F480663

General Info

Members Datasets Scaffolds Average Seq Length
783 403 1566 438

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10123741|Ga0207428_101237412
Length 460
Sequence MHSSPAMAGSEHNNNSSEVMNMPIAKAVLDPVLDPLETASIDELRQHQLDRLRWSLNHAYNNVPLYRQRFDALGVHPDDIKSLEDLAKFPFTTKTDLRDNYPYGMFAVPMNEVVRLHASSGTTGKPTVVGYTQNDIDTWANVVARSIRAAGGRRGDKVHISYGYGLFTGGLGAHYGAERLGCTVIPMSGGQTEKQVQLIKDFQPDIIMVTPSYMLNIADEIERQGIDPHKLALRLGIFGAEPWTAELRSAIEARLGITALDIYGLSEIMGPGVAMECAETKDGPTIWEDHFYPEIIDPVTGEVLPDGQMGELVFTSLSKEALPMIRYRTRDLTRLLPGTARPMRRIDKITGRSDDMLIIRGVNVFPTQIEEQVLKVKQLAECYEIHLYRNGNLDSVDVHVELKAEQQHLSDEQQKAVCGELSKHIKTYIGISSRIVLQPFHSIKRSEGKACHVVDKRPKA

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
136 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
137 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
138 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
139 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
285 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
290 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
291 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
292 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
293 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
294 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
295 2511231006 Pseudomonas sp. GM17 Isolate Nodule
296 2511231008 Pseudomonas sp. GM21 Isolate Nodule
297 2511231012 Pseudomonas sp. GM33 Isolate Nodule
298 2511231015 Pseudomonas sp. GM49 Isolate Nodule
299 2511231017 Pseudomonas sp. GM55 Isolate Nodule
300 2511231018 Pseudomonas sp. GM60 Isolate Nodule
301 2511231019 Pseudomonas sp. GM67 Isolate Nodule
302 2511231021 Pseudomonas sp. GM78 Isolate Nodule
303 2511231023 Pseudomonas sp. GM80 Isolate Nodule
304 2511231024 Pseudomonas sp. GM84 Isolate Nodule
305 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
306 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
307 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
308 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
309 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
310 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
311 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
312 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
313 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
314 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
315 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
316 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
317 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
318 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
319 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
320 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
321 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
322 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
323 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
324 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
325 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
326 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
327 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
328 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
329 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
330 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
331 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
332 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
333 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
334 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
335 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
336 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
337 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
338 2643221641 Nocardioides sp. Root122 Isolate Unclassified
339 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
340 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
341 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
342 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
343 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
344 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
345 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
346 2765235841 Pseudomonas putida AA7 Isolate Unclassified
347 2773857670 Pseudomonas sp. 478 Isolate Unclassified
348 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
349 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
350 2784132072 Pseudomonas sp. 460 Isolate Unclassified
351 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
352 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
353 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
354 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
355 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
356 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
357 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
358 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
359 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
360 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
361 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
362 2842711865 Duganella sp. R-73148 Isolate Unclassified
363 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
364 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
365 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
366 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
367 2857564685 Duganella sp. R-74599 Isolate Unclassified
368 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
369 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
370 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
371 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
372 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
373 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
374 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
375 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
376 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
377 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
378 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
379 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
380 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
381 2922554459 Rhodococcus sp. 66b Isolate Unclassified
382 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
383 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
384 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
385 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
386 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
387 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
388 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
389 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
390 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
391 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
392 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
393 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
394 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
395 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
396 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
397 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
398 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
399 8052494512 Pseudomonas putida LD6 Isolate Unclassified
400 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
401 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
402 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
403 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.93
Metatranscriptomes 0.13
Isolates 14.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 2.43
Rhizoplane 7.02
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10123741 3300027907 Bacteria 1982
2 MRS2a_Contig_7291 2124908027 Bacteria 8406
3 MRS2a_Contig_9136 2124908027 Bacteria 7420
4 SwRhRL2b_contig_2780838 2162886007 Bacteria 1935
5 JGI24739J22299_10028397 3300001989 Bacteria 1951
6 JGI24735J21928_10000368 3300002067 Bacteria 15723
7 JGI24735J21928_10001145 3300002067 Bacteria 9474
8 Ga0055525_1000009 3300003759 Bacteria 596899
9 Ga0055542_1009065 3300003762 Bacteria 1899
10 Ga0055526_1008543 3300003771 Bacteria 5084
11 Ga0055526_1012329 3300003771 Bacteria 3745
12 Ga0055524_1000402 3300003775 Bacteria 36997
13 Ga0055536_1000014 3300003781 Bacteria 240624
14 Ga0055536_1000158 3300003781 Bacteria 58733
15 Ga0055534_1005186 3300003784 Bacteria 3564
16 Ga0055530_10000009 3300003791 Bacteria 174044
17 Ga0055540_1000342 3300003792 Bacteria 39754
18 Ga0058692_1000010 3300003856 Bacteria 326761
19 JGI25405J52794_10006845 3300003911 Bacteria 2088
20 Ga0065703_1000063 3300005272 Bacteria 30242
21 Ga0065714_10008515 3300005288 Bacteria 4200
22 Ga0065704_10002892 3300005289 Bacteria 5137
23 Ga0065704_10074925 3300005289 Bacteria 5908
