F480561

General Info

Members Datasets Scaffolds Average Seq Length
781 266 1562 167

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10011117|Ga0114129_100111174
Length 185
Sequence MGDAAARQRPDHAEELTVPQPVTYRGMSLVIPDNDSEWNEYFALARRHTLMVRACTACGLMRYPPTHACPWCMDLGWKWQEVSGKGTIHSYEIVMHAIQPGFREITPYAVVLVELDEQAGQPTPDEALRIVANLVKPDFTPEAEAKVAIGARVRVAFQDLSDEFALPQFTLTDEAPVGRVWRLGG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
196 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
197 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 98.85
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10011117 3300009147 Bacteria 12829
2 Ga0065715_10119923 3300005293 Bacteria 2273
3 Ga0065707_10121056 3300005295 Bacteria 2119
4 Ga0065707_10352890 3300005295 Bacteria 915
5 Ga0065707_10951470 3300005295 Unclassified 552
6 Ga0070676_10028872 3300005328 Bacteria 3152
7 Ga0070676_10227759 3300005328 Bacteria 1234
8 Ga0070690_100134033 3300005330 Unclassified 1676
9 Ga0070670_100032526 3300005331 Bacteria 4492
10 Ga0070677_10341094 3300005333 Unclassified 773
11 Ga0068869_100005276 3300005334 Bacteria 8120
12 Ga0070666_10106707 3300005335 Bacteria 1935
13 Ga0070666_10729078 3300005335 Bacteria 728
14 Ga0070680_100001904 3300005336 Bacteria 15322
15 Ga0070682_100000483 3300005337 Bacteria 24992
16 Ga0068868_100259397 3300005338 Unclassified 1465
17 Ga0070660_100000594 3300005339 Bacteria 24277
18 Ga0070689_100078149 3300005340 Bacteria 2594
19 Ga0070689_100138925 3300005340 Bacteria 1953
20 Ga0070689_100289607 3300005340 Bacteria 1360
21 Ga0070689_100827240 3300005340 Bacteria 816
22 Ga0070689_101323272 3300005340 Unclassified 649
23 Ga0070691_10006789 3300005341 Bacteria 5233
24 Ga0070687_100003586 3300005343 Bacteria 6051
25 Ga0070687_100758080 3300005343 Unclassified 683
26 Ga0070661_100064930 3300005344 Bacteria 2682
27 Ga0070692_10004289 3300005345 Bacteria 5929
28 Ga0070692_10257953 3300005345 Bacteria 1047
29 Ga0070669_100008950 3300005353 Bacteria 7145
30 Ga0070669_100460096 3300005353 Unclassified 1050
31 Ga0070675_100009657 3300005354 Bacteria 7511
32 Ga0070688_100232811 3300005365 Bacteria 1304
33 Ga0070659_100000628 3300005366 Bacteria 25804
34 Ga0070659_100130731 3300005366 Bacteria 2039
35 Ga0070703_10013461 3300005406 Bacteria 2324
36 Ga0070703_10031955 3300005406 Unclassified 1596
37 Ga0070709_10152425 3300005434 Bacteria 1599
38 Ga0070711_100019303 3300005439 Bacteria 4373
39 Ga0070711_100065820 3300005439 Bacteria 2536
40 Ga0070705_100003562 3300005440 Bacteria 7627
41 Ga0070705_100093054 3300005440 Bacteria 1883
42 Ga0070705_100340575 3300005440 Bacteria 1090
43 Ga0070705_100435755 3300005440 Bacteria 980
44 Ga0070705_100517666 3300005440 Bacteria 909
45 Ga0070705_100763319 3300005440 Bacteria 766
46 Ga0070700_100203299 3300005441 Bacteria 1393
47 Ga0070694_100000353 3300005444 Bacteria 24635
48 Ga0070694_100005226 3300005444 Bacteria 7844
49 Ga0070694_100016507 3300005444 Bacteria 4647
50 Ga0070694_100027744 3300005444 Bacteria 3680
51 Ga0070694_100102062 3300005444 Bacteria 2031
52 Ga0070694_100221300 3300005444 Bacteria 1420
53 Ga0070694_100291521 3300005444 Bacteria 1247
54 Ga0070708_100002746 3300005445 Bacteria 13673
55 Ga0070708_100055522 3300005445 Bacteria 3522
56 Ga0070708_100183331 3300005445 Bacteria 1957
57 Ga0070708_100231006 3300005445 Bacteria 1736
58 Ga0070708_100295595 3300005445 Unclassified 1525
59 Ga0070708_101594917 3300005445 Bacteria 607
60 Ga0070708_101594918 3300005445 Unclassified 607
61 Ga0070663_100001289 3300005455 Bacteria 13732
62 Ga0070662_100025394 3300005457 Bacteria 4090
63 Ga0070681_10117180 3300005458 Bacteria 2600
64 Ga0068867_100028066 3300005459 Bacteria 4050
65 Ga0068867_100842940 3300005459 Unclassified 821
66 Ga0070706_100003807 3300005467 Bacteria 14736
67 Ga0070706_100036813 3300005467 Bacteria 4520
68 Ga0070706_100046250 3300005467 Bacteria 4018
69 Ga0070706_100068554 3300005467 Bacteria 3280
70 Ga0070706_100105869 3300005467 Bacteria 2617
71 Ga0070706_100159279 3300005467 Bacteria 2107
72 Ga0070706_100403630 3300005467 Bacteria 1272
73 Ga0070706_100411280 3300005467 Bacteria 1259
74 Ga0070706_100687015 3300005467 Bacteria 949
75 Ga0070706_100874864 3300005467 Bacteria 830
76 Ga0070706_101214173 3300005467 Bacteria 693
77 Ga0070706_101538565 3300005467 Bacteria 607
78 Ga0070706_101538566 3300005467 Unclassified 607
79 Ga0070707_100000665 3300005468 Bacteria 34228
80 Ga0070707_100157579 3300005468 Bacteria 2212
81 Ga0070707_100232214 3300005468 Bacteria 1795
82 Ga0070707_100290538 3300005468 Bacteria 1588
83 Ga0070707_100937705 3300005468 Bacteria 830
84 Ga0070707_101653287 3300005468 Bacteria 607
85 Ga0070707_101653288 3300005468 Unclassified 607
86 Ga0070698_100002692 3300005471 Bacteria 19557
87 Ga0070698_100006346 3300005471 Bacteria 12842
88 Ga0070698_100088392 3300005471 Bacteria 3084
89 Ga0070698_100426141 3300005471 Bacteria 1261
90 Ga0070698_100914015 3300005471 Bacteria 823
91 Ga0070698_101252490 3300005471 Bacteria 691
92 Ga0070699_100043164 3300005518 Bacteria 3903
93 Ga0070699_100044230 3300005518 Bacteria 3856
94 Ga0070699_100092358 3300005518 Bacteria 2647
95 Ga0070699_100327518 3300005518 Bacteria 1377
96 Ga0070699_100525968 3300005518 Bacteria 1075
97 Ga0070699_100671043 3300005518 Bacteria 946
98 Ga0070679_100015004 3300005530 Bacteria 7445
99 Ga0070679_100774257 3300005530 Unclassified 903
100 Ga0070697_100008345 3300005536 Bacteria 8082
101 Ga0070697_100064023 3300005536 Bacteria 3003
102 Ga0070697_100233099 3300005536 Bacteria 1571
103 Ga0070697_100364560 3300005536 Bacteria 1249
104 Ga0070697_100415629 3300005536 Bacteria 1168
105 Ga0070697_100563054 3300005536 Unclassified 1000
106 Ga0070697_100611259 3300005536 Unclassified 958
107 Ga0070697_100636803 3300005536 Bacteria 938
108 Ga0070697_101185445 3300005536 Bacteria 680
109 Ga0068853_100009034 3300005539 Bacteria 8026
110 Ga0070672_100054469 3300005543 Bacteria 3131
111 Ga0070686_100410085 3300005544 Bacteria 1032
112 Ga0070686_100660390 3300005544 Bacteria 830
113 Ga0070695_100000462 3300005545 Bacteria 21142
114 Ga0070695_100002002 3300005545 Bacteria 11609
115 Ga0070695_100051803 3300005545 Bacteria 2635
116 Ga0070695_100057447 3300005545 Bacteria 2514
117 Ga0070695_100095554 3300005545 Bacteria 1992
118 Ga0070695_101119464 3300005545 Bacteria 645
119 Ga0070696_100000772 3300005546 Bacteria 20572
120 Ga0070696_100074387 3300005546 Unclassified 2395
121 Ga0070696_100130517 3300005546 Bacteria 1828
122 Ga0070696_100194341 3300005546 Bacteria 1512
123 Ga0070696_100841578 3300005546 Bacteria 758
124 Ga0070696_101166964 3300005546 Bacteria 650
125 Ga0070693_100005039 3300005547 Bacteria 6309
126 Ga0070693_100017451 3300005547 Bacteria 3732
127 Ga0070704_100006384 3300005549 Bacteria 6950
128 Ga0070704_100016024 3300005549 Bacteria 4725
129 Ga0070704_100027060 3300005549 Bacteria 3797
130 Ga0070704_100688342 3300005549 Unclassified 906
131 Ga0070704_101609175 3300005549 Unclassified 599
132 Ga0068855_100001748 3300005563 Bacteria 27119
133 Ga0068857_100579705 3300005577 Bacteria 1059
134 Ga0068854_100001045 3300005578 Bacteria 16620
135 Ga0068856_100130823 3300005614 Bacteria 2514
136 Ga0068859_100001304 3300005617 Bacteria 25481
137 Ga0068859_100422994 3300005617 Bacteria 1428
138 Ga0068859_100561295 3300005617 Bacteria 1236
139 Ga0068859_101278566 3300005617 Unclassified 808
140 Ga0068864_100034776 3300005618 Bacteria 4287
