F480499
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 366 | 772 | 53 |
Family's Representative Sequence
| Representative Sequence | 3300003792|Ga0055540_1026935|Ga0055540_10269352 |
| Length | 59 |
| Sequence | MTKGGRMSTGETKSVNDIRTAIRELTARAELARKEGRPDDAAELERRVEGYRDXLGARP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 6 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 7 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 233 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 234 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 243 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 357 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 359 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 0 |
| Isolates | 1.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.28 |
| Nodule | 0 |
| Rhizoplane | 12.31 |
| Rhizosphere | 66.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1020761 | 3300000546 | Bacteria | 701 |
| 2 | JGI24746J21847_1003449 | 3300001977 | Bacteria | 2489 |
| 3 | JGI24747J21853_1010379 | 3300001978 | Bacteria | 931 |
| 4 | JGI24737J22298_10021356 | 3300001990 | Bacteria | 2064 |
| 5 | JGI24743J22301_10004378 | 3300001991 | Bacteria | 2300 |
| 6 | JGI24735J21928_10134044 | 3300002067 | Bacteria | 714 |
| 7 | JGI24750J21931_1007227 | 3300002070 | Bacteria | 1394 |
| 8 | JGI24745J21846_1021647 | 3300002073 | Bacteria | 757 |
| 9 | JGI24738J21930_10020626 | 3300002075 | Bacteria | 1370 |
| 10 | JGI24744J21845_10000295 | 3300002077 | Bacteria | 8327 |
| 11 | JGI24034J26672_10023766 | 3300002239 | Bacteria | 974 |
| 12 | JGI24034J26672_10052787 | 3300002239 | Bacteria | 702 |
| 13 | JGI24742J22300_10024505 | 3300002244 | Bacteria | 1041 |
| 14 | Ga0055528_1034782 | 3300003790 | Bacteria | 1234 |
| 15 | Ga0055540_1000219 | 3300003792 | Bacteria | 54071 |
| 16 | Ga0055540_1002262 | 3300003792 | Bacteria | 10387 |
| 17 | Ga0055540_1020897 | 3300003792 | Bacteria | 1718 |
| 18 | Ga0055540_1026935 | 3300003792 | Bacteria | 1383 |
| 19 | Ga0070676_10453100 | 3300005328 | Bacteria | 902 |
| 20 | Ga0070690_100065490 | 3300005330 | Bacteria | 2349 |
| 21 | Ga0070677_10034936 | 3300005333 | Bacteria | 1945 |
| 22 | Ga0068869_100009054 | 3300005334 | Bacteria | 6451 |
| 23 | Ga0070666_10034107 | 3300005335 | Bacteria | 3373 |
| 24 | Ga0070666_10078223 | 3300005335 | Bacteria | 2258 |
| 25 | Ga0070666_10189222 | 3300005335 | Bacteria | 1446 |
| 26 | Ga0070680_100225547 | 3300005336 | Bacteria | 1582 |
| 27 | Ga0070682_100382022 | 3300005337 | Bacteria | 1059 |
| 28 | Ga0070682_100685317 | 3300005337 | Bacteria | 820 |
| 29 | Ga0068868_100000858 | 3300005338 | Bacteria | 20639 |
| 30 | Ga0068868_100038073 | 3300005338 | Bacteria | 3732 |
| 31 | Ga0068868_100087252 | 3300005338 | Bacteria | 2509 |
| 32 | Ga0068868_101236918 | 3300005338 | Bacteria | 692 |
| 33 | Ga0070660_100061769 | 3300005339 | Bacteria | 2909 |
| 34 | Ga0070689_100046010 | 3300005340 | Bacteria | 3361 |
| 35 | Ga0070689_101406712 | 3300005340 | Bacteria | 630 |
| 36 | Ga0070691_10004817 | 3300005341 | Bacteria | 6144 |
| 37 | Ga0070687_100968798 | 3300005343 | Bacteria | 614 |
| 38 | Ga0070661_101052486 | 3300005344 | Bacteria | 677 |
| 39 | Ga0070692_10093997 | 3300005345 | Bacteria | 1634 |
| 40 | Ga0070668_100000229 | 3300005347 | Bacteria | 36371 |
| 41 | Ga0070668_100015615 | 3300005347 | Bacteria | 5676 |
| 42 | Ga0070668_100153093 | 3300005347 | Bacteria | 1866 |
| 43 | Ga0070668_100249529 | 3300005347 | Bacteria | 1473 |
| 44 | Ga0070668_101351610 | 3300005347 | Bacteria | 649 |
| 45 | Ga0070669_100094855 | 3300005353 | Bacteria | 2242 |
| 46 | Ga0070675_100480421 | 3300005354 | Bacteria | 1117 |
| 47 | Ga0070671_100015168 | 3300005355 | Bacteria | 6223 |
| 48 | Ga0070671_100295615 | 3300005355 | Bacteria | 1378 |
| 49 | Ga0070671_100547966 | 3300005355 | Bacteria | 997 |
| 50 | Ga0070674_100000228 | 3300005356 | Bacteria | 27614 |
| 51 | Ga0070674_100062206 | 3300005356 | Bacteria | 2608 |
| 52 | Ga0070674_100457638 | 3300005356 | Bacteria | 1054 |
| 53 | Ga0070674_101805473 | 3300005356 | Bacteria | 554 |
| 54 | Ga0070673_100889130 | 3300005364 | Bacteria | 826 |
| 55 | Ga0070688_100007048 | 3300005365 | Bacteria | 6046 |
| 56 | Ga0070688_100121005 | 3300005365 | Bacteria | 1753 |
| 57 | Ga0070659_100152265 | 3300005366 | Bacteria | 1887 |
| 58 | Ga0070667_100000782 | 3300005367 | Bacteria | 29910 |
| 59 | Ga0070667_100002450 | 3300005367 | Bacteria | 16209 |
| 60 | Ga0070667_100007804 | 3300005367 | Bacteria | 8873 |
| 61 | Ga0070667_100040740 | 3300005367 | Bacteria | 3896 |
| 62 | Ga0070667_100073182 | 3300005367 | Bacteria | 2921 |
| 63 | Ga0070667_100153655 | 3300005367 | Bacteria | 2023 |
| 64 | Ga0070667_100700044 | 3300005367 | Bacteria | 937 |
| 65 | Ga0070703_10061688 | 3300005406 | Bacteria | 1228 |
| 66 | Ga0070709_10064130 | 3300005434 | Bacteria | 2348 |
| 67 | Ga0070714_100627326 | 3300005435 | Bacteria | 1034 |
| 68 | Ga0070713_101191986 | 3300005436 | Bacteria | 737 |
| 69 | Ga0070710_10002759 | 3300005437 | Bacteria | 8361 |
| 70 | Ga0070701_10236012 | 3300005438 | Bacteria | 1097 |
| 71 | Ga0070711_100000347 | 3300005439 | Bacteria | 23841 |
| 72 | Ga0070711_100022825 | 3300005439 | Bacteria | 4060 |
| 73 | Ga0070705_100004568 | 3300005440 | Bacteria | 6740 |
| 74 | Ga0070705_100401190 | 3300005440 | Bacteria | 1015 |
| 75 | Ga0070700_100012138 | 3300005441 | Bacteria | 4795 |
| 76 | Ga0070694_100003851 | 3300005444 | Bacteria | 8963 |
| 77 | Ga0070694_100052701 | 3300005444 | Bacteria | 2751 |
| 78 | Ga0070663_100006705 | 3300005455 | Bacteria | 6946 |
| 79 | Ga0070663_100170394 | 3300005455 | Bacteria | 1682 |
| 80 | Ga0070663_100314919 | 3300005455 | Bacteria | 1257 |
| 81 | Ga0070663_102134197 | 3300005455 | Bacteria | 505 |
| 82 | Ga0070678_100001926 | 3300005456 | Bacteria | 11191 |
| 83 | Ga0070678_100227144 | 3300005456 | Bacteria | 1554 |
| 84 | Ga0070678_100321279 | 3300005456 | Bacteria | 1322 |
| 85 | Ga0070678_100492100 | 3300005456 | Bacteria | 1081 |
| 86 | Ga0070662_100022121 | 3300005457 | Bacteria | 4348 |
| 87 | Ga0070662_101518503 | 3300005457 | Bacteria | 578 |
| 88 | Ga0070662_101744623 | 3300005457 | Bacteria | 538 |
| 89 | Ga0070681_10614224 | 3300005458 | Bacteria | 1002 |
| 90 | Ga0068867_100312285 | 3300005459 | Bacteria | 1299 |
| 91 | Ga0070685_10117563 | 3300005466 | Bacteria | 1647 |
| 92 | Ga0070685_10282131 | 3300005466 | Bacteria | 1112 |
| 93 | Ga0070685_11078538 | 3300005466 | Bacteria | 606 |
| 94 | Ga0070707_101642852 | 3300005468 | Bacteria | 610 |
| 95 | Ga0070697_100853501 | 3300005536 | Bacteria | 807 |
| 96 | Ga0068853_100003532 | 3300005539 | Bacteria | 11957 |
| 97 | Ga0068853_100133685 | 3300005539 | Bacteria | 2222 |
| 98 | Ga0068853_101929276 | 3300005539 | Bacteria | 573 |
| 99 | Ga0070672_100332534 | 3300005543 | Bacteria | 1293 |
| 100 | Ga0070686_100037101 | 3300005544 | Bacteria | 3021 |
| 101 | Ga0070686_100077610 | 3300005544 | Bacteria | 2191 |
| 102 | Ga0070686_101083488 | 3300005544 | Bacteria | 661 |
| 103 | Ga0070695_100001767 | 3300005545 | Bacteria | 12162 |
| 104 | Ga0070696_100010405 | 3300005546 | Bacteria | 6232 |
| 105 | Ga0070665_100001933 | 3300005548 | Bacteria | 23351 |
| 106 | Ga0070665_100009878 | 3300005548 | Bacteria | 9649 |
| 107 | Ga0070665_100102783 | 3300005548 | Bacteria | 2861 |
| 108 | Ga0070665_100471373 | 3300005548 | Bacteria | 1266 |
| 109 | Ga0070665_100956978 | 3300005548 | Bacteria | 869 |
| 110 | Ga0070665_101128018 | 3300005548 | Bacteria | 795 |
| 111 | Ga0070665_102031207 | 3300005548 | Bacteria | 580 |
| 112 | Ga0070704_100001554 | 3300005549 | Bacteria | 12390 |
| 113 | Ga0070704_100048682 | 3300005549 | Bacteria | 2968 |
| 114 | Ga0070704_100199906 | 3300005549 | Bacteria | 1613 |
| 115 | Ga0068855_100226760 | 3300005563 | Bacteria | 2094 |
| 116 | Ga0068855_100560073 | 3300005563 | Bacteria | 1236 |
| 117 | Ga0068857_101315321 | 3300005577 | Bacteria | 702 |
| 118 | Ga0068854_100002103 | 3300005578 | Bacteria | 12200 |
| 119 | Ga0068854_102230631 | 3300005578 | Bacteria | 507 |
| 120 | Ga0068854_102297272 | 3300005578 | Bacteria | 500 |
| 121 | Ga0068856_102335742 | 3300005614 | Bacteria | 543 |
| 122 | Ga0070702_100000100 | 3300005615 | Bacteria | 25735 |
| 123 | Ga0070702_101324692 | 3300005615 | Bacteria | 586 |
| 124 | Ga0070702_101480825 | 3300005615 | Bacteria | 558 |
| 125 | Ga0068852_100244412 | 3300005616 | Bacteria | 1717 |
| 126 | Ga0068859_100003604 | 3300005617 | Bacteria | 15790 |
| 127 | Ga0068859_100007447 | 3300005617 | Bacteria | 11110 |
| 128 | Ga0068859_100062665 | 3300005617 | Bacteria | 3749 |
| 129 | Ga0068864_100065617 | 3300005618 | Bacteria | 3149 |
| 130 | Ga0068864_100395398 | 3300005618 | Bacteria | 1313 |
| 131 | Ga0068864_101569229 | 3300005618 | Bacteria | 662 |
| 132 | Ga0068866_10000214 | 3300005718 | Bacteria | 27363 |
| 133 | Ga0068866_10827657 | 3300005718 | Bacteria | 646 |
| 134 | Ga0068861_100000252 | 3300005719 | Bacteria | 29670 |
| 135 | Ga0068861_100105160 | 3300005719 | Bacteria | 2253 |
| 136 | Ga0068861_100120138 | 3300005719 | Bacteria | 2119 |
| 137 | Ga0068861_100905659 | 3300005719 | Bacteria | 836 |
| 138 | Ga0068870_10323206 | 3300005840 | Bacteria | 981 |
| 139 | Ga0068863_100002709 | 3300005841 | Bacteria | 17500 |
| 140 | Ga0068863_100032543 | 3300005841 | Bacteria | 4969 |
| 141 | Ga0068863_100258333 | 3300005841 | Bacteria | 1684 |
| 142 | Ga0068863_100307318 | 3300005841 | Bacteria | 1539 |
| 143 | Ga0068863_101534080 | 3300005841 | Bacteria | 675 |
| 144 | Ga0068858_100007550 | 3300005842 | Bacteria | 10509 |
| 145 | Ga0068858_100976189 | 3300005842 | Bacteria | 830 |
| 146 | Ga0068858_101262396 | 3300005842 | Bacteria | 727 |
| 147 | Ga0068860_100000021 | 3300005843 | Bacteria | 282612 |
| 148 | Ga0068860_100024036 | 3300005843 | Bacteria | 5891 |
| 149 | Ga0068860_100186815 | 3300005843 | Bacteria | 2004 |
| 150 | Ga0068860_102726303 | 3300005843 | Bacteria | 513 |
| 151 | Ga0068862_100143912 | 3300005844 | Bacteria | 2117 |
| 152 | Ga0068862_100788941 | 3300005844 | Bacteria | 927 |
| 153 | Ga0068862_101291504 | 3300005844 | Bacteria | 731 |
| 154 | Ga0081538_10133678 | 3300005981 | Bacteria | 1160 |
| 155 | Ga0081540_1066609 | 3300005983 | Bacteria | 1687 |
| 156 | Ga0075365_10188039 | 3300006038 | Bacteria | 1445 |
| 157 | Ga0075365_10210837 | 3300006038 | Bacteria | 1362 |
| 158 | Ga0075365_10993563 | 3300006038 | Bacteria | 591 |
| 159 | Ga0075365_11256115 | 3300006038 | Bacteria | 521 |
| 160 | Ga0075363_100003887 | 3300006048 | Bacteria | 6446 |
| 161 | Ga0075363_100005955 | 3300006048 | Bacteria | 5496 |
| 162 | Ga0075363_100084383 | 3300006048 | Bacteria | 1741 |
| 163 | Ga0075363_100109714 | 3300006048 | Bacteria | 1533 |
| 164 | Ga0075363_100161323 | 3300006048 | Bacteria | 1270 |
| 165 | Ga0075363_100228314 | 3300006048 | Bacteria | 1068 |
| 166 | Ga0075363_100265505 | 3300006048 | Bacteria | 991 |
| 167 | Ga0075363_100323502 | 3300006048 | Bacteria | 897 |
| 168 | Ga0075363_100482282 | 3300006048 | Bacteria | 735 |
| 169 | Ga0075363_100493299 | 3300006048 | Bacteria | 727 |
| 170 | Ga0075363_100521969 | 3300006048 | Bacteria | 707 |
| 171 | Ga0075364_10079044 | 3300006051 | Bacteria | 2173 |
| 172 | Ga0075364_10084371 | 3300006051 | Bacteria | 2103 |
| 173 | Ga0075364_10091399 | 3300006051 | Bacteria | 2019 |
| 174 | Ga0075364_10216612 | 3300006051 | Bacteria | 1299 |
| 175 | Ga0075364_10229564 | 3300006051 | Bacteria | 1260 |
| 176 | Ga0075364_10381465 | 3300006051 | Bacteria | 961 |
| 177 | Ga0075364_10482138 | 3300006051 | Bacteria | 848 |
| 178 | Ga0075364_10904125 | 3300006051 | Bacteria | 601 |
| 179 | Ga0070715_10007135 | 3300006163 | Bacteria | 3837 |
| 180 | Ga0070716_100078690 | 3300006173 | Bacteria | 1961 |
| 181 | Ga0070716_100178886 | 3300006173 | Bacteria | 1391 |
| 182 | Ga0070712_100001274 | 3300006175 | Bacteria | 15214 |
| 183 | Ga0075362_10073538 | 3300006177 | Bacteria | 1565 |
| 184 | Ga0075362_10180154 | 3300006177 | Bacteria | 1024 |
| 185 | Ga0075367_10065139 | 3300006178 | Bacteria | 2181 |
| 186 | Ga0075367_10169215 | 3300006178 | Bacteria | 1361 |
| 187 | Ga0075367_10384254 | 3300006178 | Bacteria | 887 |
| 188 | Ga0075367_10747068 | 3300006178 | Bacteria | 622 |
| 189 | Ga0075367_11023163 | 3300006178 | Bacteria | 528 |
| 190 | Ga0075369_10004863 | 3300006186 | Bacteria | 4998 |
| 191 | Ga0075369_10031500 | 3300006186 | Bacteria | 2240 |
| 192 | Ga0075369_10039062 | 3300006186 | Bacteria | 2026 |
| 193 | Ga0075369_10043105 | 3300006186 | Bacteria | 1935 |
| 194 | Ga0075369_10053724 | 3300006186 | Bacteria | 1748 |
| 195 | Ga0075369_10056916 | 3300006186 | Bacteria | 1700 |
| 196 | Ga0075369_10077230 | 3300006186 | Bacteria | 1473 |
| 197 | Ga0075369_10225916 | 3300006186 | Bacteria | 867 |
| 198 | Ga0075369_10306568 | 3300006186 | Bacteria | 742 |
| 199 | Ga0075369_10488183 | 3300006186 | Bacteria | 585 |
| 200 | Ga0097621_100013003 | 3300006237 | Bacteria | 6188 |
| 201 | Ga0075370_10001115 | 3300006353 | Bacteria | 11242 |
| 202 | Ga0075370_10007393 | 3300006353 | Bacteria | 5593 |
| 203 | Ga0075370_10072111 | 3300006353 | Bacteria | 1977 |
| 204 | Ga0075370_10149030 | 3300006353 | Bacteria | 1371 |