24 Ga0065704_10107275 3300005289 Bacteria 2060
25 Ga0070658_10006576 3300005327 Bacteria 9423
26 Ga0070658_10013426 3300005327 Bacteria 6572
27 Ga0070660_100001047 3300005339 Bacteria 18600
28 Ga0070669_100030253 3300005353 Bacteria 3906
29 Ga0070675_100256677 3300005354 Bacteria 1531
30 Ga0070663_100050937 3300005455 Bacteria 2947
31 Ga0070678_100101253 3300005456 Bacteria 2233
32 Ga0068855_100003256 3300005563 Bacteria 19861
33 Ga0068855_100011429 3300005563 Bacteria 10724
34 Ga0068856_100228432 3300005614 Bacteria 1876
35 Ga0081455_10001059 3300005937 Bacteria 34635
36 Ga0081455_10017164 3300005937 Bacteria 6950
37 Ga0081538_10003479 3300005981 Bacteria 14872
38 Ga0081538_10062383 3300005981 Bacteria 2126
39 Ga0075369_10035244 3300006186 Bacteria 2127
40 Ga0075428_100009062 3300006844 Bacteria 11042
41 Ga0075430_100009064 3300006846 Bacteria 8410
42 Ga0075430_100018249 3300006846 Bacteria 5972
43 Ga0075431_100003419 3300006847 Bacteria 15401
44 Ga0075431_100020307 3300006847 Bacteria 6785
45 Ga0075431_100088100 3300006847 Bacteria 3203
46 Ga0075434_100199804 3300006871 Bacteria 2019
47 Ga0075429_100000338 3300006880 Bacteria 34036
48 Ga0075429_100075999 3300006880 Bacteria 2925
49 Ga0099823_1000004 3300006944 Bacteria 176518
50 Ga0079104_1000097 3300006946 Bacteria 129435
51 Ga0105251_10004006 3300009011 Bacteria 10407
52 Ga0105251_10011394 3300009011 Bacteria 5082
53 Ga0105251_10050694 3300009011 Bacteria 1982
54 Ga0105244_10000053 3300009036 Bacteria 133900
55 Ga0105244_10000449 3300009036 Bacteria 37516
56 Ga0105244_10001624 3300009036 Bacteria 17818
57 Ga0105244_10022330 3300009036 Bacteria 3484
58 Ga0105250_10000092 3300009092 Bacteria 79976
59 Ga0105250_10000131 3300009092 Bacteria 64802
60 Ga0111539_10026704 3300009094 Bacteria 7056
61 Ga0111539_10228621 3300009094 Bacteria 2166
62 Ga0105245_10097184 3300009098 Bacteria 2719
63 Ga0105247_10000472 3300009101 Bacteria 33737
64 Ga0114129_10030167 3300009147 Bacteria 7680
65 Ga0114129_10038538 3300009147 Bacteria 6741
66 Ga0105243_10038876 3300009148 Bacteria 3707
67 Ga0105243_10084794 3300009148 Bacteria 2595
68 Ga0105248_10015699 3300009177 Bacteria 8346
69 Ga0105237_10207881 3300009545 Bacteria 1957
70 Ga0105239_10005327 3300010375 Bacteria 15091
71 Ga0105246_10001375 3300011119 Bacteria 14343
72 Ga0157373_10062294 3300013100 Bacteria 2642
73 Ga0157371_10001313 3300013102 Bacteria 26106
74 Ga0157371_10003361 3300013102 Bacteria 14563
75 Ga0157371_10029236 3300013102 Bacteria 3988
76 Ga0157370_10003861 3300013104 Bacteria 17467
77 Ga0157370_10053744 3300013104 Bacteria 3840
78 Ga0157369_10001578 3300013105 Bacteria 27888
79 Ga0157369_10188651 3300013105 Bacteria 2167
80 Ga0157374_10000146 3300013296 Bacteria 64549
81 Ga0163162_10004400 3300013306 Bacteria 13556
82 Ga0163162_10011171 3300013306 Bacteria 8749
83 Ga0163162_10243166 3300013306 Bacteria 1931
84 Ga0157372_10003027 3300013307 Bacteria 18108
85 Ga0157375_10003051 3300013308 Bacteria 14539
86 Ga0157375_10187362 3300013308 Bacteria 2223
87 Ga0182008_10000862 3300014497 Bacteria 21050
88 Ga0182008_10011205 3300014497 Bacteria 4777
89 Ga0182008_10012491 3300014497 Bacteria 4482
90 Ga0182008_10085737 3300014497 Bacteria 1551
91 Ga0182006_1000010 3300015261 Bacteria 413414
92 Ga0182006_1008045 3300015261 Bacteria 4791
93 Ga0182006_1010339 3300015261 Bacteria 4150
94 Ga0182007_10000030 3300015262 Bacteria 156866
95 Ga0182007_10011317 3300015262 Bacteria 3477
96 Ga0182007_10018956 3300015262 Bacteria 2482
97 Ga0182005_1000009 3300015265 Bacteria 455334
98 Ga0182005_1009614 3300015265 Bacteria 2806
99 Ga0163161_10041020 3300017792 Bacteria 3325
100 Ga0163161_10045708 3300017792 Bacteria 3159
101 Ga0213872_10000135 3300021361 Bacteria 67262
102 Ga0224712_10000073 3300022467 Bacteria 15371
103 Ga0209672_101017 3300025228 Bacteria 12156
104 Ga0209563_100015 3300025230 Bacteria 879901
105 Ga0209148_1000794 3300025254 Bacteria 23325
106 Ga0209565_1000104 3300025263 Bacteria 124432
107 Ga0209675_1000065 3300025291 Bacteria 174791
108 Ga0209676_1000003 3300025292 Bacteria 1454178
109 Ga0209676_1000044 3300025292 Bacteria 416215
110 Ga0209676_1000535 3300025292 Bacteria 59023
111 Ga0209676_1002148 3300025292 Bacteria 14931
112 Ga0209025_1000147 3300025294 Bacteria 180008
113 Ga0209025_1007698 3300025294 Bacteria 7948
114 Ga0209564_1000006 3300025295 Bacteria 1100927
115 Ga0209564_1000080 3300025295 Bacteria 263547
116 Ga0209564_1000253 3300025295 Bacteria 114335
117 Ga0209564_1000923 3300025295 Bacteria 38212
118 Ga0209758_1010657 3300025297 Bacteria 5464
119 Ga0209050_1000004 3300025298 Bacteria 1600040
120 Ga0209050_1000148 3300025298 Bacteria 164093
121 Ga0209256_1000543 3300025299 Bacteria 54373
122 Ga0207426_1003874 3300025302 Bacteria 7711
123 Ga0209051_1000006 3300025303 Bacteria 1015785
124 Ga0209051_1015660 3300025303 Bacteria 3476
125 Ga0207696_1000006 3300025711 Bacteria 616498
126 Ga0207696_1000160 3300025711 Bacteria 111012
127 Ga0207696_1000225 3300025711 Bacteria 79995
128 Ga0207696_1008385 3300025711 Bacteria 3962
129 Ga0207655_1000049 3300025728 Bacteria 295872
130 Ga0207655_1000070 3300025728 Bacteria 239196
131 Ga0207655_1000077 3300025728 Bacteria 219418
132 Ga0207655_1000112 3300025728 Bacteria 170624
133 Ga0207655_1000181 3300025728 Bacteria 112734
134 Ga0207655_1005043 3300025728 Bacteria 9128
135 Ga0207713_1000113 3300025735 Bacteria 132424
136 Ga0207713_1000232 3300025735 Bacteria 74620
137 Ga0207713_1000725 3300025735 Bacteria 30860
138 Ga0207713_1002997 3300025735 Bacteria 11801
139 Ga0207713_1006136 3300025735 Bacteria 7386
140 Ga0207713_1006407 3300025735 Bacteria 7174
141 Ga0207713_1010896 3300025735 Bacteria 4992
142 Ga0207713_1013933 3300025735 Bacteria 4207
143 Ga0207713_1014084 3300025735 Bacteria 4175
144 Ga0207713_1032743 3300025735 Bacteria 2279
145 Ga0207710_10000009 3300025900 Bacteria 485205
146 Ga0207647_10001767 3300025904 Bacteria 16587
147 Ga0207705_10000783 3300025909 Bacteria 26126
148 Ga0207705_10002884 3300025909 Bacteria 13159
149 Ga0207705_10014878 3300025909 Bacteria 5595
150 Ga0207657_10009942 3300025919 Bacteria 9520
151 Ga0207659_10196664 3300025926 Bacteria 1607
152 Ga0207687_10053315 3300025927 Bacteria 2825
153 Ga0207709_10000001 3300025935 Bacteria 2228154
154 Ga0207709_10078020 3300025935 Bacteria 2125
155 Ga0207711_10005662 3300025941 Bacteria 10555
156 Ga0207667_10004017 3300025949 Bacteria 18078
157 Ga0207667_10014081 3300025949 Bacteria 9131
158 Ga0207667_10021335 3300025949 Bacteria 7177
159 Ga0207651_10214103 3300025960 Bacteria 1553
160 Ga0207639_10014191 3300026041 Bacteria 5594
161 Ga0207674_10093515 3300026116 Bacteria 2995
162 Ga0207683_10128645 3300026121 Bacteria 2277
163 Ga0207698_10046047 3300026142 Bacteria 3290
164 Ga0209281_1000136 3300027111 Bacteria 182153
165 Ga0209389_1000006 3300027296 Bacteria 231635
166 Ga0209371_1000006 3300027312 Bacteria 1055642
167 Ga0207428_10051686 3300027907 Bacteria 3285
168 Ga0265337_1007535 3300028556 Bacteria 4065
169 Ga0265334_10007864 3300028573 Bacteria 4560
170 Ga0307515_10073804 3300028794 Bacteria 4576
171 Ga0265338_10000547 3300028800 Bacteria 65836
172 Ga0265324_10013494 3300029957 Bacteria 3046
173 Ga0268256_1000007 3300030500 Bacteria 1055326
174 Ga0265316_10018300 3300031344 Bacteria 6023
175 Ga0307508_10112036 3300031616 Bacteria 2329
176 Ga0265314_10012712 3300031711 Bacteria 6843
177 Ga0265314_10061899 3300031711 Bacteria 2546
178 Ga0307405_10056265 3300031731 Bacteria 2466
179 Ga0307405_10069783 3300031731 Bacteria 2254
180 Ga0307410_10021181 3300031852 Bacteria 3994
181 Ga0307406_10014342 3300031901 Bacteria 4558
182 Ga0307407_10020070 3300031903 Bacteria 3416
183 Ga0307407_10022645 3300031903 Bacteria 3265
184 Ga0307409_100001597 3300031995 Bacteria 11333
185 Ga0307409_100014810 3300031995 Bacteria 5089
186 Ga0307414_10117626 3300032004 Bacteria 2037
187 Ga0307415_100001340 3300032126 Bacteria 11693
188 Ga0307415_100071213 3300032126 Bacteria 2444
189 Ga0316584_0104374 3300036712 Bacteria 2122
190 Ga0395899_0000080 3300037312 Bacteria 171568
191 Ga0395899_0002023 3300037312 Bacteria 16701
192 Ga0395899_0004044 3300037312 Bacteria 11568
193 Ga0395899_0058667 3300037312 Bacteria 2838
194 Ga0395900_0000087 3300037418 Bacteria 171568
195 Ga0395900_0000411 3300037418 Bacteria 61659
196 Ga0395900_0000615 3300037418 Bacteria 48234
197 Ga0395900_0003488 3300037418 Bacteria 16976
198 Ga0395900_0031034 3300037418 Bacteria 5489
199 Ga0395898_0000679 3300037466 Bacteria 61481
200 Ga0395898_0002992 3300037466 Bacteria 19185
201 Ga0395898_0037443 3300037466 Bacteria 4812
202 Ga0395898_0072984 3300037466 Bacteria 3315
203 Ga0395898_0216905 3300037466 Bacteria 1825
204 Ga0395905_0024855 3300037471 Bacteria 5653
205 Ga0395901_0000053 3300038443 Bacteria 163807
206 Ga0395901_0000084 3300038443 Bacteria 127737
207 Ga0395901_0000328 3300038443 Bacteria 58470
