |||
| 877 | Ga0182007_10000030 | |||
| 878 | Ga0182007_10011317 | |||
| 879 | Ga0182007_10018956 | |||
| 880 | Ga0182005_1000009 | |||
| 881 | Ga0182005_1009614 | |||
| 882 | Ga0163161_10041020 | |||
| 883 | Ga0163161_10045708 | |||
| 884 | Ga0213872_10000135 | |||
| 885 | Ga0224712_10000073 | |||
| 886 | Ga0209672_101017 | |||
| 887 | Ga0209563_100015 | |||
| 888 | Ga0209148_1000794 | |||
| 889 | Ga0209565_1000104 | |||
| 890 | Ga0209675_1000065 | |||
| 891 | Ga0209676_1000003 | |||
| 892 | Ga0209676_1000044 | |||
| 893 | Ga0209676_1000535 | |||
| 894 | Ga0209676_1002148 | |||
| 895 | Ga0209025_1000147 | |||
| 896 | Ga0209025_1007698 | |||
| 897 | Ga0209564_1000006 | |||
| 898 | Ga0209564_1000080 | |||
| 899 | Ga0209564_1000253 | |||
| 900 | Ga0209564_1000923 | |||
| 901 | Ga0209758_1010657 | |||
| 902 | Ga0209050_1000004 | |||
| 903 | Ga0209050_1000148 | |||
| 904 | Ga0209256_1000543 | |||
| 905 | Ga0207426_1003874 | |||
| 906 | Ga0209051_1000006 | |||
| 907 | Ga0209051_1015660 | |||
| 908 | Ga0207696_1000006 | |||
| 909 | Ga0207696_1000160 | |||
| 910 | Ga0207696_1000225 | |||
| 911 | Ga0207696_1008385 | |||
| 912 | Ga0207655_1000049 | |||
| 913 | Ga0207655_1000070 | |||
| 914 | Ga0207655_1000077 | |||
| 915 | Ga0207655_1000112 | |||
| 916 | Ga0207655_1000181 | |||
| 917 | Ga0207655_1005043 | |||
| 918 | Ga0207713_1000113 | |||
| 919 | Ga0207713_1000232 | |||
| 920 | Ga0207713_1000725 | |||
| 921 | Ga0207713_1002997 | |||
| 922 | Ga0207713_1006136 | |||
| 923 | Ga0207713_1006407 | |||
| 924 | Ga0207713_1010896 | |||
| 925 | Ga0207713_1013933 | |||
| 926 | Ga0207713_1014084 | |||
| 927 | Ga0207713_1032743 | |||
| 928 | Ga0207710_10000009 | |||
| 929 | Ga0207647_10001767 | |||
| 930 | Ga0207705_10000783 | |||
| 931 | Ga0207705_10002884 | |||
| 932 | Ga0207705_10014878 | |||
| 933 | Ga0207657_10009942 | |||
| 934 | Ga0207659_10196664 | |||
| 935 | Ga0207687_10053315 | |||
| 936 | Ga0207709_10000001 | |||
| 937 | Ga0207709_10078020 | |||
| 938 | Ga0207711_10005662 | |||
| 939 | Ga0207667_10004017 | |||
| 940 | Ga0207667_10014081 | |||
| 941 | Ga0207667_10021335 | |||
| 942 | Ga0207651_10214103 | |||
| 943 | Ga0207639_10014191 | |||
| 944 | Ga0207674_10093515 | |||
| 945 | Ga0207683_10128645 | |||
| 946 | Ga0207698_10046047 | |||
| 947 | Ga0209281_1000136 | |||
| 948 | Ga0209389_1000006 | |||
| 949 | Ga0209371_1000006 | |||
| 950 | Ga0207428_10051686 | |||
| 951 | Ga0265337_1007535 | |||
| 952 | Ga0265334_10007864 | |||
| 953 | Ga0307515_10073804 | |||
| 954 | Ga0265338_10000547 | |||
| 955 | Ga0265324_10013494 | |||
| 956 | Ga0268256_1000007 | |||
| 957 | Ga0265316_10018300 | |||
| 958 | Ga0307508_10112036 | |||
| 959 | Ga0265314_10012712 | |||
| 960 | Ga0265314_10061899 | |||
| 961 | Ga0307405_10056265 | |||
| 962 | Ga0307405_10069783 | |||
| 963 | Ga0307410_10021181 | |||
| 964 | Ga0307406_10014342 | |||
| 965 | Ga0307407_10020070 | |||
| 966 | Ga0307407_10022645 | |||