141 Ga0068864_100104203 3300005618 Bacteria 2519
142 Ga0068864_100521776 3300005618 Unclassified 1145
143 Ga0068866_10412841 3300005718 Bacteria 874
144 Ga0068861_100003575 3300005719 Bacteria 10344
145 Ga0068861_100811064 3300005719 Bacteria 879
146 Ga0068861_100873184 3300005719 Unclassified 850
147 Ga0068851_10056116 3300005834 Bacteria 2008
148 Ga0068870_10002637 3300005840 Bacteria 7512
149 Ga0068870_10483393 3300005840 Bacteria 822
150 Ga0068863_100003572 3300005841 Bacteria 15341
151 Ga0068863_100191838 3300005841 Bacteria 1964
152 Ga0068858_100026680 3300005842 Bacteria 5365
153 Ga0068858_100795335 3300005842 Unclassified 923
154 Ga0068860_100076958 3300005843 Bacteria 3173
155 Ga0068860_100087971 3300005843 Bacteria 2957
156 Ga0068860_100100663 3300005843 Bacteria 2757
157 Ga0068860_100865861 3300005843 Bacteria 919
158 Ga0068862_100011644 3300005844 Bacteria 7258
159 Ga0068862_100084615 3300005844 Bacteria 2756
160 Ga0068862_100193051 3300005844 Bacteria 1833
161 Ga0081455_10107060 3300005937 Bacteria 2230
162 Ga0081539_10000009 3300005985 Bacteria 509286
163 Ga0075432_10051674 3300006058 Bacteria 1451
164 Ga0070715_10103566 3300006163 Bacteria 1332
165 Ga0070712_100032984 3300006175 Bacteria 3500
166 Ga0097621_100453064 3300006237 Bacteria 1156
167 Ga0075428_100001808 3300006844 Bacteria 22879
168 Ga0075428_100006126 3300006844 Bacteria 13384
169 Ga0075428_100013542 3300006844 Bacteria 9080
170 Ga0075428_100018436 3300006844 Bacteria 7718
171 Ga0075428_100191428 3300006844 Bacteria 2212
172 Ga0075428_100245290 3300006844 Archaea 1932
173 Ga0075428_100661920 3300006844 Bacteria 1113
174 Ga0075428_100922118 3300006844 Unclassified 926
175 Ga0075428_101549335 3300006844 Unclassified 694
176 Ga0075430_100000005 3300006846 Bacteria 108528
177 Ga0075430_100000114 3300006846 Bacteria 48642
178 Ga0075430_100002233 3300006846 Bacteria 16053
179 Ga0075430_100038557 3300006846 Bacteria 4046
180 Ga0075430_100043010 3300006846 Bacteria 3819
181 Ga0075430_100096420 3300006846 Bacteria 2472
182 Ga0075430_100607133 3300006846 Bacteria 903
183 Ga0075430_100901278 3300006846 Bacteria 728
184 Ga0075431_100000435 3300006847 Bacteria 34144
185 Ga0075431_100000597 3300006847 Bacteria 30487
186 Ga0075431_100003160 3300006847 Bacteria 15929
187 Ga0075431_100005204 3300006847 Bacteria 12813
188 Ga0075431_100019799 3300006847 Bacteria 6869
189 Ga0075431_100021263 3300006847 Bacteria 6631
190 Ga0075431_100028813 3300006847 Bacteria 5709
191 Ga0075431_100107218 3300006847 Bacteria 2882
192 Ga0075431_100265300 3300006847 Bacteria 1742
193 Ga0075431_100343996 3300006847 Bacteria 1500
194 Ga0075431_100361099 3300006847 Bacteria 1459
195 Ga0075431_100382384 3300006847 Bacteria 1411
196 Ga0075431_100604989 3300006847 Bacteria 1080
197 Ga0075431_101092507 3300006847 Bacteria 762
198 Ga0075433_10001294 3300006852 Bacteria 18292
199 Ga0075433_10002165 3300006852 Bacteria 14877
200 Ga0075433_10003551 3300006852 Bacteria 12034
201 Ga0075433_10019062 3300006852 Bacteria 5708
202 Ga0075433_10048508 3300006852 Bacteria 3693
203 Ga0075433_10107604 3300006852 Bacteria 2472
204 Ga0075433_10339639 3300006852 Archaea 1327
205 Ga0075433_10362963 3300006852 Bacteria 1279
206 Ga0075433_10631143 3300006852 Bacteria 940
207 Ga0075433_10705300 3300006852 Bacteria 884
208 Ga0075433_11067500 3300006852 Bacteria 703
209 Ga0075434_100010889 3300006871 Bacteria 8551
210 Ga0075434_100022157 3300006871 Bacteria 6187
211 Ga0075434_100028443 3300006871 Bacteria 5492
212 Ga0075434_100032384 3300006871 Bacteria 5155
213 Ga0075434_100038980 3300006871 Bacteria 4708
214 Ga0075434_100147552 3300006871 Bacteria 2372
215 Ga0075434_100782529 3300006871 Bacteria 971
216 Ga0075434_101116505 3300006871 Bacteria 801
217 Ga0075434_101520198 3300006871 Bacteria 678
218 Ga0075434_101582878 3300006871 Bacteria 664
219 Ga0075429_100000360 3300006880 Bacteria 33488
220 Ga0075429_100023527 3300006880 Bacteria 5346
221 Ga0075429_100038230 3300006880 Bacteria 4178
222 Ga0075429_100045189 3300006880 Bacteria 3831
223 Ga0075429_100060087 3300006880 Bacteria 3311
224 Ga0075429_100096086 3300006880 Unclassified 2584
225 Ga0075429_100121456 3300006880 Bacteria 2283
226 Ga0075429_100126415 3300006880 Unclassified 2236
227 Ga0075429_100134890 3300006880 Bacteria 2160
228 Ga0075429_100146454 3300006880 Unclassified 2067
229 Ga0075429_100252994 3300006880 Bacteria 1543
230 Ga0075429_100385795 3300006880 Bacteria 1226
231 Ga0075429_100523005 3300006880 Bacteria 1040
232 Ga0068865_100205337 3300006881 Bacteria 1532
233 Ga0068865_100642656 3300006881 Bacteria 901
234 Ga0075436_100006996 3300006914 Bacteria 7724
235 Ga0075436_100065126 3300006914 Bacteria 2519
236 Ga0075436_100086775 3300006914 Unclassified 2174
237 Ga0075436_100718839 3300006914 Bacteria 740
238 Ga0097620_100001304 3300006931 Bacteria 25481
239 Ga0097620_100422986 3300006931 Bacteria 1428
240 Ga0097620_100561274 3300006931 Bacteria 1236
241 Ga0097620_101278575 3300006931 Unclassified 808
242 Ga0075435_100002173 3300007076 Bacteria 12932
243 Ga0075435_100009476 3300007076 Bacteria 7054
244 Ga0075435_100012575 3300007076 Bacteria 6270
245 Ga0075435_100072931 3300007076 Bacteria 2805
246 Ga0075435_100103223 3300007076 Bacteria 2364
247 Ga0075435_100304199 3300007076 Bacteria 1364
248 Ga0075435_100503286 3300007076 Bacteria 1047
249 Ga0075435_100526714 3300007076 Unclassified 1022
250 Ga0075435_100720177 3300007076 Bacteria 867
251 Ga0075435_100963811 3300007076 Unclassified 744
252 Ga0075435_101225491 3300007076 Bacteria 657
253 Ga0099794_10011709 3300007265 Bacteria 3763
254 Ga0099794_10086871 3300007265 Bacteria 1549
255 Ga0099794_10109980 3300007265 Bacteria 1380
256 Ga0099794_10307638 3300007265 Bacteria 821
257 Ga0111539_10006802 3300009094 Bacteria 14709
258 Ga0111539_10031699 3300009094 Bacteria 6420
259 Ga0111539_10350861 3300009094 Unclassified 1717
260 Ga0111539_10433177 3300009094 Bacteria 1531
261 Ga0111539_10562444 3300009094 Bacteria 1328
262 Ga0111539_11906300 3300009094 Unclassified 689
263 Ga0105245_11572590 3300009098 Unclassified 709
264 Ga0105247_10055542 3300009101 Bacteria 2443
265 Ga0114129_10000078 3300009147 Bacteria 89074
266 Ga0114129_10000256 3300009147 Bacteria 60241
267 Ga0114129_10003447 3300009147 Bacteria 22241
268 Ga0114129_10019667 3300009147 Bacteria 9611
269 Ga0114129_10020970 3300009147 Bacteria 9281
270 Ga0114129_10022682 3300009147 Bacteria 8903
271 Ga0114129_10044867 3300009147 Bacteria 6217
272 Ga0114129_10064360 3300009147 Bacteria 5117
273 Ga0114129_10215331 3300009147 Bacteria 2594
274 Ga0114129_10218557 3300009147 Bacteria 2572
275 Ga0114129_10256127 3300009147 Bacteria 2347
276 Ga0114129_10293693 3300009147 Bacteria 2168
277 Ga0114129_10296703 3300009147 Bacteria 2156
278 Ga0114129_10383258 3300009147 Bacteria 1856
279 Ga0114129_10516101 3300009147 Unclassified 1559
280 Ga0114129_10576151 3300009147 Unclassified 1461
281 Ga0114129_10944333 3300009147 Bacteria 1090
282 Ga0114129_11790207 3300009147 Bacteria 747
283 Ga0114129_11890226 3300009147 Bacteria 724
284 Ga0105243_10042738 3300009148 Bacteria 3549
285 Ga0105243_10343065 3300009148 Bacteria 1369
286 Ga0105243_11043811 3300009148 Bacteria 822
287 Ga0105243_11438557 3300009148 Unclassified 711
288 Ga0105241_10000598 3300009174 Bacteria 27156
289 Ga0105242_10059191 3300009176 Bacteria 3142
290 Ga0105242_10709328 3300009176 Bacteria 985
291 Ga0105237_10038062 3300009545 Bacteria 4859