208 Ga0395901_0012510 3300038443 Bacteria 8611
209 Ga0395901_0100538 3300038443 Bacteria 3033
210 Ga0395901_0219019 3300038443 Bacteria 1990
211 Ga0436360_0818816 3300039438 Bacteria 5902
212 Ga0436361_0080101 3300039447 Bacteria 16464
213 Ga0436361_0115159 3300039447 Bacteria 1266
214 Ga0436361_0400312 3300039447 Bacteria 3036
215 Ga0436361_0402857 3300039447 Bacteria 2305
216 Ga0439436_0000475 3300041404 Bacteria 10357
217 Ga0439438_003774 3300041405 Bacteria 5987
218 Ga0439438_011913 3300041405 Bacteria 2687
219 Ga0439447_000206 3300041407 Bacteria 20774
220 Ga0439466_0000216 3300041411 Bacteria 22651
221 Ga0439466_0002842 3300041411 Bacteria 6772
222 Ga0451791_0311755 3300041451 Bacteria 3403
223 Ga0451800_0068730 3300041459 Bacteria 1730
224 Ga0451841_0238766 3300041498 Bacteria 3330
225 Ga0451853_1144978 3300041512 Bacteria 2727
226 Ga0439448_0034629 3300042005 Bacteria 1614
227 Ga0439432_000972 3300042006 Bacteria 10817
228 Ga0439449_0047827 3300042007 Bacteria 1584
229 Ga0439452_000779 3300042010 Bacteria 15127
230 Ga0439456_004376 3300042013 Bacteria 2854
231 Ga0439463_000483 3300042016 Bacteria 11084
232 Ga0450911_003292 3300042115 Bacteria 2884
233 Ga0450922_000045 3300042124 Bacteria 10921
234 Ga0450923_000523 3300042125 Bacteria 4289
235 Ga0450902_000306 3300042137 Bacteria 5895
236 Ga0450904_000071 3300042139 Bacteria 22967
237 Ga0439434_0000751 3300042435 Bacteria 9322
238 Ga0450901_000131 3300042533 Bacteria 8244
239 Ga0450901_002693 3300042533 Bacteria 1893
240 Ga0451577_0008240 3300042876 Bacteria 10156
241 Ga0466977_0002989 3300044666 Bacteria 7980
242 Ga0466966_0093253 3300044684 Bacteria 1867
243 Ga0466966_0145050 3300044684 Bacteria 1449
244 Ga0466961_0006286 3300044693 Bacteria 7543
245 Ga0453684_0048355 3300044712 Bacteria 5627
246 Ga0466957_0107909 3300044842 Bacteria 1763
247 Ga0466960_0101755 3300044901 Bacteria 1480
248 Ga0466959_0082393 3300045049 Bacteria 2317
249 Ga0466959_0087964 3300045049 Bacteria 2234
250 Ga0466967_0016544 3300045976 Bacteria 5821
251 Ga0466967_0072157 3300045976 Bacteria 3093
252 Ga0495617_001890 3300046452 Bacteria 8821
253 Ga0495617_004841 3300046452 Bacteria 4849
254 Ga0495627_000140 3300046453 Bacteria 86227
255 Ga0495627_001874 3300046453 Bacteria 11094
256 Ga0495627_004057 3300046453 Bacteria 6237
257 Ga0495627_018629 3300046453 Bacteria 2338
258 Ga0495603_0024431 3300046455 Bacteria 3654
259 Ga0495603_0045056 3300046455 Bacteria 2631
260 Ga0495590_0001454 3300046457 Bacteria 10217
261 Ga0495590_0015099 3300046457 Bacteria 2810
262 Ga0495590_0019709 3300046457 Bacteria 2400
263 Ga0495591_000026 3300046458 Bacteria 187482
264 Ga0495591_002234 3300046458 Bacteria 11025
265 Ga0495591_009858 3300046458 Bacteria 3755
266 Ga0495591_016944 3300046458 Bacteria 2517
267 Ga0495591_019100 3300046458 Bacteria 2303
268 Ga0495591_020905 3300046458 Bacteria 2149
269 Ga0495638_0000254 3300046460 Bacteria 72287
270 Ga0495638_0000449 3300046460 Bacteria 49303
271 Ga0495638_0003379 3300046460 Bacteria 12583
272 Ga0495638_0006753 3300046460 Bacteria 8310
273 Ga0495638_0047877 3300046460 Bacteria 2678
274 Ga0495638_0071549 3300046460 Bacteria 2121
275 Ga0495653_0000097 3300046463 Bacteria 72749
276 Ga0495653_0043914 3300046463 Bacteria 3471
277 Ga0495650_0000232 3300046471 Bacteria 113636
278 Ga0495650_0001039 3300046471 Bacteria 31082
279 Ga0495650_0007237 3300046471 Bacteria 6722
280 Ga0495650_0007549 3300046471 Bacteria 6513
281 Ga0495650_0015560 3300046471 Bacteria 3895
282 Ga0495605_0000170 3300046474 Bacteria 82318
283 Ga0495605_0000257 3300046474 Bacteria 62503
284 Ga0495605_0000913 3300046474 Bacteria 20291
285 Ga0495605_0001525 3300046474 Bacteria 15040
286 Ga0495605_0003624 3300046474 Bacteria 9162
287 Ga0495605_0004025 3300046474 Bacteria 8680
288 Ga0495605_0004580 3300046474 Bacteria 8094
289 Ga0495605_0005917 3300046474 Bacteria 7069
290 Ga0495664_0031354 3300046477 Bacteria 3116
291 Ga0495664_0049656 3300046477 Bacteria 2490
292 Ga0495584_0000128 3300046491 Bacteria 52353
293 Ga0495584_0004140 3300046491 Bacteria 7831
294 Ga0495584_0011954 3300046491 Bacteria 4438
295 Ga0495585_0000045 3300046492 Bacteria 123148
296 Ga0495585_0000234 3300046492 Bacteria 57324
297 Ga0495585_0001405 3300046492 Bacteria 18959
298 Ga0495585_0001866 3300046492 Bacteria 15904
299 Ga0495585_0007038 3300046492 Bacteria 6921
300 Ga0495585_0008186 3300046492 Bacteria 6350
301 Ga0495594_0004074 3300046499 Bacteria 7512
302 Ga0495594_0009901 3300046499 Bacteria 4939
303 Ga0495596_0000003 3300046500 Bacteria 186592
304 Ga0495607_0000138 3300046501 Bacteria 77180
305 Ga0495607_0000249 3300046501 Bacteria 57898
306 Ga0495607_0000546 3300046501 Bacteria 36856
307 Ga0495607_0002728 3300046501 Bacteria 14082
308 Ga0495607_0019654 3300046501 Bacteria 4286
309 Ga0495607_0051455 3300046501 Bacteria 2392
310 Ga0495607_0053202 3300046501 Bacteria 2341
311 Ga0495583_0002141 3300046506 Bacteria 17630
312 Ga0495583_0003704 3300046506 Bacteria 11369
313 Ga0495606_0000162 3300046507 Bacteria 117378
314 Ga0495606_0000280 3300046507 Bacteria 88619
315 Ga0495606_0000806 3300046507 Bacteria 47839
316 Ga0495606_0000965 3300046507 Bacteria 42060
317 Ga0495606_0001256 3300046507 Bacteria 35407
318 Ga0495606_0003849 3300046507 Bacteria 15498
319 Ga0495606_0003983 3300046507 Bacteria 15105
320 Ga0495606_0008139 3300046507 Bacteria 9185
321 Ga0495606_0009499 3300046507 Bacteria 8215
322 Ga0495606_0010074 3300046507 Bacteria 7898
323 Ga0495606_0060287 3300046507 Bacteria 2431
324 Ga0495610_0001518 3300046512 Bacteria 20436
325 Ga0495610_0003134 3300046512 Bacteria 13153
326 Ga0495610_0006069 3300046512 Bacteria 8432
327 Ga0495610_0006890 3300046512 Bacteria 7698
328 Ga0495610_0010386 3300046512 Bacteria 5792
329 Ga0495610_0022321 3300046512 Bacteria 3464
330 Ga0495616_0025078 3300046513 Bacteria 3190
331 Ga0495616_0064280 3300046513 Bacteria 1790
332 Ga0495620_0000006 3300046515 Bacteria 273098
333 Ga0495620_0002243 3300046515 Bacteria 11200
334 Ga0495620_0002910 3300046515 Bacteria 9841
335 Ga0495620_0024697 3300046515 Bacteria 2854
336 Ga0495628_0000037 3300046516 Bacteria 109854
337 Ga0495628_0009630 3300046516 Bacteria 8243
338 Ga0495630_0009539 3300046517 Bacteria 6979
339 Ga0495631_0000104 3300046518 Bacteria 55509
340 Ga0495631_0001094 3300046518 Bacteria 16840
341 Ga0495631_0040443 3300046518 Bacteria 2065
342 Ga0495632_0000395 3300046519 Bacteria 41002
343 Ga0495632_0000448 3300046519 Bacteria 39223
344 Ga0495632_0001386 3300046519 Bacteria 20327
345 Ga0495632_0003627 3300046519 Bacteria 10846
346 Ga0495632_0045687 3300046519 Bacteria 2180
347 Ga0495632_0065205 3300046519 Bacteria 1759
348 Ga0495637_0000853 3300046520 Bacteria 19941
349 Ga0495637_0001188 3300046520 Bacteria 15849
350 Ga0495637_0007800 3300046520 Bacteria 5285
351 Ga0495637_0013290 3300046520 Bacteria 3911
352 Ga0495637_0020686 3300046520 Bacteria 3023
353 Ga0495637_0039547 3300046520 Bacteria 2035
354 Ga0495643_0000029 3300046522 Bacteria 261028
355 Ga0495643_0000143 3300046522 Bacteria 114897
356 Ga0495643_0000804 3300046522 Bacteria 34565
357 Ga0495643_0009690 3300046522 Bacteria 5963
358 Ga0495643_0024614 3300046522 Bacteria 3413
359 Ga0495643_0046420 3300046522 Bacteria 2354
360 Ga0495643_0058379 3300046522 Bacteria 2053
361 Ga0495644_0000170 3300046523 Bacteria 30574
362 Ga0495648_0000126 3300046524 Bacteria 90189
363 Ga0495648_0000259 3300046524 Bacteria 59999
364 Ga0495648_0003659 3300046524 Bacteria 13446
365 Ga0495648_0005205 3300046524 Bacteria 10882
366 Ga0495648_0008347 3300046524 Bacteria 8164
367 Ga0495648_0059505 3300046524 Bacteria 2278
368 Ga0495666_0000069 3300046526 Bacteria 40652
369 Ga0495666_0003413 3300046526 Bacteria 8014
370 Ga0495666_0008984 3300046526 Bacteria 4998
371 Ga0495642_0000015 3300046528 Bacteria 121192
372 Ga0495642_0004518 3300046528 Bacteria 5401
373 Ga0495654_0001371 3300046530 Bacteria 16890
374 Ga0495654_0003483 3300046530 Bacteria 9607
375 Ga0495654_0014730 3300046530 Bacteria 4157
376 Ga0495654_0016873 3300046530 Bacteria 3845
377 Ga0495654_0017264 3300046530 Bacteria 3797
378 Ga0495654_0018600 3300046530 Bacteria 3638
379 Ga0495654_0058287 3300046530 Bacteria 1863
380 Ga0495654_0061108 3300046530 Bacteria 1810
381 Ga0495587_0001099 3300046536 Bacteria 17763
382 Ga0495609_0000634 3300046538 Bacteria 27340
383 Ga0495609_0005172 3300046538 Bacteria 6942
384 Ga0495609_0060147 3300046538 Bacteria 1680
385 Ga0495597_0000193 3300046542 Bacteria 55638
386 Ga0495597_0000253 3300046542 Bacteria 48591
387 Ga0495597_0000644 3300046542 Bacteria 28365
388 Ga0495597_0040184 3300046542 Bacteria 2091
389 Ga0495597_0046053 3300046542 Bacteria 1933
390 Ga0495597_0083892 3300046542 Bacteria 1359
391 Ga0495645_0048931 3300046543 Bacteria 3079
392 Ga0495622_0001272 3300046557 Bacteria 12949