| 205 | Ga0075370_10150304 | 3300006353 | Bacteria | 1365 |
| 206 | Ga0075370_10484686 | 3300006353 | Bacteria | 745 |
| 207 | Ga0068871_100740828 | 3300006358 | Bacteria | 903 |
| 208 | Ga0068871_101834910 | 3300006358 | Bacteria | 576 |
| 209 | Ga0075430_100025050 | 3300006846 | Bacteria | 5076 |
| 210 | Ga0075430_100261656 | 3300006846 | Bacteria | 1433 |
| 211 | Ga0075431_100073181 | 3300006847 | Bacteria | 3536 |
| 212 | Ga0075434_101556202 | 3300006871 | Bacteria | 670 |
| 213 | Ga0068865_100001907 | 3300006881 | Bacteria | 12256 |
| 214 | Ga0068865_100091553 | 3300006881 | Bacteria | 2207 |
| 215 | Ga0097620_100003603 | 3300006931 | Bacteria | 15790 |
| 216 | Ga0097620_100007447 | 3300006931 | Bacteria | 11110 |
| 217 | Ga0097620_100062656 | 3300006931 | Bacteria | 3749 |
| 218 | Ga0075435_100659098 | 3300007076 | Bacteria | 909 |
| 219 | Ga0075435_101270912 | 3300007076 | Bacteria | 644 |
| 220 | Ga0075435_101647919 | 3300007076 | Bacteria | 563 |
| 221 | Ga0099795_10357767 | 3300007788 | Bacteria | 654 |
| 222 | Ga0105251_10391222 | 3300009011 | Bacteria | 638 |
| 223 | Ga0105244_10145983 | 3300009036 | Bacteria | 1136 |
| 224 | Ga0105250_10071318 | 3300009092 | Bacteria | 1403 |
| 225 | Ga0105240_12140850 | 3300009093 | Bacteria | 580 |
| 226 | Ga0111539_10175210 | 3300009094 | Bacteria | 2505 |
| 227 | Ga0105245_10001888 | 3300009098 | Bacteria | 19021 |
| 228 | Ga0105245_10088723 | 3300009098 | Bacteria | 2841 |
| 229 | Ga0105245_11716472 | 3300009098 | Bacteria | 680 |
| 230 | Ga0105247_10001265 | 3300009101 | Bacteria | 18737 |
| 231 | Ga0105247_10022858 | 3300009101 | Bacteria | 3766 |
| 232 | Ga0105247_10157405 | 3300009101 | Bacteria | 1501 |
| 233 | Ga0105247_10203364 | 3300009101 | Bacteria | 1332 |
| 234 | Ga0105247_10405966 | 3300009101 | Bacteria | 972 |
| 235 | Ga0105247_10726458 | 3300009101 | Bacteria | 750 |
| 236 | Ga0114129_10036982 | 3300009147 | Bacteria | 6893 |
| 237 | Ga0114129_12316644 | 3300009147 | Bacteria | 644 |
| 238 | Ga0105243_10001270 | 3300009148 | Bacteria | 22670 |
| 239 | Ga0105243_10263147 | 3300009148 | Bacteria | 1545 |
| 240 | Ga0105242_10002230 | 3300009176 | Bacteria | 15288 |
| 241 | Ga0105242_10231614 | 3300009176 | Bacteria | 1656 |
| 242 | Ga0105242_12295196 | 3300009176 | Bacteria | 586 |
| 243 | Ga0105242_12957835 | 3300009176 | Bacteria | 526 |
| 244 | Ga0105248_10000275 | 3300009177 | Bacteria | 60509 |
| 245 | Ga0105248_10017985 | 3300009177 | Bacteria | 7802 |
| 246 | Ga0105248_10778099 | 3300009177 | Bacteria | 1080 |
| 247 | Ga0105248_11175291 | 3300009177 | Bacteria | 867 |
| 248 | Ga0105248_11798844 | 3300009177 | Bacteria | 695 |
| 249 | Ga0105237_10003411 | 3300009545 | Bacteria | 18890 |
| 250 | Ga0105237_10027980 | 3300009545 | Bacteria | 5744 |
| 251 | Ga0105237_10687239 | 3300009545 | Bacteria | 1030 |
| 252 | Ga0105237_10693179 | 3300009545 | Bacteria | 1025 |
| 253 | Ga0105237_10801356 | 3300009545 | Bacteria | 949 |
| 254 | Ga0105238_10575282 | 3300009551 | Bacteria | 1132 |
| 255 | Ga0105238_11737590 | 3300009551 | Bacteria | 655 |
| 256 | Ga0105238_11773584 | 3300009551 | Bacteria | 649 |
| 257 | Ga0105249_10000125 | 3300009553 | Bacteria | 103728 |
| 258 | Ga0105249_10001345 | 3300009553 | Bacteria | 21481 |
| 259 | Ga0105249_10069322 | 3300009553 | Bacteria | 3254 |
| 260 | Ga0105249_10209347 | 3300009553 | Bacteria | 1913 |
| 261 | Ga0105249_10514352 | 3300009553 | Bacteria | 1244 |
| 262 | Ga0099796_10484152 | 3300010159 | Bacteria | 553 |
| 263 | Ga0105239_10023514 | 3300010375 | Bacteria | 6787 |
| 264 | Ga0105239_10053628 | 3300010375 | Bacteria | 4423 |
| 265 | Ga0105239_10162283 | 3300010375 | Bacteria | 2497 |
| 266 | Ga0105239_10399982 | 3300010375 | Bacteria | 1554 |
| 267 | Ga0105246_10640902 | 3300011119 | Bacteria | 924 |
| 268 | Ga0105246_11150883 | 3300011119 | Bacteria | 711 |
| 269 | Ga0105246_11793813 | 3300011119 | Bacteria | 586 |
| 270 | Ga0105246_12052808 | 3300011119 | Bacteria | 553 |
| 271 | Ga0157338_1052517 | 3300012515 | Bacteria | 589 |
| 272 | Ga0157373_10512372 | 3300013100 | Bacteria | 867 |
| 273 | Ga0157370_10635708 | 3300013104 | Bacteria | 976 |
| 274 | Ga0157369_10086550 | 3300013105 | Bacteria | 3347 |
| 275 | Ga0157374_10005046 | 3300013296 | Bacteria | 11074 |
| 276 | Ga0157378_10001139 | 3300013297 | Bacteria | 24164 |
| 277 | Ga0157378_10477132 | 3300013297 | Bacteria | 1242 |
| 278 | Ga0163162_10014957 | 3300013306 | Bacteria | 7578 |
| 279 | Ga0163162_10072810 | 3300013306 | Bacteria | 3491 |
| 280 | Ga0163162_10107460 | 3300013306 | Bacteria | 2886 |
| 281 | Ga0163162_10161588 | 3300013306 | Bacteria | 2362 |
| 282 | Ga0163162_10211057 | 3300013306 | Bacteria | 2071 |
| 283 | Ga0157372_10001931 | 3300013307 | Bacteria | 22495 |
| 284 | Ga0157375_10000802 | 3300013308 | Bacteria | 27587 |
| 285 | Ga0157375_10188503 | 3300013308 | Bacteria | 2217 |
| 286 | Ga0157375_10341274 | 3300013308 | Bacteria | 1663 |
| 287 | Ga0157375_10591711 | 3300013308 | Bacteria | 1269 |
| 288 | Ga0163163_10440596 | 3300014325 | Bacteria | 1362 |
| 289 | Ga0163163_11482405 | 3300014325 | Bacteria | 740 |
| 290 | Ga0163163_11803605 | 3300014325 | Bacteria | 672 |
| 291 | Ga0157380_10012957 | 3300014326 | Bacteria | 6061 |
| 292 | Ga0157380_11835457 | 3300014326 | Bacteria | 666 |
| 293 | Ga0182008_10658727 | 3300014497 | Bacteria | 594 |
| 294 | Ga0157377_10029294 | 3300014745 | Bacteria | 2971 |
| 295 | Ga0157379_10010663 | 3300014968 | Bacteria | 8006 |
| 296 | Ga0157379_10153385 | 3300014968 | Bacteria | 2078 |
| 297 | Ga0157379_10400316 | 3300014968 | Bacteria | 1262 |
| 298 | Ga0157376_10337484 | 3300014969 | Bacteria | 1438 |
| 299 | Ga0163161_10000706 | 3300017792 | Bacteria | 26557 |
| 300 | Ga0163161_10773051 | 3300017792 | Bacteria | 805 |
| 301 | Ga0207672_1003815 | 3300025223 | Bacteria | 858 |
| 302 | Ga0209673_1021193 | 3300025273 | Bacteria | 2280 |
| 303 | Ga0209051_1000116 | 3300025303 | Bacteria | 150182 |
| 304 | Ga0209051_1000883 | 3300025303 | Bacteria | 30181 |
| 305 | Ga0209051_1002463 | 3300025303 | Bacteria | 13245 |
| 306 | Ga0209051_1003291 | 3300025303 | Bacteria | 10715 |
| 307 | Ga0207697_10114382 | 3300025315 | Bacteria | 1157 |
| 308 | Ga0207656_10096459 | 3300025321 | Bacteria | 1350 |
| 309 | Ga0207653_10130205 | 3300025885 | Bacteria | 913 |
| 310 | Ga0207682_10108278 | 3300025893 | Bacteria | 1221 |
| 311 | Ga0207692_10012772 | 3300025898 | Bacteria | 3618 |
| 312 | Ga0207642_10000561 | 3300025899 | Bacteria | 11408 |
| 313 | Ga0207710_10006352 | 3300025900 | Bacteria | 5051 |
| 314 | Ga0207710_10439669 | 3300025900 | Bacteria | 672 |
| 315 | Ga0207688_10000043 | 3300025901 | Bacteria | 43682 |
| 316 | Ga0207688_10100768 | 3300025901 | Bacteria | 1668 |
| 317 | Ga0207680_10037980 | 3300025903 | Bacteria | 2785 |
| 318 | Ga0207680_10135027 | 3300025903 | Bacteria | 1630 |
| 319 | Ga0207680_10169225 | 3300025903 | Bacteria | 1471 |
| 320 | Ga0207680_10771319 | 3300025903 | Bacteria | 689 |
| 321 | Ga0207647_10122063 | 3300025904 | Bacteria | 1536 |
| 322 | Ga0207645_10016251 | 3300025907 | Bacteria | 4929 |
| 323 | Ga0207654_10042201 | 3300025911 | Bacteria | 2580 |
| 324 | Ga0207671_10013199 | 3300025914 | Bacteria | 6592 |
| 325 | Ga0207671_10026575 | 3300025914 | Bacteria | 4335 |
| 326 | Ga0207671_10198122 | 3300025914 | Bacteria | 1568 |
| 327 | Ga0207663_10001505 | 3300025916 | Bacteria | 10875 |
| 328 | Ga0207662_10295997 | 3300025918 | Bacteria | 1074 |
| 329 | Ga0207652_10812323 | 3300025921 | Bacteria | 830 |
| 330 | Ga0207681_10132418 | 3300025923 | Bacteria | 1845 |
| 331 | Ga0207694_10479788 | 3300025924 | Bacteria | 1040 |
| 332 | Ga0207694_10805875 | 3300025924 | Bacteria | 793 |
| 333 | Ga0207687_10000710 | 3300025927 | Bacteria | 22564 |
| 334 | Ga0207687_10009114 | 3300025927 | Bacteria | 6489 |
| 335 | Ga0207700_10959574 | 3300025928 | Bacteria | 765 |
| 336 | Ga0207664_10202293 | 3300025929 | Bacteria | 1715 |
| 337 | Ga0207664_10801260 | 3300025929 | Bacteria | 847 |
| 338 | Ga0207664_10975339 | 3300025929 | Bacteria | 760 |
| 339 | Ga0207644_10013542 | 3300025931 | Bacteria | 5441 |
| 340 | Ga0207644_10037967 | 3300025931 | Bacteria | 3390 |
| 341 | Ga0207644_10458926 | 3300025931 | Bacteria | 1047 |
| 342 | Ga0207644_11666474 | 3300025931 | Bacteria | 534 |
| 343 | Ga0207706_10319020 | 3300025933 | Bacteria | 1352 |
| 344 | Ga0207686_11266142 | 3300025934 | Bacteria | 605 |
| 345 | Ga0207709_10003353 | 3300025935 | Bacteria | 9571 |
| 346 | Ga0207670_10072868 | 3300025936 | Bacteria | 2380 |
| 347 | Ga0207669_10000172 | 3300025937 | Bacteria | 30218 |
| 348 | Ga0207669_10169432 | 3300025937 | Bacteria | 1552 |
| 349 | Ga0207669_10301331 | 3300025937 | Bacteria | 1218 |
| 350 | Ga0207704_10000868 | 3300025938 | Bacteria | 13357 |
| 351 | Ga0207704_10304853 | 3300025938 | Bacteria | 1222 |
| 352 | Ga0207665_10103060 | 3300025939 | Bacteria | 1995 |
| 353 | Ga0207665_10830868 | 3300025939 | Bacteria | 731 |
| 354 | Ga0207691_10084502 | 3300025940 | Bacteria | 2849 |
| 355 | Ga0207711_10000456 | 3300025941 | Bacteria | 42657 |
| 356 | Ga0207711_10061522 | 3300025941 | Bacteria | 3237 |
| 357 | Ga0207711_10112818 | 3300025941 | Bacteria | 2420 |
| 358 | Ga0207667_10022575 | 3300025949 | Bacteria | 6947 |
| 359 | Ga0207667_10131447 | 3300025949 | Bacteria | 2578 |
| 360 | Ga0207667_11138411 | 3300025949 | Bacteria | 762 |
| 361 | Ga0207651_10153416 | 3300025960 | Bacteria | 1796 |
| 362 | Ga0207712_10000028 | 3300025961 | Bacteria | 250190 |
| 363 | Ga0207712_10001501 | 3300025961 | Bacteria | 15821 |
| 364 | Ga0207712_10802952 | 3300025961 | Bacteria | 827 |
| 365 | Ga0207668_10001313 | 3300025972 | Bacteria | 14764 |
| 366 | Ga0207668_10002088 | 3300025972 | Bacteria | 11661 |
| 367 | Ga0207668_10316136 | 3300025972 | Bacteria | 1294 |
| 368 | Ga0207668_10420550 | 3300025972 | Bacteria | 1134 |
| 369 | Ga0207640_10003250 | 3300025981 | Bacteria | 8755 |
| 370 | Ga0207658_10000679 | 3300025986 | Bacteria | 29645 |
| 371 | Ga0207658_10003784 | 3300025986 | Bacteria | 10656 |
| 372 | Ga0207658_10008256 | 3300025986 | Bacteria | 7094 |
| 373 | Ga0207658_10026234 | 3300025986 | Bacteria | 4084 |
| 374 | Ga0207658_10082686 | 3300025986 | Bacteria | 2466 |
| 375 | Ga0207658_10516165 | 3300025986 | Bacteria | 1066 |
| 376 | Ga0207658_12070065 | 3300025986 | Bacteria | 517 |
| 377 | Ga0207677_10002521 | 3300026023 | Bacteria | 9600 |
| 378 | Ga0207677_10504981 | 3300026023 | Bacteria | 1046 |
| 379 | Ga0207703_10207814 | 3300026035 | Bacteria | 1743 |
| 380 | Ga0207703_10927053 | 3300026035 | Bacteria | 834 |
| 381 | Ga0207703_11407478 | 3300026035 | Bacteria | 671 |
| 382 | Ga0207639_10006543 | 3300026041 | Bacteria | 7924 |
| 383 | Ga0207639_10008675 | 3300026041 | Bacteria | 6977 |
| 384 | Ga0207639_10289686 | 3300026041 | Bacteria | 1443 |
| 385 | Ga0207639_11366833 | 3300026041 | Bacteria | 665 |
| 386 | Ga0207708_10013001 | 3300026075 | Bacteria | 6210 |
| 387 | Ga0207702_10993899 | 3300026078 | Bacteria | 832 |
| 388 | Ga0207641_10002249 | 3300026088 | Bacteria | 18006 |
| 389 | Ga0207641_10016777 | 3300026088 | Bacteria | 5997 |
| 390 | Ga0207641_10070981 | 3300026088 | Bacteria | 2994 |
| 391 | Ga0207641_10189583 | 3300026088 | Bacteria | 1889 |
| 392 | Ga0207648_11581967 | 3300026089 | Bacteria | 616 |
| 393 | Ga0207676_10090532 | 3300026095 | Bacteria | 2511 |
| 394 | Ga0207676_10233335 | 3300026095 | Bacteria | 1646 |
| 395 | Ga0207676_12113991 | 3300026095 | Bacteria | 561 |
| 396 | Ga0207676_12581546 | 3300026095 | Bacteria | 504 |
| 397 | Ga0207675_100275579 | 3300026118 | Bacteria | 1633 |
| 398 | Ga0207675_101387063 | 3300026118 | Bacteria | 723 |
| 399 | Ga0207683_10524041 | 3300026121 | Bacteria | 1095 |
| 400 | Ga0207698_10552916 | 3300026142 | Bacteria | 1128 |
| 401 | Ga0207698_11651445 | 3300026142 | Bacteria | 656 |
| 402 | Ga0207698_11692361 | 3300026142 | Bacteria | 648 |
| 403 | Ga0209813_10249155 | 3300027866 | Bacteria | 674 |
| 404 | Ga0268266_10002270 | 3300028379 | Bacteria | 20890 |
| 405 | Ga0268266_10045987 | 3300028379 | Bacteria | 3736 |
| 406 | Ga0268266_10160707 | 3300028379 | Bacteria | 2032 |
| 407 | Ga0268266_10628131 | 3300028379 | Bacteria | 1033 |
| 408 | Ga0268265_10053617 | 3300028380 | Bacteria | 3055 |
| 409 | Ga0268265_10063383 | 3300028380 | Bacteria | 2843 |
| 410 | Ga0268265_10406314 | 3300028380 | Bacteria | 1260 |
| 411 | Ga0268265_11827107 | 3300028380 | Bacteria | 614 |
| 412 | Ga0268264_10000099 | 3300028381 | Bacteria | 228666 |
| 413 | Ga0268264_10003132 | 3300028381 | Bacteria | 14339 |
| 414 | Ga0265327_10001242 | 3300031251 | Bacteria | 34079 |
| 415 | Ga0307405_11442479 | 3300031731 | Bacteria | 603 |
| 416 | Ga0307413_10217656 | 3300031824 | Bacteria | 1392 |
| 417 | Ga0307410_10053391 | 3300031852 | Bacteria | 2735 |
| 418 | Ga0307406_10116050 | 3300031901 | Bacteria | 1852 |
| 419 | Ga0307406_10690457 | 3300031901 | Bacteria | 851 |
| 420 | Ga0307407_10865647 | 3300031903 | Bacteria | 691 |
| 421 | Ga0307409_100212092 | 3300031995 | Bacteria | 1741 |
| 422 | Ga0307409_102929426 | 3300031995 | Bacteria | 504 |
| 423 | Ga0307415_100059921 | 3300032126 | Bacteria | 2628 |
| 424 | Ga0307415_102048565 | 3300032126 | Bacteria | 558 |
| 425 | Ga0316583_10325972 | 3300032133 | Bacteria | 531 |