292 Ga0105249_10086271 3300009553 Bacteria 2927
293 Ga0105249_10093613 3300009553 Bacteria 2815
294 Ga0105249_10782401 3300009553 Bacteria 1017
295 Ga0105239_10065537 3300010375 Bacteria 3989
296 Ga0157373_10095176 3300013100 Bacteria 2096
297 Ga0157373_10679586 3300013100 Bacteria 753
298 Ga0157371_10716961 3300013102 Bacteria 749
299 Ga0157371_10853022 3300013102 Unclassified 689
300 Ga0157369_10019796 3300013105 Bacteria 7531
301 Ga0157378_10377482 3300013297 Bacteria 1391
302 Ga0157378_11259644 3300013297 Bacteria 780
303 Ga0163162_10072526 3300013306 Bacteria 3498
304 Ga0163162_10440955 3300013306 Unclassified 1434
305 Ga0163162_11327449 3300013306 Bacteria 817
306 Ga0157372_10004196 3300013307 Bacteria 15423
307 Ga0157375_10064596 3300013308 Bacteria 3645
308 Ga0157375_10072473 3300013308 Bacteria 3461
309 Ga0157380_10376434 3300014326 Bacteria 1338
310 Ga0157379_10327448 3300014968 Bacteria 1399
311 Ga0157376_10655272 3300014969 Bacteria 1051
312 Ga0163161_10709613 3300017792 Bacteria 838
313 Ga0207697_10166840 3300025315 Bacteria 962
314 Ga0207656_10040542 3300025321 Bacteria 1975
315 Ga0207653_10007577 3300025885 Bacteria 3383
316 Ga0207653_10021180 3300025885 Unclassified 2062
317 Ga0207642_10163069 3300025899 Bacteria 1199
318 Ga0207642_10521311 3300025899 Bacteria 730
319 Ga0207642_10526484 3300025899 Bacteria 727
320 Ga0207710_10089711 3300025900 Bacteria 1437
321 Ga0207680_10640255 3300025903 Bacteria 761
322 Ga0207685_10120470 3300025905 Bacteria 1151
323 Ga0207645_10014510 3300025907 Bacteria 5270
324 Ga0207645_10035350 3300025907 Bacteria 3208
325 Ga0207645_10121683 3300025907 Bacteria 1694
326 Ga0207643_10000057 3300025908 Bacteria 73664
327 Ga0207643_10372266 3300025908 Bacteria 899
328 Ga0207684_10000410 3300025910 Bacteria 57371
329 Ga0207684_10000551 3300025910 Bacteria 46114
330 Ga0207684_10000567 3300025910 Bacteria 45151
331 Ga0207684_10001805 3300025910 Bacteria 22400
332 Ga0207684_10008750 3300025910 Bacteria 8989
333 Ga0207684_10009289 3300025910 Bacteria 8686
334 Ga0207684_10020166 3300025910 Bacteria 5694
335 Ga0207684_10081620 3300025910 Bacteria 2751
336 Ga0207684_10238817 3300025910 Bacteria 1568
337 Ga0207654_10083250 3300025911 Unclassified 1931
338 Ga0207654_10372928 3300025911 Bacteria 987
339 Ga0207707_10000162 3300025912 Bacteria 70164
340 Ga0207671_10109849 3300025914 Bacteria 2097
341 Ga0207693_10001189 3300025915 Bacteria 23254
342 Ga0207663_10248989 3300025916 Unclassified 1307
343 Ga0207660_10093731 3300025917 Bacteria 2231
344 Ga0207660_10668642 3300025917 Unclassified 847
345 Ga0207662_10005099 3300025918 Bacteria 6966
346 Ga0207662_10847579 3300025918 Unclassified 646
347 Ga0207657_10000332 3300025919 Bacteria 50089
348 Ga0207649_10041394 3300025920 Bacteria 2804
349 Ga0207652_10007367 3300025921 Bacteria 8872
350 Ga0207652_10451989 3300025921 Unclassified 1158
351 Ga0207652_11167160 3300025921 Bacteria 671
352 Ga0207646_10000188 3300025922 Bacteria 84349
353 Ga0207646_10003299 3300025922 Bacteria 18386
354 Ga0207646_10042653 3300025922 Bacteria 4075
355 Ga0207646_10071589 3300025922 Bacteria 3096
356 Ga0207646_10219093 3300025922 Bacteria 1719
357 Ga0207646_10229606 3300025922 Bacteria 1677
358 Ga0207681_10057680 3300025923 Bacteria 2655
359 Ga0207681_10082241 3300025923 Bacteria 2276
360 Ga0207681_10132103 3300025923 Bacteria 1847
361 Ga0207650_10068218 3300025925 Bacteria 2670
362 Ga0207659_11030604 3300025926 Bacteria 708
363 Ga0207700_11303081 3300025928 Bacteria 647
364 Ga0207690_10014421 3300025932 Bacteria 4773
365 Ga0207690_10112431 3300025932 Bacteria 1964
366 Ga0207706_10075229 3300025933 Bacteria 2969
367 Ga0207706_10379227 3300025933 Unclassified 1227
368 Ga0207686_10441930 3300025934 Bacteria 999
369 Ga0207709_10049378 3300025935 Bacteria 2568
370 Ga0207709_10727459 3300025935 Unclassified 796
371 Ga0207670_10059654 3300025936 Bacteria 2596
372 Ga0207670_10155417 3300025936 Bacteria 1702
373 Ga0207670_10190403 3300025936 Bacteria 1552
374 Ga0207670_10288374 3300025936 Bacteria 1281
375 Ga0207704_10202007 3300025938 Unclassified 1456
376 Ga0207704_10713706 3300025938 Bacteria 831
377 Ga0207665_10010881 3300025939 Bacteria 5971
378 Ga0207665_10174631 3300025939 Bacteria 1553
379 Ga0207691_10030432 3300025940 Bacteria 5044
380 Ga0207691_10071719 3300025940 Bacteria 3125
381 Ga0207711_11801363 3300025941 Bacteria 555
382 Ga0207689_10000435 3300025942 Bacteria 39174
383 Ga0207689_10009005 3300025942 Bacteria 8644
384 Ga0207689_10552923 3300025942 Bacteria 967
385 Ga0207679_10003211 3300025945 Bacteria 10081
386 Ga0207667_10004879 3300025949 Bacteria 16378
387 Ga0207667_11379595 3300025949 Unclassified 679
388 Ga0207712_10036138 3300025961 Bacteria 3362
389 Ga0207640_10013887 3300025981 Bacteria 4623
390 Ga0207658_10494390 3300025986 Bacteria 1089
391 Ga0207658_10767934 3300025986 Bacteria 874
392 Ga0207677_10238663 3300026023 Unclassified 1469
393 Ga0207703_10027358 3300026035 Bacteria 4491
394 Ga0207703_10500286 3300026035 Bacteria 1141
395 Ga0207703_10697789 3300026035 Bacteria 965
396 Ga0207639_10025085 3300026041 Bacteria 4321
397 Ga0207678_10045112 3300026067 Bacteria 3812
398 Ga0207708_10152999 3300026075 Bacteria 1818
399 Ga0207708_10640873 3300026075 Unclassified 904
400 Ga0207702_10001756 3300026078 Bacteria 21335
401 Ga0207641_10033906 3300026088 Bacteria 4244
402 Ga0207641_10169606 3300026088 Bacteria 1991
403 Ga0207641_10205583 3300026088 Bacteria 1818
404 Ga0207648_10050235 3300026089 Bacteria 3647
405 Ga0207648_10159438 3300026089 Bacteria 1992
406 Ga0207648_10260456 3300026089 Bacteria 1547
407 Ga0207648_10344144 3300026089 Bacteria 1343
408 Ga0207676_10082633 3300026095 Bacteria 2613
409 Ga0207676_11294950 3300026095 Bacteria 723
410 Ga0207674_10001197 3300026116 Bacteria 33773
411 Ga0207675_100000989 3300026118 Bacteria 28178
412 Ga0207675_100115673 3300026118 Bacteria 2534
413 Ga0207675_100414567 3300026118 Unclassified 1329
414 Ga0207675_100443853 3300026118 Bacteria 1285
415 Ga0207675_100942858 3300026118 Bacteria 880
416 Ga0209996_1000259 3300027395 Bacteria 6690
417 Ga0209984_1000363 3300027424 Bacteria 5008
418 Ga0210000_1004827 3300027462 Bacteria 1953
419 Ga0209995_1000985 3300027471 Bacteria 4378
420 Ga0209995_1016195 3300027471 Unclassified 1224
421 Ga0209968_1002428 3300027526 Bacteria 2812
422 Ga0209999_1000335 3300027543 Bacteria 7077
423 Ga0209982_1001794 3300027552 Bacteria 2958
424 Ga0209970_1000631 3300027614 Bacteria 6096
425 Ga0210002_1002114 3300027617 Bacteria 2869
426 Ga0209983_1000201 3300027665 Bacteria 11794
427 Ga0209588_1009988 3300027671 Bacteria 2848
428 Ga0209588_1051357 3300027671 Unclassified 1333
429 Ga0209588_1058919 3300027671 Bacteria 1242
430 Ga0209971_1000006 3300027682 Bacteria 107602
431 Ga0209966_1000018 3300027695 Bacteria 71100
432 Ga0209998_10000080 3300027717 Bacteria 37627
433 Ga0209998_10026548 3300027717 Unclassified 1265
434 Ga0209974_10000791 3300027876 Bacteria 10796
435 Ga0209974_10037663 3300027876 Unclassified 1606
436 Ga0207428_10000138 3300027907 Bacteria 98359
437 Ga0207428_10011013 3300027907 Bacteria 8039
438 Ga0207428_10696444 3300027907 Bacteria 727
439 Ga0268265_10081780 3300028380 Bacteria 2552
440 Ga0268265_10184069 3300028380 Bacteria 1797
441 Ga0268265_10184346 3300028380 Bacteria 1796
442 Ga0268265_10212822 3300028380 Bacteria 1685
443 Ga0268265_10363442 3300028380 Bacteria 1326