393 Ga0495622_0037574 3300046557 Bacteria 2255
394 Ga0495622_0037827 3300046557 Bacteria 2247
395 Ga0495633_0000063 3300046558 Bacteria 141657
396 Ga0495633_0000425 3300046558 Bacteria 43892
397 Ga0495633_0000642 3300046558 Bacteria 32523
398 Ga0495633_0013884 3300046558 Bacteria 4224
399 Ga0495668_0000254 3300046616 Bacteria 76101
400 Ga0495668_0000360 3300046616 Bacteria 60235
401 Ga0495668_0001663 3300046616 Bacteria 20708
402 Ga0495668_0001785 3300046616 Bacteria 19654
403 Ga0495634_0000844 3300046642 Bacteria 29495
404 Ga0495625_0006457 3300046660 Bacteria 10433
405 Ga0495625_0006598 3300046660 Bacteria 10303
406 Ga0495625_0013046 3300046660 Bacteria 6698
407 Ga0495625_0016950 3300046660 Bacteria 5715
408 Ga0495625_0024618 3300046660 Bacteria 4579
409 Ga0495625_0034183 3300046660 Bacteria 3753
410 Ga0495635_0007684 3300046663 Bacteria 7522
411 Ga0495661_0000045 3300046665 Bacteria 148664
412 Ga0495661_0000243 3300046665 Bacteria 62850
413 Ga0495661_0014325 3300046665 Bacteria 5314
414 Ga0495661_0016653 3300046665 Bacteria 4866
415 Ga0495588_0002096 3300046674 Bacteria 8556
416 Ga0495588_0012720 3300046674 Bacteria 3987
417 Ga0495588_0081773 3300046674 Bacteria 1686
418 Ga0495623_0005211 3300046679 Bacteria 8525
419 Ga0495623_0006585 3300046679 Bacteria 7559
420 Ga0495623_0018811 3300046679 Bacteria 4460
421 Ga0495646_0006539 3300046680 Bacteria 7395
422 Ga0495646_0008394 3300046680 Bacteria 6565
423 Ga0495646_0034860 3300046680 Bacteria 3123
424 Ga0495613_0007039 3300046689 Bacteria 8373
425 Ga0495670_0000334 3300046691 Bacteria 22505
426 Ga0495670_0002833 3300046691 Bacteria 8579
427 Ga0495670_0025584 3300046691 Bacteria 2919
428 Ga0495671_0001724 3300046692 Bacteria 14202
429 Ga0495671_0004086 3300046692 Bacteria 8805
430 Ga0495671_0004132 3300046692 Bacteria 8751
431 Ga0495671_0004346 3300046692 Bacteria 8506
432 Ga0495671_0016630 3300046692 Bacteria 3924
433 Ga0495671_0022791 3300046692 Bacteria 3277
434 Ga0495671_0028166 3300046692 Bacteria 2896
435 Ga0495671_0057684 3300046692 Bacteria 1921
436 Ga0495649_0003272 3300046694 Bacteria 11032
437 Ga0495649_0004143 3300046694 Bacteria 9518
438 Ga0495649_0004590 3300046694 Bacteria 8988
439 Ga0495649_0008672 3300046694 Bacteria 6104
440 Ga0495649_0008955 3300046694 Bacteria 5983
441 Ga0495649_0009416 3300046694 Bacteria 5808
442 Ga0495649_0012938 3300046694 Bacteria 4830
443 Ga0495649_0049139 3300046694 Bacteria 2291
444 Ga0495589_0000940 3300046794 Bacteria 17866
445 Ga0495589_0004178 3300046794 Bacteria 7732
446 Ga0495589_0004848 3300046794 Bacteria 7139
447 Ga0495589_0048732 3300046794 Bacteria 2096
448 Ga0495600_0012778 3300046809 Bacteria 5259
449 Ga0495660_0000388 3300046810 Bacteria 38112
450 Ga0495660_0005616 3300046810 Bacteria 7500
451 Ga0495660_0005746 3300046810 Bacteria 7410
452 Ga0495660_0015272 3300046810 Bacteria 4437
453 Ga0495660_0022486 3300046810 Bacteria 3600
454 Ga0495604_0002332 3300047317 Bacteria 15211
455 Ga0495604_0016306 3300047317 Bacteria 5937
456 Ga0495672_0000213 3300047320 Bacteria 82925
457 Ga0495672_0001762 3300047320 Bacteria 20865
458 Ga0495672_0002378 3300047320 Bacteria 17359
459 Ga0495672_0002447 3300047320 Bacteria 17086
460 Ga0495672_0002741 3300047320 Bacteria 15795
461 Ga0495680_0000543 3300047322 Bacteria 42425
462 Ga0495680_0038665 3300047322 Bacteria 3811
463 Ga0495683_0000199 3300047323 Bacteria 56834
464 Ga0495683_0000215 3300047323 Bacteria 54712
465 Ga0495683_0006410 3300047323 Bacteria 6433
466 Ga0495683_0042327 3300047323 Bacteria 2296
467 Ga0495687_000419 3300047443 Bacteria 52487
468 Ga0495687_000660 3300047443 Bacteria 39604
469 Ga0495687_000861 3300047443 Bacteria 32175
470 Ga0495687_000898 3300047443 Bacteria 31229
471 Ga0495687_001758 3300047443 Bacteria 19151
472 Ga0495675_0013668 3300047444 Bacteria 5128
473 Ga0495679_001460 3300047446 Bacteria 13397
474 Ga0495679_001962 3300047446 Bacteria 10968
475 Ga0495679_011372 3300047446 Bacteria 3437
476 Ga0495673_0000027 3300047469 Bacteria 475440
477 Ga0495673_0000084 3300047469 Bacteria 193599
478 Ga0495673_0000251 3300047469 Bacteria 75046
479 Ga0495673_0001757 3300047469 Bacteria 16508
480 Ga0495673_0002092 3300047469 Bacteria 14560
481 Ga0495673_0002608 3300047469 Bacteria 12533
482 Ga0495673_0004328 3300047469 Bacteria 8938
483 Ga0495681_0000122 3300047470 Bacteria 68461
484 Ga0495681_0000180 3300047470 Bacteria 53731
485 Ga0495681_0000291 3300047470 Bacteria 40021
486 Ga0495681_0001803 3300047470 Bacteria 15758
487 Ga0495681_0007282 3300047470 Bacteria 7101
488 Ga0495681_0014418 3300047470 Bacteria 4530
489 Ga0495681_0025807 3300047470 Bacteria 3070
490 Ga0495681_0027142 3300047470 Bacteria 2967
491 Ga0495681_0051538 3300047470 Bacteria 1935
492 Ga0495684_0034027 3300047471 Bacteria 3909
493 Ga0495686_0002239 3300047472 Bacteria 18677
494 Ga0495686_0096893 3300047472 Bacteria 1784
495 Ga0495686_0111350 3300047472 Bacteria 1641
496 Ga0495593_0000146 3300047673 Bacteria 34680
497 Ga0495593_0068764 3300047673 Bacteria 1842
498 Ga0495602_0042772 3300048088 Bacteria 4124
499 Ga0495615_0009385 3300048090 Bacteria 1923
500 Ga0495626_0000055 3300048091 Bacteria 154219
501 Ga0495626_0000108 3300048091 Bacteria 108112
502 Ga0495626_0000131 3300048091 Bacteria 94532
503 Ga0495626_0000528 3300048091 Bacteria 38040
504 Ga0495626_0005464 3300048091 Bacteria 7424
505 Ga0495626_0007044 3300048091 Bacteria 6312
506 Ga0496100_0004201 3300048903 Bacteria 7600
507 Ga0496100_0073008 3300048903 Bacteria 2295
508 Ga0496101_0002436 3300048904 Bacteria 11436
509 Ga0496101_0043592 3300048904 Bacteria 3207
510 Ga0496101_0123231 3300048904 Bacteria 1962
511 Ga0496102_0000052 3300048905 Bacteria 177388
512 Ga0496102_0014354 3300048905 Bacteria 6882
513 Ga0496102_0106682 3300048905 Bacteria 2607
514 Ga0496102_0234858 3300048905 Bacteria 1728
515 Ga0496103_0000280 3300048906 Bacteria 48189
516 Ga0496104_0025801 3300048907 Bacteria 5419
517 Ga0496105_0001511 3300048908 Bacteria 16442
518 Ga0496105_0061014 3300048908 Bacteria 3111
519 Ga0496106_0050136 3300048909 Bacteria 3146
520 Ga0496106_0063384 3300048909 Bacteria 2809
521 Ga0496106_0311616 3300048909 Bacteria 1263
522 Ga0496107_0003109 3300048910 Bacteria 11038
523 Ga0496108_0007231 3300048911 Bacteria 8997
524 Ga0496108_0136028 3300048911 Bacteria 2114
525 Ga0496109_0001861 3300048912 Bacteria 17481
526 Ga0496109_0083507 3300048912 Bacteria 2946
527 Ga0496110_0002932 3300048913 Bacteria 12919
528 Ga0496110_0004438 3300048913 Bacteria 10877
529 Ga0496110_0026602 3300048913 Bacteria 4953
530 Ga0496110_0196507 3300048913 Bacteria 1832
531 Ga0496111_0006752 3300048914 Bacteria 7475
532 Ga0496111_0036578 3300048914 Bacteria 3511
533 Ga0496111_0079791 3300048914 Bacteria 2388
534 Ga0496111_0122623 3300048914 Bacteria 1920
535 Ga0496111_0130734 3300048914 Bacteria 1857
536 Ga0496111_0205885 3300048914 Bacteria 1462
537 Ga0496113_0081645 3300048916 Bacteria 2478
538 Ga0496114_0001260 3300048917 Bacteria 19144
539 Ga0496114_0001641 3300048917 Bacteria 16981
540 Ga0496114_0014586 3300048917 Bacteria 6313
541 Ga0496116_0000967 3300048919 Bacteria 35447
542 Ga0496116_0002130 3300048919 Bacteria 21076
543 Ga0496116_0009926 3300048919 Bacteria 8051
544 Ga0496116_0085727 3300048919 Bacteria 1935
545 Ga0496117_0000010 3300048920 Bacteria 611954
546 Ga0496117_0000461 3300048920 Bacteria 68034
547 Ga0496117_0000899 3300048920 Bacteria 45811
548 Ga0496117_0001093 3300048920 Bacteria 40952
549 Ga0496117_0006283 3300048920 Bacteria 12094
550 Ga0496117_0013152 3300048920 Bacteria 7239
551 Ga0496117_0014630 3300048920 Bacteria 6749
552 Ga0496118_0000009 3300048921 Bacteria 611954
553 Ga0496118_0000106 3300048921 Bacteria 155884
554 Ga0496118_0001115 3300048921 Bacteria 41665
555 Ga0496118_0015072 3300048921 Bacteria 7184
556 Ga0496118_0034595 3300048921 Bacteria 4118
557 Ga0496121_0000149 3300048924 Bacteria 153667
558 Ga0496121_0002573 3300048924 Bacteria 27446
559 Ga0496121_0005330 3300048924 Bacteria 16532
560 Ga0496121_0014302 3300048924 Bacteria 8438
561 Ga0496121_0036119 3300048924 Bacteria 4409
562 Ga0496122_0000388 3300048925 Bacteria 93611
563 Ga0496122_0001880 3300048925 Bacteria 31877
564 Ga0496122_0002387 3300048925 Bacteria 26853
565 Ga0496122_0004618 3300048925 Bacteria 16944
566 Ga0496122_0014388 3300048925 Bacteria 7655
567 Ga0496122_0143839 3300048925 Bacteria 1486
568 Ga0496123_0001620 3300048926 Bacteria 30319
569 Ga0496123_0003435 3300048926 Bacteria 17791
570 Ga0496123_0005379 3300048926 Bacteria 12908
571 Ga0496123_0007862 3300048926 Bacteria 9913
572 Ga0496123_0026816 3300048926 Bacteria 4307
573 Ga0496124_0003407 3300048927 Bacteria 19513
574 Ga0496124_0011349 3300048927 Bacteria 8908
575 Ga0496124_0025613 3300048927 Bacteria 5340
576 Ga0496124_0032274 3300048927 Bacteria 4625
577 Ga0496124_0040537 3300048927 Bacteria 4026
578 Ga0496125_0000038 3300048928 Bacteria 328120