| 967 | Ga0307409_100001597 | |||
| 968 | Ga0307409_100014810 | |||
| 969 | Ga0307414_10117626 | |||
| 970 | Ga0307415_100001340 | |||
| 971 | Ga0307415_100071213 | |||
| 972 | Ga0316584_0104374 | |||
| 973 | Ga0395899_0000080 | |||
| 974 | Ga0395899_0002023 | |||
| 975 | Ga0395899_0004044 | |||
| 976 | Ga0395899_0058667 | |||
| 977 | Ga0395900_0000087 | |||
| 978 | Ga0395900_0000411 | |||
| 979 | Ga0395900_0000615 | |||
| 980 | Ga0395900_0003488 | |||
| 981 | Ga0395900_0031034 | |||
| 982 | Ga0395898_0000679 | |||
| 983 | Ga0395898_0002992 | |||
| 984 | Ga0395898_0037443 | |||
| 985 | Ga0395898_0072984 | |||
| 986 | Ga0395898_0216905 | |||
| 987 | Ga0395905_0024855 | |||
| 988 | Ga0395901_0000053 | |||
| 989 | Ga0395901_0000084 | |||
| 990 | Ga0395901_0000328 | |||
| 991 | Ga0395901_0012510 | |||
| 992 | Ga0395901_0100538 | |||
| 993 | Ga0395901_0219019 | |||
| 994 | Ga0436360_0818816 | |||
| 995 | Ga0436361_0080101 | |||
| 996 | Ga0436361_0115159 | |||
| 997 | Ga0436361_0400312 | |||
| 998 | Ga0436361_0402857 | |||
| 999 | Ga0439436_0000475 | |||
| 1000 | Ga0439438_003774 | |||
| 1001 | Ga0439438_011913 | |||
| 1002 | Ga0439447_000206 | |||
| 1003 | Ga0439466_0000216 | |||
| 1004 | Ga0439466_0002842 | |||
| 1005 | Ga0451791_0311755 | |||
| 1006 | Ga0451800_0068730 | |||
| 1007 | Ga0451841_0238766 | |||
| 1008 | Ga0451853_1144978 | |||
| 1009 | Ga0439448_0034629 | |||
| 1010 | Ga0439432_000972 | |||
| 1011 | Ga0439449_0047827 | |||
| 1012 | Ga0439452_000779 | |||
| 1013 | Ga0439456_004376 | |||
| 1014 | Ga0439463_000483 | |||
| 1015 | Ga0450911_003292 | |||
| 1016 | Ga0450922_000045 | |||
| 1017 | Ga0450923_000523 | |||
| 1018 | Ga0450902_000306 | |||
| 1019 | Ga0450904_000071 | |||
| 1020 | Ga0439434_0000751 | |||
| 1021 | Ga0450901_000131 | |||
| 1022 | Ga0450901_002693 | |||
| 1023 | Ga0451577_0008240 | |||
| 1024 | Ga0466977_0002989 | |||
| 1025 | Ga0466966_0093253 | |||
| 1026 | Ga0466966_0145050 | |||
| 1027 | Ga0466961_0006286 | |||
| 1028 | Ga0453684_0048355 | |||
| 1029 | Ga0466957_0107909 | |||
| 1030 | Ga0466960_0101755 | |||
| 1031 | Ga0466959_0082393 | |||
| 1032 | Ga0466959_0087964 | |||
| 1033 | Ga0466967_0016544 | |||
| 1034 | Ga0466967_0072157 | |||
| 1035 | Ga0495617_001890 | |||
| 1036 | Ga0495617_004841 | |||
| 1037 | Ga0495627_000140 | |||
| 1038 | Ga0495627_001874 | |||
| 1039 | Ga0495627_004057 | |||
| 1040 | Ga0495627_018629 | |||
| 1041 | Ga0495603_0024431 | |||
| 1042 | Ga0495603_0045056 | |||
| 1043 | Ga0495590_0001454 | |||
| 1044 | Ga0495590_0015099 | |||
| 1045 | Ga0495590_0019709 | |||
| 1046 | Ga0495591_000026 | |||
| 1047 | Ga0495591_002234 | |||
| 1048 | Ga0495591_009858 | |||
| 1049 | Ga0495591_016944 | |||
| 1050 | Ga0495591_019100 | |||
| 1051 | Ga0495591_020905 | |||
| 1052 | Ga0495638_0000254 | |||
| 1053 | Ga0495638_0000449 | |||
| 1054 | Ga0495638_0003379 | |||
| 1055 | Ga0495638_0006753 | |||
| 1056 | Ga0495638_0047877 | |||
| 1057 | Ga0495638_0071549 | |||