| 426 | Ga0373948_0162988 | 3300034817 | Bacteria | 563 |
| 427 | Ga0373929_0148280 | 3300035085 | Bacteria | 627 |
| 428 | Ga0373949_0152012 | 3300035090 | Bacteria | 670 |
| 429 | Ga0373952_0091514 | 3300035092 | Bacteria | 791 |
| 430 | Ga0373923_0271358 | 3300035111 | Bacteria | 798 |
| 431 | Ga0373939_0142222 | 3300035114 | Bacteria | 866 |
| 432 | Ga0373941_0315962 | 3300035115 | Bacteria | 627 |
| 433 | Ga0373960_0107603 | 3300035121 | Bacteria | 911 |
| 434 | Ga0373943_0321461 | 3300035170 | Bacteria | 882 |
| 435 | Ga0373942_0013093 | 3300035207 | Bacteria | 1989 |
| 436 | Ga0373961_0066808 | 3300035241 | Bacteria | 1104 |
| 437 | Ga0373962_0077136 | 3300035242 | Bacteria | 1006 |
| 438 | Ga0316574_0953315 | 3300035398 | Bacteria | 518 |
| 439 | Ga0373931_0010495 | 3300035691 | Bacteria | 4453 |
| 440 | Ga0373931_0332144 | 3300035691 | Bacteria | 947 |
| 441 | Ga0373935_1024832 | 3300035692 | Bacteria | 613 |
| 442 | Ga0373947_0149401 | 3300035725 | Bacteria | 1504 |
| 443 | Ga0316584_0106416 | 3300036712 | Bacteria | 2099 |
| 444 | Ga0436364_0835303 | 3300037853 | Bacteria | 2412 |
| 445 | Ga0439438_105758 | 3300041405 | Bacteria | 681 |
| 446 | Ga0439461_0001096 | 3300041410 | Bacteria | 4090 |
| 447 | Ga0439461_0014223 | 3300041410 | Bacteria | 1511 |
| 448 | Ga0439466_0005219 | 3300041411 | Bacteria | 4972 |
| 449 | Ga0439466_0021877 | 3300041411 | Bacteria | 2261 |
| 450 | Ga0439466_0029974 | 3300041411 | Bacteria | 1868 |
| 451 | Ga0439466_0107932 | 3300041411 | Bacteria | 864 |
| 452 | Ga0439466_0179032 | 3300041411 | Bacteria | 646 |
| 453 | Ga0439465_0000888 | 3300041413 | Bacteria | 9447 |
| 454 | Ga0439465_0007141 | 3300041413 | Bacteria | 3550 |
| 455 | Ga0439465_0011335 | 3300041413 | Bacteria | 2797 |
| 456 | Ga0439465_0227309 | 3300041413 | Bacteria | 685 |
| 457 | Ga0451791_0225015 | 3300041451 | Bacteria | 854 |
| 458 | Ga0451793_1605892 | 3300041452 | Bacteria | 650 |
| 459 | Ga0451797_0201048 | 3300041453 | Bacteria | 628 |
| 460 | Ga0451798_0833199 | 3300041458 | Bacteria | 651 |
| 461 | Ga0451802_1153074 | 3300041460 | Bacteria | 1000 |
| 462 | Ga0451806_141653 | 3300041462 | Bacteria | 1206 |
| 463 | Ga0451833_0156992 | 3300041491 | Bacteria | 532 |
| 464 | Ga0451841_0513871 | 3300041498 | Bacteria | 1972 |
| 465 | Ga0451843_0500978 | 3300041509 | Bacteria | 726 |
| 466 | Ga0451843_0712076 | 3300041509 | Bacteria | 763 |
| 467 | Ga0439431_0003164 | 3300041997 | Bacteria | 3620 |
| 468 | Ga0439431_0024906 | 3300041997 | Bacteria | 1459 |
| 469 | Ga0439431_0038460 | 3300041997 | Bacteria | 1211 |
| 470 | Ga0439442_029980 | 3300042002 | Bacteria | 1136 |
| 471 | Ga0439445_0002779 | 3300042004 | Bacteria | 3906 |
| 472 | Ga0439448_0001735 | 3300042005 | Bacteria | 5758 |
| 473 | Ga0439463_100954 | 3300042016 | Bacteria | 744 |
| 474 | Ga0439458_0107484 | 3300042157 | Bacteria | 728 |
| 475 | Ga0439434_0008121 | 3300042435 | Bacteria | 3077 |
| 476 | Ga0439434_0011344 | 3300042435 | Bacteria | 2634 |
| 477 | Ga0439459_0012943 | 3300042438 | Bacteria | 1494 |
| 478 | Ga0439459_0156253 | 3300042438 | Bacteria | 599 |
| 479 | Ga0466972_0000752 | 3300044658 | Bacteria | 15448 |
| 480 | Ga0466972_0046165 | 3300044658 | Bacteria | 2109 |
| 481 | Ga0466972_0144330 | 3300044658 | Bacteria | 1120 |
| 482 | Ga0466972_0172690 | 3300044658 | Bacteria | 1014 |
| 483 | Ga0466965_0001251 | 3300044683 | Bacteria | 10080 |
| 484 | Ga0466965_0046943 | 3300044683 | Bacteria | 2138 |
| 485 | Ga0466966_0055083 | 3300044684 | Bacteria | 2518 |
| 486 | Ga0466961_0056252 | 3300044693 | Bacteria | 2506 |
| 487 | Ga0466963_1165920 | 3300044694 | Bacteria | 542 |
| 488 | Ga0466964_0226593 | 3300044706 | Bacteria | 910 |
| 489 | Ga0466971_0003847 | 3300044719 | Bacteria | 6434 |
| 490 | Ga0466968_0012315 | 3300044735 | Bacteria | 3346 |
| 491 | Ga0466968_0030505 | 3300044735 | Bacteria | 2233 |
| 492 | Ga0466970_0023613 | 3300044765 | Bacteria | 3212 |
| 493 | Ga0466970_0472790 | 3300044765 | Bacteria | 720 |
| 494 | Ga0466970_0657878 | 3300044765 | Bacteria | 609 |
| 495 | Ga0466957_0004736 | 3300044842 | Bacteria | 7619 |
| 496 | Ga0466957_0473357 | 3300044842 | Bacteria | 865 |
| 497 | Ga0466957_1194802 | 3300044842 | Bacteria | 550 |
| 498 | Ga0466960_0078752 | 3300044901 | Bacteria | 1655 |
| 499 | Ga0466960_0246272 | 3300044901 | Bacteria | 991 |
| 500 | Ga0466960_0376456 | 3300044901 | Bacteria | 814 |
| 501 | Ga0466960_0625786 | 3300044901 | Bacteria | 641 |
| 502 | Ga0466959_0003822 | 3300045049 | Bacteria | 9983 |
| 503 | Ga0466959_0016881 | 3300045049 | Bacteria | 5342 |
| 504 | Ga0466958_0004215 | 3300045836 | Bacteria | 7560 |
| 505 | Ga0466958_0408481 | 3300045836 | Bacteria | 877 |
| 506 | Ga0466967_0006708 | 3300045976 | Bacteria | 8189 |
| 507 | Ga0466967_0121834 | 3300045976 | Bacteria | 2411 |
| 508 | Ga0466967_0137376 | 3300045976 | Bacteria | 2274 |
| 509 | Ga0466967_0278864 | 3300045976 | Bacteria | 1603 |
| 510 | Ga0466967_0552811 | 3300045976 | Bacteria | 1133 |
| 511 | Ga0466967_1484160 | 3300045976 | Bacteria | 675 |
| 512 | Ga0495592_0422421 | 3300046454 | Bacteria | 840 |
| 513 | Ga0495603_0126973 | 3300046455 | Bacteria | 1486 |
| 514 | Ga0495603_0773586 | 3300046455 | Bacteria | 548 |
| 515 | Ga0495629_0018060 | 3300046459 | Bacteria | 5055 |
| 516 | Ga0495638_0002160 | 3300046460 | Bacteria | 16508 |
| 517 | Ga0495638_0007249 | 3300046460 | Bacteria | 7971 |
| 518 | Ga0495641_0019890 | 3300046461 | Bacteria | 3421 |
| 519 | Ga0495653_0422608 | 3300046463 | Bacteria | 843 |
| 520 | Ga0495580_0298048 | 3300046472 | Bacteria | 1098 |
| 521 | Ga0495582_0050717 | 3300046473 | Bacteria | 2287 |
| 522 | Ga0495639_0155205 | 3300046475 | Bacteria | 1106 |
| 523 | Ga0495662_0354710 | 3300046476 | Bacteria | 721 |
| 524 | Ga0495583_0082586 | 3300046506 | Bacteria | 1394 |
| 525 | Ga0495608_0449234 | 3300046511 | Bacteria | 784 |
| 526 | Ga0495616_0106594 | 3300046513 | Bacteria | 1307 |
| 527 | Ga0495630_0478009 | 3300046517 | Bacteria | 955 |
| 528 | Ga0495648_0007758 | 3300046524 | Bacteria | 8538 |
| 529 | Ga0495666_0301608 | 3300046526 | Bacteria | 724 |
| 530 | Ga0495654_0073171 | 3300046530 | Bacteria | 1621 |
| 531 | Ga0495640_0666573 | 3300046533 | Bacteria | 625 |
| 532 | Ga0495622_0284760 | 3300046557 | Bacteria | 722 |
| 533 | Ga0495668_0029180 | 3300046616 | Bacteria | 3118 |
| 534 | Ga0495668_0144997 | 3300046616 | Bacteria | 1300 |
| 535 | Ga0495611_0162983 | 3300046648 | Bacteria | 1042 |
| 536 | Ga0495625_0295414 | 3300046660 | Bacteria | 1038 |
| 537 | Ga0495625_0297939 | 3300046660 | Bacteria | 1032 |
| 538 | Ga0495635_0534623 | 3300046663 | Bacteria | 770 |
| 539 | Ga0495588_0392666 | 3300046674 | Bacteria | 728 |
| 540 | Ga0495657_0408512 | 3300046675 | Bacteria | 798 |
| 541 | Ga0495658_0147785 | 3300046683 | Bacteria | 1441 |
| 542 | Ga0495624_0098576 | 3300046690 | Bacteria | 1800 |
| 543 | Ga0495671_0596562 | 3300046692 | Bacteria | 525 |
| 544 | Ga0495649_0281899 | 3300046694 | Bacteria | 849 |
| 545 | Ga0495581_0008269 | 3300047315 | Bacteria | 6031 |
| 546 | Ga0495674_0202970 | 3300047319 | Bacteria | 1644 |
| 547 | Ga0495672_0006087 | 3300047320 | Bacteria | 9423 |
| 548 | Ga0495672_0031490 | 3300047320 | Bacteria | 3311 |
| 549 | Ga0495672_0101140 | 3300047320 | Bacteria | 1563 |
| 550 | Ga0495676_0327813 | 3300047321 | Bacteria | 1027 |
| 551 | Ga0495680_0447081 | 3300047322 | Bacteria | 885 |
| 552 | Ga0495673_0006204 | 3300047469 | Bacteria | 7077 |
| 553 | Ga0495686_0011572 | 3300047472 | Bacteria | 6211 |
| 554 | Ga0495593_0022778 | 3300047673 | Bacteria | 3485 |
| 555 | Ga0495614_0539887 | 3300048089 | Bacteria | 557 |
| 556 | Ga0495626_0233447 | 3300048091 | Bacteria | 743 |
| 557 | Ga0496100_0000091 | 3300048903 | Bacteria | 51013 |
| 558 | Ga0496100_0000686 | 3300048903 | Bacteria | 16149 |
| 559 | Ga0496100_0000796 | 3300048903 | Bacteria | 15040 |
| 560 | Ga0496100_0001186 | 3300048903 | Bacteria | 12682 |
| 561 | Ga0496100_0347403 | 3300048903 | Bacteria | 1120 |
| 562 | Ga0496100_0636184 | 3300048903 | Bacteria | 830 |
| 563 | Ga0496101_0000082 | 3300048904 | Bacteria | 104164 |
| 564 | Ga0496101_0000095 | 3300048904 | Bacteria | 94155 |
| 565 | Ga0496101_0000700 | 3300048904 | Bacteria | 20115 |
| 566 | Ga0496101_0003381 | 3300048904 | Bacteria | 9947 |
| 567 | Ga0496101_0031004 | 3300048904 | Bacteria | 3755 |
| 568 | Ga0496101_0859205 | 3300048904 | Bacteria | 715 |
| 569 | Ga0496102_0000135 | 3300048905 | Bacteria | 100763 |
| 570 | Ga0496102_0000136 | 3300048905 | Bacteria | 99667 |
| 571 | Ga0496102_0002203 | 3300048905 | Bacteria | 16737 |
| 572 | Ga0496102_0011693 | 3300048905 | Bacteria | 7573 |
| 573 | Ga0496102_0025687 | 3300048905 | Bacteria | 5246 |
| 574 | Ga0496102_0029148 | 3300048905 | Bacteria | 4936 |
| 575 | Ga0496102_0298369 | 3300048905 | Bacteria | 1519 |
| 576 | Ga0496102_0372773 | 3300048905 | Bacteria | 1343 |
| 577 | Ga0496102_0417392 | 3300048905 | Bacteria | 1260 |
| 578 | Ga0496102_0517331 | 3300048905 | Bacteria | 1116 |
| 579 | Ga0496102_0579127 | 3300048905 | Bacteria | 1045 |
| 580 | Ga0496102_0670824 | 3300048905 | Bacteria | 960 |
| 581 | Ga0496103_0000092 | 3300048906 | Bacteria | 100968 |
| 582 | Ga0496103_0000341 | 3300048906 | Bacteria | 42518 |
| 583 | Ga0496103_0004617 | 3300048906 | Bacteria | 8338 |
| 584 | Ga0496103_0014028 | 3300048906 | Bacteria | 4757 |
| 585 | Ga0496103_0053908 | 3300048906 | Bacteria | 2492 |
| 586 | Ga0496103_0118141 | 3300048906 | Bacteria | 1688 |
| 587 | Ga0496103_0121577 | 3300048906 | Bacteria | 1663 |
| 588 | Ga0496103_0592268 | 3300048906 | Bacteria | 707 |
| 589 | Ga0496104_0000782 | 3300048907 | Bacteria | 27206 |
| 590 | Ga0496104_0015064 | 3300048907 | Bacteria | 6999 |
| 591 | Ga0496104_0705622 | 3300048907 | Bacteria | 916 |
| 592 | Ga0496104_0816992 | 3300048907 | Bacteria | 838 |
| 593 | Ga0496104_1005465 | 3300048907 | Bacteria | 738 |
| 594 | Ga0496105_0001884 | 3300048908 | Bacteria | 15045 |
| 595 | Ga0496105_0087768 | 3300048908 | Bacteria | 2570 |
| 596 | Ga0496105_0206248 | 3300048908 | Bacteria | 1603 |
| 597 | Ga0496105_0317249 | 3300048908 | Bacteria | 1250 |
| 598 | Ga0496105_0385145 | 3300048908 | Bacteria | 1115 |
| 599 | Ga0496106_0000650 | 3300048909 | Bacteria | 24883 |
| 600 | Ga0496106_0024358 | 3300048909 | Bacteria | 4499 |
| 601 | Ga0496106_0029608 | 3300048909 | Bacteria | 4081 |
| 602 | Ga0496106_0058371 | 3300048909 | Bacteria | 2921 |
| 603 | Ga0496106_0125318 | 3300048909 | Bacteria | 2010 |
| 604 | Ga0496107_0000765 | 3300048910 | Bacteria | 18533 |
| 605 | Ga0496107_0002093 | 3300048910 | Bacteria | 12783 |
| 606 | Ga0496107_0054359 | 3300048910 | Bacteria | 2890 |
| 607 | Ga0496107_0595265 | 3300048910 | Bacteria | 817 |
| 608 | Ga0496107_1352731 | 3300048910 | Bacteria | 508 |
| 609 | Ga0496108_0000330 | 3300048911 | Bacteria | 40103 |
| 610 | Ga0496108_0003630 | 3300048911 | Bacteria | 12368 |
| 611 | Ga0496108_0056199 | 3300048911 | Bacteria | 3306 |
| 612 | Ga0496108_0726969 | 3300048911 | Bacteria | 860 |
| 613 | Ga0496108_1048256 | 3300048911 | Bacteria | 695 |
| 614 | Ga0496108_1296184 | 3300048911 | Bacteria | 613 |
| 615 | Ga0496109_0000302 | 3300048912 | Bacteria | 46592 |
| 616 | Ga0496109_0012077 | 3300048912 | Bacteria | 7442 |
| 617 | Ga0496109_0332539 | 3300048912 | Bacteria | 1434 |
| 618 | Ga0496109_0487347 | 3300048912 | Bacteria | 1164 |
| 619 | Ga0496109_1050372 | 3300048912 | Bacteria | 752 |
| 620 | Ga0496110_0009685 | 3300048913 | Bacteria | 7803 |
| 621 | Ga0496110_0010070 | 3300048913 | Bacteria | 7676 |
| 622 | Ga0496110_0283516 | 3300048913 | Bacteria | 1509 |
| 623 | Ga0496110_0862637 | 3300048913 | Bacteria | 811 |
| 624 | Ga0496111_0025868 | 3300048914 | Bacteria | 4141 |
| 625 | Ga0496111_0075367 | 3300048914 | Bacteria | 2458 |
| 626 | Ga0496111_0222566 | 3300048914 | Bacteria | 1402 |
| 627 | Ga0496111_0414221 | 3300048914 | Bacteria | 995 |
| 628 | Ga0496112_0077564 | 3300048915 | Bacteria | 3286 |
| 629 | Ga0496112_0107552 | 3300048915 | Bacteria | 2759 |
| 630 | Ga0496112_0220605 | 3300048915 | Bacteria | 1852 |
| 631 | Ga0496112_0330994 | 3300048915 | Bacteria | 1467 |
| 632 | Ga0496112_0488408 | 3300048915 | Bacteria | 1167 |
| 633 | Ga0496113_0015654 | 3300048916 | Bacteria | 5222 |
| 634 | Ga0496113_0343190 | 3300048916 | Bacteria | 1198 |
| 635 | Ga0496113_0389256 | 3300048916 | Bacteria | 1119 |
| 636 | Ga0496114_0000191 | 3300048917 | Bacteria | 44606 |
| 637 | Ga0496114_0000680 | 3300048917 | Bacteria | 25258 |
| 638 | Ga0496114_0036460 | 3300048917 | Bacteria | 4066 |
| 639 | Ga0496114_0243715 | 3300048917 | Bacteria | 1581 |
| 640 | Ga0496114_0293850 | 3300048917 | Bacteria | 1434 |
| 641 | Ga0496115_0000858 | 3300048918 | Bacteria | 22064 |
| 642 | Ga0496115_0007950 | 3300048918 | Bacteria | 7828 |
| 643 | Ga0496115_0017415 | 3300048918 | Bacteria | 5494 |
| 644 | Ga0496115_0426270 | 3300048918 | Bacteria | 1074 |
| 645 | Ga0496115_0524643 | 3300048918 | Bacteria | 949 |
| 646 | Ga0496115_0643369 | 3300048918 | Bacteria | 839 |
| 647 | Ga0496116_0000238 | 3300048919 | Bacteria | 100797 |
| 648 | Ga0496116_0078774 | 3300048919 | Bacteria | 2053 |
| 649 | Ga0496116_0147676 | 3300048919 | Bacteria | 1311 |