579 Ga0496125_0001343 3300048928 Bacteria 36244
580 Ga0496125_0002932 3300048928 Bacteria 21477
581 Ga0496125_0007570 3300048928 Bacteria 11532
582 Ga0496125_0008277 3300048928 Bacteria 10920
583 Ga0496125_0010628 3300048928 Bacteria 9294
584 Ga0496125_0024083 3300048928 Bacteria 5605
585 Ga0496125_0075969 3300048928 Bacteria 2596
586 Ga0496125_0087409 3300048928 Bacteria 2354
587 Ga0496125_0125215 3300048928 Bacteria 1823
588 Ga0496125_0160935 3300048928 Bacteria 1525
589 Ga0496126_0044237 3300048929 Bacteria 4102
590 Ga0496126_0071812 3300048929 Bacteria 3080
591 Ga0495678_002327 3300049459 Bacteria 13086
592 Ga0495678_006098 3300049459 Bacteria 6483
593 Ga0495678_009347 3300049459 Bacteria 4857
594 Ga0495678_025061 3300049459 Bacteria 2566
595 Ga0495678_037450 3300049459 Bacteria 1970
596 Ga0495678_060134 3300049459 Bacteria 1430
597 Ga0495682_0043250 3300049460 Bacteria 1649
598 Ga0501031_0004484 3300049568 Bacteria 9057
599 Ga0501032_0051988 3300049569 Bacteria 2761
600 Ga0501033_0000203 3300049570 Bacteria 56963
601 Ga0501034_0000055 3300049571 Bacteria 205427
602 Ga0501034_0000199 3300049571 Bacteria 113624
603 Ga0501034_0115763 3300049571 Bacteria 2669
604 Ga0501036_0004256 3300049572 Bacteria 11545
605 Ga0501037_0018830 3300049573 Bacteria 5087
606 Ga0501038_0155506 3300049574 Bacteria 1862
607 Ga0501039_0003555 3300049575 Bacteria 11678
608 Ga0501040_0001416 3300049576 Bacteria 15172
609 Ga0501040_0006631 3300049576 Bacteria 7514
610 Ga0501041_0003671 3300049577 Bacteria 8827
611 Ga0501041_0007438 3300049577 Bacteria 6433
612 Ga0501042_0022030 3300049578 Bacteria 4448
613 Ga0501042_0022537 3300049578 Bacteria 4399
614 Ga0501042_0056212 3300049578 Bacteria 2808
615 Ga0501046_0073243 3300049580 Bacteria 2658
616 Ga0501047_0039298 3300049581 Bacteria 4577
617 Ga0501048_0010542 3300049582 Bacteria 6896
618 Ga0501048_0082309 3300049582 Bacteria 2270
619 Ga0501048_0094169 3300049582 Bacteria 2113
620 Ga0501048_0105150 3300049582 Bacteria 1992
621 Ga0501068_0012250 3300049584 Bacteria 4852
622 Ga0501069_0092999 3300049585 Bacteria 1706
623 Ga0501071_0003577 3300049587 Bacteria 9728
624 Ga0501072_0006753 3300049588 Bacteria 8717
625 Ga0501072_0138757 3300049588 Bacteria 1938
626 Ga0501073_0030972 3300049589 Bacteria 3819
627 Ga0501074_0100962 3300049590 Bacteria 2065
628 Ga0501075_0073844 3300049591 Bacteria 2579
629 Ga0501076_0011201 3300049592 Bacteria 6675
630 Ga0501077_0054662 3300049593 Bacteria 2535
631 Ga0501249_001162 3300049679 Bacteria 5546
632 Ga0501079_0010695 3300049741 Bacteria 6988
633 Ga0501080_0022496 3300049742 Bacteria 5839
634 Ga0501080_0106113 3300049742 Bacteria 2604
635 Ga0501081_0027629 3300049743 Bacteria 3826
636 Ga0501269_000225 3300049766 Bacteria 16532
637 Ga0501035_0001175 3300049822 Bacteria 27278
638 Ga0501035_0057824 3300049822 Bacteria 3457
639 Ga0501035_0070964 3300049822 Bacteria 3084
640 Ga0501044_0074141 3300049823 Bacteria 3458
641 Ga0501045_0001996 3300049824 Bacteria 13779
642 Ga0501045_0031066 3300049824 Bacteria 3868
643 Ga0501045_0099069 3300049824 Bacteria 2156
644 Ga0501045_0119254 3300049824 Bacteria 1959
645 nmdc:mga07m45_123839_c1 3300050496 Bacteria 1494
646 nmdc:mga07m45_20588_c1 3300050496 Bacteria 3584
647 nmdc:mga05p37_15187_c1 3300050507 Bacteria 9247
648 nmdc:mga05p37_15247_c1 3300050507 Bacteria 9232
649 nmdc:mga09592_239_c1 3300050508 Bacteria 39950
650 nmdc:mga09592_4172_c1 3300050508 Bacteria 11672
651 nmdc:mga0qj67_26496_c1 3300050509 Bacteria 4488
652 nmdc:mga0qj67_784_c1 3300050509 Bacteria 21653
653 nmdc:mga06r32_167_c1 3300050510 Bacteria 51343
654 nmdc:mga06r32_186242_c1 3300050510 Bacteria 2063
655 nmdc:mga08y16_18876_c1 3300050511 Bacteria 7264
656 nmdc:mga0a205_44114_c1 3300050515 Bacteria 4298
657 nmdc:mga0sz30_24229_c1 3300050516 Bacteria 2475
658 Ga0500594_0002266 3300053118 Bacteria 4167
659 Ga0500618_000737 3300053125 Bacteria 18686
660 Ga0500659_0000704 3300053135 Bacteria 21594
661 Ga0500586_000366 3300053145 Bacteria 8990
662 Ga0501084_0011649 3300054114 Bacteria 7280
663 Ga0501082_0005855 3300060353 Bacteria 10674
664 Ga0501082_0023752 3300060353 Bacteria 5286
665 Ga0530510_0004711 3300061734 Bacteria 9435
666 Ga0530510_0032672 3300061734 Bacteria 3745
667 2501075564 2501025501 Bacteria 7768574
668 2501084000 2501025502 Bacteria 9641094
669 2501412687 2501025504 Bacteria 8008976
670 2511093445 2510917013 Bacteria 9951648
671 2511099894 2510917014 Bacteria 8296963
672 2511102321 2510917015 Bacteria 7950052
673 2511265901 2511231006 Bacteria 6794709
674 2511277462 2511231008 Bacteria 6624100
675 2511300268 2511231012 Bacteria 6738011
676 2511322618 2511231015 Bacteria 6598026
677 2511334577 2511231017 Bacteria 6503007
678 2511336412 2511231018 Bacteria 6436256
679 2511343308 2511231019 Bacteria 6520662
680 2511354793 2511231021 Bacteria 7302637
681 2511367945 2511231023 Bacteria 6808468
682 2511376223 2511231024 Bacteria 5835885
683 2512323788 2512047018 Bacteria 6663241
684 2513557943 2513237082 Bacteria 8640282
685 2513565563 2513237083 Bacteria 8410967
686 2513955389 2513237150 Bacteria 6553639
687 2516024958 2515154189 Bacteria 9629850
688 2552747291 2551306352 Bacteria 3873115
689 2555670106 2554235341 Bacteria 6867980
690 2566993837 2565956761 Bacteria 6601618
691 2574431526 2574179768 Bacteria 4907129
692 2583791955 2582580891 Bacteria 6800976
693 2597858014 2597489887 Bacteria 6666321
694 2599352860 2599185160 Bacteria 6844013
695 2599359205 2599185161 Bacteria 6960462
696 2599365274 2599185162 Bacteria 6957254
697 2599371899 2599185163 Bacteria 6995158
698 2599377968 2599185164 Bacteria 6841688
699 2599384655 2599185165 Bacteria 6843250
700 2599390757 2599185166 Bacteria 6959206
701 2599402942 2599185168 Bacteria 6997636
702 2599459694 2599185181 Bacteria 6844519
703 2599465967 2599185182 Bacteria 6883168
704 2599485045 2599185185 Bacteria 6652270
705 2599488715 2599185186 Bacteria 6831633
706 2600212299 2599185356 Bacteria 6843884
707 2600366585 2600254931 Bacteria 6734225
708 2601670441 2600255292 Bacteria 6300551
709 2601772467 2600255313 Bacteria 6842543
710 2640733706 2639762793 Bacteria 3943681
711 2643843865 2643221565 Bacteria 6216018
712 2643851396 2643221567 Bacteria 4163945
713 2643953167 2643221589 Bacteria 6250934
714 2644025164 2643221602 Bacteria 6249926
715 2644138013 2643221624 Bacteria 4384879
716 2644230438 2643221641 Bacteria 4490190
717 2671095563 2667528171 Bacteria 6900659
718 2678230721 2675903507 Bacteria 3737791
719 2723879542 2721755763 Bacteria 4464185
720 2739362815 2738543034 Bacteria 6084756
721 2743737480 2740892503 Bacteria 6855563
722 2746087356 2744054900 Bacteria 8399525
723 2746093137 2744054901 Bacteria 8397047
724 2765584036 2765235841 Bacteria 6137024
725 2774119984 2773857670 Bacteria 6407454
726 2774388758 2773857761 Bacteria 3837365
727 2774438616 2773857770 Bacteria 3911866
728 2784312085 2784132072 Bacteria 6596533
729 2807408496 2806310737 Bacteria 5751088
730 2807456811 2806310745 Bacteria 5742165
731 2808872791 2808606365 Bacteria 4301966
732 2808959375 2808606382 Bacteria 6841132
733 2808973012 2808606384 Bacteria 8474373
734 2809007822 2808606390 Bacteria 8476311
735 2809016529 2808606391 Bacteria 8308166
736 2812367075 2811994881 Bacteria 6298475
737 2819667740 2818991458 Bacteria 4794049
738 2819700958 2818991464 Bacteria 6907494
739 2840881676 2840878972 Bacteria 5483153
740 2842712045 2842711865 Bacteria 7155354
741 2844670726 2844665904 Bacteria 6817974
742 2852617669 2852612431 Bacteria 6885235
743 2852672967 2852667396 Bacteria 6885555
744 2857548218 2857547612 Bacteria 6179999
745 2857566017 2857564685 Bacteria 6290584
746 2883094889 2883087390 Bacteria 9532701
747 2885085214 2885080285 Bacteria 6355622
748 2904536927 2904535858 Bacteria 6308016
749 2904768221 2904765812 Bacteria 5369154
750 2904770237 2904765812 Bacteria 5369154
751 2904775455 2904770941 Bacteria 5580202
752 2908815521 2908811453 Bacteria 5478616
753 2912966680 2912963787 Bacteria 5646108
754 2917073929 2917070673 Bacteria 6868303
755 2919183611 2919182534 Bacteria 3907101
756 2919423358 2919420072 Bacteria 5390363
757 2919435966 2919432681 Bacteria 5390474
758 2919449109 2919446982 Bacteria 3994487
759 2919461544 2919456309 Bacteria 6586567
760 2922555350 2922554459 Bacteria 6683962
761 2923156521 2923153595 Bacteria 6870622
762 2923521114 2923519811 Bacteria 6298479
763 2932412813 2932410948 Bacteria 6312192
764 2932420328 2932416698 Bacteria 6315112
765 2935357016 2935353572 Unclassified 6955622
766 2939642388 2939636861 Bacteria 6297853
767 2939651636 2939651529 Bacteria 5895393
768 2945962807 2945961074 Bacteria 7342064
769 3007395905 3007395558 Bacteria 6755444
770 3007623231 3007619802 Bacteria 6411688
771 3007804907 3007803356 Bacteria 5931491
772 637320471 637000220 Bacteria 7074893
773 644751631 644736347 Bacteria 6476522