| 1058 | Ga0495653_0000097 | |||
| 1059 | Ga0495653_0043914 | |||
| 1060 | Ga0495650_0000232 | |||
| 1061 | Ga0495650_0001039 | |||
| 1062 | Ga0495650_0007237 | |||
| 1063 | Ga0495650_0007549 | |||
| 1064 | Ga0495650_0015560 | |||
| 1065 | Ga0495605_0000170 | |||
| 1066 | Ga0495605_0000257 | |||
| 1067 | Ga0495605_0000913 | |||
| 1068 | Ga0495605_0001525 | |||
| 1069 | Ga0495605_0003624 | |||
| 1070 | Ga0495605_0004025 | |||
| 1071 | Ga0495605_0004580 | |||
| 1072 | Ga0495605_0005917 | |||
| 1073 | Ga0495664_0031354 | |||
| 1074 | Ga0495664_0049656 | |||
| 1075 | Ga0495584_0000128 | |||
| 1076 | Ga0495584_0004140 | |||
| 1077 | Ga0495584_0011954 | |||
| 1078 | Ga0495585_0000045 | |||
| 1079 | Ga0495585_0000234 | |||
| 1080 | Ga0495585_0001405 | |||
| 1081 | Ga0495585_0001866 | |||
| 1082 | Ga0495585_0007038 | |||
| 1083 | Ga0495585_0008186 | |||
| 1084 | Ga0495594_0004074 | |||
| 1085 | Ga0495594_0009901 | |||
| 1086 | Ga0495596_0000003 | |||
| 1087 | Ga0495607_0000138 | |||
| 1088 | Ga0495607_0000249 | |||
| 1089 | Ga0495607_0000546 | |||
| 1090 | Ga0495607_0002728 | |||
| 1091 | Ga0495607_0019654 | |||
| 1092 | Ga0495607_0051455 | |||
| 1093 | Ga0495607_0053202 | |||
| 1094 | Ga0495583_0002141 | |||
| 1095 | Ga0495583_0003704 | |||
| 1096 | Ga0495606_0000162 | |||
| 1097 | Ga0495606_0000280 | |||
| 1098 | Ga0495606_0000806 | |||
| 1099 | Ga0495606_0000965 | |||
| 1100 | Ga0495606_0001256 | |||
| 1101 | Ga0495606_0003849 | |||
| 1102 | Ga0495606_0003983 | |||
| 1103 | Ga0495606_0008139 | |||
| 1104 | Ga0495606_0009499 | |||
| 1105 | Ga0495606_0010074 | |||
| 1106 | Ga0495606_0060287 | |||
| 1107 | Ga0495610_0001518 | |||
| 1108 | Ga0495610_0003134 | |||
| 1109 | Ga0495610_0006069 | |||
| 1110 | Ga0495610_0006890 | |||
| 1111 | Ga0495610_0010386 | |||
| 1112 | Ga0495610_0022321 | |||
| 1113 | Ga0495616_0025078 | |||
| 1114 | Ga0495616_0064280 | |||
| 1115 | Ga0495620_0000006 | |||
| 1116 | Ga0495620_0002243 | |||
| 1117 | Ga0495620_0002910 | |||
| 1118 | Ga0495620_0024697 | |||
| 1119 | Ga0495628_0000037 | |||
| 1120 | Ga0495628_0009630 | |||
| 1121 | Ga0495630_0009539 | |||
| 1122 | Ga0495631_0000104 | |||
| 1123 | Ga0495631_0001094 | |||
| 1124 | Ga0495631_0040443 | |||
| 1125 | Ga0495632_0000395 | |||
| 1126 | Ga0495632_0000448 | |||
| 1127 | Ga0495632_0001386 | |||
| 1128 | Ga0495632_0003627 | |||
| 1129 | Ga0495632_0045687 | |||
| 1130 | Ga0495632_0065205 | |||
| 1131 | Ga0495637_0000853 | |||
| 1132 | Ga0495637_0001188 | |||
| 1133 | Ga0495637_0007800 | |||
| 1134 | Ga0495637_0013290 | |||
| 1135 | Ga0495637_0020686 | |||
| 1136 | Ga0495637_0039547 | |||
| 1137 | Ga0495643_0000029 | |||
| 1138 | Ga0495643_0000143 | |||
| 1139 | Ga0495643_0000804 | |||
| 1140 | Ga0495643_0009690 | |||
| 1141 | Ga0495643_0024614 | |||
| 1142 | Ga0495643_0046420 | |||
| 1143 | Ga0495643_0058379 | |||
| 1144 | Ga0495644_0000170 | |||
| 1145 | Ga0495648_0000126 | |||