| 650 | Ga0496117_0000019 | 3300048920 | Bacteria | 469256 |
| 651 | Ga0496117_0001174 | 3300048920 | Bacteria | 39383 |
| 652 | Ga0496117_0009287 | 3300048920 | Bacteria | 9186 |
| 653 | Ga0496118_0000020 | 3300048921 | Bacteria | 470521 |
| 654 | Ga0496118_0001467 | 3300048921 | Bacteria | 35366 |
| 655 | Ga0496118_0009566 | 3300048921 | Bacteria | 9759 |
| 656 | Ga0496119_0002014 | 3300048922 | Bacteria | 22994 |
| 657 | Ga0496119_0020848 | 3300048922 | Bacteria | 4758 |
| 658 | Ga0496119_0045271 | 3300048922 | Bacteria | 2760 |
| 659 | Ga0496119_0063658 | 3300048922 | Bacteria | 2192 |
| 660 | Ga0496119_0409295 | 3300048922 | Bacteria | 646 |
| 661 | Ga0496119_0454464 | 3300048922 | Bacteria | 603 |
| 662 | Ga0496120_0003913 | 3300048923 | Bacteria | 13005 |
| 663 | Ga0496120_0038883 | 3300048923 | Bacteria | 2811 |
| 664 | Ga0496120_0484311 | 3300048923 | Bacteria | 533 |
| 665 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 666 | Ga0496121_0000064 | 3300048924 | Bacteria | 272488 |
| 667 | Ga0496122_0000085 | 3300048925 | Bacteria | 208310 |
| 668 | Ga0496123_0022496 | 3300048926 | Bacteria | 4856 |
| 669 | Ga0496124_0000030 | 3300048927 | Bacteria | 351350 |
| 670 | Ga0496124_0328613 | 3300048927 | Bacteria | 1091 |
| 671 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 672 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 673 | Ga0496126_0000668 | 3300048929 | Bacteria | 63397 |
| 674 | Ga0496126_0029090 | 3300048929 | Bacteria | 5252 |
| 675 | Ga0496126_0148977 | 3300048929 | Bacteria | 2007 |
| 676 | Ga0496126_0847289 | 3300048929 | Bacteria | 697 |
| 677 | Ga0501032_0026467 | 3300049569 | Bacteria | 3989 |
| 678 | Ga0501034_0004879 | 3300049571 | Bacteria | 14798 |
| 679 | Ga0501034_1506387 | 3300049571 | Bacteria | 546 |
| 680 | Ga0501036_0246260 | 3300049572 | Bacteria | 1498 |
| 681 | Ga0501037_0006383 | 3300049573 | Bacteria | 8625 |
| 682 | Ga0501037_0280789 | 3300049573 | Bacteria | 1160 |
| 683 | Ga0501038_0002452 | 3300049574 | Bacteria | 17278 |
| 684 | Ga0501038_0380330 | 3300049574 | Bacteria | 1095 |
| 685 | Ga0501039_0000368 | 3300049575 | Bacteria | 32267 |
| 686 | Ga0501043_0000976 | 3300049579 | Bacteria | 25292 |
| 687 | Ga0501043_0420773 | 3300049579 | Bacteria | 1007 |
| 688 | Ga0501047_1121627 | 3300049581 | Bacteria | 600 |
| 689 | Ga0501069_0897767 | 3300049585 | Bacteria | 539 |
| 690 | Ga0501070_0040869 | 3300049586 | Bacteria | 3865 |
| 691 | Ga0501070_0220116 | 3300049586 | Bacteria | 1557 |
| 692 | Ga0501073_0172132 | 3300049589 | Bacteria | 1499 |
| 693 | Ga0501080_0107341 | 3300049742 | Bacteria | 2588 |
| 694 | Ga0501044_0029742 | 3300049823 | Bacteria | 5759 |
| 695 | nmdc:mga03683_189414_c1 | 3300050489 | Bacteria | 941 |
| 696 | nmdc:mga03683_56638_c1 | 3300050489 | Bacteria | 1648 |
| 697 | nmdc:mga03683_627147_c1 | 3300050489 | Bacteria | 528 |
| 698 | nmdc:mga03683_77071_c1 | 3300050489 | Bacteria | 1434 |
| 699 | nmdc:mga03n38_156133_c1 | 3300050490 | Bacteria | 1152 |
| 700 | nmdc:mga03n38_165492_c1 | 3300050490 | Bacteria | 1123 |
| 701 | nmdc:mga03n38_255540_c1 | 3300050490 | Bacteria | 927 |
| 702 | nmdc:mga03n38_362540_c1 | 3300050490 | Bacteria | 791 |
| 703 | nmdc:mga03n38_404113_c1 | 3300050490 | Bacteria | 752 |
| 704 | nmdc:mga03n38_422250_c1 | 3300050490 | Bacteria | 737 |
| 705 | nmdc:mga03n38_572947_c1 | 3300050490 | Bacteria | 641 |
| 706 | nmdc:mga03n38_661647_c1 | 3300050490 | Bacteria | 599 |
| 707 | nmdc:mga03n38_80859_c1 | 3300050490 | Bacteria | 1527 |
| 708 | nmdc:mga00v17_161020_c1 | 3300050491 | Bacteria | 1445 |
| 709 | nmdc:mga00v17_21387_c1 | 3300050491 | Bacteria | 3719 |
| 710 | nmdc:mga00v17_321812_c1 | 3300050491 | Bacteria | 1005 |
| 711 | nmdc:mga00v17_389413_c1 | 3300050491 | Bacteria | 906 |
| 712 | nmdc:mga00v17_724141_c1 | 3300050491 | Bacteria | 637 |
| 713 | nmdc:mga00v17_9757_c1 | 3300050491 | Bacteria | 5212 |
| 714 | nmdc:mga0yw44_11851_c1 | 3300050492 | Bacteria | 4523 |
| 715 | nmdc:mga0yw44_164373_c1 | 3300050492 | Bacteria | 1454 |
| 716 | nmdc:mga0yw44_287749_c1 | 3300050492 | Bacteria | 1099 |
| 717 | nmdc:mga0yw44_463577_c1 | 3300050492 | Bacteria | 859 |
| 718 | nmdc:mga0yw44_753388_c1 | 3300050492 | Bacteria | 661 |
| 719 | nmdc:mga0yw44_76095_c1 | 3300050492 | Bacteria | 2094 |
| 720 | nmdc:mga06z11_679669_c1 | 3300050494 | Bacteria | 627 |
| 721 | nmdc:mga06z11_99076_c1 | 3300050494 | Bacteria | 1596 |
| 722 | nmdc:mga04h51_282305_c1 | 3300050495 | Bacteria | 673 |
| 723 | nmdc:mga07m45_104089_c1 | 3300050496 | Bacteria | 1632 |
| 724 | nmdc:mga07m45_109469_c1 | 3300050496 | Bacteria | 1590 |
| 725 | nmdc:mga07m45_204662_c1 | 3300050496 | Bacteria | 1148 |
| 726 | nmdc:mga07m45_283332_c1 | 3300050496 | Bacteria | 964 |
| 727 | nmdc:mga07m45_340665_c1 | 3300050496 | Bacteria | 871 |
| 728 | nmdc:mga07m45_6576_c1 | 3300050496 | Bacteria | 5886 |
| 729 | nmdc:mga05p37_81229_c1 | 3300050507 | Bacteria | 3993 |
| 730 | nmdc:mga0qj67_246989_c1 | 3300050509 | Bacteria | 1448 |
| 731 | nmdc:mga0qj67_31773_c1 | 3300050509 | Bacteria | 4114 |
| 732 | nmdc:mga06r32_75911_c1 | 3300050510 | Bacteria | 3263 |
| 733 | nmdc:mga08y16_288327_c1 | 3300050511 | Bacteria | 1692 |
| 734 | nmdc:mga0rr50_611645_c1 | 3300050513 | Bacteria | 929 |
| 735 | nmdc:mga0sz30_10903_c1 | 3300050516 | Bacteria | 3494 |
| 736 | nmdc:mga0sz30_116287_c1 | 3300050516 | Bacteria | 707 |
| 737 | nmdc:mga0sz30_12193_c1 | 3300050516 | Bacteria | 3339 |
| 738 | nmdc:mga0sz30_136194_c1 | 3300050516 | Bacteria | 1083 |
| 739 | nmdc:mga0sz30_244975_c1 | 3300050516 | Bacteria | 798 |
| 740 | nmdc:mga0sz30_265077_c1 | 3300050516 | Bacteria | 765 |
| 741 | nmdc:mga0sz30_305970_c1 | 3300050516 | Bacteria | 709 |
| 742 | nmdc:mga0sz30_33736_c1 | 3300050516 | Bacteria | 2128 |
| 743 | nmdc:mga0sz30_3712_c1 | 3300050516 | Bacteria | 3497 |
| 744 | nmdc:mga0sz30_383066_c1 | 3300050516 | Bacteria | 630 |
| 745 | nmdc:mga0sz30_413534_c1 | 3300050516 | Bacteria | 604 |
| 746 | nmdc:mga0sz30_715_c2 | 3300050516 | Bacteria | 4281 |
| 747 | nmdc:mga0sz30_79678_c1 | 3300050516 | Bacteria | 1416 |
| 748 | nmdc:mga0sz30_81625_c1 | 3300050516 | Bacteria | 1400 |
| 749 | nmdc:mga0sz30_96567_c1 | 3300050516 | Bacteria | 1289 |
| 750 | Ga0500610_0020120 | 3300053079 | Bacteria | 3254 |
| 751 | Ga0500635_0139117 | 3300053080 | Bacteria | 920 |
| 752 | Ga0495619_0158286 | 3300053085 | Bacteria | 1564 |
| 753 | Ga0500643_003798 | 3300053087 | Bacteria | 7057 |
| 754 | Ga0500643_008531 | 3300053087 | Bacteria | 4020 |
| 755 | Ga0500644_0017466 | 3300053088 | Bacteria | 2084 |
| 756 | Ga0500650_0121959 | 3300053098 | Bacteria | 1215 |
| 757 | Ga0500650_0373112 | 3300053098 | Bacteria | 621 |
| 758 | Ga0500556_0021703 | 3300053104 | Bacteria | 2074 |
| 759 | Ga0500556_0045515 | 3300053104 | Bacteria | 1566 |
| 760 | Ga0500562_007101 | 3300053108 | Bacteria | 2826 |
| 761 | Ga0500595_155258 | 3300053119 | Bacteria | 639 |
| 762 | Ga0500608_369968 | 3300053122 | Bacteria | 500 |
| 763 | Ga0500652_014247 | 3300053131 | Bacteria | 2838 |
| 764 | Ga0500559_0161899 | 3300053136 | Bacteria | 1051 |
| 765 | Ga0500588_0160108 | 3300053146 | Bacteria | 819 |
| 766 | Ga0500588_0240830 | 3300053146 | Bacteria | 678 |
| 767 | Ga0500616_0006585 | 3300053153 | Bacteria | 7574 |
| 768 | Ga0500616_0046613 | 3300053153 | Bacteria | 2304 |
| 769 | Ga0500627_0474271 | 3300053158 | Bacteria | 524 |
| 770 | Ga0500611_235738 | 3300053727 | Bacteria | 525 |
| 771 | Ga0500645_000023 | 3300053730 | Bacteria | 128995 |
| 772 | Ga0466962_0023472 | 3300061719 | Bacteria | 2964 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0144330 | Ga0466972_0144330_700_849 | 49 |
| 2 | 3300044901 | Ga0466960_0376456 | Ga0466960_0376456_84_233 | 49 |
| 3 | 3300045976 | Ga0466967_0552811 | Ga0466967_0552811_759_908 | 49 |
| 4 | iso_pu_bacteria | 2643221687 | 2644490445 | 49 |
| 5 | iso_pu_bacteria | 2643221715 | 2644638681 | 49 |
| 6 | iso_pu_bacteria | 2738541264 | 2738668568 | 49 |
| 7 | iso_pu_bacteria | 2738541356 | 2739147760 | 49 |
| 8 | iso_pu_bacteria | 2902792274 | 2902793977 | 49 |
| 9 | iso_pu_bacteria | 2902810491 | 2902811429 | 49 |
| 10 | iso_pu_bacteria | 2902837492 | 2902839746 | 49 |
| 11 | iso_pu_bacteria | 2939582691 | 2939582914 | 49 |
| 12 | 3300001977 | JGI24746J21847_1003449 | JGI24746J21847_10034492 | 51 |
| 13 | 3300001978 | JGI24747J21853_1010379 | JGI24747J21853_10103792 | 51 |
| 14 | 3300001990 | JGI24737J22298_10021356 | JGI24737J22298_100213563 | 51 |
| 15 | 3300001991 | JGI24743J22301_10004378 | JGI24743J22301_100043782 | 51 |
| 16 | 3300002070 | JGI24750J21931_1007227 | JGI24750J21931_10072272 | 51 |
| 17 | 3300002073 | JGI24745J21846_1021647 | JGI24745J21846_10216472 | 51 |
| 18 | 3300002075 | JGI24738J21930_10020626 | JGI24738J21930_100206263 | 51 |
| 19 | 3300002239 | JGI24034J26672_10023766 | JGI24034J26672_100237662 | 51 |
| 20 | 3300002244 | JGI24742J22300_10024505 | JGI24742J22300_100245052 | 51 |
| 21 | 3300005328 | Ga0070676_10453100 | Ga0070676_104531002 | 51 |
| 22 | 3300005334 | Ga0068869_100009054 | Ga0068869_1000090545 | 51 |
| 23 | 3300005335 | Ga0070666_10078223 | Ga0070666_100782233 | 51 |
| 24 | 3300005336 | Ga0070680_100225547 | Ga0070680_1002255473 | 51 |
| 25 | 3300005337 | Ga0070682_100382022 | Ga0070682_1003820222 | 51 |
| 26 | 3300005338 | Ga0068868_100087252 | Ga0068868_1000872523 | 51 |
| 27 | 3300005338 | Ga0068868_101236918 | Ga0068868_1012369182 | 51 |
| 28 | 3300005343 | Ga0070687_100968798 | Ga0070687_1009687981 | 51 |
| 29 | 3300005344 | Ga0070661_101052486 | Ga0070661_1010524862 | 51 |
| 30 | 3300005347 | Ga0070668_100153093 | Ga0070668_1001530933 | 51 |
| 31 | 3300005347 | Ga0070668_101351610 | Ga0070668_1013516102 | 51 |
| 32 | 3300005354 | Ga0070675_100480421 | Ga0070675_1004804212 | 51 |
| 33 | 3300005355 | Ga0070671_100295615 | Ga0070671_1002956152 | 51 |
| 34 | 3300005356 | Ga0070674_100457638 | Ga0070674_1004576382 | 51 |
| 35 | 3300005364 | Ga0070673_100889130 | Ga0070673_1008891302 | 51 |
| 36 | 3300005366 | Ga0070659_100152265 | Ga0070659_1001522653 | 51 |
| 37 | 3300005367 | Ga0070667_100000782 | Ga0070667_1000007824 | 51 |
| 38 | 3300005367 | Ga0070667_100153655 | Ga0070667_1001536552 | 51 |
| 39 | 3300005406 | Ga0070703_10061688 | Ga0070703_100616882 | 51 |
| 40 | 3300005435 | Ga0070714_100627326 | Ga0070714_1006273262 | 51 |
| 41 | 3300005436 | Ga0070713_101191986 | Ga0070713_1011919861 | 51 |
| 42 | 3300005437 | Ga0070710_10002759 | Ga0070710_100027595 | 51 |
| 43 | 3300005439 | Ga0070711_100022825 | Ga0070711_1000228253 | 51 |
| 44 | 3300005440 | Ga0070705_100401190 | Ga0070705_1004011902 | 51 |
| 45 | 3300005444 | Ga0070694_100052701 | Ga0070694_1000527012 | 51 |
| 46 | 3300005458 | Ga0070681_10614224 | Ga0070681_106142242 | 51 |
| 47 | 3300005459 | Ga0068867_100312285 | Ga0068867_1003122852 | 51 |
| 48 | 3300005536 | Ga0070697_100853501 | Ga0070697_1008535012 | 51 |
| 49 | 3300005539 | Ga0068853_101929276 | Ga0068853_1019292761 | 51 |
| 50 | 3300005544 | Ga0070686_101083488 | Ga0070686_1010834881 | 51 |
| 51 | 3300005546 | Ga0070696_100010405 | Ga0070696_1000104054 | 51 |
| 52 | 3300005548 | Ga0070665_100009878 | Ga0070665_1000098783 | 51 |
| 53 | 3300005549 | Ga0070704_100199906 | Ga0070704_1001999063 | 51 |
| 54 | 3300005578 | Ga0068854_102230631 | Ga0068854_1022306312 | 51 |
| 55 | 3300005615 | Ga0070702_101324692 | Ga0070702_1013246922 | 51 |
| 56 | 3300005617 | Ga0068859_100007447 | Ga0068859_10000744713 | 51 |
| 57 | 3300005618 | Ga0068864_100395398 | Ga0068864_1003953982 | 51 |
| 58 | 3300005618 | Ga0068864_101569229 | Ga0068864_1015692292 | 51 |
| 59 | 3300005718 | Ga0068866_10827657 | Ga0068866_108276571 | 51 |
| 60 | 3300005841 | Ga0068863_100002709 | Ga0068863_1000027094 | 51 |
| 61 | 3300005842 | Ga0068858_101262396 | Ga0068858_1012623962 | 51 |
| 62 | 3300005843 | Ga0068860_100000021 | Ga0068860_10000002131 | 51 |
| 63 | 3300005843 | Ga0068860_102726303 | Ga0068860_1027263032 | 51 |
| 64 | 3300005981 | Ga0081538_10133678 | Ga0081538_101336782 | 51 |
| 65 | 3300006048 | Ga0075363_100003887 | Ga0075363_1000038874 | 51 |
| 66 | 3300006048 | Ga0075363_100005955 | Ga0075363_1000059551 | 51 |
| 67 | 3300006048 | Ga0075363_100161323 | Ga0075363_1001613232 | 51 |
| 68 | 3300006048 | Ga0075363_100265505 | Ga0075363_1002655051 | 51 |
| 69 | 3300006048 | Ga0075363_100323502 | Ga0075363_1003235022 | 51 |
| 70 | 3300006048 | Ga0075363_100521969 | Ga0075363_1005219692 | 51 |
| 71 | 3300006051 | Ga0075364_10079044 | Ga0075364_100790443 | 51 |
| 72 | 3300006051 | Ga0075364_10229564 | Ga0075364_102295642 | 51 |
| 73 | 3300006051 | Ga0075364_10904125 | Ga0075364_109041252 | 51 |
| 74 | 3300006173 | Ga0070716_100178886 | Ga0070716_1001788862 | 51 |
| 75 | 3300006177 | Ga0075362_10180154 | Ga0075362_101801542 | 51 |
| 76 | 3300006178 | Ga0075367_11023163 | Ga0075367_110231632 | 51 |
| 77 | 3300006186 | Ga0075369_10031500 | Ga0075369_100315004 | 51 |
| 78 | 3300006186 | Ga0075369_10043105 | Ga0075369_100431053 | 51 |
| 79 | 3300006186 | Ga0075369_10225916 | Ga0075369_102259162 | 51 |
| 80 | 3300006353 | Ga0075370_10001115 | Ga0075370_100011152 | 51 |
| 81 | 3300006931 | Ga0097620_100007447 | Ga0097620_1000074473 | 51 |
| 82 | 3300007076 | Ga0075435_101270912 | Ga0075435_1012709122 | 51 |