444 Ga0268264_10058569 3300028381 Bacteria 3226
445 Ga0268264_10146660 3300028381 Bacteria 2111
446 Ga0307408_100051143 3300031548 Bacteria 2975
447 Ga0307408_100559769 3300031548 Unclassified 1010
448 Ga0307408_100876024 3300031548 Unclassified 820
449 Ga0307408_101003531 3300031548 Unclassified 769
450 Ga0307410_11393810 3300031852 Bacteria 615
451 Ga0307406_10456748 3300031901 Unclassified 1026
452 Ga0307407_10718089 3300031903 Unclassified 754
453 Ga0307409_100288222 3300031995 Bacteria 1521
454 Ga0307416_100001559 3300032002 Bacteria 12548
455 Ga0307416_100598267 3300032002 Unclassified 1182
456 Ga0307411_10186031 3300032005 Bacteria 1581
457 Ga0307411_10299044 3300032005 Bacteria 1290
458 Ga0373959_0011841 3300034820 Unclassified 1547
459 Ga0373928_0036372 3300035084 Unclassified 1113
460 Ga0373928_0222957 3300035084 Bacteria 552
461 Ga0373940_0008678 3300035088 Bacteria 2342
462 Ga0373940_0025222 3300035088 Unclassified 1547
463 Ga0373949_0005167 3300035090 Bacteria 2929
464 Ga0373949_0054645 3300035090 Unclassified 1014
465 Ga0373949_0084694 3300035090 Bacteria 849
466 Ga0373951_0029678 3300035091 Bacteria 1285
467 Ga0373952_0083377 3300035092 Unclassified 819
468 Ga0373952_0147217 3300035092 Bacteria 658
469 Ga0373952_0259073 3300035092 Bacteria 529
470 Ga0373932_0154768 3300035112 Bacteria 789
471 Ga0373932_0162268 3300035112 Unclassified 774
472 Ga0373939_0071725 3300035114 Bacteria 1129
473 Ga0373939_0129258 3300035114 Bacteria 900
474 Ga0373941_0025078 3300035115 Bacteria 1719
475 Ga0373960_0023484 3300035121 Bacteria 1661
476 Ga0373942_0127984 3300035207 Unclassified 799
477 Ga0373942_0169762 3300035207 Bacteria 710
478 Ga0373961_0020339 3300035241 Unclassified 1755
479 Ga0373962_0019773 3300035242 Bacteria 1764
480 Ga0373962_0103318 3300035242 Bacteria 891
481 Ga0373931_0228449 3300035691 Unclassified 1123
482 Ga0373931_0311690 3300035691 Bacteria 975
483 Ga0395899_0027325 3300037312 Bacteria 4303
484 Ga0395899_0527635 3300037312 Bacteria 762
485 Ga0395900_0028051 3300037418 Bacteria 5764
486 Ga0395900_0126441 3300037418 Bacteria 2622
487 Ga0395898_0006720 3300037466 Bacteria 12265
488 Ga0395905_0156079 3300037471 Bacteria 2146
489 Ga0395901_0019469 3300038443 Bacteria 6940
490 Ga0395901_0194476 3300038443 Bacteria 2127
491 Ga0439437_006478 3300042000 Bacteria 1297
492 Ga0439448_0017221 3300042005 Bacteria 2205
493 Ga0439448_0130040 3300042005 Bacteria 867
494 Ga0439455_0068637 3300042012 Bacteria 949
495 Ga0450889_004378 3300042144 Bacteria 1395
496 Ga0439458_0002832 3300042157 Bacteria 4175
497 Ga0439444_0190445 3300042437 Bacteria 513
498 Ga0439459_0000660 3300042438 Bacteria 4696
499 Ga0439464_0002807 3300042439 Bacteria 4328
500 Ga0439460_0000532 3300042461 Bacteria 8304
501 Ga0450893_0007043 3300042532 Bacteria 1823
502 Ga0451577_0013030 3300042876 Bacteria 7800
503 Ga0451577_0043297 3300042876 Bacteria 4032
504 Ga0451577_0119796 3300042876 Bacteria 2357
505 Ga0451577_0571696 3300042876 Unclassified 1026
506 Ga0451577_0916334 3300042876 Unclassified 789
507 Ga0453683_0036667 3300044673 Bacteria 3086
508 Ga0453683_0104982 3300044673 Bacteria 1774
509 Ga0453683_0258024 3300044673 Unclassified 1112
510 Ga0453684_0396357 3300044712 Bacteria 1547
511 Ga0451576_0005043 3300045051 Bacteria 16745
512 Ga0451576_0022500 3300045051 Bacteria 6834
513 Ga0451576_0029600 3300045051 Bacteria 5859
514 Ga0451576_0114817 3300045051 Bacteria 2803
515 Ga0451576_0120113 3300045051 Bacteria 2736
516 Ga0451576_0540154 3300045051 Bacteria 1225
517 Ga0495580_0004290 3300046472 Bacteria 11988
518 Ga0495580_0148018 3300046472 Unclassified 1627
519 Ga0495580_0173571 3300046472 Bacteria 1489
520 Ga0495580_0210128 3300046472 Bacteria 1339
521 Ga0495584_0175871 3300046491 Archaea 1088
522 Ga0495594_0244863 3300046499 Bacteria 1022
523 Ga0495594_0499683 3300046499 Bacteria 691
524 Ga0495608_0287838 3300046511 Unclassified 1019
525 Ga0495628_0430191 3300046516 Unclassified 961
526 Ga0495642_0238846 3300046528 Bacteria 794
527 Ga0495656_0027872 3300046615 Bacteria 2260
528 Ga0495659_0029899 3300046664 Bacteria 1893
529 Ga0495659_0112433 3300046664 Unclassified 1065
530 Ga0495659_0222199 3300046664 Bacteria 780
531 Ga0495669_0304313 3300046684 Bacteria 769
532 Ga0495669_0327933 3300046684 Unclassified 739
533 Ga0495636_0056002 3300047318 Bacteria 1659
534 Ga0496102_0006529 3300048905 Bacteria 9953
535 Ga0496102_0013075 3300048905 Bacteria 7186
536 Ga0496103_0077168 3300048906 Bacteria 2091
537 Ga0496104_0768412 3300048907 Unclassified 870
538 Ga0496107_0044021 3300048910 Bacteria 3209
539 Ga0496107_0592637 3300048910 Bacteria 820
540 Ga0496108_0430769 3300048911 Unclassified 1152
541 Ga0496111_0080979 3300048914 Bacteria 2370
542 Ga0496115_1137590 3300048918 Bacteria 590
543 Ga0501292_009426 3300049515 Bacteria 1449
544 Ga0501033_0044890 3300049570 Bacteria 3290
545 Ga0501033_0234041 3300049570 Bacteria 1304
546 Ga0501033_0355431 3300049570 Unclassified 1026
547 Ga0501036_0102050 3300049572 Bacteria 2427
548 Ga0501036_0499621 3300049572 Bacteria 1012
549 Ga0501036_1176697 3300049572 Bacteria 625
550 Ga0501036_1390141 3300049572 Unclassified 569
551 Ga0501037_0095890 3300049573 Bacteria 2144
552 Ga0501037_0463736 3300049573 Bacteria 863
553 Ga0501038_0086268 3300049574 Bacteria 2638
554 Ga0501038_0160318 3300049574 Bacteria 1828
555 Ga0501038_0640546 3300049574 Unclassified 801
556 Ga0501039_0010567 3300049575 Bacteria 7036
557 Ga0501039_0506007 3300049575 Unclassified 948
558 Ga0501039_0556216 3300049575 Bacteria 900
559 Ga0501039_0666133 3300049575 Unclassified 814
560 Ga0501040_0001317 3300049576 Bacteria 15724
561 Ga0501040_0028439 3300049576 Bacteria 3769
562 Ga0501040_0071925 3300049576 Unclassified 2388
563 Ga0501040_0167043 3300049576 Unclassified 1557
564 Ga0501040_0215406 3300049576 Bacteria 1366
565 Ga0501041_0008607 3300049577 Bacteria 6012
566 Ga0501041_0077881 3300049577 Bacteria 2040
567 Ga0501041_0178420 3300049577 Bacteria 1330
568 Ga0501041_0953953 3300049577 Bacteria 551
569 Ga0501042_0038184 3300049578 Bacteria 3410
570 Ga0501042_0341431 3300049578 Bacteria 1083
571 Ga0501043_0252916 3300049579 Bacteria 1357
572 Ga0501043_0350947 3300049579 Bacteria 1121
573 Ga0501043_0530600 3300049579 Bacteria 876
574 Ga0501046_0000263 3300049580 Bacteria 53575
575 Ga0501046_0035979 3300049580 Bacteria 3987
576 Ga0501046_0067846 3300049580 Bacteria 2777
577 Ga0501046_0116372 3300049580 Bacteria 2038
578 Ga0501046_0171540 3300049580 Bacteria 1628
579 Ga0501046_1011962 3300049580 Bacteria 576
580 Ga0501047_0019825 3300049581 Bacteria 6455
581 Ga0501048_0020736 3300049582 Bacteria 4817
582 Ga0501048_0028350 3300049582 Bacteria 4063
583 Ga0501048_0123760 3300049582 Bacteria 1828
584 Ga0501048_0204561 3300049582 Bacteria 1400
585 Ga0501048_0283348 3300049582 Unclassified 1178
586 Ga0501048_0891698 3300049582 Unclassified 639
587 Ga0501067_0116593 3300049583 Bacteria 1485
588 Ga0501067_0261714 3300049583 Bacteria 963
589 Ga0501067_0296082 3300049583 Bacteria 901
590 Ga0501068_0314440 3300049584 Bacteria 1003
591 Ga0501069_0065351 3300049585 Bacteria 2034
592 Ga0501069_0378523 3300049585 Bacteria 836
593 Ga0501071_0025653 3300049587 Bacteria 4131
594 Ga0501071_0067400 3300049587 Bacteria 2603
595 Ga0501071_0079394 3300049587 Bacteria 2399
596 Ga0501071_0188061 3300049587 Bacteria 1548
597 Ga0501071_0249661 3300049587 Unclassified 1339
598 Ga0501071_0277213 3300049587 Bacteria 1269