| 1146 | Ga0495648_0000259 | |||
| 1147 | Ga0495648_0003659 | |||
| 1148 | Ga0495648_0005205 | |||
| 1149 | Ga0495648_0008347 | |||
| 1150 | Ga0495648_0059505 | |||
| 1151 | Ga0495666_0000069 | |||
| 1152 | Ga0495666_0003413 | |||
| 1153 | Ga0495666_0008984 | |||
| 1154 | Ga0495642_0000015 | |||
| 1155 | Ga0495642_0004518 | |||
| 1156 | Ga0495654_0001371 | |||
| 1157 | Ga0495654_0003483 | |||
| 1158 | Ga0495654_0014730 | |||
| 1159 | Ga0495654_0016873 | |||
| 1160 | Ga0495654_0017264 | |||
| 1161 | Ga0495654_0018600 | |||
| 1162 | Ga0495654_0058287 | |||
| 1163 | Ga0495654_0061108 | |||
| 1164 | Ga0495587_0001099 | |||
| 1165 | Ga0495609_0000634 | |||
| 1166 | Ga0495609_0005172 | |||
| 1167 | Ga0495609_0060147 | |||
| 1168 | Ga0495597_0000193 | |||
| 1169 | Ga0495597_0000253 | |||
| 1170 | Ga0495597_0000644 | |||
| 1171 | Ga0495597_0040184 | |||
| 1172 | Ga0495597_0046053 | |||
| 1173 | Ga0495597_0083892 | |||
| 1174 | Ga0495645_0048931 | |||
| 1175 | Ga0495622_0001272 | |||
| 1176 | Ga0495622_0037574 | |||
| 1177 | Ga0495622_0037827 | |||
| 1178 | Ga0495633_0000063 | |||
| 1179 | Ga0495633_0000425 | |||
| 1180 | Ga0495633_0000642 | |||
| 1181 | Ga0495633_0013884 | |||
| 1182 | Ga0495668_0000254 | |||
| 1183 | Ga0495668_0000360 | |||
| 1184 | Ga0495668_0001663 | |||
| 1185 | Ga0495668_0001785 | |||
| 1186 | Ga0495634_0000844 | |||
| 1187 | Ga0495625_0006457 | |||
| 1188 | Ga0495625_0006598 | |||
| 1189 | Ga0495625_0013046 | |||
| 1190 | Ga0495625_0016950 | |||
| 1191 | Ga0495625_0024618 | |||
| 1192 | Ga0495625_0034183 | |||
| 1193 | Ga0495635_0007684 | |||
| 1194 | Ga0495661_0000045 | |||
| 1195 | Ga0495661_0000243 | |||
| 1196 | Ga0495661_0014325 | |||
| 1197 | Ga0495661_0016653 | |||
| 1198 | Ga0495588_0002096 | |||
| 1199 | Ga0495588_0012720 | |||
| 1200 | Ga0495588_0081773 | |||
| 1201 | Ga0495623_0005211 | |||
| 1202 | Ga0495623_0006585 | |||
| 1203 | Ga0495623_0018811 | |||
| 1204 | Ga0495646_0006539 | |||
| 1205 | Ga0495646_0008394 | |||
| 1206 | Ga0495646_0034860 | |||
| 1207 | Ga0495613_0007039 | |||
| 1208 | Ga0495670_0000334 | |||
| 1209 | Ga0495670_0002833 | |||
| 1210 | Ga0495670_0025584 | |||
| 1211 | Ga0495671_0001724 | |||
| 1212 | Ga0495671_0004086 | |||
| 1213 | Ga0495671_0004132 | |||
| 1214 | Ga0495671_0004346 | |||
| 1215 | Ga0495671_0016630 | |||
| 1216 | Ga0495671_0022791 | |||
| 1217 | Ga0495671_0028166 | |||
| 1218 | Ga0495671_0057684 | |||
| 1219 | Ga0495649_0003272 | |||
| 1220 | Ga0495649_0004143 | |||
| 1221 | Ga0495649_0004590 | |||
| 1222 | Ga0495649_0008672 | |||
| 1223 | Ga0495649_0008955 | |||
| 1224 | Ga0495649_0009416 | |||
| 1225 | Ga0495649_0012938 | |||
| 1226 | Ga0495649_0049139 | |||
| 1227 | Ga0495589_0000940 | |||
| 1228 | Ga0495589_0004178 | |||
| 1229 | Ga0495589_0004848 | |||
| 1230 | Ga0495589_0048732 | |||
| 1231 | Ga0495600_0012778 | |||
| 1232 | Ga0495660_0000388 | |||
| 1233 | Ga0495660_0005616 | |||
| 1234 | Ga0495660_0005746 | |||