| 83 | 3300009094 | Ga0111539_10175210 | Ga0111539_101752102 | 51 |
| 84 | 3300009147 | Ga0114129_10036982 | Ga0114129_100369825 | 51 |
| 85 | 3300009176 | Ga0105242_12957835 | Ga0105242_129578352 | 51 |
| 86 | 3300009177 | Ga0105248_10000275 | Ga0105248_1000027525 | 51 |
| 87 | 3300009545 | Ga0105237_10693179 | Ga0105237_106931792 | 51 |
| 88 | 3300009551 | Ga0105238_11773584 | Ga0105238_117735841 | 51 |
| 89 | 3300009553 | Ga0105249_10000125 | Ga0105249_1000012548 | 51 |
| 90 | 3300009553 | Ga0105249_10514352 | Ga0105249_105143523 | 51 |
| 91 | 3300010159 | Ga0099796_10484152 | Ga0099796_104841522 | 51 |
| 92 | 3300011119 | Ga0105246_12052808 | Ga0105246_120528081 | 51 |
| 93 | 3300013306 | Ga0163162_10161588 | Ga0163162_101615881 | 51 |
| 94 | 3300013306 | Ga0163162_10211057 | Ga0163162_102110571 | 51 |
| 95 | 3300014325 | Ga0163163_10440596 | Ga0163163_104405963 | 51 |
| 96 | 3300014325 | Ga0163163_11803605 | Ga0163163_118036052 | 51 |
| 97 | 3300014968 | Ga0157379_10010663 | Ga0157379_100106632 | 51 |
| 98 | 3300014968 | Ga0157379_10400316 | Ga0157379_104003162 | 51 |
| 99 | 3300025921 | Ga0207652_10812323 | Ga0207652_108123232 | 51 |
| 100 | 3300025924 | Ga0207694_10805875 | Ga0207694_108058751 | 51 |
| 101 | 3300025939 | Ga0207665_10830868 | Ga0207665_108308682 | 51 |
| 102 | 3300025941 | Ga0207711_10000456 | Ga0207711_1000045625 | 51 |
| 103 | 3300025949 | Ga0207667_11138411 | Ga0207667_111384111 | 51 |
| 104 | 3300025961 | Ga0207712_10000028 | Ga0207712_10000028184 | 51 |
| 105 | 3300025986 | Ga0207658_10000679 | Ga0207658_1000067927 | 51 |
| 106 | 3300026088 | Ga0207641_10002249 | Ga0207641_1000224911 | 51 |
| 107 | 3300026095 | Ga0207676_10233335 | Ga0207676_102333352 | 51 |
| 108 | 3300026095 | Ga0207676_12113991 | Ga0207676_121139912 | 51 |
| 109 | 3300026118 | Ga0207675_101387063 | Ga0207675_1013870632 | 51 |
| 110 | 3300026142 | Ga0207698_11651445 | Ga0207698_116514452 | 51 |
| 111 | 3300027866 | Ga0209813_10249155 | Ga0209813_102491552 | 51 |
| 112 | 3300028379 | Ga0268266_10045987 | Ga0268266_100459874 | 51 |
| 113 | 3300028381 | Ga0268264_10000099 | Ga0268264_1000009931 | 51 |
| 114 | 3300032126 | Ga0307415_102048565 | Ga0307415_1020485651 | 51 |
| 115 | 3300032133 | Ga0316583_10325972 | Ga0316583_103259722 | 51 |
| 116 | 3300035111 | Ga0373923_0271358 | Ga0373923_0271358_431_586 | 51 |
| 117 | 3300035170 | Ga0373943_0321461 | Ga0373943_0321461_504_659 | 51 |
| 118 | 3300035398 | Ga0316574_0953315 | Ga0316574_0953315_124_279 | 51 |
| 119 | 3300035692 | Ga0373935_1024832 | Ga0373935_1024832_16_171 | 51 |
| 120 | 3300035725 | Ga0373947_0149401 | Ga0373947_0149401_292_447 | 51 |
| 121 | 3300036712 | Ga0316584_0106416 | Ga0316584_0106416_1199_1354 | 51 |
| 122 | 3300037853 | Ga0436364_0835303 | Ga0436364_0835303_1516_1671 | 51 |
| 123 | 3300041410 | Ga0439461_0014223 | Ga0439461_0014223_35_190 | 51 |
| 124 | 3300041411 | Ga0439466_0005219 | Ga0439466_0005219_3608_3763 | 51 |
| 125 | 3300041413 | Ga0439465_0000888 | Ga0439465_0000888_325_480 | 51 |
| 126 | 3300041458 | Ga0451798_0833199 | Ga0451798_0833199_196_351 | 51 |
| 127 | 3300041997 | Ga0439431_0024906 | Ga0439431_0024906_335_490 | 51 |
| 128 | 3300042016 | Ga0439463_100954 | Ga0439463_100954_137_292 | 51 |
| 129 | 3300046454 | Ga0495592_0422421 | Ga0495592_0422421_129_284 | 51 |
| 130 | 3300046455 | Ga0495603_0126973 | Ga0495603_0126973_646_801 | 51 |
| 131 | 3300046459 | Ga0495629_0018060 | Ga0495629_0018060_874_1029 | 51 |
| 132 | 3300046460 | Ga0495638_0007249 | Ga0495638_0007249_4744_4899 | 51 |
| 133 | 3300046461 | Ga0495641_0019890 | Ga0495641_0019890_935_1090 | 51 |
| 134 | 3300046463 | Ga0495653_0422608 | Ga0495653_0422608_584_739 | 51 |
| 135 | 3300046472 | Ga0495580_0298048 | Ga0495580_0298048_553_708 | 51 |
| 136 | 3300046473 | Ga0495582_0050717 | Ga0495582_0050717_1573_1728 | 51 |
| 137 | 3300046475 | Ga0495639_0155205 | Ga0495639_0155205_689_844 | 51 |
| 138 | 3300046476 | Ga0495662_0354710 | Ga0495662_0354710_55_210 | 51 |
| 139 | 3300046511 | Ga0495608_0449234 | Ga0495608_0449234_357_512 | 51 |
| 140 | 3300046517 | Ga0495630_0478009 | Ga0495630_0478009_692_847 | 51 |
| 141 | 3300046526 | Ga0495666_0301608 | Ga0495666_0301608_288_443 | 51 |
| 142 | 3300046533 | Ga0495640_0666573 | Ga0495640_0666573_255_410 | 51 |
| 143 | 3300046557 | Ga0495622_0284760 | Ga0495622_0284760_255_410 | 51 |
| 144 | 3300046674 | Ga0495588_0392666 | Ga0495588_0392666_539_694 | 51 |
| 145 | 3300046675 | Ga0495657_0408512 | Ga0495657_0408512_470_625 | 51 |
| 146 | 3300046683 | Ga0495658_0147785 | Ga0495658_0147785_763_918 | 51 |
| 147 | 3300046690 | Ga0495624_0098576 | Ga0495624_0098576_891_1046 | 51 |
| 148 | 3300047315 | Ga0495581_0008269 | Ga0495581_0008269_2136_2291 | 51 |
| 149 | 3300047319 | Ga0495674_0202970 | Ga0495674_0202970_942_1097 | 51 |
| 150 | 3300047320 | Ga0495672_0031490 | Ga0495672_0031490_1698_1853 | 51 |
| 151 | 3300047321 | Ga0495676_0327813 | Ga0495676_0327813_271_426 | 51 |
| 152 | 3300047322 | Ga0495680_0447081 | Ga0495680_0447081_490_645 | 51 |
| 153 | 3300047673 | Ga0495593_0022778 | Ga0495593_0022778_2837_2992 | 51 |
| 154 | 3300048089 | Ga0495614_0539887 | Ga0495614_0539887_211_366 | 51 |
| 155 | 3300048903 | Ga0496100_0347403 | Ga0496100_0347403_268_423 | 51 |
| 156 | 3300048903 | Ga0496100_0636184 | Ga0496100_0636184_516_671 | 51 |
| 157 | 3300048904 | Ga0496101_0859205 | Ga0496101_0859205_495_650 | 51 |
| 158 | 3300048905 | Ga0496102_0000136 | Ga0496102_0000136_18533_18688 | 51 |
| 159 | 3300048905 | Ga0496102_0298369 | Ga0496102_0298369_267_422 | 51 |
| 160 | 3300048905 | Ga0496102_0372773 | Ga0496102_0372773_876_1031 | 51 |
| 161 | 3300048906 | Ga0496103_0000341 | Ga0496103_0000341_29417_29572 | 51 |
| 162 | 3300048906 | Ga0496103_0118141 | Ga0496103_0118141_307_462 | 51 |
| 163 | 3300048910 | Ga0496107_1352731 | Ga0496107_1352731_302_457 | 51 |
| 164 | 3300048911 | Ga0496108_1296184 | Ga0496108_1296184_394_549 | 51 |
| 165 | 3300048912 | Ga0496109_1050372 | Ga0496109_1050372_122_277 | 51 |
| 166 | 3300048915 | Ga0496112_0107552 | Ga0496112_0107552_328_483 | 51 |
| 167 | 3300048916 | Ga0496113_0343190 | Ga0496113_0343190_700_855 | 51 |
| 168 | 3300048917 | Ga0496114_0293850 | Ga0496114_0293850_1032_1187 | 51 |
| 169 | 3300048918 | Ga0496115_0643369 | Ga0496115_0643369_331_486 | 51 |
| 170 | 3300048919 | Ga0496116_0078774 | Ga0496116_0078774_1074_1229 | 51 |
| 171 | 3300048920 | Ga0496117_0001174 | Ga0496117_0001174_627_782 | 51 |
| 172 | 3300048921 | Ga0496118_0001467 | Ga0496118_0001467_5338_5493 | 51 |
| 173 | 3300048922 | Ga0496119_0045271 | Ga0496119_0045271_951_1106 | 51 |
| 174 | 3300048923 | Ga0496120_0003913 | Ga0496120_0003913_3018_3173 | 51 |
| 175 | 3300048927 | Ga0496124_0328613 | Ga0496124_0328613_38_193 | 51 |
| 176 | 3300048929 | Ga0496126_0029090 | Ga0496126_0029090_2715_2870 | 51 |
| 177 | 3300049573 | Ga0501037_0280789 | Ga0501037_0280789_666_821 | 51 |
| 178 | 3300049574 | Ga0501038_0380330 | Ga0501038_0380330_566_721 | 51 |
| 179 | 3300049579 | Ga0501043_0420773 | Ga0501043_0420773_683_838 | 51 |
| 180 | 3300049823 | Ga0501044_0029742 | Ga0501044_0029742_996_1151 | 51 |
| 181 | 3300050489 | nmdc:mga03683_627147_c1 | nmdc:mga03683_627147_c1_188_343 | 51 |
| 182 | 3300050490 | nmdc:mga03n38_156133_c1 | nmdc:mga03n38_156133_c1_919_1074 | 51 |
| 183 | 3300050490 | nmdc:mga03n38_165492_c1 | nmdc:mga03n38_165492_c1_17_172 | 51 |
| 184 | 3300050490 | nmdc:mga03n38_255540_c1 | nmdc:mga03n38_255540_c1_337_492 | 51 |
| 185 | 3300050490 | nmdc:mga03n38_362540_c1 | nmdc:mga03n38_362540_c1_470_625 | 51 |
| 186 | 3300050491 | nmdc:mga00v17_161020_c1 | nmdc:mga00v17_161020_c1_1147_1302 | 51 |
| 187 | 3300050491 | nmdc:mga00v17_321812_c1 | nmdc:mga00v17_321812_c1_481_636 | 51 |
| 188 | 3300050492 | nmdc:mga0yw44_287749_c1 | nmdc:mga0yw44_287749_c1_897_1052 | 51 |
| 189 | 3300050495 | nmdc:mga04h51_282305_c1 | nmdc:mga04h51_282305_c1_316_471 | 51 |
| 190 | 3300050496 | nmdc:mga07m45_104089_c1 | nmdc:mga07m45_104089_c1_188_343 | 51 |
| 191 | 3300050507 | nmdc:mga05p37_81229_c1 | nmdc:mga05p37_81229_c1_2936_3091 | 51 |
| 192 | 3300050509 | nmdc:mga0qj67_31773_c1 | nmdc:mga0qj67_31773_c1_2472_2627 | 51 |
| 193 | 3300050510 | nmdc:mga06r32_75911_c1 | nmdc:mga06r32_75911_c1_2627_2782 | 51 |
| 194 | 3300050511 | nmdc:mga08y16_288327_c1 | nmdc:mga08y16_288327_c1_223_378 | 51 |
| 195 | 3300050516 | nmdc:mga0sz30_33736_c1 | nmdc:mga0sz30_33736_c1_989_1144 | 51 |
| 196 | 3300050516 | nmdc:mga0sz30_383066_c1 | nmdc:mga0sz30_383066_c1_249_404 | 51 |
| 197 | 3300050516 | nmdc:mga0sz30_81625_c1 | nmdc:mga0sz30_81625_c1_640_795 | 51 |
| 198 | 3300050516 | nmdc:mga0sz30_96567_c1 | nmdc:mga0sz30_96567_c1_305_460 | 51 |
| 199 | 3300053080 | Ga0500635_0139117 | Ga0500635_0139117_513_668 | 51 |
| 200 | 3300053085 | Ga0495619_0158286 | Ga0495619_0158286_425_580 | 51 |
| 201 | 3300053087 | Ga0500643_008531 | Ga0500643_008531_3794_3949 | 51 |
| 202 | 3300053098 | Ga0500650_0121959 | Ga0500650_0121959_245_400 | 51 |
| 203 | 3300053119 | Ga0500595_155258 | Ga0500595_155258_419_574 | 51 |
| 204 | 3300053131 | Ga0500652_014247 | Ga0500652_014247_1202_1357 | 51 |
| 205 | 3300053136 | Ga0500559_0161899 | Ga0500559_0161899_875_1030 | 51 |
| 206 | 3300053146 | Ga0500588_0240830 | Ga0500588_0240830_436_591 | 51 |
| 207 | 3300053158 | Ga0500627_0474271 | Ga0500627_0474271_138_293 | 51 |
| 208 | 3300053730 | Ga0500645_000023 | Ga0500645_000023_128507_128662 | 51 |
| 209 | 3300000546 | LJNas_1020761 | LJNas_10207612 | 53 |
| 210 | 3300002067 | JGI24735J21928_10134044 | JGI24735J21928_101340441 | 53 |
| 211 | 3300002077 | JGI24744J21845_10000295 | JGI24744J21845_100002953 | 53 |
| 212 | 3300002239 | JGI24034J26672_10052787 | JGI24034J26672_100527872 | 53 |
| 213 | 3300003790 | Ga0055528_1034782 | Ga0055528_10347822 | 53 |
| 214 | 3300003792 | Ga0055540_1000219 | Ga0055540_100021918 | 53 |
| 215 | 3300003792 | Ga0055540_1002262 | Ga0055540_10022627 | 53 |
| 216 | 3300003792 | Ga0055540_1020897 | Ga0055540_10208972 | 53 |
| 217 | 3300003792 | Ga0055540_1026935 | Ga0055540_10269352 | 53 |
| 218 | 3300005330 | Ga0070690_100065490 | Ga0070690_1000654902 | 53 |
| 219 | 3300005333 | Ga0070677_10034936 | Ga0070677_100349362 | 53 |
| 220 | 3300005335 | Ga0070666_10034107 | Ga0070666_100341073 | 53 |
| 221 | 3300005335 | Ga0070666_10189222 | Ga0070666_101892222 | 53 |
| 222 | 3300005337 | Ga0070682_100685317 | Ga0070682_1006853172 | 53 |
| 223 | 3300005338 | Ga0068868_100000858 | Ga0068868_1000008588 | 53 |
| 224 | 3300005338 | Ga0068868_100038073 | Ga0068868_1000380733 | 53 |
| 225 | 3300005339 | Ga0070660_100061769 | Ga0070660_1000617693 | 53 |
| 226 | 3300005340 | Ga0070689_100046010 | Ga0070689_1000460103 | 53 |
| 227 | 3300005340 | Ga0070689_101406712 | Ga0070689_1014067122 | 53 |
| 228 | 3300005341 | Ga0070691_10004817 | Ga0070691_100048176 | 53 |
| 229 | 3300005345 | Ga0070692_10093997 | Ga0070692_100939972 | 53 |
| 230 | 3300005347 | Ga0070668_100000229 | Ga0070668_10000022912 | 53 |
| 231 | 3300005347 | Ga0070668_100015615 | Ga0070668_1000156154 | 53 |
| 232 | 3300005347 | Ga0070668_100249529 | Ga0070668_1002495293 | 53 |
| 233 | 3300005353 | Ga0070669_100094855 | Ga0070669_1000948553 | 53 |
| 234 | 3300005355 | Ga0070671_100015168 | Ga0070671_1000151685 | 53 |
| 235 | 3300005355 | Ga0070671_100547966 | Ga0070671_1005479661 | 53 |
| 236 | 3300005356 | Ga0070674_100000228 | Ga0070674_1000002288 | 53 |
| 237 | 3300005356 | Ga0070674_100062206 | Ga0070674_1000622063 | 53 |
| 238 | 3300005356 | Ga0070674_101805473 | Ga0070674_1018054731 | 53 |
| 239 | 3300005365 | Ga0070688_100007048 | Ga0070688_1000070484 | 53 |
| 240 | 3300005365 | Ga0070688_100121005 | Ga0070688_1001210053 | 53 |
| 241 | 3300005367 | Ga0070667_100002450 | Ga0070667_1000024509 | 53 |
| 242 | 3300005367 | Ga0070667_100007804 | Ga0070667_1000078047 | 53 |
| 243 | 3300005367 | Ga0070667_100040740 | Ga0070667_1000407405 | 53 |
| 244 | 3300005367 | Ga0070667_100073182 | Ga0070667_1000731823 | 53 |
| 245 | 3300005367 | Ga0070667_100700044 | Ga0070667_1007000442 | 53 |
| 246 | 3300005434 | Ga0070709_10064130 | Ga0070709_100641304 | 53 |
| 247 | 3300005438 | Ga0070701_10236012 | Ga0070701_102360122 | 53 |
| 248 | 3300005439 | Ga0070711_100000347 | Ga0070711_1000003478 | 53 |
| 249 | 3300005440 | Ga0070705_100004568 | Ga0070705_1000045686 | 53 |
| 250 | 3300005441 | Ga0070700_100012138 | Ga0070700_1000121385 | 53 |
| 251 | 3300005444 | Ga0070694_100003851 | Ga0070694_1000038512 | 53 |
| 252 | 3300005455 | Ga0070663_100006705 | Ga0070663_1000067056 | 53 |
| 253 | 3300005455 | Ga0070663_100170394 | Ga0070663_1001703941 | 53 |
| 254 | 3300005455 | Ga0070663_100314919 | Ga0070663_1003149192 | 53 |
| 255 | 3300005455 | Ga0070663_102134197 | Ga0070663_1021341972 | 53 |
| 256 | 3300005456 | Ga0070678_100001926 | Ga0070678_1000019263 | 53 |
| 257 | 3300005456 | Ga0070678_100227144 | Ga0070678_1002271443 | 53 |
| 258 | 3300005456 | Ga0070678_100321279 | Ga0070678_1003212792 | 53 |
| 259 | 3300005456 | Ga0070678_100492100 | Ga0070678_1004921002 | 53 |
| 260 | 3300005457 | Ga0070662_100022121 | Ga0070662_1000221214 | 53 |
| 261 | 3300005457 | Ga0070662_101518503 | Ga0070662_1015185031 | 53 |
| 262 | 3300005457 | Ga0070662_101744623 | Ga0070662_1017446231 | 53 |