599 Ga0501072_0011411 3300049588 Bacteria 6791
600 Ga0501072_0020267 3300049588 Bacteria 5151
601 Ga0501072_0139763 3300049588 Bacteria 1931
602 Ga0501072_0166914 3300049588 Bacteria 1756
603 Ga0501072_0217724 3300049588 Bacteria 1522
604 Ga0501072_0280982 3300049588 Bacteria 1324
605 Ga0501072_0371236 3300049588 Bacteria 1135
606 Ga0501072_0717326 3300049588 Unclassified 785
607 Ga0501072_0829629 3300049588 Bacteria 723
608 Ga0501073_0512307 3300049589 Bacteria 829
609 Ga0501074_0008980 3300049590 Bacteria 7252
610 Ga0501075_0005728 3300049591 Bacteria 8502
611 Ga0501075_0009588 3300049591 Bacteria 6778
612 Ga0501075_0016840 3300049591 Bacteria 5271
613 Ga0501075_0041331 3300049591 Bacteria 3455
614 Ga0501075_0073682 3300049591 Unclassified 2582
615 Ga0501075_0126188 3300049591 Bacteria 1948
616 Ga0501075_0425511 3300049591 Bacteria 1012
617 Ga0501075_0886306 3300049591 Bacteria 679
618 Ga0501076_0016170 3300049592 Bacteria 5650
619 Ga0501076_0040268 3300049592 Bacteria 3671
620 Ga0501076_0055920 3300049592 Bacteria 3130
621 Ga0501076_0088014 3300049592 Bacteria 2496
622 Ga0501076_0134073 3300049592 Bacteria 2010
623 Ga0501076_0180245 3300049592 Bacteria 1722
624 Ga0501076_0947525 3300049592 Bacteria 709
625 Ga0501077_0010548 3300049593 Bacteria 5753
626 Ga0501077_0019470 3300049593 Bacteria 4294
627 Ga0501077_0020053 3300049593 Bacteria 4231
628 Ga0501077_0103142 3300049593 Bacteria 1807
629 Ga0501077_0202160 3300049593 Bacteria 1262
630 Ga0501077_0577799 3300049593 Bacteria 721
631 Ga0501077_0849847 3300049593 Unclassified 587
632 Ga0501079_0007221 3300049741 Bacteria 8388
633 Ga0501079_0036845 3300049741 Bacteria 3767
634 Ga0501079_0043848 3300049741 Bacteria 3452
635 Ga0501079_0051237 3300049741 Bacteria 3187
636 Ga0501079_0095759 3300049741 Bacteria 2301
637 Ga0501079_0099891 3300049741 Bacteria 2250
638 Ga0501079_0139348 3300049741 Bacteria 1889
639 Ga0501079_0758475 3300049741 Bacteria 764
640 Ga0501080_0401549 3300049742 Bacteria 1233
641 Ga0501080_1343988 3300049742 Unclassified 611
642 Ga0501080_1376736 3300049742 Bacteria 602
643 Ga0501081_0011905 3300049743 Bacteria 5699
644 Ga0501081_0012097 3300049743 Bacteria 5656
645 Ga0501081_0033368 3300049743 Bacteria 3497
646 Ga0501081_0225589 3300049743 Bacteria 1363
647 Ga0501081_0241549 3300049743 Bacteria 1317
648 Ga0501081_0381243 3300049743 Bacteria 1042
649 Ga0501083_0012130 3300049744 Bacteria 6033
650 Ga0501083_1143275 3300049744 Unclassified 507
651 Ga0501035_0116249 3300049822 Bacteria 2341
652 Ga0501035_1001596 3300049822 Bacteria 657
653 Ga0501035_1306619 3300049822 Unclassified 559
654 Ga0501044_1090696 3300049823 Bacteria 668
655 Ga0501045_0000484 3300049824 Bacteria 24590
656 Ga0501045_0045959 3300049824 Bacteria 3179
657 Ga0501045_0121667 3300049824 Bacteria 1938
658 Ga0501045_0197921 3300049824 Bacteria 1497
659 Ga0501045_0674563 3300049824 Bacteria 763
660 Ga0501045_0843110 3300049824 Bacteria 674
661 nmdc:mga05p37_12987_c1 3300050507 Bacteria 9965
662 nmdc:mga05p37_16500_c1 3300050507 Bacteria 8897
663 nmdc:mga05p37_192267_c1 3300050507 Bacteria 2477
664 nmdc:mga05p37_199747_c1 3300050507 Bacteria 2423
665 nmdc:mga05p37_22777_c1 3300050507 Bacteria 7598
666 nmdc:mga05p37_235502_c1 3300050507 Bacteria 2204
667 nmdc:mga05p37_237189_c1 3300050507 Bacteria 2195
668 nmdc:mga05p37_244385_c1 3300050507 Bacteria 2156
669 nmdc:mga05p37_253217_c1 3300050507 Bacteria 2111
670 nmdc:mga05p37_311513_c1 3300050507 Bacteria 1866
671 nmdc:mga05p37_314789_c1 3300050507 Bacteria 1854
672 nmdc:mga05p37_353_c1 3300050507 Bacteria 49206
673 nmdc:mga05p37_389267_c1 3300050507 Unclassified 976
674 nmdc:mga05p37_4877_c1 3300050507 Bacteria 15702
675 nmdc:mga05p37_534777_c1 3300050507 Bacteria 1338
676 nmdc:mga05p37_64791_c1 3300050507 Bacteria 4497
677 nmdc:mga05p37_667826_c1 3300050507 Bacteria 1161
678 nmdc:mga05p37_89148_c1 3300050507 Bacteria 3801
679 nmdc:mga05p37_90558_c1 3300050507 Bacteria 3769
680 nmdc:mga05p37_922281_c1 3300050507 Bacteria 939
681 nmdc:mga05p37_9282_c1 3300050507 Bacteria 11633
682 nmdc:mga05p37_935533_c1 3300050507 Bacteria 930
683 nmdc:mga09592_15982_c1 3300050508 Bacteria 6133
684 nmdc:mga09592_1872_c1 3300050508 Bacteria 16944
685 nmdc:mga09592_21624_c1 3300050508 Bacteria 5303
686 nmdc:mga09592_253_c1 3300050508 Bacteria 39042
687 nmdc:mga09592_291007_c1 3300050508 Bacteria 1416
688 nmdc:mga09592_35547_c1 3300050508 Bacteria 4171
689 nmdc:mga09592_445576_c1 3300050508 Bacteria 1117
690 nmdc:mga09592_56610_c1 3300050508 Bacteria 3313
691 nmdc:mga09592_71403_c1 3300050508 Bacteria 2947
692 nmdc:mga09592_93218_c1 3300050508 Unclassified 2575
693 nmdc:mga0qj67_115_c1 3300050509 Bacteria 52730
694 nmdc:mga0qj67_133807_c1 3300050509 Bacteria 2008
695 nmdc:mga0qj67_2129_c1 3300050509 Bacteria 14102
696 nmdc:mga0qj67_218680_c1 3300050509 Bacteria 1546
697 nmdc:mga0qj67_27994_c1 3300050509 Bacteria 4373
698 nmdc:mga0qj67_49512_c1 3300050509 Bacteria 3321
699 nmdc:mga0qj67_522812_c1 3300050509 Bacteria 953
700 nmdc:mga0qj67_630376_c1 3300050509 Unclassified 856
701 nmdc:mga0qj67_80425_c1 3300050509 Bacteria 2611
702 nmdc:mga0qj67_99740_c1 3300050509 Bacteria 2340
703 nmdc:mga06r32_10892_c1 3300050510 Bacteria 8188
704 nmdc:mga06r32_1307040_c1 3300050510 Bacteria 669
705 nmdc:mga06r32_130790_c1 3300050510 Bacteria 2482
706 nmdc:mga06r32_160393_c1 3300050510 Bacteria 2231
707 nmdc:mga06r32_209652_c1 3300050510 Bacteria 1936
708 nmdc:mga06r32_23373_c1 3300050510 Bacteria 5718
709 nmdc:mga06r32_24486_c1 3300050510 Bacteria 5604
710 nmdc:mga06r32_3455_c1 3300050510 Bacteria 14105
711 nmdc:mga06r32_473661_c1 3300050510 Unclassified 1231
712 nmdc:mga06r32_613682_c1 3300050510 Bacteria 1058
713 nmdc:mga06r32_70126_c1 3300050510 Bacteria 3389
714 nmdc:mga08y16_1035897_c1 3300050511 Bacteria 799
715 nmdc:mga08y16_1173_c1 3300050511 Bacteria 25842
716 nmdc:mga08y16_1215094_c1 3300050511 Unclassified 724
717 nmdc:mga08y16_12597_c1 3300050511 Bacteria 8896
718 nmdc:mga08y16_320777_c1 3300050511 Bacteria 1595
719 nmdc:mga08y16_33647_c1 3300050511 Bacteria 5382
720 nmdc:mga0n895_228546_c1 3300050512 Bacteria 1889
721 nmdc:mga0n895_28572_c1 3300050512 Bacteria 5306
722 nmdc:mga0n895_30718_c1 3300050512 Bacteria 5137
723 nmdc:mga0n895_3099_c1 3300050512 Bacteria 13241
724 nmdc:mga0n895_34011_c1 3300050512 Bacteria 4903
725 nmdc:mga0n895_361593_c1 3300050512 Unclassified 1470
726 nmdc:mga0n895_424230_c1 3300050512 Bacteria 1344
727 nmdc:mga0n895_58276_c1 3300050512 Bacteria 3807
728 nmdc:mga0n895_665967_c1 3300050512 Unclassified 1039
729 nmdc:mga0n895_691148_c1 3300050512 Bacteria 1017
730 nmdc:mga0n895_699588_c1 3300050512 Bacteria 1010
731 nmdc:mga0n895_92194_c1 3300050512 Bacteria 3033
732 nmdc:mga0rr50_1312790_c1 3300050513 Unclassified 613
733 nmdc:mga0rr50_156622_c1 3300050513 Bacteria 1846
734 nmdc:mga0rr50_160168_c1 3300050513 Bacteria 1826
735 nmdc:mga0rr50_185425_c1 3300050513 Bacteria 1703
736 nmdc:mga0rr50_23369_c1 3300050513 Bacteria 4262
737 nmdc:mga0rr50_233768_c1 3300050513 Bacteria 1522
738 nmdc:mga0rr50_271061_c1 3300050513 Bacteria 1415
739 nmdc:mga0rr50_327237_c1 3300050513 Bacteria 1286
740 nmdc:mga0rr50_56611_c2 3300050513 Bacteria 2435
741 nmdc:mga0rr50_685484_c1 3300050513 Bacteria 875
742 nmdc:mga0rr50_72117_c1 3300050513 Bacteria 2637
743 nmdc:mga08x19_278626_c1 3300050514 Bacteria 1158
744 nmdc:mga08x19_37967_c1 3300050514 Bacteria 3059
745 nmdc:mga08x19_6796_c1 3300050514 Bacteria 6794
746 nmdc:mga08x19_6922_c1 3300050514 Bacteria 6735
747 nmdc:mga0a205_1033657_c1 3300050515 Bacteria 669
748 nmdc:mga0a205_1350031_c1 3300050515 Bacteria 561
749 nmdc:mga0a205_13753_c1 3300050515 Bacteria 7543
750 nmdc:mga0a205_140371_c1 3300050515 Bacteria 2316
751 nmdc:mga0a205_180287_c1 3300050515 Bacteria 2007
752 nmdc:mga0a205_180865_c1 3300050515 Bacteria 2003
753 nmdc:mga0a205_270525_c1 3300050515 Bacteria 1576
754 nmdc:mga0a205_323146_c1 3300050515 Archaea 1414
755 nmdc:mga0a205_43208_c1 3300050515 Bacteria 4346
756 nmdc:mga0a205_4436_c1 3300050515 Bacteria 12601
757 nmdc:mga0a205_518314_c1 3300050515 Bacteria 1049
758 nmdc:mga0a205_662039_c1 3300050515 Bacteria 895
759 nmdc:mga0a205_690_c2 3300050515 Bacteria 6469
760 Ga0495619_0003736 3300053085 Bacteria 9811
761 Ga0501084_0002889 3300054114 Bacteria 13895
762 Ga0501084_0008876 3300054114 Bacteria 8320
763 Ga0501084_0009788 3300054114 Bacteria 7924
764 Ga0501084_0018615 3300054114 Bacteria 5780
765 Ga0501084_0074505 3300054114 Bacteria 2842
766 Ga0501084_0309487 3300054114 Bacteria 1334
767 Ga0501084_0784995 3300054114 Unclassified 802
768 Ga0501084_0856185 3300054114 Unclassified 765
769 Ga0501082_0003419 3300060353 Bacteria 13859
770 Ga0501082_0023475 3300060353 Bacteria 5321
771 Ga0501082_0105953 3300060353 Bacteria 2432
772 Ga0501082_0127335 3300060353 Bacteria 2209
773 Ga0501082_0134186 3300060353 Bacteria 2148
774 Ga0501082_0181394 3300060353 Bacteria 1831
775 Ga0530510_0029217 3300061734 Bacteria 3956
776 Ga0530510_0030630 3300061734 Bacteria 3865
777 Ga0530510_0100633 3300061734 Bacteria 2113
778 Ga0530510_0107575 3300061734 Bacteria 2041
779 Ga0530510_0360335 3300061734 Bacteria 1093
780 Ga0530510_0444027 3300061734 Bacteria 980
781 Ga0530510_0991358 3300061734 Bacteria 643
782 Ga0114129_10011117
783 Ga0065715_10119923
784 Ga0065707_10121056
785 Ga0065707_10352890
786 Ga0065707_10951470
787 Ga0070676_10028872
788 Ga0070676_10227759
789 Ga0070690_100134033
790 Ga0070670_100032526
791 Ga0070677_10341094
792 Ga0068869_100005276
793 Ga0070666_10106707
794 Ga0070666_10729078
795 Ga0070680_100001904
796 Ga0070682_100000483
797 Ga0068868_100259397
798 Ga0070660_100000594
799 Ga0070689_100078149
800 Ga0070689_100138925
801 Ga0070689_100289607
802 Ga0070689_100827240
803 Ga0070689_101323272
804 Ga0070691_10006789
805 Ga0070687_100003586
806 Ga0070687_100758080
807 Ga0070661_100064930
808 Ga0070692_10004289
809 Ga0070692_10257953
810 Ga0070669_100008950
811 Ga0070669_100460096
812 Ga0070675_100009657
813 Ga0070688_100232811
814 Ga0070659_100000628
815 Ga0070659_100130731
816 Ga0070703_10013461
817 Ga0070703_10031955
818 Ga0070709_10152425
819 Ga0070711_100019303
820 Ga0070711_100065820
821 Ga0070705_100003562
822 Ga0070705_100093054
823 Ga0070705_100340575
824 Ga0070705_100435755
825 Ga0070705_100517666
826 Ga0070705_100763319
827 Ga0070700_100203299
828 Ga0070694_100000353
829 Ga0070694_100005226
830 Ga0070694_100016507
831 Ga0070694_100027744
832 Ga0070694_100102062
833 Ga0070694_100221300
834 Ga0070694_100291521
835 Ga0070708_100002746
836 Ga0070708_100055522
837 Ga0070708_100183331
838 Ga0070708_100231006
839 Ga0070708_100295595
840 Ga0070708_101594917
841 Ga0070708_101594918
842 Ga0070663_100001289
843 Ga0070662_100025394
844 Ga0070681_10117180
845 Ga0068867_100028066
846 Ga0068867_100842940
847 Ga0070706_100003807
848 Ga0070706_100036813
849 Ga0070706_100046250
850 Ga0070706_100068554
851 Ga0070706_100105869
852 Ga0070706_100159279
853 Ga0070706_100403630
854 Ga0070706_100411280
855 Ga0070706_100687015
856 Ga0070706_100874864
857 Ga0070706_101214173
858 Ga0070706_101538565
859 Ga0070706_101538566
860 Ga0070707_100000665
861 Ga0070707_100157579
862 Ga0070707_100232214
863 Ga0070707_100290538
864 Ga0070707_100937705
865 Ga0070707_101653287
866 Ga0070707_101653288
867 Ga0070698_100002692
868 Ga0070698_100006346
869 Ga0070698_100088392
870 Ga0070698_100426141
871 Ga0070698_100914015
872 Ga0070698_101252490
873 Ga0070699_100043164
874 Ga0070699_100044230
875 Ga0070699_100092358
876 Ga0070699_100327518
877 Ga0070699_100525968
878 Ga0070699_100671043
879 Ga0070679_100015004
880 Ga0070679_100774257
881 Ga0070697_100008345
882 Ga0070697_100064023
883 Ga0070697_100233099
884 Ga0070697_100364560
885 Ga0070697_100415629
886 Ga0070697_100563054
887 Ga0070697_100611259
888 Ga0070697_100636803
889 Ga0070697_101185445
890 Ga0068853_100009034
891 Ga0070672_100054469
892 Ga0070686_100410085
893 Ga0070686_100660390
894 Ga0070695_100000462
895 Ga0070695_100002002
896 Ga0070695_100051803
897 Ga0070695_100057447
898 Ga0070695_100095554
899 Ga0070695_101119464
900 Ga0070696_100000772
901 Ga0070696_100074387
902 Ga0070696_100130517
903 Ga0070696_100194341
904 Ga0070696_100841578
905 Ga0070696_101166964
906 Ga0070693_100005039
907 Ga0070693_100017451
908 Ga0070704_100006384
909 Ga0070704_100016024
910 Ga0070704_100027060
911 Ga0070704_100688342
912 Ga0070704_101609175
913 Ga0068855_100001748
914 Ga0068857_100579705
915 Ga0068854_100001045
916 Ga0068856_100130823
917 Ga0068859_100001304
918 Ga0068859_100422994
919 Ga0068859_100561295
920 Ga0068859_101278566
921 Ga0068864_100034776
922 Ga0068864_100104203
923 Ga0068864_100521776
924 Ga0068866_10412841
925 Ga0068861_100003575
926 Ga0068861_100811064
927 Ga0068861_100873184
928 Ga0068851_10056116
929 Ga0068870_10002637
930 Ga0068870_10483393
931 Ga0068863_100003572
932 Ga0068863_100191838
933 Ga0068858_100026680
934 Ga0068858_100795335
935 Ga0068860_100076958
936 Ga0068860_100087971
937 Ga0068860_100100663
938 Ga0068860_100865861
939 Ga0068862_100011644
940 Ga0068862_100084615
941 Ga0068862_100193051
942 Ga0081455_10107060
943 Ga0081539_10000009
944 Ga0075432_10051674
945 Ga0070715_10103566
946 Ga0070712_100032984
947 Ga0097621_100453064
948 Ga0075428_100001808
949 Ga0075428_100006126
950 Ga0075428_100013542
951 Ga0075428_100018436
952 Ga0075428_100191428
953 Ga0075428_100245290
954 Ga0075428_100661920
955 Ga0075428_100922118
956 Ga0075428_101549335
957 Ga0075430_100000005
958 Ga0075430_100000114
959 Ga0075430_100002233
960 Ga0075430_100038557
961 Ga0075430_100043010
962 Ga0075430_100096420
963 Ga0075430_100607133
964 Ga0075430_100901278
965 Ga0075431_100000435
966 Ga0075431_100000597
967 Ga0075431_100003160
968 Ga0075431_100005204
969 Ga0075431_100019799
970 Ga0075431_100021263
971 Ga0075431_100028813
972 Ga0075431_100107218
973 Ga0075431_100265300
974 Ga0075431_100343996
975 Ga0075431_100361099
976 Ga0075431_100382384
977 Ga0075431_100604989
978 Ga0075431_101092507
979 Ga0075433_10001294
980 Ga0075433_10002165
981 Ga0075433_10003551
982 Ga0075433_10019062
983 Ga0075433_10048508
984 Ga0075433_10107604
985 Ga0075433_10339639
986 Ga0075433_10362963
987 Ga0075433_10631143
988 Ga0075433_10705300
989 Ga0075433_11067500
990 Ga0075434_100010889
991 Ga0075434_100022157
992 Ga0075434_100028443
993 Ga0075434_100032384
994 Ga0075434_100038980
995 Ga0075434_100147552
996 Ga0075434_100782529
997 Ga0075434_101116505
998 Ga0075434_101520198
999 Ga0075434_101582878
1000 Ga0075429_100000360
1001 Ga0075429_100023527
1002 Ga0075429_100038230
1003 Ga0075429_100045189
1004 Ga0075429_100060087
1005 Ga0075429_100096086
1006 Ga0075429_100121456
1007 Ga0075429_100126415
1008 Ga0075429_100134890
1009 Ga0075429_100146454
1010 Ga0075429_100252994
1011 Ga0075429_100385795
1012 Ga0075429_100523005
1013 Ga0068865_100205337
1014 Ga0068865_100642656
1015 Ga0075436_100006996
1016 Ga0075436_100065126
1017 Ga0075436_100086775
1018 Ga0075436_100718839
1019 Ga0097620_100001304
1020 Ga0097620_100422986
1021 Ga0097620_100561274
1022 Ga0097620_101278575
1023 Ga0075435_100002173
1024 Ga0075435_100009476
1025 Ga0075435_100012575
1026 Ga0075435_100072931
1027 Ga0075435_100103223
1028 Ga0075435_100304199
1029 Ga0075435_100503286
1030 Ga0075435_100526714
1031 Ga0075435_100720177
1032 Ga0075435_100963811
1033 Ga0075435_101225491
1034 Ga0099794_10011709
1035 Ga0099794_10086871
1036 Ga0099794_10109980
1037 Ga0099794_10307638
1038 Ga0111539_10006802
1039 Ga0111539_10031699
1040 Ga0111539_10350861
1041 Ga0111539_10433177
1042 Ga0111539_10562444
1043 Ga0111539_11906300
1044 Ga0105245_11572590
1045 Ga0105247_10055542
1046 Ga0114129_10000078
1047 Ga0114129_10000256
1048 Ga0114129_10003447
1049 Ga0114129_10019667
1050 Ga0114129_10020970
1051 Ga0114129_10022682
1052 Ga0114129_10044867
1053 Ga0114129_10064360
1054 Ga0114129_10215331
1055 Ga0114129_10218557
1056 Ga0114129_10256127
1057 Ga0114129_10293693
1058 Ga0114129_10296703
1059 Ga0114129_10383258
1060 Ga0114129_10516101
1061 Ga0114129_10576151
1062 Ga0114129_10944333
1063 Ga0114129_11790207
1064 Ga0114129_11890226
1065 Ga0105243_10042738
1066 Ga0105243_10343065
1067 Ga0105243_11043811
1068 Ga0105243_11438557
1069 Ga0105241_10000598
1070 Ga0105242_10059191
1071 Ga0105242_10709328
1072 Ga0105237_10038062
1073 Ga0105249_10086271
1074 Ga0105249_10093613
1075 Ga0105249_10782401
1076 Ga0105239_10065537
1077 Ga0157373_10095176
1078 Ga0157373_10679586
1079 Ga0157371_10716961
1080 Ga0157371_10853022
1081 Ga0157369_10019796
1082 Ga0157378_10377482
1083 Ga0157378_11259644
1084 Ga0163162_10072526
1085 Ga0163162_10440955
1086 Ga0163162_11327449
1087 Ga0157372_10004196
1088 Ga0157375_10064596
1089 Ga0157375_10072473
1090 Ga0157380_10376434
1091 Ga0157379_10327448
1092 Ga0157376_10655272
1093 Ga0163161_10709613
1094 Ga0207697_10166840
1095 Ga0207656_10040542
1096 Ga0207653_10007577
1097 Ga0207653_10021180
1098 Ga0207642_10163069
1099 Ga0207642_10521311
1100 Ga0207642_10526484
1101 Ga0207710_10089711
1102 Ga0207680_10640255
1103 Ga0207685_10120470
1104 Ga0207645_10014510
1105 Ga0207645_10035350
1106 Ga0207645_10121683
1107 Ga0207643_10000057
1108 Ga0207643_10372266
1109 Ga0207684_10000410
1110 Ga0207684_10000551
1111 Ga0207684_10000567
1112 Ga0207684_10001805
1113 Ga0207684_10008750
1114 Ga0207684_10009289
1115 Ga0207684_10020166
1116 Ga0207684_10081620
1117 Ga0207684_10238817
1118 Ga0207654_10083250
1119 Ga0207654_10372928
1120 Ga0207707_10000162
1121 Ga0207671_10109849
1122 Ga0207693_10001189
1123 Ga0207663_10248989
1124 Ga0207660_10093731
1125 Ga0207660_10668642
1126 Ga0207662_10005099
1127 Ga0207662_10847579
1128 Ga0207657_10000332
1129 Ga0207649_10041394
1130 Ga0207652_10007367
1131 Ga0207652_10451989
1132 Ga0207652_11167160
1133 Ga0207646_10000188
1134 Ga0207646_10003299
1135 Ga0207646_10042653
1136 Ga0207646_10071589
1137 Ga0207646_10219093
1138 Ga0207646_10229606
1139 Ga0207681_10057680
1140 Ga0207681_10082241
1141 Ga0207681_10132103
1142 Ga0207650_10068218
1143 Ga0207659_11030604
1144 Ga0207700_11303081
1145 Ga0207690_10014421
1146 Ga0207690_10112431
1147 Ga0207706_10075229
1148 Ga0207706_10379227
1149 Ga0207686_10441930
1150 Ga0207709_10049378
1151 Ga0207709_10727459
1152 Ga0207670_10059654
1153 Ga0207670_10155417
1154 Ga0207670_10190403
1155 Ga0207670_10288374
1156 Ga0207704_10202007
1157 Ga0207704_10713706
1158 Ga0207665_10010881
1159 Ga0207665_10174631
1160 Ga0207691_10030432
1161 Ga0207691_10071719
1162 Ga0207711_11801363
1163 Ga0207689_10000435
1164 Ga0207689_10009005
1165 Ga0207689_10552923
1166 Ga0207679_10003211
1167 Ga0207667_10004879
1168 Ga0207667_11379595
1169 Ga0207712_10036138
1170 Ga0207640_10013887
1171 Ga0207658_10494390
1172 Ga0207658_10767934
1173 Ga0207677_10238663
1174 Ga0207703_10027358
1175 Ga0207703_10500286
1176 Ga0207703_10697789
1177 Ga0207639_10025085
1178 Ga0207678_10045112
1179 Ga0207708_10152999
1180 Ga0207708_10640873
1181 Ga0207702_10001756
1182 Ga0207641_10033906
1183 Ga0207641_10169606
1184 Ga0207641_10205583
1185 Ga0207648_10050235
1186 Ga0207648_10159438
1187 Ga0207648_10260456
1188 Ga0207648_10344144
1189 Ga0207676_10082633
1190 Ga0207676_11294950
1191 Ga0207674_10001197
1192 Ga0207675_100000989
1193 Ga0207675_100115673
1194 Ga0207675_100414567
1195 Ga0207675_100443853
1196 Ga0207675_100942858
1197 Ga0209996_1000259
1198 Ga0209984_1000363
1199 Ga0210000_1004827
1200 Ga0209995_1000985
1201 Ga0209995_1016195
1202 Ga0209968_1002428
1203 Ga0209999_1000335
1204 Ga0209982_1001794
1205 Ga0209970_1000631
1206 Ga0210002_1002114
1207 Ga0209983_1000201
1208 Ga0209588_1009988
1209 Ga0209588_1051357
1210 Ga0209588_1058919
1211 Ga0209971_1000006
1212 Ga0209966_1000018
1213 Ga0209998_10000080
1214 Ga0209998_10026548
1215 Ga0209974_10000791
1216 Ga0209974_10037663
1217 Ga0207428_10000138
1218 Ga0207428_10011013
1219 Ga0207428_10696444
1220 Ga0268265_10081780
1221 Ga0268265_10184069
1222 Ga0268265_10184346
1223 Ga0268265_10212822
1224 Ga0268265_10363442
1225 Ga0268264_10058569
1226 Ga0268264_10146660
1227 Ga0307408_100051143
1228 Ga0307408_100559769
1229 Ga0307408_100876024
1230 Ga0307408_101003531
1231 Ga0307410_11393810
1232 Ga0307406_10456748
1233 Ga0307407_10718089
1234 Ga0307409_100288222
1235 Ga0307416_100001559
1236 Ga0307416_100598267
1237 Ga0307411_10186031
1238 Ga0307411_10299044
1239 Ga0373959_0011841
1240 Ga0373928_0036372
1241 Ga0373928_0222957
1242 Ga0373940_0008678
1243 Ga0373940_0025222
1244 Ga0373949_0005167
1245 Ga0373949_0054645
1246 Ga0373949_0084694
1247 Ga0373951_0029678
1248 Ga0373952_0083377
1249 Ga0373952_0147217
1250 Ga0373952_0259073
1251 Ga0373932_0154768
1252 Ga0373932_0162268
1253 Ga0373939_0071725
1254 Ga0373939_0129258
1255 Ga0373941_0025078
1256 Ga0373960_0023484
1257 Ga0373942_0127984
1258 Ga0373942_0169762
1259 Ga0373961_0020339
1260 Ga0373962_0019773
1261 Ga0373962_0103318
1262 Ga0373931_0228449
1263 Ga0373931_0311690
1264 Ga0395899_0027325
1265 Ga0395899_0527635
1266 Ga0395900_0028051
1267 Ga0395900_0126441
1268 Ga0395898_0006720
1269 Ga0395905_0156079
1270 Ga0395901_0019469
1271 Ga0395901_0194476
1272 Ga0439437_006478
1273 Ga0439448_0017221
1274 Ga0439448_0130040
1275 Ga0439455_0068637
1276 Ga0450889_004378
1277 Ga0439458_0002832
1278 Ga0439444_0190445
1279 Ga0439459_0000660
1280 Ga0439464_0002807
1281 Ga0439460_0000532
1282 Ga0450893_0007043
1283 Ga0451577_0013030
1284 Ga0451577_0043297
1285 Ga0451577_0119796
1286 Ga0451577_0571696
1287 Ga0451577_0916334
1288 Ga0453683_0036667
1289 Ga0453683_0104982
1290 Ga0453683_0258024
1291 Ga0453684_0396357
1292 Ga0451576_0005043
1293 Ga0451576_0022500
1294 Ga0451576_0029600
1295 Ga0451576_0114817
1296 Ga0451576_0120113
1297 Ga0451576_0540154
1298 Ga0495580_0004290
1299 Ga0495580_0148018
1300 Ga0495580_0173571
1301 Ga0495580_0210128
1302 Ga0495584_0175871
1303 Ga0495594_0244863
1304 Ga0495594_0499683
1305 Ga0495608_0287838
1306 Ga0495628_0430191
1307 Ga0495642_0238846
1308 Ga0495656_0027872
1309 Ga0495659_0029899
1310 Ga0495659_0112433
1311 Ga0495659_0222199
1312 Ga0495669_0304313
1313 Ga0495669_0327933
1314 Ga0495636_0056002
1315 Ga0496102_0006529
1316 Ga0496102_0013075
1317 Ga0496103_0077168
1318 Ga0496104_0768412
1319 Ga0496107_0044021
1320 Ga0496107_0592637
1321 Ga0496108_0430769
1322 Ga0496111_0080979
1323 Ga0496115_1137590
1324 Ga0501292_009426
1325 Ga0501033_0044890
1326 Ga0501033_0234041
1327 Ga0501033_0355431