774 8002746239 8002745576 Bacteria 4840272
775 8003961952 8003955200 Bacteria 8601927
776 8011352261 8011350971 Bacteria 6158957
777 8015690715 8015687852 Bacteria 6613826
778 8052497326 8052494512 Bacteria 5765634
779 8055773850 8055770955 Bacteria 6827675
780 8055880386 8055878733 Bacteria 5907058
781 8055883728 8055878733 Bacteria 5907058
782 8056123297 8056120720 Bacteria 5758328
783 8056181424 8056177738 Bacteria 6748268
784 Ga0207428_10123741
785 MRS2a_Contig_7291
786 MRS2a_Contig_9136
787 SwRhRL2b_contig_2780838
788 JGI24739J22299_10028397
789 JGI24735J21928_10000368
790 JGI24735J21928_10001145
791 Ga0055525_1000009
792 Ga0055542_1009065
793 Ga0055526_1008543
794 Ga0055526_1012329
795 Ga0055524_1000402
796 Ga0055536_1000014
797 Ga0055536_1000158
798 Ga0055534_1005186
799 Ga0055530_10000009
800 Ga0055540_1000342
801 Ga0058692_1000010
802 JGI25405J52794_10006845
803 Ga0065703_1000063
804 Ga0065714_10008515
805 Ga0065704_10002892
806 Ga0065704_10074925
807 Ga0065704_10107275
808 Ga0070658_10006576
809 Ga0070658_10013426
810 Ga0070660_100001047
811 Ga0070669_100030253
812 Ga0070675_100256677
813 Ga0070663_100050937
814 Ga0070678_100101253
815 Ga0068855_100003256
816 Ga0068855_100011429
817 Ga0068856_100228432
818 Ga0081455_10001059
819 Ga0081455_10017164
820 Ga0081538_10003479
821 Ga0081538_10062383
822 Ga0075369_10035244
823 Ga0075428_100009062
824 Ga0075430_100009064
825 Ga0075430_100018249
826 Ga0075431_100003419
827 Ga0075431_100020307
828 Ga0075431_100088100
829 Ga0075434_100199804
830 Ga0075429_100000338
831 Ga0075429_100075999
832 Ga0099823_1000004
833 Ga0079104_1000097
834 Ga0105251_10004006
835 Ga0105251_10011394
836 Ga0105251_10050694
837 Ga0105244_10000053
838 Ga0105244_10000449
839 Ga0105244_10001624
840 Ga0105244_10022330
841 Ga0105250_10000092
842 Ga0105250_10000131
843 Ga0111539_10026704
844 Ga0111539_10228621
845 Ga0105245_10097184
846 Ga0105247_10000472
847 Ga0114129_10030167
848 Ga0114129_10038538
849 Ga0105243_10038876
850 Ga0105243_10084794
851 Ga0105248_10015699
852 Ga0105237_10207881
853 Ga0105239_10005327
854 Ga0105246_10001375
855 Ga0157373_10062294
856 Ga0157371_10001313
857 Ga0157371_10003361
858 Ga0157371_10029236
859 Ga0157370_10003861
860 Ga0157370_10053744
861 Ga0157369_10001578
862 Ga0157369_10188651
863 Ga0157374_10000146
864 Ga0163162_10004400
865 Ga0163162_10011171
866 Ga0163162_10243166
867 Ga0157372_10003027
868 Ga0157375_10003051
869 Ga0157375_10187362
870 Ga0182008_10000862
871 Ga0182008_10011205
872 Ga0182008_10012491
873 Ga0182008_10085737
874 Ga0182006_1000010
875 Ga0182006_1008045
876 Ga0182006_1010339
877 Ga0182007_10000030
878 Ga0182007_10011317
879 Ga0182007_10018956
880 Ga0182005_1000009
881 Ga0182005_1009614
882 Ga0163161_10041020
883 Ga0163161_10045708
884 Ga0213872_10000135
885 Ga0224712_10000073
886 Ga0209672_101017
887 Ga0209563_100015
888 Ga0209148_1000794
889 Ga0209565_1000104
890 Ga0209675_1000065
891 Ga0209676_1000003
892 Ga0209676_1000044
893 Ga0209676_1000535
894 Ga0209676_1002148
895 Ga0209025_1000147
896 Ga0209025_1007698
897 Ga0209564_1000006
898 Ga0209564_1000080
899 Ga0209564_1000253
900 Ga0209564_1000923
901 Ga0209758_1010657
902 Ga0209050_1000004
903 Ga0209050_1000148
904 Ga0209256_1000543
905 Ga0207426_1003874
906 Ga0209051_1000006
907 Ga0209051_1015660
908 Ga0207696_1000006
909 Ga0207696_1000160
910 Ga0207696_1000225
911 Ga0207696_1008385
912 Ga0207655_1000049
913 Ga0207655_1000070
914 Ga0207655_1000077
915 Ga0207655_1000112
916 Ga0207655_1000181
917 Ga0207655_1005043
918 Ga0207713_1000113
919 Ga0207713_1000232
920 Ga0207713_1000725
921 Ga0207713_1002997
922 Ga0207713_1006136
923 Ga0207713_1006407
924 Ga0207713_1010896
925 Ga0207713_1013933
926 Ga0207713_1014084
927 Ga0207713_1032743
928 Ga0207710_10000009
929 Ga0207647_10001767
930 Ga0207705_10000783
931 Ga0207705_10002884
932 Ga0207705_10014878
933 Ga0207657_10009942
934 Ga0207659_10196664
935 Ga0207687_10053315
936 Ga0207709_10000001
937 Ga0207709_10078020
938 Ga0207711_10005662
939 Ga0207667_10004017
940 Ga0207667_10014081
941 Ga0207667_10021335
942 Ga0207651_10214103
943 Ga0207639_10014191
944 Ga0207674_10093515
945 Ga0207683_10128645
946 Ga0207698_10046047
947 Ga0209281_1000136
948 Ga0209389_1000006
949 Ga0209371_1000006
950 Ga0207428_10051686
951 Ga0265337_1007535
952 Ga0265334_10007864
953 Ga0307515_10073804
954 Ga0265338_10000547
955 Ga0265324_10013494
956 Ga0268256_1000007
957 Ga0265316_10018300
958 Ga0307508_10112036
959 Ga0265314_10012712
960 Ga0265314_10061899
961 Ga0307405_10056265
962 Ga0307405_10069783
963 Ga0307410_10021181
964 Ga0307406_10014342
965 Ga0307407_10020070
966 Ga0307407_10022645
967 Ga0307409_100001597
968 Ga0307409_100014810
969 Ga0307414_10117626
970 Ga0307415_100001340
971 Ga0307415_100071213
972 Ga0316584_0104374
973 Ga0395899_0000080
974 Ga0395899_0002023
975 Ga0395899_0004044
976 Ga0395899_0058667
977 Ga0395900_0000087
978 Ga0395900_0000411
979 Ga0395900_0000615
980 Ga0395900_0003488
981 Ga0395900_0031034
982 Ga0395898_0000679
983 Ga0395898_0002992
984 Ga0395898_0037443
985 Ga0395898_0072984
986 Ga0395898_0216905
987 Ga0395905_0024855
988 Ga0395901_0000053
989 Ga0395901_0000084
990 Ga0395901_0000328
991 Ga0395901_0012510
992 Ga0395901_0100538
993 Ga0395901_0219019
994 Ga0436360_0818816
995 Ga0436361_0080101
996 Ga0436361_0115159
997 Ga0436361_0400312
998 Ga0436361_0402857
999 Ga0439436_0000475
1000 Ga0439438_003774
1001 Ga0439438_011913
1002 Ga0439447_000206
1003 Ga0439466_0000216
1004 Ga0439466_0002842
1005 Ga0451791_0311755
1006 Ga0451800_0068730
1007 Ga0451841_0238766
1008 Ga0451853_1144978
1009 Ga0439448_0034629
1010 Ga0439432_000972
1011 Ga0439449_0047827
1012 Ga0439452_000779
1013 Ga0439456_004376
1014 Ga0439463_000483
1015 Ga0450911_003292
1016 Ga0450922_000045
1017 Ga0450923_000523
1018 Ga0450902_000306
1019 Ga0450904_000071
1020 Ga0439434_0000751
1021 Ga0450901_000131
1022 Ga0450901_002693
1023 Ga0451577_0008240
1024 Ga0466977_0002989
1025 Ga0466966_0093253
1026 Ga0466966_0145050
1027 Ga0466961_0006286
1028 Ga0453684_0048355
1029 Ga0466957_0107909
1030 Ga0466960_0101755
1031 Ga0466959_0082393
1032 Ga0466959_0087964
1033 Ga0466967_0016544
1034 Ga0466967_0072157
1035 Ga0495617_001890
1036 Ga0495617_004841
1037 Ga0495627_000140
1038 Ga0495627_001874
1039 Ga0495627_004057
1040 Ga0495627_018629
1041 Ga0495603_0024431
1042 Ga0495603_0045056
1043 Ga0495590_0001454
1044 Ga0495590_0015099
1045 Ga0495590_0019709
1046 Ga0495591_000026
1047 Ga0495591_002234
1048 Ga0495591_009858
1049 Ga0495591_016944
1050 Ga0495591_019100
1051 Ga0495591_020905
1052 Ga0495638_0000254
1053 Ga0495638_0000449
1054 Ga0495638_0003379
1055 Ga0495638_0006753
1056 Ga0495638_0047877
1057 Ga0495638_0071549
1058 Ga0495653_0000097
1059 Ga0495653_0043914
1060 Ga0495650_0000232
1061 Ga0495650_0001039
1062 Ga0495650_0007237
1063 Ga0495650_0007549
1064 Ga0495650_0015560
1065 Ga0495605_0000170
1066 Ga0495605_0000257
1067 Ga0495605_0000913
1068 Ga0495605_0001525
1069 Ga0495605_0003624
1070 Ga0495605_0004025
1071 Ga0495605_0004580
1072 Ga0495605_0005917
1073 Ga0495664_0031354
1074 Ga0495664_0049656
1075 Ga0495584_0000128
1076 Ga0495584_0004140
1077 Ga0495584_0011954
1078 Ga0495585_0000045
1079 Ga0495585_0000234
1080 Ga0495585_0001405
1081 Ga0495585_0001866
1082 Ga0495585_0007038
1083 Ga0495585_0008186
1084 Ga0495594_0004074
1085 Ga0495594_0009901
1086 Ga0495596_0000003
1087 Ga0495607_0000138
1088 Ga0495607_0000249
1089 Ga0495607_0000546
1090 Ga0495607_0002728
1091 Ga0495607_0019654
1092 Ga0495607_0051455
1093 Ga0495607_0053202
1094 Ga0495583_0002141
1095 Ga0495583_0003704
1096 Ga0495606_0000162
1097 Ga0495606_0000280
1098 Ga0495606_0000806
1099 Ga0495606_0000965
1100 Ga0495606_0001256
1101 Ga0495606_0003849
1102 Ga0495606_0003983
1103 Ga0495606_0008139
1104 Ga0495606_0009499
1105 Ga0495606_0010074
1106 Ga0495606_0060287
1107 Ga0495610_0001518
1108 Ga0495610_0003134
1109 Ga0495610_0006069
1110 Ga0495610_0006890
1111 Ga0495610_0010386
1112 Ga0495610_0022321
1113 Ga0495616_0025078
1114 Ga0495616_0064280
1115 Ga0495620_0000006
1116 Ga0495620_0002243
1117 Ga0495620_0002910
1118 Ga0495620_0024697
1119 Ga0495628_0000037
1120 Ga0495628_0009630
1121 Ga0495630_0009539
1122 Ga0495631_0000104
1123 Ga0495631_0001094
1124 Ga0495631_0040443
1125 Ga0495632_0000395
1126 Ga0495632_0000448
1127 Ga0495632_0001386
1128 Ga0495632_0003627
1129 Ga0495632_0045687
1130 Ga0495632_0065205
1131 Ga0495637_0000853
1132 Ga0495637_0001188
1133 Ga0495637_0007800
1134 Ga0495637_0013290
1135 Ga0495637_0020686
1136 Ga0495637_0039547
1137 Ga0495643_0000029
1138 Ga0495643_0000143
1139 Ga0495643_0000804
1140 Ga0495643_0009690
1141 Ga0495643_0024614
1142 Ga0495643_0046420
1143 Ga0495643_0058379
1144 Ga0495644_0000170
1145 Ga0495648_0000126
1146 Ga0495648_0000259
1147 Ga0495648_0003659
1148 Ga0495648_0005205
1149 Ga0495648_0008347
1150 Ga0495648_0059505