| 1235 | Ga0495660_0015272 | |||
| 1236 | Ga0495660_0022486 | |||
| 1237 | Ga0495604_0002332 | |||
| 1238 | Ga0495604_0016306 | |||
| 1239 | Ga0495672_0000213 | |||
| 1240 | Ga0495672_0001762 | |||
| 1241 | Ga0495672_0002378 | |||
| 1242 | Ga0495672_0002447 | |||
| 1243 | Ga0495672_0002741 | |||
| 1244 | Ga0495680_0000543 | |||
| 1245 | Ga0495680_0038665 | |||
| 1246 | Ga0495683_0000199 | |||
| 1247 | Ga0495683_0000215 | |||
| 1248 | Ga0495683_0006410 | |||
| 1249 | Ga0495683_0042327 | |||
| 1250 | Ga0495687_000419 | |||
| 1251 | Ga0495687_000660 | |||
| 1252 | Ga0495687_000861 | |||
| 1253 | Ga0495687_000898 | |||
| 1254 | Ga0495687_001758 | |||
| 1255 | Ga0495675_0013668 | |||
| 1256 | Ga0495679_001460 | |||
| 1257 | Ga0495679_001962 | |||
| 1258 | Ga0495679_011372 | |||
| 1259 | Ga0495673_0000027 | |||
| 1260 | Ga0495673_0000084 | |||
| 1261 | Ga0495673_0000251 | |||
| 1262 | Ga0495673_0001757 | |||
| 1263 | Ga0495673_0002092 | |||
| 1264 | Ga0495673_0002608 | |||
| 1265 | Ga0495673_0004328 | |||
| 1266 | Ga0495681_0000122 | |||
| 1267 | Ga0495681_0000180 | |||
| 1268 | Ga0495681_0000291 | |||
| 1269 | Ga0495681_0001803 | |||
| 1270 | Ga0495681_0007282 | |||
| 1271 | Ga0495681_0014418 | |||
| 1272 | Ga0495681_0025807 | |||
| 1273 | Ga0495681_0027142 | |||
| 1274 | Ga0495681_0051538 | |||
| 1275 | Ga0495684_0034027 | |||
| 1276 | Ga0495686_0002239 | |||
| 1277 | Ga0495686_0096893 | |||
| 1278 | Ga0495686_0111350 | |||
| 1279 | Ga0495593_0000146 | |||
| 1280 | Ga0495593_0068764 | |||
| 1281 | Ga0495602_0042772 | |||
| 1282 | Ga0495615_0009385 | |||
| 1283 | Ga0495626_0000055 | |||
| 1284 | Ga0495626_0000108 | |||
| 1285 | Ga0495626_0000131 | |||
| 1286 | Ga0495626_0000528 | |||
| 1287 | Ga0495626_0005464 | |||
| 1288 | Ga0495626_0007044 | |||
| 1289 | Ga0496100_0004201 | |||
| 1290 | Ga0496100_0073008 | |||
| 1291 | Ga0496101_0002436 | |||
| 1292 | Ga0496101_0043592 | |||
| 1293 | Ga0496101_0123231 | |||
| 1294 | Ga0496102_0000052 | |||
| 1295 | Ga0496102_0014354 | |||
| 1296 | Ga0496102_0106682 | |||
| 1297 | Ga0496102_0234858 | |||
| 1298 | Ga0496103_0000280 | |||
| 1299 | Ga0496104_0025801 | |||
| 1300 | Ga0496105_0001511 | |||
| 1301 | Ga0496105_0061014 | |||
| 1302 | Ga0496106_0050136 | |||
| 1303 | Ga0496106_0063384 | |||
| 1304 | Ga0496106_0311616 | |||
| 1305 | Ga0496107_0003109 | |||
| 1306 | Ga0496108_0007231 | |||
| 1307 | Ga0496108_0136028 | |||
| 1308 | Ga0496109_0001861 | |||
| 1309 | Ga0496109_0083507 | |||
| 1310 | Ga0496110_0002932 | |||
| 1311 | Ga0496110_0004438 | |||
| 1312 | Ga0496110_0026602 | |||
| 1313 | Ga0496110_0196507 | |||
| 1314 | Ga0496111_0006752 | |||
| 1315 | Ga0496111_0036578 | |||
| 1316 | Ga0496111_0079791 | |||
| 1317 | Ga0496111_0122623 | |||
| 1318 | Ga0496111_0130734 | |||
| 1319 | Ga0496111_0205885 | |||
| 1320 | Ga0496113_0081645 | |||
| 1321 | Ga0496114_0001260 | |||
| 1322 | Ga0496114_0001641 | |||
| 1323 | Ga0496114_0014586 | |||