1328 Ga0501036_0102050
1329 Ga0501036_0499621
1330 Ga0501036_1176697
1331 Ga0501036_1390141
1332 Ga0501037_0095890
1333 Ga0501037_0463736
1334 Ga0501038_0086268
1335 Ga0501038_0160318
1336 Ga0501038_0640546
1337 Ga0501039_0010567
1338 Ga0501039_0506007
1339 Ga0501039_0556216
1340 Ga0501039_0666133
1341 Ga0501040_0001317
1342 Ga0501040_0028439
1343 Ga0501040_0071925
1344 Ga0501040_0167043
1345 Ga0501040_0215406
1346 Ga0501041_0008607
1347 Ga0501041_0077881
1348 Ga0501041_0178420
1349 Ga0501041_0953953
1350 Ga0501042_0038184
1351 Ga0501042_0341431
1352 Ga0501043_0252916
1353 Ga0501043_0350947
1354 Ga0501043_0530600
1355 Ga0501046_0000263
1356 Ga0501046_0035979
1357 Ga0501046_0067846
1358 Ga0501046_0116372
1359 Ga0501046_0171540
1360 Ga0501046_1011962
1361 Ga0501047_0019825
1362 Ga0501048_0020736
1363 Ga0501048_0028350
1364 Ga0501048_0123760
1365 Ga0501048_0204561
1366 Ga0501048_0283348
1367 Ga0501048_0891698
1368 Ga0501067_0116593
1369 Ga0501067_0261714
1370 Ga0501067_0296082
1371 Ga0501068_0314440
1372 Ga0501069_0065351
1373 Ga0501069_0378523
1374 Ga0501071_0025653
1375 Ga0501071_0067400
1376 Ga0501071_0079394
1377 Ga0501071_0188061
1378 Ga0501071_0249661
1379 Ga0501071_0277213
1380 Ga0501072_0011411
1381 Ga0501072_0020267
1382 Ga0501072_0139763
1383 Ga0501072_0166914
1384 Ga0501072_0217724
1385 Ga0501072_0280982
1386 Ga0501072_0371236
1387 Ga0501072_0717326
1388 Ga0501072_0829629
1389 Ga0501073_0512307
1390 Ga0501074_0008980
1391 Ga0501075_0005728
1392 Ga0501075_0009588
1393 Ga0501075_0016840
1394 Ga0501075_0041331
1395 Ga0501075_0073682
1396 Ga0501075_0126188
1397 Ga0501075_0425511
1398 Ga0501075_0886306
1399 Ga0501076_0016170
1400 Ga0501076_0040268
1401 Ga0501076_0055920
1402 Ga0501076_0088014
1403 Ga0501076_0134073
1404 Ga0501076_0180245
1405 Ga0501076_0947525
1406 Ga0501077_0010548
1407 Ga0501077_0019470
1408 Ga0501077_0020053
1409 Ga0501077_0103142
1410 Ga0501077_0202160
1411 Ga0501077_0577799
1412 Ga0501077_0849847
1413 Ga0501079_0007221
1414 Ga0501079_0036845
1415 Ga0501079_0043848
1416 Ga0501079_0051237
1417 Ga0501079_0095759
1418 Ga0501079_0099891
1419 Ga0501079_0139348
1420 Ga0501079_0758475
1421 Ga0501080_0401549
1422 Ga0501080_1343988
1423 Ga0501080_1376736
1424 Ga0501081_0011905
1425 Ga0501081_0012097
1426 Ga0501081_0033368
1427 Ga0501081_0225589
1428 Ga0501081_0241549
1429 Ga0501081_0381243
1430 Ga0501083_0012130
1431 Ga0501083_1143275
1432 Ga0501035_0116249
1433 Ga0501035_1001596
1434 Ga0501035_1306619
1435 Ga0501044_1090696
1436 Ga0501045_0000484
1437 Ga0501045_0045959
1438 Ga0501045_0121667
1439 Ga0501045_0197921
1440 Ga0501045_0674563
1441 Ga0501045_0843110
1442 nmdc:mga05p37_12987_c1
1443 nmdc:mga05p37_16500_c1
1444 nmdc:mga05p37_192267_c1
1445 nmdc:mga05p37_199747_c1
1446 nmdc:mga05p37_22777_c1
1447 nmdc:mga05p37_235502_c1
1448 nmdc:mga05p37_237189_c1
1449 nmdc:mga05p37_244385_c1
1450 nmdc:mga05p37_253217_c1
1451 nmdc:mga05p37_311513_c1
1452 nmdc:mga05p37_314789_c1
1453 nmdc:mga05p37_353_c1
1454 nmdc:mga05p37_389267_c1
1455 nmdc:mga05p37_4877_c1
1456 nmdc:mga05p37_534777_c1
1457 nmdc:mga05p37_64791_c1
1458 nmdc:mga05p37_667826_c1
1459 nmdc:mga05p37_89148_c1
1460 nmdc:mga05p37_90558_c1
1461 nmdc:mga05p37_922281_c1
1462 nmdc:mga05p37_9282_c1
1463 nmdc:mga05p37_935533_c1
1464 nmdc:mga09592_15982_c1
1465 nmdc:mga09592_1872_c1
1466 nmdc:mga09592_21624_c1
1467 nmdc:mga09592_253_c1
1468 nmdc:mga09592_291007_c1
1469 nmdc:mga09592_35547_c1
1470 nmdc:mga09592_445576_c1
1471 nmdc:mga09592_56610_c1
1472 nmdc:mga09592_71403_c1
1473 nmdc:mga09592_93218_c1
1474 nmdc:mga0qj67_115_c1
1475 nmdc:mga0qj67_133807_c1
1476 nmdc:mga0qj67_2129_c1
1477 nmdc:mga0qj67_218680_c1
1478 nmdc:mga0qj67_27994_c1
1479 nmdc:mga0qj67_49512_c1
1480 nmdc:mga0qj67_522812_c1
1481 nmdc:mga0qj67_630376_c1
1482 nmdc:mga0qj67_80425_c1
1483 nmdc:mga0qj67_99740_c1
1484 nmdc:mga06r32_10892_c1
1485 nmdc:mga06r32_1307040_c1
1486 nmdc:mga06r32_130790_c1
1487 nmdc:mga06r32_160393_c1
1488 nmdc:mga06r32_209652_c1
1489 nmdc:mga06r32_23373_c1
1490 nmdc:mga06r32_24486_c1
1491 nmdc:mga06r32_3455_c1
1492 nmdc:mga06r32_473661_c1
1493 nmdc:mga06r32_613682_c1
1494 nmdc:mga06r32_70126_c1
1495 nmdc:mga08y16_1035897_c1
1496 nmdc:mga08y16_1173_c1
1497 nmdc:mga08y16_1215094_c1
1498 nmdc:mga08y16_12597_c1
1499 nmdc:mga08y16_320777_c1
1500 nmdc:mga08y16_33647_c1
1501 nmdc:mga0n895_228546_c1
1502 nmdc:mga0n895_28572_c1
1503 nmdc:mga0n895_30718_c1
1504 nmdc:mga0n895_3099_c1
1505 nmdc:mga0n895_34011_c1
1506 nmdc:mga0n895_361593_c1
1507 nmdc:mga0n895_424230_c1
1508 nmdc:mga0n895_58276_c1
1509 nmdc:mga0n895_665967_c1
1510 nmdc:mga0n895_691148_c1
1511 nmdc:mga0n895_699588_c1
1512 nmdc:mga0n895_92194_c1
1513 nmdc:mga0rr50_1312790_c1
1514 nmdc:mga0rr50_156622_c1
1515 nmdc:mga0rr50_160168_c1
1516 nmdc:mga0rr50_185425_c1
1517 nmdc:mga0rr50_23369_c1
1518 nmdc:mga0rr50_233768_c1
1519 nmdc:mga0rr50_271061_c1
1520 nmdc:mga0rr50_327237_c1
1521 nmdc:mga0rr50_56611_c2
1522 nmdc:mga0rr50_685484_c1
1523 nmdc:mga0rr50_72117_c1
1524 nmdc:mga08x19_278626_c1
1525 nmdc:mga08x19_37967_c1
1526 nmdc:mga08x19_6796_c1
1527 nmdc:mga08x19_6922_c1
1528 nmdc:mga0a205_1033657_c1
1529 nmdc:mga0a205_1350031_c1
1530 nmdc:mga0a205_13753_c1
1531 nmdc:mga0a205_140371_c1
1532 nmdc:mga0a205_180287_c1
1533 nmdc:mga0a205_180865_c1
1534 nmdc:mga0a205_270525_c1
1535 nmdc:mga0a205_323146_c1
1536 nmdc:mga0a205_43208_c1
1537 nmdc:mga0a205_4436_c1
1538 nmdc:mga0a205_518314_c1
1539 nmdc:mga0a205_662039_c1
1540 nmdc:mga0a205_690_c2
1541 Ga0495619_0003736
1542 Ga0501084_0002889
1543 Ga0501084_0008876
1544 Ga0501084_0009788
1545 Ga0501084_0018615
1546 Ga0501084_0074505
1547 Ga0501084_0309487
1548 Ga0501084_0784995
1549 Ga0501084_0856185
1550 Ga0501082_0003419
1551 Ga0501082_0023475
1552 Ga0501082_0105953
1553 Ga0501082_0127335
1554 Ga0501082_0134186
1555 Ga0501082_0181394
1556 Ga0530510_0029217
1557 Ga0530510_0030630
1558 Ga0530510_0100633
1559 Ga0530510_0107575
1560 Ga0530510_0360335
1561 Ga0530510_0444027
1562 Ga0530510_0991358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

42

74

0.93

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

79

158

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8716 35 62
7fsf-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase active site variant y851f 0.8505 35 62
8hl4-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8371 35 63
8hl3-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8195 35 63
2ayj-assembly1.cif.gz_A solution structure of 50s ribosomal protein l40e from sulfolobus solfataricus 0.7822 35 63
ID Description Score Start End Superfamily
af_Q4DTI5_457_613_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8101 33 62 2.40.50.140
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.7822 35 63 4.10.1060.50
af_A0A1D6LN64_306_454_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7624 34 64 2.40.50.140
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.7102 22 65 6.10.30.10
af_A0A1D6FN39_769_930_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6934 29 62 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V6TDB3-F1-model_v4 DUF35 domain-containing protein 0.8518 81 168
AF-A0A2V6TDB3-F1-model_v4 DUF35 domain-containing protein 0.8432 81 168
AF-A0A1Q7U343-F1-model_v4 DUF35 domain-containing protein 0.839 3 168
AF-A0A6G1STE8-F1-model_v4 Zn-ribbon domain-containing OB-fold protein 0.8372 4 168
AF-A0A538QLP1-F1-model_v4 DUF35 domain-containing protein 0.8318 3 168

Map