| 263 | 3300005466 | Ga0070685_10117563 | Ga0070685_101175633 | 53 |
| 264 | 3300005466 | Ga0070685_10282131 | Ga0070685_102821312 | 53 |
| 265 | 3300005466 | Ga0070685_11078538 | Ga0070685_110785381 | 53 |
| 266 | 3300005468 | Ga0070707_101642852 | Ga0070707_1016428522 | 53 |
| 267 | 3300005539 | Ga0068853_100003532 | Ga0068853_1000035325 | 53 |
| 268 | 3300005539 | Ga0068853_100133685 | Ga0068853_1001336853 | 53 |
| 269 | 3300005543 | Ga0070672_100332534 | Ga0070672_1003325342 | 53 |
| 270 | 3300005544 | Ga0070686_100037101 | Ga0070686_1000371013 | 53 |
| 271 | 3300005544 | Ga0070686_100077610 | Ga0070686_1000776104 | 53 |
| 272 | 3300005545 | Ga0070695_100001767 | Ga0070695_1000017676 | 53 |
| 273 | 3300005548 | Ga0070665_100001933 | Ga0070665_1000019331 | 53 |
| 274 | 3300005548 | Ga0070665_100102783 | Ga0070665_1001027833 | 53 |
| 275 | 3300005548 | Ga0070665_100471373 | Ga0070665_1004713732 | 53 |
| 276 | 3300005548 | Ga0070665_100956978 | Ga0070665_1009569782 | 53 |
| 277 | 3300005548 | Ga0070665_101128018 | Ga0070665_1011280182 | 53 |
| 278 | 3300005548 | Ga0070665_102031207 | Ga0070665_1020312071 | 53 |
| 279 | 3300005549 | Ga0070704_100001554 | Ga0070704_1000015547 | 53 |
| 280 | 3300005549 | Ga0070704_100048682 | Ga0070704_1000486822 | 53 |
| 281 | 3300005563 | Ga0068855_100226760 | Ga0068855_1002267601 | 53 |
| 282 | 3300005563 | Ga0068855_100560073 | Ga0068855_1005600732 | 53 |
| 283 | 3300005577 | Ga0068857_101315321 | Ga0068857_1013153212 | 53 |
| 284 | 3300005578 | Ga0068854_100002103 | Ga0068854_1000021035 | 53 |
| 285 | 3300005578 | Ga0068854_102297272 | Ga0068854_1022972722 | 53 |
| 286 | 3300005614 | Ga0068856_102335742 | Ga0068856_1023357422 | 53 |
| 287 | 3300005615 | Ga0070702_100000100 | Ga0070702_10000010012 | 53 |
| 288 | 3300005615 | Ga0070702_101480825 | Ga0070702_1014808252 | 53 |
| 289 | 3300005616 | Ga0068852_100244412 | Ga0068852_1002444122 | 53 |
| 290 | 3300005617 | Ga0068859_100003604 | Ga0068859_1000036043 | 53 |
| 291 | 3300005617 | Ga0068859_100062665 | Ga0068859_1000626652 | 53 |
| 292 | 3300005618 | Ga0068864_100065617 | Ga0068864_1000656173 | 53 |
| 293 | 3300005718 | Ga0068866_10000214 | Ga0068866_1000021416 | 53 |
| 294 | 3300005719 | Ga0068861_100000252 | Ga0068861_1000002525 | 53 |
| 295 | 3300005719 | Ga0068861_100105160 | Ga0068861_1001051603 | 53 |
| 296 | 3300005719 | Ga0068861_100120138 | Ga0068861_1001201383 | 53 |
| 297 | 3300005719 | Ga0068861_100905659 | Ga0068861_1009056592 | 53 |
| 298 | 3300005840 | Ga0068870_10323206 | Ga0068870_103232061 | 53 |
| 299 | 3300005841 | Ga0068863_100032543 | Ga0068863_1000325435 | 53 |
| 300 | 3300005841 | Ga0068863_100258333 | Ga0068863_1002583333 | 53 |
| 301 | 3300005841 | Ga0068863_100307318 | Ga0068863_1003073183 | 53 |
| 302 | 3300005841 | Ga0068863_101534080 | Ga0068863_1015340802 | 53 |
| 303 | 3300005842 | Ga0068858_100007550 | Ga0068858_1000075507 | 53 |
| 304 | 3300005842 | Ga0068858_100976189 | Ga0068858_1009761892 | 53 |
| 305 | 3300005843 | Ga0068860_100024036 | Ga0068860_1000240365 | 53 |
| 306 | 3300005843 | Ga0068860_100186815 | Ga0068860_1001868153 | 53 |
| 307 | 3300005844 | Ga0068862_100143912 | Ga0068862_1001439123 | 53 |
| 308 | 3300005844 | Ga0068862_100788941 | Ga0068862_1007889412 | 53 |
| 309 | 3300005844 | Ga0068862_101291504 | Ga0068862_1012915042 | 53 |
| 310 | 3300005983 | Ga0081540_1066609 | Ga0081540_10666093 | 53 |
| 311 | 3300006038 | Ga0075365_10188039 | Ga0075365_101880393 | 53 |
| 312 | 3300006038 | Ga0075365_10210837 | Ga0075365_102108372 | 53 |
| 313 | 3300006038 | Ga0075365_10993563 | Ga0075365_109935632 | 53 |
| 314 | 3300006038 | Ga0075365_11256115 | Ga0075365_112561151 | 53 |
| 315 | 3300006048 | Ga0075363_100084383 | Ga0075363_1000843833 | 53 |
| 316 | 3300006048 | Ga0075363_100109714 | Ga0075363_1001097143 | 53 |
| 317 | 3300006048 | Ga0075363_100228314 | Ga0075363_1002283141 | 53 |
| 318 | 3300006048 | Ga0075363_100482282 | Ga0075363_1004822822 | 53 |
| 319 | 3300006048 | Ga0075363_100493299 | Ga0075363_1004932991 | 53 |
| 320 | 3300006051 | Ga0075364_10084371 | Ga0075364_100843712 | 53 |
| 321 | 3300006051 | Ga0075364_10091399 | Ga0075364_100913993 | 53 |
| 322 | 3300006051 | Ga0075364_10216612 | Ga0075364_102166123 | 53 |
| 323 | 3300006051 | Ga0075364_10381465 | Ga0075364_103814653 | 53 |
| 324 | 3300006051 | Ga0075364_10482138 | Ga0075364_104821382 | 53 |
| 325 | 3300006163 | Ga0070715_10007135 | Ga0070715_100071355 | 53 |
| 326 | 3300006173 | Ga0070716_100078690 | Ga0070716_1000786903 | 53 |
| 327 | 3300006175 | Ga0070712_100001274 | Ga0070712_10000127411 | 53 |
| 328 | 3300006177 | Ga0075362_10073538 | Ga0075362_100735382 | 53 |
| 329 | 3300006178 | Ga0075367_10065139 | Ga0075367_100651393 | 53 |
| 330 | 3300006178 | Ga0075367_10169215 | Ga0075367_101692153 | 53 |
| 331 | 3300006178 | Ga0075367_10384254 | Ga0075367_103842542 | 53 |
| 332 | 3300006178 | Ga0075367_10747068 | Ga0075367_107470682 | 53 |
| 333 | 3300006186 | Ga0075369_10004863 | Ga0075369_100048635 | 53 |
| 334 | 3300006186 | Ga0075369_10039062 | Ga0075369_100390624 | 53 |
| 335 | 3300006186 | Ga0075369_10053724 | Ga0075369_100537243 | 53 |
| 336 | 3300006186 | Ga0075369_10056916 | Ga0075369_100569162 | 53 |
| 337 | 3300006186 | Ga0075369_10077230 | Ga0075369_100772302 | 53 |
| 338 | 3300006186 | Ga0075369_10306568 | Ga0075369_103065682 | 53 |
| 339 | 3300006186 | Ga0075369_10488183 | Ga0075369_104881832 | 53 |
| 340 | 3300006237 | Ga0097621_100013003 | Ga0097621_1000130036 | 53 |
| 341 | 3300006353 | Ga0075370_10007393 | Ga0075370_100073933 | 53 |
| 342 | 3300006353 | Ga0075370_10072111 | Ga0075370_100721113 | 53 |
| 343 | 3300006353 | Ga0075370_10149030 | Ga0075370_101490303 | 53 |
| 344 | 3300006353 | Ga0075370_10150304 | Ga0075370_101503042 | 53 |
| 345 | 3300006353 | Ga0075370_10484686 | Ga0075370_104846862 | 53 |
| 346 | 3300006358 | Ga0068871_100740828 | Ga0068871_1007408282 | 53 |
| 347 | 3300006358 | Ga0068871_101834910 | Ga0068871_1018349102 | 53 |
| 348 | 3300006846 | Ga0075430_100025050 | Ga0075430_1000250503 | 53 |
| 349 | 3300006846 | Ga0075430_100261656 | Ga0075430_1002616562 | 53 |
| 350 | 3300006847 | Ga0075431_100073181 | Ga0075431_1000731813 | 53 |
| 351 | 3300006871 | Ga0075434_101556202 | Ga0075434_1015562022 | 53 |
| 352 | 3300006881 | Ga0068865_100001907 | Ga0068865_1000019078 | 53 |
| 353 | 3300006881 | Ga0068865_100091553 | Ga0068865_1000915533 | 53 |
| 354 | 3300006931 | Ga0097620_100003603 | Ga0097620_1000036033 | 53 |
| 355 | 3300006931 | Ga0097620_100062656 | Ga0097620_1000626562 | 53 |
| 356 | 3300007076 | Ga0075435_100659098 | Ga0075435_1006590982 | 53 |
| 357 | 3300007076 | Ga0075435_101647919 | Ga0075435_1016479192 | 53 |
| 358 | 3300007788 | Ga0099795_10357767 | Ga0099795_103577672 | 53 |
| 359 | 3300009011 | Ga0105251_10391222 | Ga0105251_103912222 | 53 |
| 360 | 3300009036 | Ga0105244_10145983 | Ga0105244_101459832 | 53 |
| 361 | 3300009092 | Ga0105250_10071318 | Ga0105250_100713182 | 53 |
| 362 | 3300009093 | Ga0105240_12140850 | Ga0105240_121408502 | 53 |
| 363 | 3300009098 | Ga0105245_10001888 | Ga0105245_100018889 | 53 |
| 364 | 3300009098 | Ga0105245_10088723 | Ga0105245_100887234 | 53 |
| 365 | 3300009098 | Ga0105245_11716472 | Ga0105245_117164721 | 53 |
| 366 | 3300009101 | Ga0105247_10001265 | Ga0105247_1000126515 | 53 |
| 367 | 3300009101 | Ga0105247_10022858 | Ga0105247_100228583 | 53 |
| 368 | 3300009101 | Ga0105247_10157405 | Ga0105247_101574052 | 53 |
| 369 | 3300009101 | Ga0105247_10203364 | Ga0105247_102033642 | 53 |
| 370 | 3300009101 | Ga0105247_10405966 | Ga0105247_104059663 | 53 |
| 371 | 3300009101 | Ga0105247_10726458 | Ga0105247_107264581 | 53 |
| 372 | 3300009147 | Ga0114129_12316644 | Ga0114129_123166441 | 53 |
| 373 | 3300009148 | Ga0105243_10001270 | Ga0105243_1000127027 | 53 |
| 374 | 3300009148 | Ga0105243_10263147 | Ga0105243_102631472 | 53 |
| 375 | 3300009176 | Ga0105242_10002230 | Ga0105242_1000223015 | 53 |
| 376 | 3300009176 | Ga0105242_10231614 | Ga0105242_102316142 | 53 |
| 377 | 3300009176 | Ga0105242_12295196 | Ga0105242_122951961 | 53 |
| 378 | 3300009177 | Ga0105248_10017985 | Ga0105248_100179852 | 53 |
| 379 | 3300009177 | Ga0105248_10778099 | Ga0105248_107780992 | 53 |
| 380 | 3300009177 | Ga0105248_11175291 | Ga0105248_111752913 | 53 |
| 381 | 3300009177 | Ga0105248_11798844 | Ga0105248_117988442 | 53 |
| 382 | 3300009545 | Ga0105237_10003411 | Ga0105237_100034113 | 53 |
| 383 | 3300009545 | Ga0105237_10027980 | Ga0105237_100279803 | 53 |
| 384 | 3300009545 | Ga0105237_10687239 | Ga0105237_106872391 | 53 |
| 385 | 3300009545 | Ga0105237_10801356 | Ga0105237_108013562 | 53 |
| 386 | 3300009551 | Ga0105238_10575282 | Ga0105238_105752822 | 53 |
| 387 | 3300009551 | Ga0105238_11737590 | Ga0105238_117375901 | 53 |
| 388 | 3300009553 | Ga0105249_10001345 | Ga0105249_100013455 | 53 |
| 389 | 3300009553 | Ga0105249_10069322 | Ga0105249_100693223 | 53 |
| 390 | 3300009553 | Ga0105249_10209347 | Ga0105249_102093473 | 53 |
| 391 | 3300010375 | Ga0105239_10023514 | Ga0105239_100235143 | 53 |
| 392 | 3300010375 | Ga0105239_10053628 | Ga0105239_100536286 | 53 |
| 393 | 3300010375 | Ga0105239_10162283 | Ga0105239_101622833 | 53 |
| 394 | 3300010375 | Ga0105239_10399982 | Ga0105239_103999822 | 53 |
| 395 | 3300011119 | Ga0105246_10640902 | Ga0105246_106409022 | 53 |
| 396 | 3300011119 | Ga0105246_11150883 | Ga0105246_111508832 | 53 |
| 397 | 3300011119 | Ga0105246_11793813 | Ga0105246_117938132 | 53 |
| 398 | 3300012515 | Ga0157338_1052517 | Ga0157338_10525172 | 53 |
| 399 | 3300013100 | Ga0157373_10512372 | Ga0157373_105123722 | 53 |
| 400 | 3300013104 | Ga0157370_10635708 | Ga0157370_106357082 | 53 |
| 401 | 3300013105 | Ga0157369_10086550 | Ga0157369_100865502 | 53 |
| 402 | 3300013296 | Ga0157374_10005046 | Ga0157374_100050462 | 53 |
| 403 | 3300013297 | Ga0157378_10001139 | Ga0157378_1000113915 | 53 |
| 404 | 3300013297 | Ga0157378_10477132 | Ga0157378_104771322 | 53 |
| 405 | 3300013306 | Ga0163162_10014957 | Ga0163162_100149578 | 53 |
| 406 | 3300013306 | Ga0163162_10072810 | Ga0163162_100728103 | 53 |
| 407 | 3300013306 | Ga0163162_10107460 | Ga0163162_101074605 | 53 |
| 408 | 3300013307 | Ga0157372_10001931 | Ga0157372_1000193117 | 53 |
| 409 | 3300013308 | Ga0157375_10000802 | Ga0157375_100008029 | 53 |
| 410 | 3300013308 | Ga0157375_10188503 | Ga0157375_101885033 | 53 |
| 411 | 3300013308 | Ga0157375_10341274 | Ga0157375_103412743 | 53 |
| 412 | 3300013308 | Ga0157375_10591711 | Ga0157375_105917112 | 53 |
| 413 | 3300014325 | Ga0163163_11482405 | Ga0163163_114824052 | 53 |
| 414 | 3300014326 | Ga0157380_10012957 | Ga0157380_100129573 | 53 |
| 415 | 3300014326 | Ga0157380_11835457 | Ga0157380_118354571 | 53 |
| 416 | 3300014497 | Ga0182008_10658727 | Ga0182008_106587272 | 53 |
| 417 | 3300014745 | Ga0157377_10029294 | Ga0157377_100292944 | 53 |
| 418 | 3300014968 | Ga0157379_10153385 | Ga0157379_101533853 | 53 |
| 419 | 3300014969 | Ga0157376_10337484 | Ga0157376_103374842 | 53 |
| 420 | 3300017792 | Ga0163161_10000706 | Ga0163161_100007068 | 53 |
| 421 | 3300017792 | Ga0163161_10773051 | Ga0163161_107730511 | 53 |
| 422 | 3300025223 | Ga0207672_1003815 | Ga0207672_10038152 | 53 |
| 423 | 3300025273 | Ga0209673_1021193 | Ga0209673_10211933 | 53 |
| 424 | 3300025303 | Ga0209051_1000116 | Ga0209051_1000116102 | 53 |
| 425 | 3300025303 | Ga0209051_1000883 | Ga0209051_10008837 | 53 |
| 426 | 3300025303 | Ga0209051_1002463 | Ga0209051_100246310 | 53 |
| 427 | 3300025303 | Ga0209051_1003291 | Ga0209051_10032917 | 53 |
| 428 | 3300025315 | Ga0207697_10114382 | Ga0207697_101143822 | 53 |
| 429 | 3300025321 | Ga0207656_10096459 | Ga0207656_100964592 | 53 |
| 430 | 3300025885 | Ga0207653_10130205 | Ga0207653_101302052 | 53 |
| 431 | 3300025893 | Ga0207682_10108278 | Ga0207682_101082783 | 53 |
| 432 | 3300025898 | Ga0207692_10012772 | Ga0207692_100127724 | 53 |
| 433 | 3300025899 | Ga0207642_10000561 | Ga0207642_100005614 | 53 |
| 434 | 3300025900 | Ga0207710_10006352 | Ga0207710_100063524 | 53 |
| 435 | 3300025900 | Ga0207710_10439669 | Ga0207710_104396692 | 53 |
| 436 | 3300025901 | Ga0207688_10000043 | Ga0207688_1000004312 | 53 |
| 437 | 3300025901 | Ga0207688_10100768 | Ga0207688_101007682 | 53 |
| 438 | 3300025903 | Ga0207680_10037980 | Ga0207680_100379803 | 53 |
| 439 | 3300025903 | Ga0207680_10135027 | Ga0207680_101350273 | 53 |
| 440 | 3300025903 | Ga0207680_10169225 | Ga0207680_101692253 | 53 |
| 441 | 3300025903 | Ga0207680_10771319 | Ga0207680_107713192 | 53 |
| 442 | 3300025904 | Ga0207647_10122063 | Ga0207647_101220632 | 53 |
| 443 | 3300025907 | Ga0207645_10016251 | Ga0207645_100162512 | 53 |
| 444 | 3300025911 | Ga0207654_10042201 | Ga0207654_100422014 | 53 |
| 445 | 3300025914 | Ga0207671_10013199 | Ga0207671_100131996 | 53 |
| 446 | 3300025914 | Ga0207671_10026575 | Ga0207671_100265752 | 53 |
| 447 | 3300025914 | Ga0207671_10198122 | Ga0207671_101981223 | 53 |
| 448 | 3300025916 | Ga0207663_10001505 | Ga0207663_100015056 | 53 |
| 449 | 3300025918 | Ga0207662_10295997 | Ga0207662_102959972 | 53 |
| 450 | 3300025923 | Ga0207681_10132418 | Ga0207681_101324182 | 53 |
| 451 | 3300025924 | Ga0207694_10479788 | Ga0207694_104797882 | 53 |