| 1324 | Ga0496116_0000967 | |||
| 1325 | Ga0496116_0002130 | |||
| 1326 | Ga0496116_0009926 | |||
| 1327 | Ga0496116_0085727 | |||
| 1328 | Ga0496117_0000010 | |||
| 1329 | Ga0496117_0000461 | |||
| 1330 | Ga0496117_0000899 | |||
| 1331 | Ga0496117_0001093 | |||
| 1332 | Ga0496117_0006283 | |||
| 1333 | Ga0496117_0013152 | |||
| 1334 | Ga0496117_0014630 | |||
| 1335 | Ga0496118_0000009 | |||
| 1336 | Ga0496118_0000106 | |||
| 1337 | Ga0496118_0001115 | |||
| 1338 | Ga0496118_0015072 | |||
| 1339 | Ga0496118_0034595 | |||
| 1340 | Ga0496121_0000149 | |||
| 1341 | Ga0496121_0002573 | |||
| 1342 | Ga0496121_0005330 | |||
| 1343 | Ga0496121_0014302 | |||
| 1344 | Ga0496121_0036119 | |||
| 1345 | Ga0496122_0000388 | |||
| 1346 | Ga0496122_0001880 | |||
| 1347 | Ga0496122_0002387 | |||
| 1348 | Ga0496122_0004618 | |||
| 1349 | Ga0496122_0014388 | |||
| 1350 | Ga0496122_0143839 | |||
| 1351 | Ga0496123_0001620 | |||
| 1352 | Ga0496123_0003435 | |||
| 1353 | Ga0496123_0005379 | |||
| 1354 | Ga0496123_0007862 | |||
| 1355 | Ga0496123_0026816 | |||
| 1356 | Ga0496124_0003407 | |||
| 1357 | Ga0496124_0011349 | |||
| 1358 | Ga0496124_0025613 | |||
| 1359 | Ga0496124_0032274 | |||
| 1360 | Ga0496124_0040537 | |||
| 1361 | Ga0496125_0000038 | |||
| 1362 | Ga0496125_0001343 | |||
| 1363 | Ga0496125_0002932 | |||
| 1364 | Ga0496125_0007570 | |||
| 1365 | Ga0496125_0008277 | |||
| 1366 | Ga0496125_0010628 | |||
| 1367 | Ga0496125_0024083 | |||
| 1368 | Ga0496125_0075969 | |||
| 1369 | Ga0496125_0087409 | |||
| 1370 | Ga0496125_0125215 | |||
| 1371 | Ga0496125_0160935 | |||
| 1372 | Ga0496126_0044237 | |||
| 1373 | Ga0496126_0071812 | |||
| 1374 | Ga0495678_002327 | |||
| 1375 | Ga0495678_006098 | |||
| 1376 | Ga0495678_009347 | |||
| 1377 | Ga0495678_025061 | |||
| 1378 | Ga0495678_037450 | |||
| 1379 | Ga0495678_060134 | |||
| 1380 | Ga0495682_0043250 | |||
| 1381 | Ga0501031_0004484 | |||
| 1382 | Ga0501032_0051988 | |||
| 1383 | Ga0501033_0000203 | |||
| 1384 | Ga0501034_0000055 | |||
| 1385 | Ga0501034_0000199 | |||
| 1386 | Ga0501034_0115763 | |||
| 1387 | Ga0501036_0004256 | |||
| 1388 | Ga0501037_0018830 | |||
| 1389 | Ga0501038_0155506 | |||
| 1390 | Ga0501039_0003555 | |||
| 1391 | Ga0501040_0001416 | |||
| 1392 | Ga0501040_0006631 | |||
| 1393 | Ga0501041_0003671 | |||
| 1394 | Ga0501041_0007438 | |||
| 1395 | Ga0501042_0022030 | |||
| 1396 | Ga0501042_0022537 | |||
| 1397 | Ga0501042_0056212 | |||
| 1398 | Ga0501046_0073243 | |||
| 1399 | Ga0501047_0039298 | |||
| 1400 | Ga0501048_0010542 | |||
| 1401 | Ga0501048_0082309 | |||
| 1402 | Ga0501048_0094169 | |||
| 1403 | Ga0501048_0105150 | |||
| 1404 | Ga0501068_0012250 | |||
| 1405 | Ga0501069_0092999 | |||
| 1406 | Ga0501071_0003577 | |||
| 1407 | Ga0501072_0006753 | |||
| 1408 | Ga0501072_0138757 | |||
| 1409 | Ga0501073_0030972 | |||
| 1410 | Ga0501074_0100962 | |||
| 1411 | Ga0501075_0073844 | |||
| 1412 | Ga0501076_0011201 | |||