1151 Ga0495666_0000069
1152 Ga0495666_0003413
1153 Ga0495666_0008984
1154 Ga0495642_0000015
1155 Ga0495642_0004518
1156 Ga0495654_0001371
1157 Ga0495654_0003483
1158 Ga0495654_0014730
1159 Ga0495654_0016873
1160 Ga0495654_0017264
1161 Ga0495654_0018600
1162 Ga0495654_0058287
1163 Ga0495654_0061108
1164 Ga0495587_0001099
1165 Ga0495609_0000634
1166 Ga0495609_0005172
1167 Ga0495609_0060147
1168 Ga0495597_0000193
1169 Ga0495597_0000253
1170 Ga0495597_0000644
1171 Ga0495597_0040184
1172 Ga0495597_0046053
1173 Ga0495597_0083892
1174 Ga0495645_0048931
1175 Ga0495622_0001272
1176 Ga0495622_0037574
1177 Ga0495622_0037827
1178 Ga0495633_0000063
1179 Ga0495633_0000425
1180 Ga0495633_0000642
1181 Ga0495633_0013884
1182 Ga0495668_0000254
1183 Ga0495668_0000360
1184 Ga0495668_0001663
1185 Ga0495668_0001785
1186 Ga0495634_0000844
1187 Ga0495625_0006457
1188 Ga0495625_0006598
1189 Ga0495625_0013046
1190 Ga0495625_0016950
1191 Ga0495625_0024618
1192 Ga0495625_0034183
1193 Ga0495635_0007684
1194 Ga0495661_0000045
1195 Ga0495661_0000243
1196 Ga0495661_0014325
1197 Ga0495661_0016653
1198 Ga0495588_0002096
1199 Ga0495588_0012720
1200 Ga0495588_0081773
1201 Ga0495623_0005211
1202 Ga0495623_0006585
1203 Ga0495623_0018811
1204 Ga0495646_0006539
1205 Ga0495646_0008394
1206 Ga0495646_0034860
1207 Ga0495613_0007039
1208 Ga0495670_0000334
1209 Ga0495670_0002833
1210 Ga0495670_0025584
1211 Ga0495671_0001724
1212 Ga0495671_0004086
1213 Ga0495671_0004132
1214 Ga0495671_0004346
1215 Ga0495671_0016630
1216 Ga0495671_0022791
1217 Ga0495671_0028166
1218 Ga0495671_0057684
1219 Ga0495649_0003272
1220 Ga0495649_0004143
1221 Ga0495649_0004590
1222 Ga0495649_0008672
1223 Ga0495649_0008955
1224 Ga0495649_0009416
1225 Ga0495649_0012938
1226 Ga0495649_0049139
1227 Ga0495589_0000940
1228 Ga0495589_0004178
1229 Ga0495589_0004848
1230 Ga0495589_0048732
1231 Ga0495600_0012778
1232 Ga0495660_0000388
1233 Ga0495660_0005616
1234 Ga0495660_0005746
1235 Ga0495660_0015272
1236 Ga0495660_0022486
1237 Ga0495604_0002332
1238 Ga0495604_0016306
1239 Ga0495672_0000213
1240 Ga0495672_0001762
1241 Ga0495672_0002378
1242 Ga0495672_0002447
1243 Ga0495672_0002741
1244 Ga0495680_0000543
1245 Ga0495680_0038665
1246 Ga0495683_0000199
1247 Ga0495683_0000215
1248 Ga0495683_0006410
1249 Ga0495683_0042327
1250 Ga0495687_000419
1251 Ga0495687_000660
1252 Ga0495687_000861
1253 Ga0495687_000898
1254 Ga0495687_001758
1255 Ga0495675_0013668
1256 Ga0495679_001460
1257 Ga0495679_001962
1258 Ga0495679_011372
1259 Ga0495673_0000027
1260 Ga0495673_0000084
1261 Ga0495673_0000251
1262 Ga0495673_0001757
1263 Ga0495673_0002092
1264 Ga0495673_0002608
1265 Ga0495673_0004328
1266 Ga0495681_0000122
1267 Ga0495681_0000180
1268 Ga0495681_0000291
1269 Ga0495681_0001803
1270 Ga0495681_0007282
1271 Ga0495681_0014418
1272 Ga0495681_0025807
1273 Ga0495681_0027142
1274 Ga0495681_0051538
1275 Ga0495684_0034027
1276 Ga0495686_0002239
1277 Ga0495686_0096893
1278 Ga0495686_0111350
1279 Ga0495593_0000146
1280 Ga0495593_0068764
1281 Ga0495602_0042772
1282 Ga0495615_0009385
1283 Ga0495626_0000055
1284 Ga0495626_0000108
1285 Ga0495626_0000131
1286 Ga0495626_0000528
1287 Ga0495626_0005464
1288 Ga0495626_0007044
1289 Ga0496100_0004201
1290 Ga0496100_0073008
1291 Ga0496101_0002436
1292 Ga0496101_0043592
1293 Ga0496101_0123231
1294 Ga0496102_0000052
1295 Ga0496102_0014354
1296 Ga0496102_0106682
1297 Ga0496102_0234858
1298 Ga0496103_0000280
1299 Ga0496104_0025801
1300 Ga0496105_0001511
1301 Ga0496105_0061014
1302 Ga0496106_0050136
1303 Ga0496106_0063384
1304 Ga0496106_0311616
1305 Ga0496107_0003109
1306 Ga0496108_0007231
1307 Ga0496108_0136028
1308 Ga0496109_0001861
1309 Ga0496109_0083507
1310 Ga0496110_0002932
1311 Ga0496110_0004438
1312 Ga0496110_0026602
1313 Ga0496110_0196507
1314 Ga0496111_0006752
1315 Ga0496111_0036578
1316 Ga0496111_0079791
1317 Ga0496111_0122623
1318 Ga0496111_0130734
1319 Ga0496111_0205885
1320 Ga0496113_0081645
1321 Ga0496114_0001260
1322 Ga0496114_0001641
1323 Ga0496114_0014586
1324 Ga0496116_0000967
1325 Ga0496116_0002130
1326 Ga0496116_0009926
1327 Ga0496116_0085727
1328 Ga0496117_0000010
1329 Ga0496117_0000461
1330 Ga0496117_0000899
1331 Ga0496117_0001093
1332 Ga0496117_0006283
1333 Ga0496117_0013152
1334 Ga0496117_0014630
1335 Ga0496118_0000009
1336 Ga0496118_0000106
1337 Ga0496118_0001115
1338 Ga0496118_0015072
1339 Ga0496118_0034595
1340 Ga0496121_0000149
1341 Ga0496121_0002573
1342 Ga0496121_0005330
1343 Ga0496121_0014302
1344 Ga0496121_0036119
1345 Ga0496122_0000388
1346 Ga0496122_0001880
1347 Ga0496122_0002387
1348 Ga0496122_0004618
1349 Ga0496122_0014388
1350 Ga0496122_0143839
1351 Ga0496123_0001620
1352 Ga0496123_0003435
1353 Ga0496123_0005379
1354 Ga0496123_0007862
1355 Ga0496123_0026816
1356 Ga0496124_0003407
1357 Ga0496124_0011349
1358 Ga0496124_0025613
1359 Ga0496124_0032274
1360 Ga0496124_0040537
1361 Ga0496125_0000038
1362 Ga0496125_0001343
1363 Ga0496125_0002932
1364 Ga0496125_0007570
1365 Ga0496125_0008277
1366 Ga0496125_0010628
1367 Ga0496125_0024083
1368 Ga0496125_0075969
1369 Ga0496125_0087409
1370 Ga0496125_0125215
1371 Ga0496125_0160935
1372 Ga0496126_0044237
1373 Ga0496126_0071812
1374 Ga0495678_002327
1375 Ga0495678_006098
1376 Ga0495678_009347
1377 Ga0495678_025061
1378 Ga0495678_037450
1379 Ga0495678_060134
1380 Ga0495682_0043250
1381 Ga0501031_0004484
1382 Ga0501032_0051988
1383 Ga0501033_0000203
1384 Ga0501034_0000055
1385 Ga0501034_0000199
1386 Ga0501034_0115763
1387 Ga0501036_0004256
1388 Ga0501037_0018830
1389 Ga0501038_0155506
1390 Ga0501039_0003555
1391 Ga0501040_0001416
1392 Ga0501040_0006631
1393 Ga0501041_0003671
1394 Ga0501041_0007438
1395 Ga0501042_0022030
1396 Ga0501042_0022537
1397 Ga0501042_0056212
1398 Ga0501046_0073243
1399 Ga0501047_0039298
1400 Ga0501048_0010542
1401 Ga0501048_0082309
1402 Ga0501048_0094169
1403 Ga0501048_0105150
1404 Ga0501068_0012250
1405 Ga0501069_0092999
1406 Ga0501071_0003577
1407 Ga0501072_0006753
1408 Ga0501072_0138757
1409 Ga0501073_0030972
1410 Ga0501074_0100962
1411 Ga0501075_0073844
1412 Ga0501076_0011201
1413 Ga0501077_0054662
1414 Ga0501249_001162
1415 Ga0501079_0010695
1416 Ga0501080_0022496
1417 Ga0501080_0106113
1418 Ga0501081_0027629
1419 Ga0501269_000225
1420 Ga0501035_0001175
1421 Ga0501035_0057824
1422 Ga0501035_0070964
1423 Ga0501044_0074141
1424 Ga0501045_0001996
1425 Ga0501045_0031066
1426 Ga0501045_0099069
1427 Ga0501045_0119254
1428 nmdc:mga07m45_123839_c1
1429 nmdc:mga07m45_20588_c1
1430 nmdc:mga05p37_15187_c1
1431 nmdc:mga05p37_15247_c1
1432 nmdc:mga09592_239_c1
1433 nmdc:mga09592_4172_c1
1434 nmdc:mga0qj67_26496_c1
1435 nmdc:mga0qj67_784_c1
1436 nmdc:mga06r32_167_c1
1437 nmdc:mga06r32_186242_c1
1438 nmdc:mga08y16_18876_c1
1439 nmdc:mga0a205_44114_c1
1440 nmdc:mga0sz30_24229_c1
1441 Ga0500594_0002266
1442 Ga0500618_000737
1443 Ga0500659_0000704
1444 Ga0500586_000366
1445 Ga0501084_0011649
1446 Ga0501082_0005855
1447 Ga0501082_0023752
1448 Ga0530510_0004711
1449 Ga0530510_0032672
1450 2501075564
1451 2501084000
1452 2501412687
1453 2511093445
1454 2511099894
1455 2511102321
1456 2511265901
1457 2511277462
1458 2511300268
1459 2511322618
1460 2511334577
1461 2511336412
1462 2511343308
1463 2511354793
1464 2511367945
1465 2511376223
1466 2512323788
1467 2513557943
1468 2513565563
1469 2513955389
1470 2516024958
1471 2552747291
1472 2555670106
1473 2566993837
1474 2574431526
1475 2583791955
1476 2597858014
1477 2599352860
1478 2599359205
1479 2599365274
1480 2599371899
1481 2599377968
1482 2599384655
1483 2599390757
1484 2599402942
1485 2599459694
1486 2599465967
1487 2599485045
1488 2599488715
1489 2600212299
1490 2600366585
1491 2601670441
1492 2601772467
1493 2640733706
1494 2643843865
1495 2643851396
1496 2643953167
1497 2644025164
1498 2644138013
1499 2644230438
1500 2671095563
1501 2678230721
1502 2723879542
1503 2739362815
1504 2743737480
1505 2746087356
1506 2746093137
1507 2765584036
1508 2774119984
1509 2774388758
1510 2774438616
1511 2784312085
1512 2807408496
1513 2807456811
1514 2808872791
1515 2808959375
1516 2808973012
1517 2809007822
1518 2809016529
1519 2812367075
1520 2819667740
1521 2819700958
1522 2840881676
1523 2842712045
1524 2844670726
1525 2852617669
1526 2852672967
1527 2857548218
1528 2857566017
1529 2883094889
1530 2885085214
1531 2904536927
1532 2904768221
1533 2904770237
1534 2904775455
1535 2908815521
1536 2912966680
1537 2917073929
1538 2919183611
1539 2919423358
1540 2919435966
1541 2919449109
1542 2919461544
1543 2922555350
1544 2923156521
1545 2923521114
1546 2932412813
1547 2932420328
1548 2935357016
1549 2939642388
1550 2939651636
1551 2945962807
1552 3007395905
1553 3007623231
1554 3007804907
1555 637320471
1556 644751631
1557 8002746239
1558 8003961952
1559 8011352261
1560 8015690715
1561 8052497326
1562 8055773850
1563 8055880386
1564 8055883728
1565 8056123297
1566 8056181424