| 452 | 3300025927 | Ga0207687_10000710 | Ga0207687_1000071015 | 53 |
| 453 | 3300025927 | Ga0207687_10009114 | Ga0207687_100091146 | 53 |
| 454 | 3300025928 | Ga0207700_10959574 | Ga0207700_109595742 | 53 |
| 455 | 3300025929 | Ga0207664_10202293 | Ga0207664_102022933 | 53 |
| 456 | 3300025929 | Ga0207664_10801260 | Ga0207664_108012601 | 53 |
| 457 | 3300025929 | Ga0207664_10975339 | Ga0207664_109753392 | 53 |
| 458 | 3300025931 | Ga0207644_10013542 | Ga0207644_100135425 | 53 |
| 459 | 3300025931 | Ga0207644_10037967 | Ga0207644_100379673 | 53 |
| 460 | 3300025931 | Ga0207644_10458926 | Ga0207644_104589262 | 53 |
| 461 | 3300025931 | Ga0207644_11666474 | Ga0207644_116664742 | 53 |
| 462 | 3300025933 | Ga0207706_10319020 | Ga0207706_103190202 | 53 |
| 463 | 3300025934 | Ga0207686_11266142 | Ga0207686_112661422 | 53 |
| 464 | 3300025935 | Ga0207709_10003353 | Ga0207709_100033538 | 53 |
| 465 | 3300025936 | Ga0207670_10072868 | Ga0207670_100728682 | 53 |
| 466 | 3300025937 | Ga0207669_10000172 | Ga0207669_1000017215 | 53 |
| 467 | 3300025937 | Ga0207669_10169432 | Ga0207669_101694322 | 53 |
| 468 | 3300025937 | Ga0207669_10301331 | Ga0207669_103013312 | 53 |
| 469 | 3300025938 | Ga0207704_10000868 | Ga0207704_100008683 | 53 |
| 470 | 3300025938 | Ga0207704_10304853 | Ga0207704_103048532 | 53 |
| 471 | 3300025939 | Ga0207665_10103060 | Ga0207665_101030603 | 53 |
| 472 | 3300025940 | Ga0207691_10084502 | Ga0207691_100845023 | 53 |
| 473 | 3300025941 | Ga0207711_10061522 | Ga0207711_100615222 | 53 |
| 474 | 3300025941 | Ga0207711_10112818 | Ga0207711_101128183 | 53 |
| 475 | 3300025949 | Ga0207667_10022575 | Ga0207667_100225759 | 53 |
| 476 | 3300025949 | Ga0207667_10131447 | Ga0207667_101314471 | 53 |
| 477 | 3300025960 | Ga0207651_10153416 | Ga0207651_101534162 | 53 |
| 478 | 3300025961 | Ga0207712_10001501 | Ga0207712_100015013 | 53 |
| 479 | 3300025961 | Ga0207712_10802952 | Ga0207712_108029521 | 53 |
| 480 | 3300025972 | Ga0207668_10001313 | Ga0207668_1000131314 | 53 |
| 481 | 3300025972 | Ga0207668_10002088 | Ga0207668_100020888 | 53 |
| 482 | 3300025972 | Ga0207668_10316136 | Ga0207668_103161363 | 53 |
| 483 | 3300025972 | Ga0207668_10420550 | Ga0207668_104205502 | 53 |
| 484 | 3300025981 | Ga0207640_10003250 | Ga0207640_100032509 | 53 |
| 485 | 3300025986 | Ga0207658_10003784 | Ga0207658_100037846 | 53 |
| 486 | 3300025986 | Ga0207658_10008256 | Ga0207658_100082568 | 53 |
| 487 | 3300025986 | Ga0207658_10026234 | Ga0207658_100262343 | 53 |
| 488 | 3300025986 | Ga0207658_10082686 | Ga0207658_100826863 | 53 |
| 489 | 3300025986 | Ga0207658_10516165 | Ga0207658_105161652 | 53 |
| 490 | 3300025986 | Ga0207658_12070065 | Ga0207658_120700652 | 53 |
| 491 | 3300026023 | Ga0207677_10002521 | Ga0207677_1000252112 | 53 |
| 492 | 3300026023 | Ga0207677_10504981 | Ga0207677_105049812 | 53 |
| 493 | 3300026035 | Ga0207703_10207814 | Ga0207703_102078143 | 53 |
| 494 | 3300026035 | Ga0207703_10927053 | Ga0207703_109270532 | 53 |
| 495 | 3300026035 | Ga0207703_11407478 | Ga0207703_114074782 | 53 |
| 496 | 3300026041 | Ga0207639_10006543 | Ga0207639_100065434 | 53 |
| 497 | 3300026041 | Ga0207639_10008675 | Ga0207639_100086752 | 53 |
| 498 | 3300026041 | Ga0207639_10289686 | Ga0207639_102896863 | 53 |
| 499 | 3300026041 | Ga0207639_11366833 | Ga0207639_113668332 | 53 |
| 500 | 3300026075 | Ga0207708_10013001 | Ga0207708_100130013 | 53 |
| 501 | 3300026078 | Ga0207702_10993899 | Ga0207702_109938992 | 53 |
| 502 | 3300026088 | Ga0207641_10016777 | Ga0207641_100167775 | 53 |
| 503 | 3300026088 | Ga0207641_10070981 | Ga0207641_100709814 | 53 |
| 504 | 3300026088 | Ga0207641_10189583 | Ga0207641_101895832 | 53 |
| 505 | 3300026089 | Ga0207648_11581967 | Ga0207648_115819671 | 53 |
| 506 | 3300026095 | Ga0207676_10090532 | Ga0207676_100905323 | 53 |
| 507 | 3300026095 | Ga0207676_12581546 | Ga0207676_125815462 | 53 |
| 508 | 3300026118 | Ga0207675_100275579 | Ga0207675_1002755792 | 53 |
| 509 | 3300026121 | Ga0207683_10524041 | Ga0207683_105240412 | 53 |
| 510 | 3300026142 | Ga0207698_10552916 | Ga0207698_105529163 | 53 |
| 511 | 3300026142 | Ga0207698_11692361 | Ga0207698_116923612 | 53 |
| 512 | 3300028379 | Ga0268266_10002270 | Ga0268266_100022702 | 53 |
| 513 | 3300028379 | Ga0268266_10160707 | Ga0268266_101607072 | 53 |
| 514 | 3300028379 | Ga0268266_10628131 | Ga0268266_106281312 | 53 |
| 515 | 3300028380 | Ga0268265_10053617 | Ga0268265_100536174 | 53 |
| 516 | 3300028380 | Ga0268265_10063383 | Ga0268265_100633833 | 53 |
| 517 | 3300028380 | Ga0268265_10406314 | Ga0268265_104063142 | 53 |
| 518 | 3300028380 | Ga0268265_11827107 | Ga0268265_118271072 | 53 |
| 519 | 3300028381 | Ga0268264_10003132 | Ga0268264_100031323 | 53 |
| 520 | 3300031251 | Ga0265327_10001242 | Ga0265327_1000124214 | 53 |
| 521 | 3300031731 | Ga0307405_11442479 | Ga0307405_114424792 | 53 |
| 522 | 3300031824 | Ga0307413_10217656 | Ga0307413_102176562 | 53 |
| 523 | 3300031852 | Ga0307410_10053391 | Ga0307410_100533913 | 53 |
| 524 | 3300031901 | Ga0307406_10116050 | Ga0307406_101160503 | 53 |
| 525 | 3300031901 | Ga0307406_10690457 | Ga0307406_106904572 | 53 |
| 526 | 3300031903 | Ga0307407_10865647 | Ga0307407_108656472 | 53 |
| 527 | 3300031995 | Ga0307409_100212092 | Ga0307409_1002120921 | 53 |
| 528 | 3300031995 | Ga0307409_102929426 | Ga0307409_1029294262 | 53 |
| 529 | 3300032126 | Ga0307415_100059921 | Ga0307415_1000599212 | 53 |
| 530 | 3300034817 | Ga0373948_0162988 | Ga0373948_0162988_200_361 | 53 |
| 531 | 3300035085 | Ga0373929_0148280 | Ga0373929_0148280_377_538 | 53 |
| 532 | 3300035090 | Ga0373949_0152012 | Ga0373949_0152012_306_467 | 53 |
| 533 | 3300035092 | Ga0373952_0091514 | Ga0373952_0091514_350_511 | 53 |
| 534 | 3300035114 | Ga0373939_0142222 | Ga0373939_0142222_308_469 | 53 |
| 535 | 3300035115 | Ga0373941_0315962 | Ga0373941_0315962_295_456 | 53 |
| 536 | 3300035121 | Ga0373960_0107603 | Ga0373960_0107603_382_543 | 53 |
| 537 | 3300035207 | Ga0373942_0013093 | Ga0373942_0013093_711_872 | 53 |
| 538 | 3300035241 | Ga0373961_0066808 | Ga0373961_0066808_513_674 | 53 |
| 539 | 3300035242 | Ga0373962_0077136 | Ga0373962_0077136_745_906 | 53 |
| 540 | 3300035691 | Ga0373931_0010495 | Ga0373931_0010495_848_1009 | 53 |
| 541 | 3300035691 | Ga0373931_0332144 | Ga0373931_0332144_734_895 | 53 |
| 542 | 3300041405 | Ga0439438_105758 | Ga0439438_105758_262_423 | 53 |
| 543 | 3300041410 | Ga0439461_0001096 | Ga0439461_0001096_1620_1781 | 53 |
| 544 | 3300041411 | Ga0439466_0021877 | Ga0439466_0021877_41_202 | 53 |
| 545 | 3300041411 | Ga0439466_0029974 | Ga0439466_0029974_130_291 | 53 |
| 546 | 3300041411 | Ga0439466_0107932 | Ga0439466_0107932_467_628 | 53 |
| 547 | 3300041411 | Ga0439466_0179032 | Ga0439466_0179032_67_228 | 53 |
| 548 | 3300041413 | Ga0439465_0007141 | Ga0439465_0007141_94_255 | 53 |
| 549 | 3300041413 | Ga0439465_0011335 | Ga0439465_0011335_1775_1936 | 53 |
| 550 | 3300041413 | Ga0439465_0227309 | Ga0439465_0227309_252_413 | 53 |
| 551 | 3300041451 | Ga0451791_0225015 | Ga0451791_0225015_343_504 | 53 |
| 552 | 3300041452 | Ga0451793_1605892 | Ga0451793_1605892_378_539 | 53 |
| 553 | 3300041453 | Ga0451797_0201048 | Ga0451797_0201048_148_309 | 53 |
| 554 | 3300041460 | Ga0451802_1153074 | Ga0451802_1153074_781_990 | 53 |
| 555 | 3300041462 | Ga0451806_141653 | Ga0451806_141653_663_824 | 53 |
| 556 | 3300041491 | Ga0451833_0156992 | Ga0451833_0156992_275_436 | 53 |
| 557 | 3300041498 | Ga0451841_0513871 | Ga0451841_0513871_1753_1914 | 53 |
| 558 | 3300041509 | Ga0451843_0500978 | Ga0451843_0500978_332_514 | 53 |
| 559 | 3300041509 | Ga0451843_0712076 | Ga0451843_0712076_128_304 | 53 |
| 560 | 3300041997 | Ga0439431_0003164 | Ga0439431_0003164_610_771 | 53 |
| 561 | 3300041997 | Ga0439431_0038460 | Ga0439431_0038460_64_225 | 53 |
| 562 | 3300042002 | Ga0439442_029980 | Ga0439442_029980_411_572 | 53 |
| 563 | 3300042004 | Ga0439445_0002779 | Ga0439445_0002779_2021_2182 | 53 |
| 564 | 3300042005 | Ga0439448_0001735 | Ga0439448_0001735_3406_3567 | 53 |
| 565 | 3300042157 | Ga0439458_0107484 | Ga0439458_0107484_230_391 | 53 |
| 566 | 3300042435 | Ga0439434_0008121 | Ga0439434_0008121_2655_2816 | 53 |
| 567 | 3300042435 | Ga0439434_0011344 | Ga0439434_0011344_541_702 | 53 |
| 568 | 3300042438 | Ga0439459_0012943 | Ga0439459_0012943_331_492 | 53 |
| 569 | 3300042438 | Ga0439459_0156253 | Ga0439459_0156253_168_329 | 53 |
| 570 | 3300044658 | Ga0466972_0000752 | Ga0466972_0000752_4242_4403 | 53 |
| 571 | 3300044658 | Ga0466972_0046165 | Ga0466972_0046165_629_790 | 53 |
| 572 | 3300044658 | Ga0466972_0172690 | Ga0466972_0172690_129_290 | 53 |
| 573 | 3300044683 | Ga0466965_0001251 | Ga0466965_0001251_9782_9943 | 53 |
| 574 | 3300044683 | Ga0466965_0046943 | Ga0466965_0046943_1882_2043 | 53 |
| 575 | 3300044684 | Ga0466966_0055083 | Ga0466966_0055083_644_805 | 53 |
| 576 | 3300044693 | Ga0466961_0056252 | Ga0466961_0056252_2317_2478 | 53 |
| 577 | 3300044694 | Ga0466963_1165920 | Ga0466963_1165920_47_208 | 53 |
| 578 | 3300044706 | Ga0466964_0226593 | Ga0466964_0226593_360_521 | 53 |
| 579 | 3300044719 | Ga0466971_0003847 | Ga0466971_0003847_1438_1599 | 53 |
| 580 | 3300044735 | Ga0466968_0012315 | Ga0466968_0012315_1645_1806 | 53 |
| 581 | 3300044735 | Ga0466968_0030505 | Ga0466968_0030505_1808_1969 | 53 |
| 582 | 3300044765 | Ga0466970_0023613 | Ga0466970_0023613_2771_2932 | 53 |
| 583 | 3300044765 | Ga0466970_0472790 | Ga0466970_0472790_106_267 | 53 |
| 584 | 3300044765 | Ga0466970_0657878 | Ga0466970_0657878_138_299 | 53 |
| 585 | 3300044842 | Ga0466957_0004736 | Ga0466957_0004736_738_899 | 53 |
| 586 | 3300044842 | Ga0466957_0473357 | Ga0466957_0473357_522_683 | 53 |
| 587 | 3300044842 | Ga0466957_1194802 | Ga0466957_1194802_220_381 | 53 |
| 588 | 3300044901 | Ga0466960_0078752 | Ga0466960_0078752_1469_1630 | 53 |
| 589 | 3300044901 | Ga0466960_0246272 | Ga0466960_0246272_68_229 | 53 |
| 590 | 3300044901 | Ga0466960_0625786 | Ga0466960_0625786_305_466 | 53 |
| 591 | 3300045049 | Ga0466959_0003822 | Ga0466959_0003822_6739_6900 | 53 |
| 592 | 3300045049 | Ga0466959_0016881 | Ga0466959_0016881_4495_4656 | 53 |
| 593 | 3300045836 | Ga0466958_0004215 | Ga0466958_0004215_5410_5571 | 53 |
| 594 | 3300045836 | Ga0466958_0408481 | Ga0466958_0408481_484_645 | 53 |
| 595 | 3300045976 | Ga0466967_0006708 | Ga0466967_0006708_6812_6973 | 53 |
| 596 | 3300045976 | Ga0466967_0121834 | Ga0466967_0121834_325_486 | 53 |
| 597 | 3300045976 | Ga0466967_0137376 | Ga0466967_0137376_1284_1445 | 53 |
| 598 | 3300045976 | Ga0466967_0278864 | Ga0466967_0278864_1122_1283 | 53 |
| 599 | 3300045976 | Ga0466967_1484160 | Ga0466967_1484160_199_360 | 53 |
| 600 | 3300046455 | Ga0495603_0773586 | Ga0495603_0773586_286_447 | 53 |
| 601 | 3300046460 | Ga0495638_0002160 | Ga0495638_0002160_2151_2312 | 53 |
| 602 | 3300046506 | Ga0495583_0082586 | Ga0495583_0082586_1085_1246 | 53 |
| 603 | 3300046513 | Ga0495616_0106594 | Ga0495616_0106594_1029_1190 | 53 |
| 604 | 3300046524 | Ga0495648_0007758 | Ga0495648_0007758_3411_3572 | 53 |
| 605 | 3300046530 | Ga0495654_0073171 | Ga0495654_0073171_249_410 | 53 |
| 606 | 3300046616 | Ga0495668_0029180 | Ga0495668_0029180_835_996 | 53 |
| 607 | 3300046616 | Ga0495668_0144997 | Ga0495668_0144997_310_471 | 53 |
| 608 | 3300046648 | Ga0495611_0162983 | Ga0495611_0162983_552_713 | 53 |
| 609 | 3300046660 | Ga0495625_0295414 | Ga0495625_0295414_701_862 | 53 |
| 610 | 3300046660 | Ga0495625_0297939 | Ga0495625_0297939_749_910 | 53 |
| 611 | 3300046663 | Ga0495635_0534623 | Ga0495635_0534623_17_178 | 53 |
| 612 | 3300046692 | Ga0495671_0596562 | Ga0495671_0596562_116_277 | 53 |
| 613 | 3300046694 | Ga0495649_0281899 | Ga0495649_0281899_175_336 | 53 |
| 614 | 3300047320 | Ga0495672_0006087 | Ga0495672_0006087_6909_7070 | 53 |
| 615 | 3300047320 | Ga0495672_0101140 | Ga0495672_0101140_699_860 | 53 |
| 616 | 3300047469 | Ga0495673_0006204 | Ga0495673_0006204_5406_5567 | 53 |
| 617 | 3300047472 | Ga0495686_0011572 | Ga0495686_0011572_619_780 | 53 |
| 618 | 3300048091 | Ga0495626_0233447 | Ga0495626_0233447_307_468 | 53 |
| 619 | 3300048903 | Ga0496100_0000091 | Ga0496100_0000091_28062_28223 | 53 |
| 620 | 3300048903 | Ga0496100_0000686 | Ga0496100_0000686_1015_1176 | 53 |
| 621 | 3300048903 | Ga0496100_0000796 | Ga0496100_0000796_9932_10093 | 53 |
| 622 | 3300048903 | Ga0496100_0001186 | Ga0496100_0001186_7932_8111 | 53 |
| 623 | 3300048904 | Ga0496101_0000082 | Ga0496101_0000082_81882_82061 | 53 |
| 624 | 3300048904 | Ga0496101_0000095 | Ga0496101_0000095_22765_22926 | 53 |
| 625 | 3300048904 | Ga0496101_0000700 | Ga0496101_0000700_3603_3764 | 53 |
| 626 | 3300048904 | Ga0496101_0003381 | Ga0496101_0003381_556_717 | 53 |
| 627 | 3300048904 | Ga0496101_0031004 | Ga0496101_0031004_954_1115 | 53 |
| 628 | 3300048905 | Ga0496102_0000135 | Ga0496102_0000135_78504_78683 | 53 |
| 629 | 3300048905 | Ga0496102_0002203 | Ga0496102_0002203_8306_8467 | 53 |
| 630 | 3300048905 | Ga0496102_0011693 | Ga0496102_0011693_3054_3215 | 53 |
| 631 | 3300048905 | Ga0496102_0025687 | Ga0496102_0025687_3091_3252 | 53 |
| 632 | 3300048905 | Ga0496102_0029148 | Ga0496102_0029148_3382_3543 | 53 |
| 633 | 3300048905 | Ga0496102_0417392 | Ga0496102_0417392_924_1085 | 53 |
| 634 | 3300048905 | Ga0496102_0517331 | Ga0496102_0517331_268_429 | 53 |