| 1413 | Ga0501077_0054662 | |||
| 1414 | Ga0501249_001162 | |||
| 1415 | Ga0501079_0010695 | |||
| 1416 | Ga0501080_0022496 | |||
| 1417 | Ga0501080_0106113 | |||
| 1418 | Ga0501081_0027629 | |||
| 1419 | Ga0501269_000225 | |||
| 1420 | Ga0501035_0001175 | |||
| 1421 | Ga0501035_0057824 | |||
| 1422 | Ga0501035_0070964 | |||
| 1423 | Ga0501044_0074141 | |||
| 1424 | Ga0501045_0001996 | |||
| 1425 | Ga0501045_0031066 | |||
| 1426 | Ga0501045_0099069 | |||
| 1427 | Ga0501045_0119254 | |||
| 1428 | nmdc:mga07m45_123839_c1 | |||
| 1429 | nmdc:mga07m45_20588_c1 | |||
| 1430 | nmdc:mga05p37_15187_c1 | |||
| 1431 | nmdc:mga05p37_15247_c1 | |||
| 1432 | nmdc:mga09592_239_c1 | |||
| 1433 | nmdc:mga09592_4172_c1 | |||
| 1434 | nmdc:mga0qj67_26496_c1 | |||
| 1435 | nmdc:mga0qj67_784_c1 | |||
| 1436 | nmdc:mga06r32_167_c1 | |||
| 1437 | nmdc:mga06r32_186242_c1 | |||
| 1438 | nmdc:mga08y16_18876_c1 | |||
| 1439 | nmdc:mga0a205_44114_c1 | |||
| 1440 | nmdc:mga0sz30_24229_c1 | |||
| 1441 | Ga0500594_0002266 | |||
| 1442 | Ga0500618_000737 | |||
| 1443 | Ga0500659_0000704 | |||
| 1444 | Ga0500586_000366 | |||
| 1445 | Ga0501084_0011649 | |||
| 1446 | Ga0501082_0005855 | |||
| 1447 | Ga0501082_0023752 | |||
| 1448 | Ga0530510_0004711 | |||
| 1449 | Ga0530510_0032672 | |||
| 1450 | 2501075564 | |||
| 1451 | 2501084000 | |||
| 1452 | 2501412687 | |||
| 1453 | 2511093445 | |||
| 1454 | 2511099894 | |||
| 1455 | 2511102321 | |||
| 1456 | 2511265901 | |||
| 1457 | 2511277462 | |||
| 1458 | 2511300268 | |||
| 1459 | 2511322618 | |||
| 1460 | 2511334577 | |||
| 1461 | 2511336412 | |||
| 1462 | 2511343308 | |||
| 1463 | 2511354793 | |||
| 1464 | 2511367945 | |||
| 1465 | 2511376223 | |||
| 1466 | 2512323788 | |||
| 1467 | 2513557943 | |||
| 1468 | 2513565563 | |||
| 1469 | 2513955389 | |||
| 1470 | 2516024958 | |||
| 1471 | 2552747291 | |||
| 1472 | 2555670106 | |||
| 1473 | 2566993837 | |||
| 1474 | 2574431526 | |||
| 1475 | 2583791955 | |||
| 1476 | 2597858014 | |||
| 1477 | 2599352860 | |||
| 1478 | 2599359205 | |||
| 1479 | 2599365274 | |||
| 1480 | 2599371899 | |||
| 1481 | 2599377968 | |||
| 1482 | 2599384655 | |||
| 1483 | 2599390757 | |||
| 1484 | 2599402942 | |||
| 1485 | 2599459694 | |||
| 1486 | 2599465967 | |||
| 1487 | 2599485045 | |||
| 1488 | 2599488715 | |||
| 1489 | 2600212299 | |||
| 1490 | 2600366585 | |||
| 1491 | 2601670441 | |||
| 1492 | 2601772467 | |||
| 1493 | 2640733706 | |||
| 1494 | 2643843865 | |||
| 1495 | 2643851396 | |||
| 1496 | 2643953167 | |||
| 1497 | 2644025164 | |||
| 1498 | 2644138013 | |||
| 1499 | 2644230438 | |||
| 1500 | 2671095563 | |||
| 1501 | 2678230721 | |||
| 1502 | 2723879542 | |||
| 1503 | 2739362815 | |||
| 1504 | 2743737480 | |||
| 1505 | 2746087356 | |||
| 1506 | 2746093137 | |||
| 1507 | 2765584036 | |||
| 1508 | 2774119984 | |||
| 1509 | 2774388758 | |||
| 1510 | 2774438616 | |||
| 1511 | 2784312085 | |||
| 1512 | 2807408496 | |||
| 1513 | 2807456811 | |||
| 1514 | 2808872791 | |||
| 1515 | 2808959375 | |||
| 1516 | 2808973012 | |||
| 1517 | 2809007822 | |||
| 1518 | 2809016529 | |||
| 1519 | 2812367075 | |||
| 1520 | 2819667740 | |||
| 1521 | 2819700958 | |||
| 1522 | 2840881676 | |||
| 1523 | 2842712045 | |||
| 1524 | 2844670726 | |||
| 1525 | 2852617669 | |||
| 1526 | 2852672967 | |||
| 1527 | 2857548218 | |||
| 1528 | 2857566017 | |||
| 1529 | 2883094889 | |||
| 1530 | 2885085214 | |||
| 1531 | 2904536927 | |||
| 1532 | 2904768221 | |||
| 1533 | 2904770237 | |||
| 1534 | 2904775455 | |||
| 1535 | 2908815521 | |||
| 1536 | 2912966680 | |||
| 1537 | 2917073929 | |||
| 1538 | 2919183611 | |||
| 1539 | 2919423358 | |||
| 1540 | 2919435966 | |||
| 1541 | 2919449109 | |||
| 1542 | 2919461544 | |||
| 1543 | 2922555350 | |||
| 1544 | 2923156521 | |||
| 1545 | 2923521114 | |||
| 1546 | 2932412813 | |||
| 1547 | 2932420328 | |||
| 1548 | 2935357016 | |||
| 1549 | 2939642388 | |||
| 1550 | 2939651636 | |||
| 1551 | 2945962807 | |||
| 1552 | 3007395905 | |||
| 1553 | 3007623231 | |||
| 1554 | 3007804907 | |||
| 1555 | 637320471 | |||
| 1556 | 644751631 | |||
| 1557 | 8002746239 | |||
| 1558 | 8003961952 | |||
| 1559 | 8011352261 | |||
| 1560 | 8015690715 | |||
| 1561 | 8052497326 | |||
| 1562 | 8055773850 | |||
| 1563 | 8055880386 | |||
| 1564 | 8055883728 | |||
| 1565 | 8056123297 | |||
| 1566 | 8056181424 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y4o-assembly1.cif.gz_B | crystal structure of paak2 in complex with phenylacetyl adenylate | 0.9718 | 14 | 438 |
| 4r1m-assembly2.cif.gz_C | crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution | 0.9625 | 17 | 438 |
| 4r1l-assembly1.cif.gz_A | crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution | 0.9604 | 17 | 440 |
| 4r1m-assembly1.cif.gz_A | crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution | 0.9566 | 17 | 440 |
| 6he0-assembly1.cif.gz_A-2 | crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state | 0.9565 | 18 | 439 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y4nA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.9824 | 14 | 335 | 3.40.50.12780 |
| 2y4nA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.9704 | 14 | 335 | 3.40.50.12780 |
| 3qovC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.9613 | 17 | 335 | 3.40.50.12780 |
| af_P76085_328_435_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9546 | 334 | 439 | 3.30.300.30 |
| 3qovC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.9319 | 17 | 335 | 3.40.50.12780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R9C0I3-F1-model_v4 | Phenylacetate--CoA ligase | 0.9921 | 219 | 344 |
|
| AF-A0A7X6EMY5-F1-model_v4 | deleted | 0.9882 | 179 | 268 |
|
| AF-A0A4R9C0I3-F1-model_v4 | Phenylacetate--CoA ligase | 0.9843 | 219 | 344 |
|
| AF-A0A7Y8V6J1-F1-model_v4 | deleted | 0.9823 | 17 | 264 |
|
| AF-A0A357NBS0-F1-model_v4 | Phenylacetate--CoA ligase | 0.9794 | 124 | 315 |
GO:0016874
|