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14535

AMP-binding_C_2

AMP-binding enzyme C-terminal domain

361

457

0.95

PF00501

AMP-binding

AMP-binding enzyme

51

318

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4o-assembly1.cif.gz_B crystal structure of paak2 in complex with phenylacetyl adenylate 0.9718 14 438
4r1m-assembly2.cif.gz_C crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution 0.9625 17 438
4r1l-assembly1.cif.gz_A crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution 0.9604 17 440
4r1m-assembly1.cif.gz_A crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution 0.9566 17 440
6he0-assembly1.cif.gz_A-2 crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state 0.9565 18 439
ID Description Score Start End Superfamily
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9824 14 335 3.40.50.12780
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9704 14 335 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9613 17 335 3.40.50.12780
af_P76085_328_435_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9546 334 439 3.30.300.30
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9319 17 335 3.40.50.12780
ID Description Score Start End GO Terms
AF-A0A4R9C0I3-F1-model_v4 Phenylacetate--CoA ligase 0.9921 219 344
AF-A0A7X6EMY5-F1-model_v4 deleted 0.9882 179 268
AF-A0A4R9C0I3-F1-model_v4 Phenylacetate--CoA ligase 0.9843 219 344
AF-A0A7Y8V6J1-F1-model_v4 deleted 0.9823 17 264
AF-A0A357NBS0-F1-model_v4 Phenylacetate--CoA ligase 0.9794 124 315 GO:0016874

Map