| 635 | 3300048905 | Ga0496102_0579127 | Ga0496102_0579127_698_859 | 53 |
| 636 | 3300048905 | Ga0496102_0670824 | Ga0496102_0670824_346_507 | 53 |
| 637 | 3300048906 | Ga0496103_0000092 | Ga0496103_0000092_22286_22465 | 53 |
| 638 | 3300048906 | Ga0496103_0004617 | Ga0496103_0004617_4359_4520 | 53 |
| 639 | 3300048906 | Ga0496103_0014028 | Ga0496103_0014028_2414_2575 | 53 |
| 640 | 3300048906 | Ga0496103_0053908 | Ga0496103_0053908_1167_1328 | 53 |
| 641 | 3300048906 | Ga0496103_0121577 | Ga0496103_0121577_1443_1604 | 53 |
| 642 | 3300048906 | Ga0496103_0592268 | Ga0496103_0592268_313_474 | 53 |
| 643 | 3300048907 | Ga0496104_0000782 | Ga0496104_0000782_20181_20342 | 53 |
| 644 | 3300048907 | Ga0496104_0015064 | Ga0496104_0015064_3950_4111 | 53 |
| 645 | 3300048907 | Ga0496104_0705622 | Ga0496104_0705622_714_875 | 53 |
| 646 | 3300048907 | Ga0496104_0816992 | Ga0496104_0816992_604_765 | 53 |
| 647 | 3300048907 | Ga0496104_1005465 | Ga0496104_1005465_328_489 | 53 |
| 648 | 3300048908 | Ga0496105_0001884 | Ga0496105_0001884_7541_7702 | 53 |
| 649 | 3300048908 | Ga0496105_0087768 | Ga0496105_0087768_1271_1432 | 53 |
| 650 | 3300048908 | Ga0496105_0206248 | Ga0496105_0206248_923_1084 | 53 |
| 651 | 3300048908 | Ga0496105_0317249 | Ga0496105_0317249_558_719 | 53 |
| 652 | 3300048908 | Ga0496105_0385145 | Ga0496105_0385145_436_615 | 53 |
| 653 | 3300048909 | Ga0496106_0000650 | Ga0496106_0000650_20954_21115 | 53 |
| 654 | 3300048909 | Ga0496106_0024358 | Ga0496106_0024358_3872_4051 | 53 |
| 655 | 3300048909 | Ga0496106_0029608 | Ga0496106_0029608_697_858 | 53 |
| 656 | 3300048909 | Ga0496106_0058371 | Ga0496106_0058371_2252_2413 | 53 |
| 657 | 3300048909 | Ga0496106_0125318 | Ga0496106_0125318_1137_1298 | 53 |
| 658 | 3300048910 | Ga0496107_0000765 | Ga0496107_0000765_843_1004 | 53 |
| 659 | 3300048910 | Ga0496107_0002093 | Ga0496107_0002093_9527_9688 | 53 |
| 660 | 3300048910 | Ga0496107_0054359 | Ga0496107_0054359_2148_2327 | 53 |
| 661 | 3300048910 | Ga0496107_0595265 | Ga0496107_0595265_615_776 | 53 |
| 662 | 3300048911 | Ga0496108_0000330 | Ga0496108_0000330_21178_21339 | 53 |
| 663 | 3300048911 | Ga0496108_0003630 | Ga0496108_0003630_4850_5011 | 53 |
| 664 | 3300048911 | Ga0496108_0056199 | Ga0496108_0056199_772_933 | 53 |
| 665 | 3300048911 | Ga0496108_0726969 | Ga0496108_0726969_133_294 | 53 |
| 666 | 3300048911 | Ga0496108_1048256 | Ga0496108_1048256_73_234 | 53 |
| 667 | 3300048912 | Ga0496109_0000302 | Ga0496109_0000302_39165_39326 | 53 |
| 668 | 3300048912 | Ga0496109_0012077 | Ga0496109_0012077_2818_2979 | 53 |
| 669 | 3300048912 | Ga0496109_0332539 | Ga0496109_0332539_529_690 | 53 |
| 670 | 3300048912 | Ga0496109_0487347 | Ga0496109_0487347_171_332 | 53 |
| 671 | 3300048913 | Ga0496110_0009685 | Ga0496110_0009685_5109_5270 | 53 |
| 672 | 3300048913 | Ga0496110_0010070 | Ga0496110_0010070_7315_7476 | 53 |
| 673 | 3300048913 | Ga0496110_0283516 | Ga0496110_0283516_597_758 | 53 |
| 674 | 3300048913 | Ga0496110_0862637 | Ga0496110_0862637_467_628 | 53 |
| 675 | 3300048914 | Ga0496111_0025868 | Ga0496111_0025868_3548_3709 | 53 |
| 676 | 3300048914 | Ga0496111_0075367 | Ga0496111_0075367_882_1043 | 53 |
| 677 | 3300048914 | Ga0496111_0222566 | Ga0496111_0222566_530_691 | 53 |
| 678 | 3300048914 | Ga0496111_0414221 | Ga0496111_0414221_497_658 | 53 |
| 679 | 3300048915 | Ga0496112_0077564 | Ga0496112_0077564_2097_2258 | 53 |
| 680 | 3300048915 | Ga0496112_0220605 | Ga0496112_0220605_1487_1648 | 53 |
| 681 | 3300048915 | Ga0496112_0330994 | Ga0496112_0330994_325_486 | 53 |
| 682 | 3300048915 | Ga0496112_0488408 | Ga0496112_0488408_765_926 | 53 |
| 683 | 3300048916 | Ga0496113_0015654 | Ga0496113_0015654_4615_4776 | 53 |
| 684 | 3300048916 | Ga0496113_0389256 | Ga0496113_0389256_518_679 | 53 |
| 685 | 3300048917 | Ga0496114_0000191 | Ga0496114_0000191_8926_9087 | 53 |
| 686 | 3300048917 | Ga0496114_0000680 | Ga0496114_0000680_1264_1425 | 53 |
| 687 | 3300048917 | Ga0496114_0036460 | Ga0496114_0036460_2321_2482 | 53 |
| 688 | 3300048917 | Ga0496114_0243715 | Ga0496114_0243715_175_336 | 53 |
| 689 | 3300048918 | Ga0496115_0000858 | Ga0496115_0000858_6474_6635 | 53 |
| 690 | 3300048918 | Ga0496115_0007950 | Ga0496115_0007950_4843_5004 | 53 |
| 691 | 3300048918 | Ga0496115_0017415 | Ga0496115_0017415_415_576 | 53 |
| 692 | 3300048918 | Ga0496115_0426270 | Ga0496115_0426270_18_179 | 53 |
| 693 | 3300048918 | Ga0496115_0524643 | Ga0496115_0524643_723_884 | 53 |
| 694 | 3300048919 | Ga0496116_0000238 | Ga0496116_0000238_21421_21600 | 53 |
| 695 | 3300048919 | Ga0496116_0147676 | Ga0496116_0147676_351_512 | 53 |
| 696 | 3300048920 | Ga0496117_0000019 | Ga0496117_0000019_102770_102949 | 53 |
| 697 | 3300048920 | Ga0496117_0009287 | Ga0496117_0009287_7719_7880 | 53 |
| 698 | 3300048921 | Ga0496118_0000020 | Ga0496118_0000020_366308_366487 | 53 |
| 699 | 3300048921 | Ga0496118_0009566 | Ga0496118_0009566_1867_2028 | 53 |
| 700 | 3300048922 | Ga0496119_0002014 | Ga0496119_0002014_13046_13207 | 53 |
| 701 | 3300048922 | Ga0496119_0020848 | Ga0496119_0020848_2881_3042 | 53 |
| 702 | 3300048922 | Ga0496119_0063658 | Ga0496119_0063658_1145_1324 | 53 |
| 703 | 3300048922 | Ga0496119_0409295 | Ga0496119_0409295_122_283 | 53 |
| 704 | 3300048922 | Ga0496119_0454464 | Ga0496119_0454464_258_434 | 53 |
| 705 | 3300048923 | Ga0496120_0038883 | Ga0496120_0038883_1863_2024 | 53 |
| 706 | 3300048923 | Ga0496120_0484311 | Ga0496120_0484311_56_235 | 53 |
| 707 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_810452_810613 | 53 |
| 708 | 3300048924 | Ga0496121_0000064 | Ga0496121_0000064_168207_168386 | 53 |
| 709 | 3300048925 | Ga0496122_0000085 | Ga0496122_0000085_68107_68268 | 53 |
| 710 | 3300048926 | Ga0496123_0022496 | Ga0496123_0022496_385_546 | 53 |
| 711 | 3300048927 | Ga0496124_0000030 | Ga0496124_0000030_22791_22952 | 53 |
| 712 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_379155_379316 | 53 |
| 713 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_810452_810613 | 53 |
| 714 | 3300048929 | Ga0496126_0000668 | Ga0496126_0000668_41873_42034 | 53 |
| 715 | 3300048929 | Ga0496126_0148977 | Ga0496126_0148977_1794_1955 | 53 |
| 716 | 3300048929 | Ga0496126_0847289 | Ga0496126_0847289_391_552 | 53 |
| 717 | 3300049569 | Ga0501032_0026467 | Ga0501032_0026467_1726_1887 | 53 |
| 718 | 3300049571 | Ga0501034_0004879 | Ga0501034_0004879_3245_3406 | 53 |
| 719 | 3300049571 | Ga0501034_1506387 | Ga0501034_1506387_259_420 | 53 |
| 720 | 3300049572 | Ga0501036_0246260 | Ga0501036_0246260_1058_1219 | 53 |
| 721 | 3300049573 | Ga0501037_0006383 | Ga0501037_0006383_1982_2143 | 53 |
| 722 | 3300049574 | Ga0501038_0002452 | Ga0501038_0002452_6474_6635 | 53 |
| 723 | 3300049575 | Ga0501039_0000368 | Ga0501039_0000368_21764_21925 | 53 |
| 724 | 3300049579 | Ga0501043_0000976 | Ga0501043_0000976_11057_11218 | 53 |
| 725 | 3300049581 | Ga0501047_1121627 | Ga0501047_1121627_74_235 | 53 |
| 726 | 3300049585 | Ga0501069_0897767 | Ga0501069_0897767_95_256 | 53 |
| 727 | 3300049586 | Ga0501070_0040869 | Ga0501070_0040869_2828_2989 | 53 |
| 728 | 3300049586 | Ga0501070_0220116 | Ga0501070_0220116_1197_1358 | 53 |
| 729 | 3300049589 | Ga0501073_0172132 | Ga0501073_0172132_672_833 | 53 |
| 730 | 3300049742 | Ga0501080_0107341 | Ga0501080_0107341_1342_1503 | 53 |
| 731 | 3300050489 | nmdc:mga03683_189414_c1 | nmdc:mga03683_189414_c1_24_185 | 53 |
| 732 | 3300050489 | nmdc:mga03683_56638_c1 | nmdc:mga03683_56638_c1_848_1009 | 53 |
| 733 | 3300050489 | nmdc:mga03683_77071_c1 | nmdc:mga03683_77071_c1_481_642 | 53 |
| 734 | 3300050490 | nmdc:mga03n38_404113_c1 | nmdc:mga03n38_404113_c1_375_536 | 53 |
| 735 | 3300050490 | nmdc:mga03n38_422250_c1 | nmdc:mga03n38_422250_c1_290_451 | 53 |
| 736 | 3300050490 | nmdc:mga03n38_572947_c1 | nmdc:mga03n38_572947_c1_98_259 | 53 |
| 737 | 3300050490 | nmdc:mga03n38_661647_c1 | nmdc:mga03n38_661647_c1_404_565 | 53 |
| 738 | 3300050490 | nmdc:mga03n38_80859_c1 | nmdc:mga03n38_80859_c1_1102_1263 | 53 |
| 739 | 3300050491 | nmdc:mga00v17_21387_c1 | nmdc:mga00v17_21387_c1_3053_3214 | 53 |
| 740 | 3300050491 | nmdc:mga00v17_389413_c1 | nmdc:mga00v17_389413_c1_97_258 | 53 |
| 741 | 3300050491 | nmdc:mga00v17_724141_c1 | nmdc:mga00v17_724141_c1_342_503 | 53 |
| 742 | 3300050491 | nmdc:mga00v17_9757_c1 | nmdc:mga00v17_9757_c1_4109_4270 | 53 |
| 743 | 3300050492 | nmdc:mga0yw44_11851_c1 | nmdc:mga0yw44_11851_c1_3112_3273 | 53 |
| 744 | 3300050492 | nmdc:mga0yw44_164373_c1 | nmdc:mga0yw44_164373_c1_400_561 | 53 |
| 745 | 3300050492 | nmdc:mga0yw44_463577_c1 | nmdc:mga0yw44_463577_c1_511_672 | 53 |
| 746 | 3300050492 | nmdc:mga0yw44_753388_c1 | nmdc:mga0yw44_753388_c1_70_231 | 53 |
| 747 | 3300050492 | nmdc:mga0yw44_76095_c1 | nmdc:mga0yw44_76095_c1_1796_1957 | 53 |
| 748 | 3300050494 | nmdc:mga06z11_679669_c1 | nmdc:mga06z11_679669_c1_194_355 | 53 |
| 749 | 3300050494 | nmdc:mga06z11_99076_c1 | nmdc:mga06z11_99076_c1_965_1126 | 53 |
| 750 | 3300050496 | nmdc:mga07m45_109469_c1 | nmdc:mga07m45_109469_c1_741_902 | 53 |
| 751 | 3300050496 | nmdc:mga07m45_204662_c1 | nmdc:mga07m45_204662_c1_83_244 | 53 |
| 752 | 3300050496 | nmdc:mga07m45_283332_c1 | nmdc:mga07m45_283332_c1_379_540 | 53 |
| 753 | 3300050496 | nmdc:mga07m45_340665_c1 | nmdc:mga07m45_340665_c1_543_704 | 53 |
| 754 | 3300050496 | nmdc:mga07m45_6576_c1 | nmdc:mga07m45_6576_c1_638_799 | 53 |
| 755 | 3300050509 | nmdc:mga0qj67_246989_c1 | nmdc:mga0qj67_246989_c1_1063_1224 | 53 |
| 756 | 3300050513 | nmdc:mga0rr50_611645_c1 | nmdc:mga0rr50_611645_c1_527_688 | 53 |
| 757 | 3300050516 | nmdc:mga0sz30_10903_c1 | nmdc:mga0sz30_10903_c1_2197_2358 | 53 |
| 758 | 3300050516 | nmdc:mga0sz30_116287_c1 | nmdc:mga0sz30_116287_c1_116_277 | 53 |
| 759 | 3300050516 | nmdc:mga0sz30_12193_c1 | nmdc:mga0sz30_12193_c1_3165_3326 | 53 |
| 760 | 3300050516 | nmdc:mga0sz30_136194_c1 | nmdc:mga0sz30_136194_c1_571_732 | 53 |
| 761 | 3300050516 | nmdc:mga0sz30_244975_c1 | nmdc:mga0sz30_244975_c1_46_207 | 53 |
| 762 | 3300050516 | nmdc:mga0sz30_265077_c1 | nmdc:mga0sz30_265077_c1_108_269 | 53 |
| 763 | 3300050516 | nmdc:mga0sz30_305970_c1 | nmdc:mga0sz30_305970_c1_140_301 | 53 |
| 764 | 3300050516 | nmdc:mga0sz30_3712_c1 | nmdc:mga0sz30_3712_c1_1605_1766 | 53 |
| 765 | 3300050516 | nmdc:mga0sz30_413534_c1 | nmdc:mga0sz30_413534_c1_304_465 | 53 |
| 766 | 3300050516 | nmdc:mga0sz30_715_c2 | nmdc:mga0sz30_715_c2_2889_3050 | 53 |
| 767 | 3300050516 | nmdc:mga0sz30_79678_c1 | nmdc:mga0sz30_79678_c1_671_832 | 53 |
| 768 | 3300053079 | Ga0500610_0020120 | Ga0500610_0020120_1723_1884 | 53 |
| 769 | 3300053087 | Ga0500643_003798 | Ga0500643_003798_862_1023 | 53 |
| 770 | 3300053088 | Ga0500644_0017466 | Ga0500644_0017466_1389_1550 | 53 |
| 771 | 3300053098 | Ga0500650_0373112 | Ga0500650_0373112_338_499 | 53 |
| 772 | 3300053104 | Ga0500556_0021703 | Ga0500556_0021703_1635_1796 | 53 |
| 773 | 3300053104 | Ga0500556_0045515 | Ga0500556_0045515_1087_1266 | 53 |
| 774 | 3300053108 | Ga0500562_007101 | Ga0500562_007101_860_1021 | 53 |
| 775 | 3300053122 | Ga0500608_369968 | Ga0500608_369968_118_291 | 53 |
| 776 | 3300053146 | Ga0500588_0160108 | Ga0500588_0160108_247_408 | 53 |
| 777 | 3300053153 | Ga0500616_0006585 | Ga0500616_0006585_6788_6949 | 53 |
| 778 | 3300053153 | Ga0500616_0046613 | Ga0500616_0046613_652_831 | 53 |
| 779 | 3300053727 | Ga0500611_235738 | Ga0500611_235738_175_336 | 53 |
| 780 | 3300061719 | Ga0466962_0023472 | Ga0466962_0023472_2318_2479 | 53 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n1q-assembly1.cif.gz_A | crystal structure of a dps protein from bacillus brevis | 0.9905 | 9 | 49 |
| 5ca3-assembly1.cif.gz_A | crystal structure of the glycosynthase mutant d324n of escherichia coli gh63 glycosidase in complex with glucose and lactose | 0.9863 | 8 | 45 |
| 3w7t-assembly1.cif.gz_A | escherichia coli k12 ygjk complexed with mannose | 0.9851 | 8 | 45 |
| 5jno-assembly1.cif.gz_B | crystal structure of the bd1-ntpr complex from bend3 and pich | 0.9846 | 11 | 45 |
| 1jig-assembly1.cif.gz_A | dlp-2 from bacillus anthracis | 0.9843 | 9 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MN29_151_271_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 1.002 | 12 | 45 | 1.25.40.10 |
| af_A0A1D6NXM7_295_374_1.20.58.180 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 | 1.001 | 8 | 52 | 1.20.58.180 |
| af_Q5VRH2_276_355_1.20.58.180 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 | 0.9991 | 8 | 52 | 1.20.58.180 |
| af_E9QEW1_175_361_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9989 | 8 | 50 | 1.25.40.10 |
| af_A4HST6_211_307_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9946 | 12 | 50 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7UYB9-F1-model_v4 | Uncharacterized protein | 1.011 | 8 | 49 |
|
| AF-A0A829PH36-F1-model_v4 | Uncharacterized protein | 1.01 | 8 | 53 |
|
| AF-A0A1H7MZB7-F1-model_v4 | Uncharacterized protein | 1.007 | 9 | 49 |
|
| AF-A0A1F6MEJ1-F1-model_v4 | Transcription elongation factor GreA/GreB N-terminal domain-containing protein | 1.007 | 9 | 50 |
|
| AF-A0A1C7ND58-F1-model_v4 | Charged multivesicular body protein 7 | 1.006 | 9 | 50 |
GO:0000815
GO:0005771 GO:0006900 GO:0009898 GO:0032511 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar