F480499

General Info

Members Datasets Scaffolds Average Seq Length
780 366 772 53

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1026935|Ga0055540_10269352
Length 59
Sequence MTKGGRMSTGETKSVNDIRTAIRELTARAELARKEGRPDDAAELERRVEGYRDXLGARP

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
232 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
233 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
234 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
355 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
356 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
359 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
364 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.28
Nodule 0
Rhizoplane 12.31
Rhizosphere 66.03
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1020761 3300000546 Bacteria 701
2 JGI24746J21847_1003449 3300001977 Bacteria 2489
3 JGI24747J21853_1010379 3300001978 Bacteria 931
4 JGI24737J22298_10021356 3300001990 Bacteria 2064
5 JGI24743J22301_10004378 3300001991 Bacteria 2300
6 JGI24735J21928_10134044 3300002067 Bacteria 714
7 JGI24750J21931_1007227 3300002070 Bacteria 1394
8 JGI24745J21846_1021647 3300002073 Bacteria 757
9 JGI24738J21930_10020626 3300002075 Bacteria 1370
10 JGI24744J21845_10000295 3300002077 Bacteria 8327
11 JGI24034J26672_10023766 3300002239 Bacteria 974
12 JGI24034J26672_10052787 3300002239 Bacteria 702
13 JGI24742J22300_10024505 3300002244 Bacteria 1041
14 Ga0055528_1034782 3300003790 Bacteria 1234
15 Ga0055540_1000219 3300003792 Bacteria 54071
16 Ga0055540_1002262 3300003792 Bacteria 10387
17 Ga0055540_1020897 3300003792 Bacteria 1718
18 Ga0055540_1026935 3300003792 Bacteria 1383
19 Ga0070676_10453100 3300005328 Bacteria 902
20 Ga0070690_100065490 3300005330 Bacteria 2349
21 Ga0070677_10034936 3300005333 Bacteria 1945
22 Ga0068869_100009054 3300005334 Bacteria 6451
23 Ga0070666_10034107 3300005335 Bacteria 3373
24 Ga0070666_10078223 3300005335 Bacteria 2258
25 Ga0070666_10189222 3300005335 Bacteria 1446
26 Ga0070680_100225547 3300005336 Bacteria 1582
27 Ga0070682_100382022 3300005337 Bacteria 1059
28 Ga0070682_100685317 3300005337 Bacteria 820
29 Ga0068868_100000858 3300005338 Bacteria 20639
30 Ga0068868_100038073 3300005338 Bacteria 3732
31 Ga0068868_100087252 3300005338 Bacteria 2509
32 Ga0068868_101236918 3300005338 Bacteria 692
33 Ga0070660_100061769 3300005339 Bacteria 2909
34 Ga0070689_100046010 3300005340 Bacteria 3361
35 Ga0070689_101406712 3300005340 Bacteria 630
36 Ga0070691_10004817 3300005341 Bacteria 6144
37 Ga0070687_100968798 3300005343 Bacteria 614
38 Ga0070661_101052486 3300005344 Bacteria 677
39 Ga0070692_10093997 3300005345 Bacteria 1634
40 Ga0070668_100000229 3300005347 Bacteria 36371
41 Ga0070668_100015615 3300005347 Bacteria 5676
42 Ga0070668_100153093 3300005347 Bacteria 1866
43 Ga0070668_100249529 3300005347 Bacteria 1473
44 Ga0070668_101351610 3300005347 Bacteria 649
45 Ga0070669_100094855 3300005353 Bacteria 2242
46 Ga0070675_100480421 3300005354 Bacteria 1117
47 Ga0070671_100015168 3300005355 Bacteria 6223
48 Ga0070671_100295615 3300005355 Bacteria 1378
49 Ga0070671_100547966 3300005355 Bacteria 997
50 Ga0070674_100000228 3300005356 Bacteria 27614
51 Ga0070674_100062206 3300005356 Bacteria 2608
52 Ga0070674_100457638 3300005356 Bacteria 1054
53 Ga0070674_101805473 3300005356 Bacteria 554
54 Ga0070673_100889130 3300005364 Bacteria 826
55 Ga0070688_100007048 3300005365 Bacteria 6046
56 Ga0070688_100121005 3300005365 Bacteria 1753
57 Ga0070659_100152265 3300005366 Bacteria 1887
58 Ga0070667_100000782 3300005367 Bacteria 29910
59 Ga0070667_100002450 3300005367 Bacteria 16209
60 Ga0070667_100007804 3300005367 Bacteria 8873
61 Ga0070667_100040740 3300005367 Bacteria 3896
62 Ga0070667_100073182 3300005367 Bacteria 2921
63 Ga0070667_100153655 3300005367 Bacteria 2023
64 Ga0070667_100700044 3300005367 Bacteria 937
65 Ga0070703_10061688 3300005406 Bacteria 1228
66 Ga0070709_10064130 3300005434 Bacteria 2348
67 Ga0070714_100627326 3300005435 Bacteria 1034
68 Ga0070713_101191986 3300005436 Bacteria 737
69 Ga0070710_10002759 3300005437 Bacteria 8361
70 Ga0070701_10236012 3300005438 Bacteria 1097
71 Ga0070711_100000347 3300005439 Bacteria 23841
72 Ga0070711_100022825 3300005439 Bacteria 4060
73 Ga0070705_100004568 3300005440 Bacteria 6740
74 Ga0070705_100401190 3300005440 Bacteria 1015
75 Ga0070700_100012138 3300005441 Bacteria 4795
76 Ga0070694_100003851 3300005444 Bacteria 8963
77 Ga0070694_100052701 3300005444 Bacteria 2751
78 Ga0070663_100006705 3300005455 Bacteria 6946
79 Ga0070663_100170394 3300005455 Bacteria 1682
80 Ga0070663_100314919 3300005455 Bacteria 1257
81 Ga0070663_102134197 3300005455 Bacteria 505
82 Ga0070678_100001926 3300005456 Bacteria 11191
83 Ga0070678_100227144 3300005456 Bacteria 1554
84 Ga0070678_100321279 3300005456 Bacteria 1322
85 Ga0070678_100492100 3300005456 Bacteria 1081
86 Ga0070662_100022121 3300005457 Bacteria 4348
87 Ga0070662_101518503 3300005457 Bacteria 578
88 Ga0070662_101744623 3300005457 Bacteria 538
89 Ga0070681_10614224 3300005458 Bacteria 1002
90 Ga0068867_100312285 3300005459 Bacteria 1299
91 Ga0070685_10117563 3300005466 Bacteria 1647
92 Ga0070685_10282131 3300005466 Bacteria 1112
93 Ga0070685_11078538 3300005466 Bacteria 606
94 Ga0070707_101642852 3300005468 Bacteria 610
95 Ga0070697_100853501 3300005536 Bacteria 807
96 Ga0068853_100003532 3300005539 Bacteria 11957
97 Ga0068853_100133685 3300005539 Bacteria 2222
98 Ga0068853_101929276 3300005539 Bacteria 573
99 Ga0070672_100332534 3300005543 Bacteria 1293
100 Ga0070686_100037101 3300005544 Bacteria 3021
101 Ga0070686_100077610 3300005544 Bacteria 2191
102 Ga0070686_101083488 3300005544 Bacteria 661
103 Ga0070695_100001767 3300005545 Bacteria 12162
104 Ga0070696_100010405 3300005546 Bacteria 6232
105 Ga0070665_100001933 3300005548 Bacteria 23351
106 Ga0070665_100009878 3300005548 Bacteria 9649
107 Ga0070665_100102783 3300005548 Bacteria 2861
108 Ga0070665_100471373 3300005548 Bacteria 1266
109 Ga0070665_100956978 3300005548 Bacteria 869
110 Ga0070665_101128018 3300005548 Bacteria 795
111 Ga0070665_102031207 3300005548 Bacteria 580
112 Ga0070704_100001554 3300005549 Bacteria 12390
113 Ga0070704_100048682 3300005549 Bacteria 2968
114 Ga0070704_100199906 3300005549 Bacteria 1613
115 Ga0068855_100226760 3300005563 Bacteria 2094
116 Ga0068855_100560073 3300005563 Bacteria 1236
117 Ga0068857_101315321 3300005577 Bacteria 702
118 Ga0068854_100002103 3300005578 Bacteria 12200
119 Ga0068854_102230631 3300005578 Bacteria 507
120 Ga0068854_102297272 3300005578 Bacteria 500
121 Ga0068856_102335742 3300005614 Bacteria 543
122 Ga0070702_100000100 3300005615 Bacteria 25735
123 Ga0070702_101324692 3300005615 Bacteria 586
124 Ga0070702_101480825 3300005615 Bacteria 558
125 Ga0068852_100244412 3300005616 Bacteria 1717
126 Ga0068859_100003604 3300005617 Bacteria 15790
127 Ga0068859_100007447 3300005617 Bacteria 11110
128 Ga0068859_100062665 3300005617 Bacteria 3749
129 Ga0068864_100065617 3300005618 Bacteria 3149
130 Ga0068864_100395398 3300005618 Bacteria 1313
131 Ga0068864_101569229 3300005618 Bacteria 662
132 Ga0068866_10000214 3300005718 Bacteria 27363
133 Ga0068866_10827657 3300005718 Bacteria 646
134 Ga0068861_100000252 3300005719 Bacteria 29670
135 Ga0068861_100105160 3300005719 Bacteria 2253
136 Ga0068861_100120138 3300005719 Bacteria 2119
137 Ga0068861_100905659 3300005719 Bacteria 836
138 Ga0068870_10323206 3300005840 Bacteria 981
139 Ga0068863_100002709 3300005841 Bacteria 17500
140 Ga0068863_100032543 3300005841 Bacteria 4969
141 Ga0068863_100258333 3300005841 Bacteria 1684
142 Ga0068863_100307318 3300005841 Bacteria 1539
143 Ga0068863_101534080 3300005841 Bacteria 675
144 Ga0068858_100007550 3300005842 Bacteria 10509
145 Ga0068858_100976189 3300005842 Bacteria 830
146 Ga0068858_101262396 3300005842 Bacteria 727
147 Ga0068860_100000021 3300005843 Bacteria 282612
148 Ga0068860_100024036 3300005843 Bacteria 5891
149 Ga0068860_100186815 3300005843 Bacteria 2004
150 Ga0068860_102726303 3300005843 Bacteria 513
151 Ga0068862_100143912 3300005844 Bacteria 2117
152 Ga0068862_100788941 3300005844 Bacteria 927
153 Ga0068862_101291504 3300005844 Bacteria 731
154 Ga0081538_10133678 3300005981 Bacteria 1160
155 Ga0081540_1066609 3300005983 Bacteria 1687
156 Ga0075365_10188039 3300006038 Bacteria 1445
157 Ga0075365_10210837 3300006038 Bacteria 1362
158 Ga0075365_10993563 3300006038 Bacteria 591
159 Ga0075365_11256115 3300006038 Bacteria 521
160 Ga0075363_100003887 3300006048 Bacteria 6446
161 Ga0075363_100005955 3300006048 Bacteria 5496
162 Ga0075363_100084383 3300006048 Bacteria 1741
163 Ga0075363_100109714 3300006048 Bacteria 1533
164 Ga0075363_100161323 3300006048 Bacteria 1270
165 Ga0075363_100228314 3300006048 Bacteria 1068
166 Ga0075363_100265505 3300006048 Bacteria 991
167 Ga0075363_100323502 3300006048 Bacteria 897
168 Ga0075363_100482282 3300006048 Bacteria 735
169 Ga0075363_100493299 3300006048 Bacteria 727
170 Ga0075363_100521969 3300006048 Bacteria 707
171 Ga0075364_10079044 3300006051 Bacteria 2173
172 Ga0075364_10084371 3300006051 Bacteria 2103
173 Ga0075364_10091399 3300006051 Bacteria 2019
174 Ga0075364_10216612 3300006051 Bacteria 1299
175 Ga0075364_10229564 3300006051 Bacteria 1260
176 Ga0075364_10381465 3300006051 Bacteria 961
177 Ga0075364_10482138 3300006051 Bacteria 848
178 Ga0075364_10904125 3300006051 Bacteria 601
179 Ga0070715_10007135 3300006163 Bacteria 3837
180 Ga0070716_100078690 3300006173 Bacteria 1961
181 Ga0070716_100178886 3300006173 Bacteria 1391
182 Ga0070712_100001274 3300006175 Bacteria 15214
183 Ga0075362_10073538 3300006177 Bacteria 1565
184 Ga0075362_10180154 3300006177 Bacteria 1024
185 Ga0075367_10065139 3300006178 Bacteria 2181
186 Ga0075367_10169215 3300006178 Bacteria 1361
187 Ga0075367_10384254 3300006178 Bacteria 887
188 Ga0075367_10747068 3300006178 Bacteria 622
189 Ga0075367_11023163 3300006178 Bacteria 528
190 Ga0075369_10004863 3300006186 Bacteria 4998
191 Ga0075369_10031500 3300006186 Bacteria 2240
192 Ga0075369_10039062 3300006186 Bacteria 2026
193 Ga0075369_10043105 3300006186 Bacteria 1935
194 Ga0075369_10053724 3300006186 Bacteria 1748
195 Ga0075369_10056916 3300006186 Bacteria 1700
196 Ga0075369_10077230 3300006186 Bacteria 1473
197 Ga0075369_10225916 3300006186 Bacteria 867
198 Ga0075369_10306568 3300006186 Bacteria 742
199 Ga0075369_10488183 3300006186 Bacteria 585
200 Ga0097621_100013003 3300006237 Bacteria 6188
201 Ga0075370_10001115 3300006353 Bacteria 11242
202 Ga0075370_10007393 3300006353 Bacteria 5593
203 Ga0075370_10072111 3300006353 Bacteria 1977
204 Ga0075370_10149030 3300006353 Bacteria 1371
205 Ga0075370_10150304 3300006353 Bacteria 1365
206 Ga0075370_10484686 3300006353 Bacteria 745
207 Ga0068871_100740828 3300006358 Bacteria 903
208 Ga0068871_101834910 3300006358 Bacteria 576
209 Ga0075430_100025050 3300006846 Bacteria 5076
210 Ga0075430_100261656 3300006846 Bacteria 1433
211 Ga0075431_100073181 3300006847 Bacteria 3536
212 Ga0075434_101556202 3300006871 Bacteria 670
213 Ga0068865_100001907 3300006881 Bacteria 12256
214 Ga0068865_100091553 3300006881 Bacteria 2207
215 Ga0097620_100003603 3300006931 Bacteria 15790
216 Ga0097620_100007447 3300006931 Bacteria 11110
217 Ga0097620_100062656 3300006931 Bacteria 3749
218 Ga0075435_100659098 3300007076 Bacteria 909
219 Ga0075435_101270912 3300007076 Bacteria 644
220 Ga0075435_101647919 3300007076 Bacteria 563
221 Ga0099795_10357767 3300007788 Bacteria 654
222 Ga0105251_10391222 3300009011 Bacteria 638
223 Ga0105244_10145983 3300009036 Bacteria 1136
224 Ga0105250_10071318 3300009092 Bacteria 1403
225 Ga0105240_12140850 3300009093 Bacteria 580
226 Ga0111539_10175210 3300009094 Bacteria 2505
227 Ga0105245_10001888 3300009098 Bacteria 19021
228 Ga0105245_10088723 3300009098 Bacteria 2841
229 Ga0105245_11716472 3300009098 Bacteria 680
230 Ga0105247_10001265 3300009101 Bacteria 18737
231 Ga0105247_10022858 3300009101 Bacteria 3766
232 Ga0105247_10157405 3300009101 Bacteria 1501
233 Ga0105247_10203364 3300009101 Bacteria 1332
234 Ga0105247_10405966 3300009101 Bacteria 972
235 Ga0105247_10726458 3300009101 Bacteria 750
236 Ga0114129_10036982 3300009147 Bacteria 6893
237 Ga0114129_12316644 3300009147 Bacteria 644
238 Ga0105243_10001270 3300009148 Bacteria 22670
239 Ga0105243_10263147 3300009148 Bacteria 1545
240 Ga0105242_10002230 3300009176 Bacteria 15288
241 Ga0105242_10231614 3300009176 Bacteria 1656
242 Ga0105242_12295196 3300009176 Bacteria 586
243 Ga0105242_12957835 3300009176 Bacteria 526
244 Ga0105248_10000275 3300009177 Bacteria 60509
245 Ga0105248_10017985 3300009177 Bacteria 7802
246 Ga0105248_10778099 3300009177 Bacteria 1080
247 Ga0105248_11175291 3300009177 Bacteria 867
248 Ga0105248_11798844 3300009177 Bacteria 695
249 Ga0105237_10003411 3300009545 Bacteria 18890
250 Ga0105237_10027980 3300009545 Bacteria 5744
251 Ga0105237_10687239 3300009545 Bacteria 1030
252 Ga0105237_10693179 3300009545 Bacteria 1025
253 Ga0105237_10801356 3300009545 Bacteria 949
254 Ga0105238_10575282 3300009551 Bacteria 1132
255 Ga0105238_11737590 3300009551 Bacteria 655
256 Ga0105238_11773584 3300009551 Bacteria 649
257 Ga0105249_10000125 3300009553 Bacteria 103728
258 Ga0105249_10001345 3300009553 Bacteria 21481
259 Ga0105249_10069322 3300009553 Bacteria 3254
260 Ga0105249_10209347 3300009553 Bacteria 1913
261 Ga0105249_10514352 3300009553 Bacteria 1244
262 Ga0099796_10484152 3300010159 Bacteria 553
263 Ga0105239_10023514 3300010375 Bacteria 6787
264 Ga0105239_10053628 3300010375 Bacteria 4423
265 Ga0105239_10162283 3300010375 Bacteria 2497
266 Ga0105239_10399982 3300010375 Bacteria 1554
267 Ga0105246_10640902 3300011119 Bacteria 924
268 Ga0105246_11150883 3300011119 Bacteria 711
269 Ga0105246_11793813 3300011119 Bacteria 586
270 Ga0105246_12052808 3300011119 Bacteria 553
271 Ga0157338_1052517 3300012515 Bacteria 589
272 Ga0157373_10512372 3300013100 Bacteria 867
273 Ga0157370_10635708 3300013104 Bacteria 976
274 Ga0157369_10086550 3300013105 Bacteria 3347
275 Ga0157374_10005046 3300013296 Bacteria 11074
276 Ga0157378_10001139 3300013297 Bacteria 24164
277 Ga0157378_10477132 3300013297 Bacteria 1242
278 Ga0163162_10014957 3300013306 Bacteria 7578
279 Ga0163162_10072810 3300013306 Bacteria 3491
280 Ga0163162_10107460 3300013306 Bacteria 2886
281 Ga0163162_10161588 3300013306 Bacteria 2362
282 Ga0163162_10211057 3300013306 Bacteria 2071
283 Ga0157372_10001931 3300013307 Bacteria 22495
284 Ga0157375_10000802 3300013308 Bacteria 27587
285 Ga0157375_10188503 3300013308 Bacteria 2217
286 Ga0157375_10341274 3300013308 Bacteria 1663
287 Ga0157375_10591711 3300013308 Bacteria 1269
288 Ga0163163_10440596 3300014325 Bacteria 1362
289 Ga0163163_11482405 3300014325 Bacteria 740
290 Ga0163163_11803605 3300014325 Bacteria 672
291 Ga0157380_10012957 3300014326 Bacteria 6061
292 Ga0157380_11835457 3300014326 Bacteria 666
293 Ga0182008_10658727 3300014497 Bacteria 594
294 Ga0157377_10029294 3300014745 Bacteria 2971
295 Ga0157379_10010663 3300014968 Bacteria 8006
296 Ga0157379_10153385 3300014968 Bacteria 2078
297 Ga0157379_10400316 3300014968 Bacteria 1262
298 Ga0157376_10337484 3300014969 Bacteria 1438
299 Ga0163161_10000706 3300017792 Bacteria 26557
300 Ga0163161_10773051 3300017792 Bacteria 805
301 Ga0207672_1003815 3300025223 Bacteria 858
302 Ga0209673_1021193 3300025273 Bacteria 2280
303 Ga0209051_1000116 3300025303 Bacteria 150182
304 Ga0209051_1000883 3300025303 Bacteria 30181
305 Ga0209051_1002463 3300025303 Bacteria 13245
306 Ga0209051_1003291 3300025303 Bacteria 10715
307 Ga0207697_10114382 3300025315 Bacteria 1157
308 Ga0207656_10096459 3300025321 Bacteria 1350
309 Ga0207653_10130205 3300025885 Bacteria 913
310 Ga0207682_10108278 3300025893 Bacteria 1221
311 Ga0207692_10012772 3300025898 Bacteria 3618
312 Ga0207642_10000561 3300025899 Bacteria 11408
313 Ga0207710_10006352 3300025900 Bacteria 5051
314 Ga0207710_10439669 3300025900 Bacteria 672
315 Ga0207688_10000043 3300025901 Bacteria 43682
316 Ga0207688_10100768 3300025901 Bacteria 1668
317 Ga0207680_10037980 3300025903 Bacteria 2785
318 Ga0207680_10135027 3300025903 Bacteria 1630
319 Ga0207680_10169225 3300025903 Bacteria 1471
320 Ga0207680_10771319 3300025903 Bacteria 689
321 Ga0207647_10122063 3300025904 Bacteria 1536
322 Ga0207645_10016251 3300025907 Bacteria 4929
323 Ga0207654_10042201 3300025911 Bacteria 2580
324 Ga0207671_10013199 3300025914 Bacteria 6592
325 Ga0207671_10026575 3300025914 Bacteria 4335
326 Ga0207671_10198122 3300025914 Bacteria 1568
327 Ga0207663_10001505 3300025916 Bacteria 10875
328 Ga0207662_10295997 3300025918 Bacteria 1074
329 Ga0207652_10812323 3300025921 Bacteria 830
330 Ga0207681_10132418 3300025923 Bacteria 1845
331 Ga0207694_10479788 3300025924 Bacteria 1040
332 Ga0207694_10805875 3300025924 Bacteria 793
333 Ga0207687_10000710 3300025927 Bacteria 22564
334 Ga0207687_10009114 3300025927 Bacteria 6489
335 Ga0207700_10959574 3300025928 Bacteria 765
336 Ga0207664_10202293 3300025929 Bacteria 1715
337 Ga0207664_10801260 3300025929 Bacteria 847
338 Ga0207664_10975339 3300025929 Bacteria 760
339 Ga0207644_10013542 3300025931 Bacteria 5441
340 Ga0207644_10037967 3300025931 Bacteria 3390
341 Ga0207644_10458926 3300025931 Bacteria 1047
342 Ga0207644_11666474 3300025931 Bacteria 534
343 Ga0207706_10319020 3300025933 Bacteria 1352
344 Ga0207686_11266142 3300025934 Bacteria 605
345 Ga0207709_10003353 3300025935 Bacteria 9571
346 Ga0207670_10072868 3300025936 Bacteria 2380
347 Ga0207669_10000172 3300025937 Bacteria 30218
348 Ga0207669_10169432 3300025937 Bacteria 1552
349 Ga0207669_10301331 3300025937 Bacteria 1218
350 Ga0207704_10000868 3300025938 Bacteria 13357
351 Ga0207704_10304853 3300025938 Bacteria 1222
352 Ga0207665_10103060 3300025939 Bacteria 1995
353 Ga0207665_10830868 3300025939 Bacteria 731
354 Ga0207691_10084502 3300025940 Bacteria 2849
355 Ga0207711_10000456 3300025941 Bacteria 42657
356 Ga0207711_10061522 3300025941 Bacteria 3237
357 Ga0207711_10112818 3300025941 Bacteria 2420
358 Ga0207667_10022575 3300025949 Bacteria 6947
359 Ga0207667_10131447 3300025949 Bacteria 2578
360 Ga0207667_11138411 3300025949 Bacteria 762
361 Ga0207651_10153416 3300025960 Bacteria 1796
362 Ga0207712_10000028 3300025961 Bacteria 250190
363 Ga0207712_10001501 3300025961 Bacteria 15821
364 Ga0207712_10802952 3300025961 Bacteria 827
365 Ga0207668_10001313 3300025972 Bacteria 14764
366 Ga0207668_10002088 3300025972 Bacteria 11661
367 Ga0207668_10316136 3300025972 Bacteria 1294
368 Ga0207668_10420550 3300025972 Bacteria 1134
369 Ga0207640_10003250 3300025981 Bacteria 8755
370 Ga0207658_10000679 3300025986 Bacteria 29645
371 Ga0207658_10003784 3300025986 Bacteria 10656
372 Ga0207658_10008256 3300025986 Bacteria 7094
373 Ga0207658_10026234 3300025986 Bacteria 4084
374 Ga0207658_10082686 3300025986 Bacteria 2466
375 Ga0207658_10516165 3300025986 Bacteria 1066
376 Ga0207658_12070065 3300025986 Bacteria 517
377 Ga0207677_10002521 3300026023 Bacteria 9600
378 Ga0207677_10504981 3300026023 Bacteria 1046
379 Ga0207703_10207814 3300026035 Bacteria 1743
380 Ga0207703_10927053 3300026035 Bacteria 834
381 Ga0207703_11407478 3300026035 Bacteria 671
382 Ga0207639_10006543 3300026041 Bacteria 7924
383 Ga0207639_10008675 3300026041 Bacteria 6977
384 Ga0207639_10289686 3300026041 Bacteria 1443
385 Ga0207639_11366833 3300026041 Bacteria 665
386 Ga0207708_10013001 3300026075 Bacteria 6210
387 Ga0207702_10993899 3300026078 Bacteria 832
388 Ga0207641_10002249 3300026088 Bacteria 18006
389 Ga0207641_10016777 3300026088 Bacteria 5997
390 Ga0207641_10070981 3300026088 Bacteria 2994
391 Ga0207641_10189583 3300026088 Bacteria 1889
392 Ga0207648_11581967 3300026089 Bacteria 616
393 Ga0207676_10090532 3300026095 Bacteria 2511
394 Ga0207676_10233335 3300026095 Bacteria 1646
395 Ga0207676_12113991 3300026095 Bacteria 561
396 Ga0207676_12581546 3300026095 Bacteria 504
397 Ga0207675_100275579 3300026118 Bacteria 1633
398 Ga0207675_101387063 3300026118 Bacteria 723
399 Ga0207683_10524041 3300026121 Bacteria 1095
400 Ga0207698_10552916 3300026142 Bacteria 1128
401 Ga0207698_11651445 3300026142 Bacteria 656
402 Ga0207698_11692361 3300026142 Bacteria 648
403 Ga0209813_10249155 3300027866 Bacteria 674
404 Ga0268266_10002270 3300028379 Bacteria 20890
405 Ga0268266_10045987 3300028379 Bacteria 3736
406 Ga0268266_10160707 3300028379 Bacteria 2032
407 Ga0268266_10628131 3300028379 Bacteria 1033
408 Ga0268265_10053617 3300028380 Bacteria 3055
409 Ga0268265_10063383 3300028380 Bacteria 2843
410 Ga0268265_10406314 3300028380 Bacteria 1260
411 Ga0268265_11827107 3300028380 Bacteria 614
412 Ga0268264_10000099 3300028381 Bacteria 228666
413 Ga0268264_10003132 3300028381 Bacteria 14339
414 Ga0265327_10001242 3300031251 Bacteria 34079
415 Ga0307405_11442479 3300031731 Bacteria 603
416 Ga0307413_10217656 3300031824 Bacteria 1392
417 Ga0307410_10053391 3300031852 Bacteria 2735
418 Ga0307406_10116050 3300031901 Bacteria 1852
419 Ga0307406_10690457 3300031901 Bacteria 851
420 Ga0307407_10865647 3300031903 Bacteria 691
421 Ga0307409_100212092 3300031995 Bacteria 1741
422 Ga0307409_102929426 3300031995 Bacteria 504
423 Ga0307415_100059921 3300032126 Bacteria 2628
424 Ga0307415_102048565 3300032126 Bacteria 558
425 Ga0316583_10325972 3300032133 Bacteria 531
426 Ga0373948_0162988 3300034817 Bacteria 563
427 Ga0373929_0148280 3300035085 Bacteria 627
428 Ga0373949_0152012 3300035090 Bacteria 670
429 Ga0373952_0091514 3300035092 Bacteria 791
430 Ga0373923_0271358 3300035111 Bacteria 798
431 Ga0373939_0142222 3300035114 Bacteria 866
432 Ga0373941_0315962 3300035115 Bacteria 627
433 Ga0373960_0107603 3300035121 Bacteria 911
434 Ga0373943_0321461 3300035170 Bacteria 882
435 Ga0373942_0013093 3300035207 Bacteria 1989
436 Ga0373961_0066808 3300035241 Bacteria 1104
437 Ga0373962_0077136 3300035242 Bacteria 1006
438 Ga0316574_0953315 3300035398 Bacteria 518
439 Ga0373931_0010495 3300035691 Bacteria 4453
440 Ga0373931_0332144 3300035691 Bacteria 947
441 Ga0373935_1024832 3300035692 Bacteria 613
442 Ga0373947_0149401 3300035725 Bacteria 1504
443 Ga0316584_0106416 3300036712 Bacteria 2099
444 Ga0436364_0835303 3300037853 Bacteria 2412
445 Ga0439438_105758 3300041405 Bacteria 681
446 Ga0439461_0001096 3300041410 Bacteria 4090
447 Ga0439461_0014223 3300041410 Bacteria 1511
448 Ga0439466_0005219 3300041411 Bacteria 4972
449 Ga0439466_0021877 3300041411 Bacteria 2261
450 Ga0439466_0029974 3300041411 Bacteria 1868
451 Ga0439466_0107932 3300041411 Bacteria 864
452 Ga0439466_0179032 3300041411 Bacteria 646
453 Ga0439465_0000888 3300041413 Bacteria 9447
454 Ga0439465_0007141 3300041413 Bacteria 3550
455 Ga0439465_0011335 3300041413 Bacteria 2797
456 Ga0439465_0227309 3300041413 Bacteria 685
457 Ga0451791_0225015 3300041451 Bacteria 854
458 Ga0451793_1605892 3300041452 Bacteria 650
459 Ga0451797_0201048 3300041453 Bacteria 628
460 Ga0451798_0833199 3300041458 Bacteria 651
461 Ga0451802_1153074 3300041460 Bacteria 1000
462 Ga0451806_141653 3300041462 Bacteria 1206
463 Ga0451833_0156992 3300041491 Bacteria 532
464 Ga0451841_0513871 3300041498 Bacteria 1972
465 Ga0451843_0500978 3300041509 Bacteria 726
466 Ga0451843_0712076 3300041509 Bacteria 763
467 Ga0439431_0003164 3300041997 Bacteria 3620
468 Ga0439431_0024906 3300041997 Bacteria 1459
469 Ga0439431_0038460 3300041997 Bacteria 1211
470 Ga0439442_029980 3300042002 Bacteria 1136
471 Ga0439445_0002779 3300042004 Bacteria 3906
472 Ga0439448_0001735 3300042005 Bacteria 5758
473 Ga0439463_100954 3300042016 Bacteria 744
474 Ga0439458_0107484 3300042157 Bacteria 728
475 Ga0439434_0008121 3300042435 Bacteria 3077
476 Ga0439434_0011344 3300042435 Bacteria 2634
477 Ga0439459_0012943 3300042438 Bacteria 1494
478 Ga0439459_0156253 3300042438 Bacteria 599
479 Ga0466972_0000752 3300044658 Bacteria 15448
480 Ga0466972_0046165 3300044658 Bacteria 2109
481 Ga0466972_0144330 3300044658 Bacteria 1120
482 Ga0466972_0172690 3300044658 Bacteria 1014
483 Ga0466965_0001251 3300044683 Bacteria 10080
484 Ga0466965_0046943 3300044683 Bacteria 2138
485 Ga0466966_0055083 3300044684 Bacteria 2518
486 Ga0466961_0056252 3300044693 Bacteria 2506
487 Ga0466963_1165920 3300044694 Bacteria 542
488 Ga0466964_0226593 3300044706 Bacteria 910
489 Ga0466971_0003847 3300044719 Bacteria 6434
490 Ga0466968_0012315 3300044735 Bacteria 3346
491 Ga0466968_0030505 3300044735 Bacteria 2233
492 Ga0466970_0023613 3300044765 Bacteria 3212
493 Ga0466970_0472790 3300044765 Bacteria 720
494 Ga0466970_0657878 3300044765 Bacteria 609
495 Ga0466957_0004736 3300044842 Bacteria 7619
496 Ga0466957_0473357 3300044842 Bacteria 865
497 Ga0466957_1194802 3300044842 Bacteria 550
498 Ga0466960_0078752 3300044901 Bacteria 1655
499 Ga0466960_0246272 3300044901 Bacteria 991
500 Ga0466960_0376456 3300044901 Bacteria 814
501 Ga0466960_0625786 3300044901 Bacteria 641
502 Ga0466959_0003822 3300045049 Bacteria 9983
503 Ga0466959_0016881 3300045049 Bacteria 5342
504 Ga0466958_0004215 3300045836 Bacteria 7560
505 Ga0466958_0408481 3300045836 Bacteria 877
506 Ga0466967_0006708 3300045976 Bacteria 8189
507 Ga0466967_0121834 3300045976 Bacteria 2411
508 Ga0466967_0137376 3300045976 Bacteria 2274
509 Ga0466967_0278864 3300045976 Bacteria 1603
510 Ga0466967_0552811 3300045976 Bacteria 1133
511 Ga0466967_1484160 3300045976 Bacteria 675
512 Ga0495592_0422421 3300046454 Bacteria 840
513 Ga0495603_0126973 3300046455 Bacteria 1486
514 Ga0495603_0773586 3300046455 Bacteria 548
515 Ga0495629_0018060 3300046459 Bacteria 5055
516 Ga0495638_0002160 3300046460 Bacteria 16508
517 Ga0495638_0007249 3300046460 Bacteria 7971
518 Ga0495641_0019890 3300046461 Bacteria 3421
519 Ga0495653_0422608 3300046463 Bacteria 843
520 Ga0495580_0298048 3300046472 Bacteria 1098
521 Ga0495582_0050717 3300046473 Bacteria 2287
522 Ga0495639_0155205 3300046475 Bacteria 1106
523 Ga0495662_0354710 3300046476 Bacteria 721
524 Ga0495583_0082586 3300046506 Bacteria 1394
525 Ga0495608_0449234 3300046511 Bacteria 784
526 Ga0495616_0106594 3300046513 Bacteria 1307
527 Ga0495630_0478009 3300046517 Bacteria 955
528 Ga0495648_0007758 3300046524 Bacteria 8538
529 Ga0495666_0301608 3300046526 Bacteria 724
530 Ga0495654_0073171 3300046530 Bacteria 1621
531 Ga0495640_0666573 3300046533 Bacteria 625
532 Ga0495622_0284760 3300046557 Bacteria 722
533 Ga0495668_0029180 3300046616 Bacteria 3118
534 Ga0495668_0144997 3300046616 Bacteria 1300
535 Ga0495611_0162983 3300046648 Bacteria 1042
536 Ga0495625_0295414 3300046660 Bacteria 1038
537 Ga0495625_0297939 3300046660 Bacteria 1032
538 Ga0495635_0534623 3300046663 Bacteria 770
539 Ga0495588_0392666 3300046674 Bacteria 728
540 Ga0495657_0408512 3300046675 Bacteria 798
541 Ga0495658_0147785 3300046683 Bacteria 1441
542 Ga0495624_0098576 3300046690 Bacteria 1800
543 Ga0495671_0596562 3300046692 Bacteria 525
544 Ga0495649_0281899 3300046694 Bacteria 849
545 Ga0495581_0008269 3300047315 Bacteria 6031
546 Ga0495674_0202970 3300047319 Bacteria 1644
547 Ga0495672_0006087 3300047320 Bacteria 9423
548 Ga0495672_0031490 3300047320 Bacteria 3311
549 Ga0495672_0101140 3300047320 Bacteria 1563
550 Ga0495676_0327813 3300047321 Bacteria 1027
551 Ga0495680_0447081 3300047322 Bacteria 885
552 Ga0495673_0006204 3300047469 Bacteria 7077
553 Ga0495686_0011572 3300047472 Bacteria 6211
554 Ga0495593_0022778 3300047673 Bacteria 3485
555 Ga0495614_0539887 3300048089 Bacteria 557
556 Ga0495626_0233447 3300048091 Bacteria 743
557 Ga0496100_0000091 3300048903 Bacteria 51013
558 Ga0496100_0000686 3300048903 Bacteria 16149
559 Ga0496100_0000796 3300048903 Bacteria 15040
560 Ga0496100_0001186 3300048903 Bacteria 12682
561 Ga0496100_0347403 3300048903 Bacteria 1120
562 Ga0496100_0636184 3300048903 Bacteria 830
563 Ga0496101_0000082 3300048904 Bacteria 104164
564 Ga0496101_0000095 3300048904 Bacteria 94155
565 Ga0496101_0000700 3300048904 Bacteria 20115
566 Ga0496101_0003381 3300048904 Bacteria 9947
567 Ga0496101_0031004 3300048904 Bacteria 3755
568 Ga0496101_0859205 3300048904 Bacteria 715
569 Ga0496102_0000135 3300048905 Bacteria 100763
570 Ga0496102_0000136 3300048905 Bacteria 99667
571 Ga0496102_0002203 3300048905 Bacteria 16737
572 Ga0496102_0011693 3300048905 Bacteria 7573
573 Ga0496102_0025687 3300048905 Bacteria 5246
574 Ga0496102_0029148 3300048905 Bacteria 4936
575 Ga0496102_0298369 3300048905 Bacteria 1519
576 Ga0496102_0372773 3300048905 Bacteria 1343
577 Ga0496102_0417392 3300048905 Bacteria 1260
578 Ga0496102_0517331 3300048905 Bacteria 1116
579 Ga0496102_0579127 3300048905 Bacteria 1045
580 Ga0496102_0670824 3300048905 Bacteria 960
581 Ga0496103_0000092 3300048906 Bacteria 100968
582 Ga0496103_0000341 3300048906 Bacteria 42518
583 Ga0496103_0004617 3300048906 Bacteria 8338
584 Ga0496103_0014028 3300048906 Bacteria 4757
585 Ga0496103_0053908 3300048906 Bacteria 2492
586 Ga0496103_0118141 3300048906 Bacteria 1688
587 Ga0496103_0121577 3300048906 Bacteria 1663
588 Ga0496103_0592268 3300048906 Bacteria 707
589 Ga0496104_0000782 3300048907 Bacteria 27206
590 Ga0496104_0015064 3300048907 Bacteria 6999
591 Ga0496104_0705622 3300048907 Bacteria 916
592 Ga0496104_0816992 3300048907 Bacteria 838
593 Ga0496104_1005465 3300048907 Bacteria 738
594 Ga0496105_0001884 3300048908 Bacteria 15045
595 Ga0496105_0087768 3300048908 Bacteria 2570
596 Ga0496105_0206248 3300048908 Bacteria 1603
597 Ga0496105_0317249 3300048908 Bacteria 1250
598 Ga0496105_0385145 3300048908 Bacteria 1115
599 Ga0496106_0000650 3300048909 Bacteria 24883
600 Ga0496106_0024358 3300048909 Bacteria 4499
601 Ga0496106_0029608 3300048909 Bacteria 4081
602 Ga0496106_0058371 3300048909 Bacteria 2921
603 Ga0496106_0125318 3300048909 Bacteria 2010
604 Ga0496107_0000765 3300048910 Bacteria 18533
605 Ga0496107_0002093 3300048910 Bacteria 12783
606 Ga0496107_0054359 3300048910 Bacteria 2890
607 Ga0496107_0595265 3300048910 Bacteria 817
608 Ga0496107_1352731 3300048910 Bacteria 508
609 Ga0496108_0000330 3300048911 Bacteria 40103
610 Ga0496108_0003630 3300048911 Bacteria 12368
611 Ga0496108_0056199 3300048911 Bacteria 3306
612 Ga0496108_0726969 3300048911 Bacteria 860
613 Ga0496108_1048256 3300048911 Bacteria 695
614 Ga0496108_1296184 3300048911 Bacteria 613
615 Ga0496109_0000302 3300048912 Bacteria 46592
616 Ga0496109_0012077 3300048912 Bacteria 7442
617 Ga0496109_0332539 3300048912 Bacteria 1434
618 Ga0496109_0487347 3300048912 Bacteria 1164
619 Ga0496109_1050372 3300048912 Bacteria 752
620 Ga0496110_0009685 3300048913 Bacteria 7803
621 Ga0496110_0010070 3300048913 Bacteria 7676
622 Ga0496110_0283516 3300048913 Bacteria 1509
623 Ga0496110_0862637 3300048913 Bacteria 811
624 Ga0496111_0025868 3300048914 Bacteria 4141
625 Ga0496111_0075367 3300048914 Bacteria 2458
626 Ga0496111_0222566 3300048914 Bacteria 1402
627 Ga0496111_0414221 3300048914 Bacteria 995
628 Ga0496112_0077564 3300048915 Bacteria 3286
629 Ga0496112_0107552 3300048915 Bacteria 2759
630 Ga0496112_0220605 3300048915 Bacteria 1852
631 Ga0496112_0330994 3300048915 Bacteria 1467
632 Ga0496112_0488408 3300048915 Bacteria 1167
633 Ga0496113_0015654 3300048916 Bacteria 5222
634 Ga0496113_0343190 3300048916 Bacteria 1198
635 Ga0496113_0389256 3300048916 Bacteria 1119
636 Ga0496114_0000191 3300048917 Bacteria 44606
637 Ga0496114_0000680 3300048917 Bacteria 25258
638 Ga0496114_0036460 3300048917 Bacteria 4066
639 Ga0496114_0243715 3300048917 Bacteria 1581
640 Ga0496114_0293850 3300048917 Bacteria 1434
641 Ga0496115_0000858 3300048918 Bacteria 22064
642 Ga0496115_0007950 3300048918 Bacteria 7828
643 Ga0496115_0017415 3300048918 Bacteria 5494
644 Ga0496115_0426270 3300048918 Bacteria 1074
645 Ga0496115_0524643 3300048918 Bacteria 949
646 Ga0496115_0643369 3300048918 Bacteria 839
647 Ga0496116_0000238 3300048919 Bacteria 100797
648 Ga0496116_0078774 3300048919 Bacteria 2053
649 Ga0496116_0147676 3300048919 Bacteria 1311
650 Ga0496117_0000019 3300048920 Bacteria 469256
651 Ga0496117_0001174 3300048920 Bacteria 39383
652 Ga0496117_0009287 3300048920 Bacteria 9186
653 Ga0496118_0000020 3300048921 Bacteria 470521
654 Ga0496118_0001467 3300048921 Bacteria 35366
655 Ga0496118_0009566 3300048921 Bacteria 9759
656 Ga0496119_0002014 3300048922 Bacteria 22994
657 Ga0496119_0020848 3300048922 Bacteria 4758
658 Ga0496119_0045271 3300048922 Bacteria 2760
659 Ga0496119_0063658 3300048922 Bacteria 2192
660 Ga0496119_0409295 3300048922 Bacteria 646
661 Ga0496119_0454464 3300048922 Bacteria 603
662 Ga0496120_0003913 3300048923 Bacteria 13005
663 Ga0496120_0038883 3300048923 Bacteria 2811
664 Ga0496120_0484311 3300048923 Bacteria 533
665 Ga0496121_0000004 3300048924 Bacteria 1139011
666 Ga0496121_0000064 3300048924 Bacteria 272488
667 Ga0496122_0000085 3300048925 Bacteria 208310
668 Ga0496123_0022496 3300048926 Bacteria 4856
669 Ga0496124_0000030 3300048927 Bacteria 351350
670 Ga0496124_0328613 3300048927 Bacteria 1091
671 Ga0496125_0000003 3300048928 Bacteria 1189767
672 Ga0496126_0000001 3300048929 Bacteria 1139011
673 Ga0496126_0000668 3300048929 Bacteria 63397
674 Ga0496126_0029090 3300048929 Bacteria 5252
675 Ga0496126_0148977 3300048929 Bacteria 2007
676 Ga0496126_0847289 3300048929 Bacteria 697
677 Ga0501032_0026467 3300049569 Bacteria 3989
678 Ga0501034_0004879 3300049571 Bacteria 14798
679 Ga0501034_1506387 3300049571 Bacteria 546
680 Ga0501036_0246260 3300049572 Bacteria 1498
681 Ga0501037_0006383 3300049573 Bacteria 8625
682 Ga0501037_0280789 3300049573 Bacteria 1160
683 Ga0501038_0002452 3300049574 Bacteria 17278
684 Ga0501038_0380330 3300049574 Bacteria 1095
685 Ga0501039_0000368 3300049575 Bacteria 32267
686 Ga0501043_0000976 3300049579 Bacteria 25292
687 Ga0501043_0420773 3300049579 Bacteria 1007
688 Ga0501047_1121627 3300049581 Bacteria 600
689 Ga0501069_0897767 3300049585 Bacteria 539
690 Ga0501070_0040869 3300049586 Bacteria 3865
691 Ga0501070_0220116 3300049586 Bacteria 1557
692 Ga0501073_0172132 3300049589 Bacteria 1499
693 Ga0501080_0107341 3300049742 Bacteria 2588
694 Ga0501044_0029742 3300049823 Bacteria 5759
695 nmdc:mga03683_189414_c1 3300050489 Bacteria 941
696 nmdc:mga03683_56638_c1 3300050489 Bacteria 1648
697 nmdc:mga03683_627147_c1 3300050489 Bacteria 528
698 nmdc:mga03683_77071_c1 3300050489 Bacteria 1434
699 nmdc:mga03n38_156133_c1 3300050490 Bacteria 1152
700 nmdc:mga03n38_165492_c1 3300050490 Bacteria 1123
701 nmdc:mga03n38_255540_c1 3300050490 Bacteria 927
702 nmdc:mga03n38_362540_c1 3300050490 Bacteria 791
703 nmdc:mga03n38_404113_c1 3300050490 Bacteria 752
704 nmdc:mga03n38_422250_c1 3300050490 Bacteria 737
705 nmdc:mga03n38_572947_c1 3300050490 Bacteria 641
706 nmdc:mga03n38_661647_c1 3300050490 Bacteria 599
707 nmdc:mga03n38_80859_c1 3300050490 Bacteria 1527
708 nmdc:mga00v17_161020_c1 3300050491 Bacteria 1445
709 nmdc:mga00v17_21387_c1 3300050491 Bacteria 3719
710 nmdc:mga00v17_321812_c1 3300050491 Bacteria 1005
711 nmdc:mga00v17_389413_c1 3300050491 Bacteria 906
712 nmdc:mga00v17_724141_c1 3300050491 Bacteria 637
713 nmdc:mga00v17_9757_c1 3300050491 Bacteria 5212
714 nmdc:mga0yw44_11851_c1 3300050492 Bacteria 4523
715 nmdc:mga0yw44_164373_c1 3300050492 Bacteria 1454
716 nmdc:mga0yw44_287749_c1 3300050492 Bacteria 1099
717 nmdc:mga0yw44_463577_c1 3300050492 Bacteria 859
718 nmdc:mga0yw44_753388_c1 3300050492 Bacteria 661
719 nmdc:mga0yw44_76095_c1 3300050492 Bacteria 2094
720 nmdc:mga06z11_679669_c1 3300050494 Bacteria 627
721 nmdc:mga06z11_99076_c1 3300050494 Bacteria 1596
722 nmdc:mga04h51_282305_c1 3300050495 Bacteria 673
723 nmdc:mga07m45_104089_c1 3300050496 Bacteria 1632
724 nmdc:mga07m45_109469_c1 3300050496 Bacteria 1590
725 nmdc:mga07m45_204662_c1 3300050496 Bacteria 1148
726 nmdc:mga07m45_283332_c1 3300050496 Bacteria 964
727 nmdc:mga07m45_340665_c1 3300050496 Bacteria 871
728 nmdc:mga07m45_6576_c1 3300050496 Bacteria 5886
729 nmdc:mga05p37_81229_c1 3300050507 Bacteria 3993
730 nmdc:mga0qj67_246989_c1 3300050509 Bacteria 1448
731 nmdc:mga0qj67_31773_c1 3300050509 Bacteria 4114
732 nmdc:mga06r32_75911_c1 3300050510 Bacteria 3263
733 nmdc:mga08y16_288327_c1 3300050511 Bacteria 1692
734 nmdc:mga0rr50_611645_c1 3300050513 Bacteria 929
735 nmdc:mga0sz30_10903_c1 3300050516 Bacteria 3494
736 nmdc:mga0sz30_116287_c1 3300050516 Bacteria 707
737 nmdc:mga0sz30_12193_c1 3300050516 Bacteria 3339
738 nmdc:mga0sz30_136194_c1 3300050516 Bacteria 1083
739 nmdc:mga0sz30_244975_c1 3300050516 Bacteria 798
740 nmdc:mga0sz30_265077_c1 3300050516 Bacteria 765
741 nmdc:mga0sz30_305970_c1 3300050516 Bacteria 709
742 nmdc:mga0sz30_33736_c1 3300050516 Bacteria 2128
743 nmdc:mga0sz30_3712_c1 3300050516 Bacteria 3497
744 nmdc:mga0sz30_383066_c1 3300050516 Bacteria 630
745 nmdc:mga0sz30_413534_c1 3300050516 Bacteria 604
746 nmdc:mga0sz30_715_c2 3300050516 Bacteria 4281
747 nmdc:mga0sz30_79678_c1 3300050516 Bacteria 1416
748 nmdc:mga0sz30_81625_c1 3300050516 Bacteria 1400
749 nmdc:mga0sz30_96567_c1 3300050516 Bacteria 1289
750 Ga0500610_0020120 3300053079 Bacteria 3254
751 Ga0500635_0139117 3300053080 Bacteria 920
752 Ga0495619_0158286 3300053085 Bacteria 1564
753 Ga0500643_003798 3300053087 Bacteria 7057
754 Ga0500643_008531 3300053087 Bacteria 4020
755 Ga0500644_0017466 3300053088 Bacteria 2084
756 Ga0500650_0121959 3300053098 Bacteria 1215
757 Ga0500650_0373112 3300053098 Bacteria 621
758 Ga0500556_0021703 3300053104 Bacteria 2074
759 Ga0500556_0045515 3300053104 Bacteria 1566
760 Ga0500562_007101 3300053108 Bacteria 2826
761 Ga0500595_155258 3300053119 Bacteria 639
762 Ga0500608_369968 3300053122 Bacteria 500
763 Ga0500652_014247 3300053131 Bacteria 2838
764 Ga0500559_0161899 3300053136 Bacteria 1051
765 Ga0500588_0160108 3300053146 Bacteria 819
766 Ga0500588_0240830 3300053146 Bacteria 678
767 Ga0500616_0006585 3300053153 Bacteria 7574
768 Ga0500616_0046613 3300053153 Bacteria 2304
769 Ga0500627_0474271 3300053158 Bacteria 524
770 Ga0500611_235738 3300053727 Bacteria 525
771 Ga0500645_000023 3300053730 Bacteria 128995
772 Ga0466962_0023472 3300061719 Bacteria 2964

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0144330 Ga0466972_0144330_700_849 49
2 3300044901 Ga0466960_0376456 Ga0466960_0376456_84_233 49
3 3300045976 Ga0466967_0552811 Ga0466967_0552811_759_908 49
4 iso_pu_bacteria 2643221687 2644490445 49
5 iso_pu_bacteria 2643221715 2644638681 49
6 iso_pu_bacteria 2738541264 2738668568 49
7 iso_pu_bacteria 2738541356 2739147760 49
8 iso_pu_bacteria 2902792274 2902793977 49
9 iso_pu_bacteria 2902810491 2902811429 49
10 iso_pu_bacteria 2902837492 2902839746 49
11 iso_pu_bacteria 2939582691 2939582914 49
12 3300001977 JGI24746J21847_1003449 JGI24746J21847_10034492 51
13 3300001978 JGI24747J21853_1010379 JGI24747J21853_10103792 51
14 3300001990 JGI24737J22298_10021356 JGI24737J22298_100213563 51
15 3300001991 JGI24743J22301_10004378 JGI24743J22301_100043782 51
16 3300002070 JGI24750J21931_1007227 JGI24750J21931_10072272 51
17 3300002073 JGI24745J21846_1021647 JGI24745J21846_10216472 51
18 3300002075 JGI24738J21930_10020626 JGI24738J21930_100206263 51
19 3300002239 JGI24034J26672_10023766 JGI24034J26672_100237662 51
20 3300002244 JGI24742J22300_10024505 JGI24742J22300_100245052 51
21 3300005328 Ga0070676_10453100 Ga0070676_104531002 51
22 3300005334 Ga0068869_100009054 Ga0068869_1000090545 51
23 3300005335 Ga0070666_10078223 Ga0070666_100782233 51
24 3300005336 Ga0070680_100225547 Ga0070680_1002255473 51
25 3300005337 Ga0070682_100382022 Ga0070682_1003820222 51
26 3300005338 Ga0068868_100087252 Ga0068868_1000872523 51
27 3300005338 Ga0068868_101236918 Ga0068868_1012369182 51
28 3300005343 Ga0070687_100968798 Ga0070687_1009687981 51
29 3300005344 Ga0070661_101052486 Ga0070661_1010524862 51
30 3300005347 Ga0070668_100153093 Ga0070668_1001530933 51
31 3300005347 Ga0070668_101351610 Ga0070668_1013516102 51
32 3300005354 Ga0070675_100480421 Ga0070675_1004804212 51
33 3300005355 Ga0070671_100295615 Ga0070671_1002956152 51
34 3300005356 Ga0070674_100457638 Ga0070674_1004576382 51
35 3300005364 Ga0070673_100889130 Ga0070673_1008891302 51
36 3300005366 Ga0070659_100152265 Ga0070659_1001522653 51
37 3300005367 Ga0070667_100000782 Ga0070667_1000007824 51
38 3300005367 Ga0070667_100153655 Ga0070667_1001536552 51
39 3300005406 Ga0070703_10061688 Ga0070703_100616882 51
40 3300005435 Ga0070714_100627326 Ga0070714_1006273262 51
41 3300005436 Ga0070713_101191986 Ga0070713_1011919861 51
42 3300005437 Ga0070710_10002759 Ga0070710_100027595 51
43 3300005439 Ga0070711_100022825 Ga0070711_1000228253 51
44 3300005440 Ga0070705_100401190 Ga0070705_1004011902 51
45 3300005444 Ga0070694_100052701 Ga0070694_1000527012 51
46 3300005458 Ga0070681_10614224 Ga0070681_106142242 51
47 3300005459 Ga0068867_100312285 Ga0068867_1003122852 51
48 3300005536 Ga0070697_100853501 Ga0070697_1008535012 51
49 3300005539 Ga0068853_101929276 Ga0068853_1019292761 51
50 3300005544 Ga0070686_101083488 Ga0070686_1010834881 51
51 3300005546 Ga0070696_100010405 Ga0070696_1000104054 51
52 3300005548 Ga0070665_100009878 Ga0070665_1000098783 51
53 3300005549 Ga0070704_100199906 Ga0070704_1001999063 51
54 3300005578 Ga0068854_102230631 Ga0068854_1022306312 51
55 3300005615 Ga0070702_101324692 Ga0070702_1013246922 51
56 3300005617 Ga0068859_100007447 Ga0068859_10000744713 51
57 3300005618 Ga0068864_100395398 Ga0068864_1003953982 51
58 3300005618 Ga0068864_101569229 Ga0068864_1015692292 51
59 3300005718 Ga0068866_10827657 Ga0068866_108276571 51
60 3300005841 Ga0068863_100002709 Ga0068863_1000027094 51
61 3300005842 Ga0068858_101262396 Ga0068858_1012623962 51
62 3300005843 Ga0068860_100000021 Ga0068860_10000002131 51
63 3300005843 Ga0068860_102726303 Ga0068860_1027263032 51
64 3300005981 Ga0081538_10133678 Ga0081538_101336782 51
65 3300006048 Ga0075363_100003887 Ga0075363_1000038874 51
66 3300006048 Ga0075363_100005955 Ga0075363_1000059551 51
67 3300006048 Ga0075363_100161323 Ga0075363_1001613232 51
68 3300006048 Ga0075363_100265505 Ga0075363_1002655051 51
69 3300006048 Ga0075363_100323502 Ga0075363_1003235022 51
70 3300006048 Ga0075363_100521969 Ga0075363_1005219692 51
71 3300006051 Ga0075364_10079044 Ga0075364_100790443 51
72 3300006051 Ga0075364_10229564 Ga0075364_102295642 51
73 3300006051 Ga0075364_10904125 Ga0075364_109041252 51
74 3300006173 Ga0070716_100178886 Ga0070716_1001788862 51
75 3300006177 Ga0075362_10180154 Ga0075362_101801542 51
76 3300006178 Ga0075367_11023163 Ga0075367_110231632 51
77 3300006186 Ga0075369_10031500 Ga0075369_100315004 51
78 3300006186 Ga0075369_10043105 Ga0075369_100431053 51
79 3300006186 Ga0075369_10225916 Ga0075369_102259162 51
80 3300006353 Ga0075370_10001115 Ga0075370_100011152 51
81 3300006931 Ga0097620_100007447 Ga0097620_1000074473 51
82 3300007076 Ga0075435_101270912 Ga0075435_1012709122 51
83 3300009094 Ga0111539_10175210 Ga0111539_101752102 51
84 3300009147 Ga0114129_10036982 Ga0114129_100369825 51
85 3300009176 Ga0105242_12957835 Ga0105242_129578352 51
86 3300009177 Ga0105248_10000275 Ga0105248_1000027525 51
87 3300009545 Ga0105237_10693179 Ga0105237_106931792 51
88 3300009551 Ga0105238_11773584 Ga0105238_117735841 51
89 3300009553 Ga0105249_10000125 Ga0105249_1000012548 51
90 3300009553 Ga0105249_10514352 Ga0105249_105143523 51
91 3300010159 Ga0099796_10484152 Ga0099796_104841522 51
92 3300011119 Ga0105246_12052808 Ga0105246_120528081 51
93 3300013306 Ga0163162_10161588 Ga0163162_101615881 51
94 3300013306 Ga0163162_10211057 Ga0163162_102110571 51
95 3300014325 Ga0163163_10440596 Ga0163163_104405963 51
96 3300014325 Ga0163163_11803605 Ga0163163_118036052 51
97 3300014968 Ga0157379_10010663 Ga0157379_100106632 51
98 3300014968 Ga0157379_10400316 Ga0157379_104003162 51
99 3300025921 Ga0207652_10812323 Ga0207652_108123232 51
100 3300025924 Ga0207694_10805875 Ga0207694_108058751 51
101 3300025939 Ga0207665_10830868 Ga0207665_108308682 51
102 3300025941 Ga0207711_10000456 Ga0207711_1000045625 51
103 3300025949 Ga0207667_11138411 Ga0207667_111384111 51
104 3300025961 Ga0207712_10000028 Ga0207712_10000028184 51
105 3300025986 Ga0207658_10000679 Ga0207658_1000067927 51
106 3300026088 Ga0207641_10002249 Ga0207641_1000224911 51
107 3300026095 Ga0207676_10233335 Ga0207676_102333352 51
108 3300026095 Ga0207676_12113991 Ga0207676_121139912 51
109 3300026118 Ga0207675_101387063 Ga0207675_1013870632 51
110 3300026142 Ga0207698_11651445 Ga0207698_116514452 51
111 3300027866 Ga0209813_10249155 Ga0209813_102491552 51
112 3300028379 Ga0268266_10045987 Ga0268266_100459874 51
113 3300028381 Ga0268264_10000099 Ga0268264_1000009931 51
114 3300032126 Ga0307415_102048565 Ga0307415_1020485651 51
115 3300032133 Ga0316583_10325972 Ga0316583_103259722 51
116 3300035111 Ga0373923_0271358 Ga0373923_0271358_431_586 51
117 3300035170 Ga0373943_0321461 Ga0373943_0321461_504_659 51
118 3300035398 Ga0316574_0953315 Ga0316574_0953315_124_279 51
119 3300035692 Ga0373935_1024832 Ga0373935_1024832_16_171 51
120 3300035725 Ga0373947_0149401 Ga0373947_0149401_292_447 51
121 3300036712 Ga0316584_0106416 Ga0316584_0106416_1199_1354 51
122 3300037853 Ga0436364_0835303 Ga0436364_0835303_1516_1671 51
123 3300041410 Ga0439461_0014223 Ga0439461_0014223_35_190 51
124 3300041411 Ga0439466_0005219 Ga0439466_0005219_3608_3763 51
125 3300041413 Ga0439465_0000888 Ga0439465_0000888_325_480 51
126 3300041458 Ga0451798_0833199 Ga0451798_0833199_196_351 51
127 3300041997 Ga0439431_0024906 Ga0439431_0024906_335_490 51
128 3300042016 Ga0439463_100954 Ga0439463_100954_137_292 51
129 3300046454 Ga0495592_0422421 Ga0495592_0422421_129_284 51
130 3300046455 Ga0495603_0126973 Ga0495603_0126973_646_801 51
131 3300046459 Ga0495629_0018060 Ga0495629_0018060_874_1029 51
132 3300046460 Ga0495638_0007249 Ga0495638_0007249_4744_4899 51
133 3300046461 Ga0495641_0019890 Ga0495641_0019890_935_1090 51
134 3300046463 Ga0495653_0422608 Ga0495653_0422608_584_739 51
135 3300046472 Ga0495580_0298048 Ga0495580_0298048_553_708 51
136 3300046473 Ga0495582_0050717 Ga0495582_0050717_1573_1728 51
137 3300046475 Ga0495639_0155205 Ga0495639_0155205_689_844 51
138 3300046476 Ga0495662_0354710 Ga0495662_0354710_55_210 51
139 3300046511 Ga0495608_0449234 Ga0495608_0449234_357_512 51
140 3300046517 Ga0495630_0478009 Ga0495630_0478009_692_847 51
141 3300046526 Ga0495666_0301608 Ga0495666_0301608_288_443 51
142 3300046533 Ga0495640_0666573 Ga0495640_0666573_255_410 51
143 3300046557 Ga0495622_0284760 Ga0495622_0284760_255_410 51
144 3300046674 Ga0495588_0392666 Ga0495588_0392666_539_694 51
145 3300046675 Ga0495657_0408512 Ga0495657_0408512_470_625 51
146 3300046683 Ga0495658_0147785 Ga0495658_0147785_763_918 51
147 3300046690 Ga0495624_0098576 Ga0495624_0098576_891_1046 51
148 3300047315 Ga0495581_0008269 Ga0495581_0008269_2136_2291 51
149 3300047319 Ga0495674_0202970 Ga0495674_0202970_942_1097 51
150 3300047320 Ga0495672_0031490 Ga0495672_0031490_1698_1853 51
151 3300047321 Ga0495676_0327813 Ga0495676_0327813_271_426 51
152 3300047322 Ga0495680_0447081 Ga0495680_0447081_490_645 51
153 3300047673 Ga0495593_0022778 Ga0495593_0022778_2837_2992 51
154 3300048089 Ga0495614_0539887 Ga0495614_0539887_211_366 51
155 3300048903 Ga0496100_0347403 Ga0496100_0347403_268_423 51
156 3300048903 Ga0496100_0636184 Ga0496100_0636184_516_671 51
157 3300048904 Ga0496101_0859205 Ga0496101_0859205_495_650 51
158 3300048905 Ga0496102_0000136 Ga0496102_0000136_18533_18688 51
159 3300048905 Ga0496102_0298369 Ga0496102_0298369_267_422 51
160 3300048905 Ga0496102_0372773 Ga0496102_0372773_876_1031 51
161 3300048906 Ga0496103_0000341 Ga0496103_0000341_29417_29572 51
162 3300048906 Ga0496103_0118141 Ga0496103_0118141_307_462 51
163 3300048910 Ga0496107_1352731 Ga0496107_1352731_302_457 51
164 3300048911 Ga0496108_1296184 Ga0496108_1296184_394_549 51
165 3300048912 Ga0496109_1050372 Ga0496109_1050372_122_277 51
166 3300048915 Ga0496112_0107552 Ga0496112_0107552_328_483 51
167 3300048916 Ga0496113_0343190 Ga0496113_0343190_700_855 51
168 3300048917 Ga0496114_0293850 Ga0496114_0293850_1032_1187 51
169 3300048918 Ga0496115_0643369 Ga0496115_0643369_331_486 51
170 3300048919 Ga0496116_0078774 Ga0496116_0078774_1074_1229 51
171 3300048920 Ga0496117_0001174 Ga0496117_0001174_627_782 51
172 3300048921 Ga0496118_0001467 Ga0496118_0001467_5338_5493 51
173 3300048922 Ga0496119_0045271 Ga0496119_0045271_951_1106 51
174 3300048923 Ga0496120_0003913 Ga0496120_0003913_3018_3173 51
175 3300048927 Ga0496124_0328613 Ga0496124_0328613_38_193 51
176 3300048929 Ga0496126_0029090 Ga0496126_0029090_2715_2870 51
177 3300049573 Ga0501037_0280789 Ga0501037_0280789_666_821 51
178 3300049574 Ga0501038_0380330 Ga0501038_0380330_566_721 51
179 3300049579 Ga0501043_0420773 Ga0501043_0420773_683_838 51
180 3300049823 Ga0501044_0029742 Ga0501044_0029742_996_1151 51
181 3300050489 nmdc:mga03683_627147_c1 nmdc:mga03683_627147_c1_188_343 51
182 3300050490 nmdc:mga03n38_156133_c1 nmdc:mga03n38_156133_c1_919_1074 51
183 3300050490 nmdc:mga03n38_165492_c1 nmdc:mga03n38_165492_c1_17_172 51
184 3300050490 nmdc:mga03n38_255540_c1 nmdc:mga03n38_255540_c1_337_492 51
185 3300050490 nmdc:mga03n38_362540_c1 nmdc:mga03n38_362540_c1_470_625 51
186 3300050491 nmdc:mga00v17_161020_c1 nmdc:mga00v17_161020_c1_1147_1302 51
187 3300050491 nmdc:mga00v17_321812_c1 nmdc:mga00v17_321812_c1_481_636 51
188 3300050492 nmdc:mga0yw44_287749_c1 nmdc:mga0yw44_287749_c1_897_1052 51
189 3300050495 nmdc:mga04h51_282305_c1 nmdc:mga04h51_282305_c1_316_471 51
190 3300050496 nmdc:mga07m45_104089_c1 nmdc:mga07m45_104089_c1_188_343 51
191 3300050507 nmdc:mga05p37_81229_c1 nmdc:mga05p37_81229_c1_2936_3091 51
192 3300050509 nmdc:mga0qj67_31773_c1 nmdc:mga0qj67_31773_c1_2472_2627 51
193 3300050510 nmdc:mga06r32_75911_c1 nmdc:mga06r32_75911_c1_2627_2782 51
194 3300050511 nmdc:mga08y16_288327_c1 nmdc:mga08y16_288327_c1_223_378 51
195 3300050516 nmdc:mga0sz30_33736_c1 nmdc:mga0sz30_33736_c1_989_1144 51
196 3300050516 nmdc:mga0sz30_383066_c1 nmdc:mga0sz30_383066_c1_249_404 51
197 3300050516 nmdc:mga0sz30_81625_c1 nmdc:mga0sz30_81625_c1_640_795 51
198 3300050516 nmdc:mga0sz30_96567_c1 nmdc:mga0sz30_96567_c1_305_460 51
199 3300053080 Ga0500635_0139117 Ga0500635_0139117_513_668 51
200 3300053085 Ga0495619_0158286 Ga0495619_0158286_425_580 51
201 3300053087 Ga0500643_008531 Ga0500643_008531_3794_3949 51
202 3300053098 Ga0500650_0121959 Ga0500650_0121959_245_400 51
203 3300053119 Ga0500595_155258 Ga0500595_155258_419_574 51
204 3300053131 Ga0500652_014247 Ga0500652_014247_1202_1357 51
205 3300053136 Ga0500559_0161899 Ga0500559_0161899_875_1030 51
206 3300053146 Ga0500588_0240830 Ga0500588_0240830_436_591 51
207 3300053158 Ga0500627_0474271 Ga0500627_0474271_138_293 51
208 3300053730 Ga0500645_000023 Ga0500645_000023_128507_128662 51
209 3300000546 LJNas_1020761 LJNas_10207612 53
210 3300002067 JGI24735J21928_10134044 JGI24735J21928_101340441 53
211 3300002077 JGI24744J21845_10000295 JGI24744J21845_100002953 53
212 3300002239 JGI24034J26672_10052787 JGI24034J26672_100527872 53
213 3300003790 Ga0055528_1034782 Ga0055528_10347822 53
214 3300003792 Ga0055540_1000219 Ga0055540_100021918 53
215 3300003792 Ga0055540_1002262 Ga0055540_10022627 53
216 3300003792 Ga0055540_1020897 Ga0055540_10208972 53
217 3300003792 Ga0055540_1026935 Ga0055540_10269352 53
218 3300005330 Ga0070690_100065490 Ga0070690_1000654902 53
219 3300005333 Ga0070677_10034936 Ga0070677_100349362 53
220 3300005335 Ga0070666_10034107 Ga0070666_100341073 53
221 3300005335 Ga0070666_10189222 Ga0070666_101892222 53
222 3300005337 Ga0070682_100685317 Ga0070682_1006853172 53
223 3300005338 Ga0068868_100000858 Ga0068868_1000008588 53
224 3300005338 Ga0068868_100038073 Ga0068868_1000380733 53
225 3300005339 Ga0070660_100061769 Ga0070660_1000617693 53
226 3300005340 Ga0070689_100046010 Ga0070689_1000460103 53
227 3300005340 Ga0070689_101406712 Ga0070689_1014067122 53
228 3300005341 Ga0070691_10004817 Ga0070691_100048176 53
229 3300005345 Ga0070692_10093997 Ga0070692_100939972 53
230 3300005347 Ga0070668_100000229 Ga0070668_10000022912 53
231 3300005347 Ga0070668_100015615 Ga0070668_1000156154 53
232 3300005347 Ga0070668_100249529 Ga0070668_1002495293 53
233 3300005353 Ga0070669_100094855 Ga0070669_1000948553 53
234 3300005355 Ga0070671_100015168 Ga0070671_1000151685 53
235 3300005355 Ga0070671_100547966 Ga0070671_1005479661 53
236 3300005356 Ga0070674_100000228 Ga0070674_1000002288 53
237 3300005356 Ga0070674_100062206 Ga0070674_1000622063 53
238 3300005356 Ga0070674_101805473 Ga0070674_1018054731 53
239 3300005365 Ga0070688_100007048 Ga0070688_1000070484 53
240 3300005365 Ga0070688_100121005 Ga0070688_1001210053 53
241 3300005367 Ga0070667_100002450 Ga0070667_1000024509 53
242 3300005367 Ga0070667_100007804 Ga0070667_1000078047 53
243 3300005367 Ga0070667_100040740 Ga0070667_1000407405 53
244 3300005367 Ga0070667_100073182 Ga0070667_1000731823 53
245 3300005367 Ga0070667_100700044 Ga0070667_1007000442 53
246 3300005434 Ga0070709_10064130 Ga0070709_100641304 53
247 3300005438 Ga0070701_10236012 Ga0070701_102360122 53
248 3300005439 Ga0070711_100000347 Ga0070711_1000003478 53
249 3300005440 Ga0070705_100004568 Ga0070705_1000045686 53
250 3300005441 Ga0070700_100012138 Ga0070700_1000121385 53
251 3300005444 Ga0070694_100003851 Ga0070694_1000038512 53
252 3300005455 Ga0070663_100006705 Ga0070663_1000067056 53
253 3300005455 Ga0070663_100170394 Ga0070663_1001703941 53
254 3300005455 Ga0070663_100314919 Ga0070663_1003149192 53
255 3300005455 Ga0070663_102134197 Ga0070663_1021341972 53
256 3300005456 Ga0070678_100001926 Ga0070678_1000019263 53
257 3300005456 Ga0070678_100227144 Ga0070678_1002271443 53
258 3300005456 Ga0070678_100321279 Ga0070678_1003212792 53
259 3300005456 Ga0070678_100492100 Ga0070678_1004921002 53
260 3300005457 Ga0070662_100022121 Ga0070662_1000221214 53
261 3300005457 Ga0070662_101518503 Ga0070662_1015185031 53
262 3300005457 Ga0070662_101744623 Ga0070662_1017446231 53
263 3300005466 Ga0070685_10117563 Ga0070685_101175633 53
264 3300005466 Ga0070685_10282131 Ga0070685_102821312 53
265 3300005466 Ga0070685_11078538 Ga0070685_110785381 53
266 3300005468 Ga0070707_101642852 Ga0070707_1016428522 53
267 3300005539 Ga0068853_100003532 Ga0068853_1000035325 53
268 3300005539 Ga0068853_100133685 Ga0068853_1001336853 53
269 3300005543 Ga0070672_100332534 Ga0070672_1003325342 53
270 3300005544 Ga0070686_100037101 Ga0070686_1000371013 53
271 3300005544 Ga0070686_100077610 Ga0070686_1000776104 53
272 3300005545 Ga0070695_100001767 Ga0070695_1000017676 53
273 3300005548 Ga0070665_100001933 Ga0070665_1000019331 53
274 3300005548 Ga0070665_100102783 Ga0070665_1001027833 53
275 3300005548 Ga0070665_100471373 Ga0070665_1004713732 53
276 3300005548 Ga0070665_100956978 Ga0070665_1009569782 53
277 3300005548 Ga0070665_101128018 Ga0070665_1011280182 53
278 3300005548 Ga0070665_102031207 Ga0070665_1020312071 53
279 3300005549 Ga0070704_100001554 Ga0070704_1000015547 53
280 3300005549 Ga0070704_100048682 Ga0070704_1000486822 53
281 3300005563 Ga0068855_100226760 Ga0068855_1002267601 53
282 3300005563 Ga0068855_100560073 Ga0068855_1005600732 53
283 3300005577 Ga0068857_101315321 Ga0068857_1013153212 53
284 3300005578 Ga0068854_100002103 Ga0068854_1000021035 53
285 3300005578 Ga0068854_102297272 Ga0068854_1022972722 53
286 3300005614 Ga0068856_102335742 Ga0068856_1023357422 53
287 3300005615 Ga0070702_100000100 Ga0070702_10000010012 53
288 3300005615 Ga0070702_101480825 Ga0070702_1014808252 53
289 3300005616 Ga0068852_100244412 Ga0068852_1002444122 53
290 3300005617 Ga0068859_100003604 Ga0068859_1000036043 53
291 3300005617 Ga0068859_100062665 Ga0068859_1000626652 53
292 3300005618 Ga0068864_100065617 Ga0068864_1000656173 53
293 3300005718 Ga0068866_10000214 Ga0068866_1000021416 53
294 3300005719 Ga0068861_100000252 Ga0068861_1000002525 53
295 3300005719 Ga0068861_100105160 Ga0068861_1001051603 53
296 3300005719 Ga0068861_100120138 Ga0068861_1001201383 53
297 3300005719 Ga0068861_100905659 Ga0068861_1009056592 53
298 3300005840 Ga0068870_10323206 Ga0068870_103232061 53
299 3300005841 Ga0068863_100032543 Ga0068863_1000325435 53
300 3300005841 Ga0068863_100258333 Ga0068863_1002583333 53
301 3300005841 Ga0068863_100307318 Ga0068863_1003073183 53
302 3300005841 Ga0068863_101534080 Ga0068863_1015340802 53
303 3300005842 Ga0068858_100007550 Ga0068858_1000075507 53
304 3300005842 Ga0068858_100976189 Ga0068858_1009761892 53
305 3300005843 Ga0068860_100024036 Ga0068860_1000240365 53
306 3300005843 Ga0068860_100186815 Ga0068860_1001868153 53
307 3300005844 Ga0068862_100143912 Ga0068862_1001439123 53
308 3300005844 Ga0068862_100788941 Ga0068862_1007889412 53
309 3300005844 Ga0068862_101291504 Ga0068862_1012915042 53
310 3300005983 Ga0081540_1066609 Ga0081540_10666093 53
311 3300006038 Ga0075365_10188039 Ga0075365_101880393 53
312 3300006038 Ga0075365_10210837 Ga0075365_102108372 53
313 3300006038 Ga0075365_10993563 Ga0075365_109935632 53
314 3300006038 Ga0075365_11256115 Ga0075365_112561151 53
315 3300006048 Ga0075363_100084383 Ga0075363_1000843833 53
316 3300006048 Ga0075363_100109714 Ga0075363_1001097143 53
317 3300006048 Ga0075363_100228314 Ga0075363_1002283141 53
318 3300006048 Ga0075363_100482282 Ga0075363_1004822822 53
319 3300006048 Ga0075363_100493299 Ga0075363_1004932991 53
320 3300006051 Ga0075364_10084371 Ga0075364_100843712 53
321 3300006051 Ga0075364_10091399 Ga0075364_100913993 53
322 3300006051 Ga0075364_10216612 Ga0075364_102166123 53
323 3300006051 Ga0075364_10381465 Ga0075364_103814653 53
324 3300006051 Ga0075364_10482138 Ga0075364_104821382 53
325 3300006163 Ga0070715_10007135 Ga0070715_100071355 53
326 3300006173 Ga0070716_100078690 Ga0070716_1000786903 53
327 3300006175 Ga0070712_100001274 Ga0070712_10000127411 53
328 3300006177 Ga0075362_10073538 Ga0075362_100735382 53
329 3300006178 Ga0075367_10065139 Ga0075367_100651393 53
330 3300006178 Ga0075367_10169215 Ga0075367_101692153 53
331 3300006178 Ga0075367_10384254 Ga0075367_103842542 53
332 3300006178 Ga0075367_10747068 Ga0075367_107470682 53
333 3300006186 Ga0075369_10004863 Ga0075369_100048635 53
334 3300006186 Ga0075369_10039062 Ga0075369_100390624 53
335 3300006186 Ga0075369_10053724 Ga0075369_100537243 53
336 3300006186 Ga0075369_10056916 Ga0075369_100569162 53
337 3300006186 Ga0075369_10077230 Ga0075369_100772302 53
338 3300006186 Ga0075369_10306568 Ga0075369_103065682 53
339 3300006186 Ga0075369_10488183 Ga0075369_104881832 53
340 3300006237 Ga0097621_100013003 Ga0097621_1000130036 53
341 3300006353 Ga0075370_10007393 Ga0075370_100073933 53
342 3300006353 Ga0075370_10072111 Ga0075370_100721113 53
343 3300006353 Ga0075370_10149030 Ga0075370_101490303 53
344 3300006353 Ga0075370_10150304 Ga0075370_101503042 53
345 3300006353 Ga0075370_10484686 Ga0075370_104846862 53
346 3300006358 Ga0068871_100740828 Ga0068871_1007408282 53
347 3300006358 Ga0068871_101834910 Ga0068871_1018349102 53
348 3300006846 Ga0075430_100025050 Ga0075430_1000250503 53
349 3300006846 Ga0075430_100261656 Ga0075430_1002616562 53
350 3300006847 Ga0075431_100073181 Ga0075431_1000731813 53
351 3300006871 Ga0075434_101556202 Ga0075434_1015562022 53
352 3300006881 Ga0068865_100001907 Ga0068865_1000019078 53
353 3300006881 Ga0068865_100091553 Ga0068865_1000915533 53
354 3300006931 Ga0097620_100003603 Ga0097620_1000036033 53
355 3300006931 Ga0097620_100062656 Ga0097620_1000626562 53
356 3300007076 Ga0075435_100659098 Ga0075435_1006590982 53
357 3300007076 Ga0075435_101647919 Ga0075435_1016479192 53
358 3300007788 Ga0099795_10357767 Ga0099795_103577672 53
359 3300009011 Ga0105251_10391222 Ga0105251_103912222 53
360 3300009036 Ga0105244_10145983 Ga0105244_101459832 53
361 3300009092 Ga0105250_10071318 Ga0105250_100713182 53
362 3300009093 Ga0105240_12140850 Ga0105240_121408502 53
363 3300009098 Ga0105245_10001888 Ga0105245_100018889 53
364 3300009098 Ga0105245_10088723 Ga0105245_100887234 53
365 3300009098 Ga0105245_11716472 Ga0105245_117164721 53
366 3300009101 Ga0105247_10001265 Ga0105247_1000126515 53
367 3300009101 Ga0105247_10022858 Ga0105247_100228583 53
368 3300009101 Ga0105247_10157405 Ga0105247_101574052 53
369 3300009101 Ga0105247_10203364 Ga0105247_102033642 53
370 3300009101 Ga0105247_10405966 Ga0105247_104059663 53
371 3300009101 Ga0105247_10726458 Ga0105247_107264581 53
372 3300009147 Ga0114129_12316644 Ga0114129_123166441 53
373 3300009148 Ga0105243_10001270 Ga0105243_1000127027 53
374 3300009148 Ga0105243_10263147 Ga0105243_102631472 53
375 3300009176 Ga0105242_10002230 Ga0105242_1000223015 53
376 3300009176 Ga0105242_10231614 Ga0105242_102316142 53
377 3300009176 Ga0105242_12295196 Ga0105242_122951961 53
378 3300009177 Ga0105248_10017985 Ga0105248_100179852 53
379 3300009177 Ga0105248_10778099 Ga0105248_107780992 53
380 3300009177 Ga0105248_11175291 Ga0105248_111752913 53
381 3300009177 Ga0105248_11798844 Ga0105248_117988442 53
382 3300009545 Ga0105237_10003411 Ga0105237_100034113 53
383 3300009545 Ga0105237_10027980 Ga0105237_100279803 53
384 3300009545 Ga0105237_10687239 Ga0105237_106872391 53
385 3300009545 Ga0105237_10801356 Ga0105237_108013562 53
386 3300009551 Ga0105238_10575282 Ga0105238_105752822 53
387 3300009551 Ga0105238_11737590 Ga0105238_117375901 53
388 3300009553 Ga0105249_10001345 Ga0105249_100013455 53
389 3300009553 Ga0105249_10069322 Ga0105249_100693223 53
390 3300009553 Ga0105249_10209347 Ga0105249_102093473 53
391 3300010375 Ga0105239_10023514 Ga0105239_100235143 53
392 3300010375 Ga0105239_10053628 Ga0105239_100536286 53
393 3300010375 Ga0105239_10162283 Ga0105239_101622833 53
394 3300010375 Ga0105239_10399982 Ga0105239_103999822 53
395 3300011119 Ga0105246_10640902 Ga0105246_106409022 53
396 3300011119 Ga0105246_11150883 Ga0105246_111508832 53
397 3300011119 Ga0105246_11793813 Ga0105246_117938132 53
398 3300012515 Ga0157338_1052517 Ga0157338_10525172 53
399 3300013100 Ga0157373_10512372 Ga0157373_105123722 53
400 3300013104 Ga0157370_10635708 Ga0157370_106357082 53
401 3300013105 Ga0157369_10086550 Ga0157369_100865502 53
402 3300013296 Ga0157374_10005046 Ga0157374_100050462 53
403 3300013297 Ga0157378_10001139 Ga0157378_1000113915 53
404 3300013297 Ga0157378_10477132 Ga0157378_104771322 53
405 3300013306 Ga0163162_10014957 Ga0163162_100149578 53
406 3300013306 Ga0163162_10072810 Ga0163162_100728103 53
407 3300013306 Ga0163162_10107460 Ga0163162_101074605 53
408 3300013307 Ga0157372_10001931 Ga0157372_1000193117 53
409 3300013308 Ga0157375_10000802 Ga0157375_100008029 53
410 3300013308 Ga0157375_10188503 Ga0157375_101885033 53
411 3300013308 Ga0157375_10341274 Ga0157375_103412743 53
412 3300013308 Ga0157375_10591711 Ga0157375_105917112 53
413 3300014325 Ga0163163_11482405 Ga0163163_114824052 53
414 3300014326 Ga0157380_10012957 Ga0157380_100129573 53
415 3300014326 Ga0157380_11835457 Ga0157380_118354571 53
416 3300014497 Ga0182008_10658727 Ga0182008_106587272 53
417 3300014745 Ga0157377_10029294 Ga0157377_100292944 53
418 3300014968 Ga0157379_10153385 Ga0157379_101533853 53
419 3300014969 Ga0157376_10337484 Ga0157376_103374842 53
420 3300017792 Ga0163161_10000706 Ga0163161_100007068 53
421 3300017792 Ga0163161_10773051 Ga0163161_107730511 53
422 3300025223 Ga0207672_1003815 Ga0207672_10038152 53
423 3300025273 Ga0209673_1021193 Ga0209673_10211933 53
424 3300025303 Ga0209051_1000116 Ga0209051_1000116102 53
425 3300025303 Ga0209051_1000883 Ga0209051_10008837 53
426 3300025303 Ga0209051_1002463 Ga0209051_100246310 53
427 3300025303 Ga0209051_1003291 Ga0209051_10032917 53
428 3300025315 Ga0207697_10114382 Ga0207697_101143822 53
429 3300025321 Ga0207656_10096459 Ga0207656_100964592 53
430 3300025885 Ga0207653_10130205 Ga0207653_101302052 53
431 3300025893 Ga0207682_10108278 Ga0207682_101082783 53
432 3300025898 Ga0207692_10012772 Ga0207692_100127724 53
433 3300025899 Ga0207642_10000561 Ga0207642_100005614 53
434 3300025900 Ga0207710_10006352 Ga0207710_100063524 53
435 3300025900 Ga0207710_10439669 Ga0207710_104396692 53
436 3300025901 Ga0207688_10000043 Ga0207688_1000004312 53
437 3300025901 Ga0207688_10100768 Ga0207688_101007682 53
438 3300025903 Ga0207680_10037980 Ga0207680_100379803 53
439 3300025903 Ga0207680_10135027 Ga0207680_101350273 53
440 3300025903 Ga0207680_10169225 Ga0207680_101692253 53
441 3300025903 Ga0207680_10771319 Ga0207680_107713192 53
442 3300025904 Ga0207647_10122063 Ga0207647_101220632 53
443 3300025907 Ga0207645_10016251 Ga0207645_100162512 53
444 3300025911 Ga0207654_10042201 Ga0207654_100422014 53
445 3300025914 Ga0207671_10013199 Ga0207671_100131996 53
446 3300025914 Ga0207671_10026575 Ga0207671_100265752 53
447 3300025914 Ga0207671_10198122 Ga0207671_101981223 53
448 3300025916 Ga0207663_10001505 Ga0207663_100015056 53
449 3300025918 Ga0207662_10295997 Ga0207662_102959972 53
450 3300025923 Ga0207681_10132418 Ga0207681_101324182 53
451 3300025924 Ga0207694_10479788 Ga0207694_104797882 53
452 3300025927 Ga0207687_10000710 Ga0207687_1000071015 53
453 3300025927 Ga0207687_10009114 Ga0207687_100091146 53
454 3300025928 Ga0207700_10959574 Ga0207700_109595742 53
455 3300025929 Ga0207664_10202293 Ga0207664_102022933 53
456 3300025929 Ga0207664_10801260 Ga0207664_108012601 53
457 3300025929 Ga0207664_10975339 Ga0207664_109753392 53
458 3300025931 Ga0207644_10013542 Ga0207644_100135425 53
459 3300025931 Ga0207644_10037967 Ga0207644_100379673 53
460 3300025931 Ga0207644_10458926 Ga0207644_104589262 53
461 3300025931 Ga0207644_11666474 Ga0207644_116664742 53
462 3300025933 Ga0207706_10319020 Ga0207706_103190202 53
463 3300025934 Ga0207686_11266142 Ga0207686_112661422 53
464 3300025935 Ga0207709_10003353 Ga0207709_100033538 53
465 3300025936 Ga0207670_10072868 Ga0207670_100728682 53
466 3300025937 Ga0207669_10000172 Ga0207669_1000017215 53
467 3300025937 Ga0207669_10169432 Ga0207669_101694322 53
468 3300025937 Ga0207669_10301331 Ga0207669_103013312 53
469 3300025938 Ga0207704_10000868 Ga0207704_100008683 53
470 3300025938 Ga0207704_10304853 Ga0207704_103048532 53
471 3300025939 Ga0207665_10103060 Ga0207665_101030603 53
472 3300025940 Ga0207691_10084502 Ga0207691_100845023 53
473 3300025941 Ga0207711_10061522 Ga0207711_100615222 53
474 3300025941 Ga0207711_10112818 Ga0207711_101128183 53
475 3300025949 Ga0207667_10022575 Ga0207667_100225759 53
476 3300025949 Ga0207667_10131447 Ga0207667_101314471 53
477 3300025960 Ga0207651_10153416 Ga0207651_101534162 53
478 3300025961 Ga0207712_10001501 Ga0207712_100015013 53
479 3300025961 Ga0207712_10802952 Ga0207712_108029521 53
480 3300025972 Ga0207668_10001313 Ga0207668_1000131314 53
481 3300025972 Ga0207668_10002088 Ga0207668_100020888 53
482 3300025972 Ga0207668_10316136 Ga0207668_103161363 53
483 3300025972 Ga0207668_10420550 Ga0207668_104205502 53
484 3300025981 Ga0207640_10003250 Ga0207640_100032509 53
485 3300025986 Ga0207658_10003784 Ga0207658_100037846 53
486 3300025986 Ga0207658_10008256 Ga0207658_100082568 53
487 3300025986 Ga0207658_10026234 Ga0207658_100262343 53
488 3300025986 Ga0207658_10082686 Ga0207658_100826863 53
489 3300025986 Ga0207658_10516165 Ga0207658_105161652 53
490 3300025986 Ga0207658_12070065 Ga0207658_120700652 53
491 3300026023 Ga0207677_10002521 Ga0207677_1000252112 53
492 3300026023 Ga0207677_10504981 Ga0207677_105049812 53
493 3300026035 Ga0207703_10207814 Ga0207703_102078143 53
494 3300026035 Ga0207703_10927053 Ga0207703_109270532 53
495 3300026035 Ga0207703_11407478 Ga0207703_114074782 53
496 3300026041 Ga0207639_10006543 Ga0207639_100065434 53
497 3300026041 Ga0207639_10008675 Ga0207639_100086752 53
498 3300026041 Ga0207639_10289686 Ga0207639_102896863 53
499 3300026041 Ga0207639_11366833 Ga0207639_113668332 53
500 3300026075 Ga0207708_10013001 Ga0207708_100130013 53
501 3300026078 Ga0207702_10993899 Ga0207702_109938992 53
502 3300026088 Ga0207641_10016777 Ga0207641_100167775 53
503 3300026088 Ga0207641_10070981 Ga0207641_100709814 53
504 3300026088 Ga0207641_10189583 Ga0207641_101895832 53
505 3300026089 Ga0207648_11581967 Ga0207648_115819671 53
506 3300026095 Ga0207676_10090532 Ga0207676_100905323 53
507 3300026095 Ga0207676_12581546 Ga0207676_125815462 53
508 3300026118 Ga0207675_100275579 Ga0207675_1002755792 53
509 3300026121 Ga0207683_10524041 Ga0207683_105240412 53
510 3300026142 Ga0207698_10552916 Ga0207698_105529163 53
511 3300026142 Ga0207698_11692361 Ga0207698_116923612 53
512 3300028379 Ga0268266_10002270 Ga0268266_100022702 53
513 3300028379 Ga0268266_10160707 Ga0268266_101607072 53
514 3300028379 Ga0268266_10628131 Ga0268266_106281312 53
515 3300028380 Ga0268265_10053617 Ga0268265_100536174 53
516 3300028380 Ga0268265_10063383 Ga0268265_100633833 53
517 3300028380 Ga0268265_10406314 Ga0268265_104063142 53
518 3300028380 Ga0268265_11827107 Ga0268265_118271072 53
519 3300028381 Ga0268264_10003132 Ga0268264_100031323 53
520 3300031251 Ga0265327_10001242 Ga0265327_1000124214 53
521 3300031731 Ga0307405_11442479 Ga0307405_114424792 53
522 3300031824 Ga0307413_10217656 Ga0307413_102176562 53
523 3300031852 Ga0307410_10053391 Ga0307410_100533913 53
524 3300031901 Ga0307406_10116050 Ga0307406_101160503 53
525 3300031901 Ga0307406_10690457 Ga0307406_106904572 53
526 3300031903 Ga0307407_10865647 Ga0307407_108656472 53
527 3300031995 Ga0307409_100212092 Ga0307409_1002120921 53
528 3300031995 Ga0307409_102929426 Ga0307409_1029294262 53
529 3300032126 Ga0307415_100059921 Ga0307415_1000599212 53
530 3300034817 Ga0373948_0162988 Ga0373948_0162988_200_361 53
531 3300035085 Ga0373929_0148280 Ga0373929_0148280_377_538 53
532 3300035090 Ga0373949_0152012 Ga0373949_0152012_306_467 53
533 3300035092 Ga0373952_0091514 Ga0373952_0091514_350_511 53
534 3300035114 Ga0373939_0142222 Ga0373939_0142222_308_469 53
535 3300035115 Ga0373941_0315962 Ga0373941_0315962_295_456 53
536 3300035121 Ga0373960_0107603 Ga0373960_0107603_382_543 53
537 3300035207 Ga0373942_0013093 Ga0373942_0013093_711_872 53
538 3300035241 Ga0373961_0066808 Ga0373961_0066808_513_674 53
539 3300035242 Ga0373962_0077136 Ga0373962_0077136_745_906 53
540 3300035691 Ga0373931_0010495 Ga0373931_0010495_848_1009 53
541 3300035691 Ga0373931_0332144 Ga0373931_0332144_734_895 53
542 3300041405 Ga0439438_105758 Ga0439438_105758_262_423 53
543 3300041410 Ga0439461_0001096 Ga0439461_0001096_1620_1781 53
544 3300041411 Ga0439466_0021877 Ga0439466_0021877_41_202 53
545 3300041411 Ga0439466_0029974 Ga0439466_0029974_130_291 53
546 3300041411 Ga0439466_0107932 Ga0439466_0107932_467_628 53
547 3300041411 Ga0439466_0179032 Ga0439466_0179032_67_228 53
548 3300041413 Ga0439465_0007141 Ga0439465_0007141_94_255 53
549 3300041413 Ga0439465_0011335 Ga0439465_0011335_1775_1936 53
550 3300041413 Ga0439465_0227309 Ga0439465_0227309_252_413 53
551 3300041451 Ga0451791_0225015 Ga0451791_0225015_343_504 53
552 3300041452 Ga0451793_1605892 Ga0451793_1605892_378_539 53
553 3300041453 Ga0451797_0201048 Ga0451797_0201048_148_309 53
554 3300041460 Ga0451802_1153074 Ga0451802_1153074_781_990 53
555 3300041462 Ga0451806_141653 Ga0451806_141653_663_824 53
556 3300041491 Ga0451833_0156992 Ga0451833_0156992_275_436 53
557 3300041498 Ga0451841_0513871 Ga0451841_0513871_1753_1914 53
558 3300041509 Ga0451843_0500978 Ga0451843_0500978_332_514 53
559 3300041509 Ga0451843_0712076 Ga0451843_0712076_128_304 53
560 3300041997 Ga0439431_0003164 Ga0439431_0003164_610_771 53
561 3300041997 Ga0439431_0038460 Ga0439431_0038460_64_225 53
562 3300042002 Ga0439442_029980 Ga0439442_029980_411_572 53
563 3300042004 Ga0439445_0002779 Ga0439445_0002779_2021_2182 53
564 3300042005 Ga0439448_0001735 Ga0439448_0001735_3406_3567 53
565 3300042157 Ga0439458_0107484 Ga0439458_0107484_230_391 53
566 3300042435 Ga0439434_0008121 Ga0439434_0008121_2655_2816 53
567 3300042435 Ga0439434_0011344 Ga0439434_0011344_541_702 53
568 3300042438 Ga0439459_0012943 Ga0439459_0012943_331_492 53
569 3300042438 Ga0439459_0156253 Ga0439459_0156253_168_329 53
570 3300044658 Ga0466972_0000752 Ga0466972_0000752_4242_4403 53
571 3300044658 Ga0466972_0046165 Ga0466972_0046165_629_790 53
572 3300044658 Ga0466972_0172690 Ga0466972_0172690_129_290 53
573 3300044683 Ga0466965_0001251 Ga0466965_0001251_9782_9943 53
574 3300044683 Ga0466965_0046943 Ga0466965_0046943_1882_2043 53
575 3300044684 Ga0466966_0055083 Ga0466966_0055083_644_805 53
576 3300044693 Ga0466961_0056252 Ga0466961_0056252_2317_2478 53
577 3300044694 Ga0466963_1165920 Ga0466963_1165920_47_208 53
578 3300044706 Ga0466964_0226593 Ga0466964_0226593_360_521 53
579 3300044719 Ga0466971_0003847 Ga0466971_0003847_1438_1599 53
580 3300044735 Ga0466968_0012315 Ga0466968_0012315_1645_1806 53
581 3300044735 Ga0466968_0030505 Ga0466968_0030505_1808_1969 53
582 3300044765 Ga0466970_0023613 Ga0466970_0023613_2771_2932 53
583 3300044765 Ga0466970_0472790 Ga0466970_0472790_106_267 53
584 3300044765 Ga0466970_0657878 Ga0466970_0657878_138_299 53
585 3300044842 Ga0466957_0004736 Ga0466957_0004736_738_899 53
586 3300044842 Ga0466957_0473357 Ga0466957_0473357_522_683 53
587 3300044842 Ga0466957_1194802 Ga0466957_1194802_220_381 53
588 3300044901 Ga0466960_0078752 Ga0466960_0078752_1469_1630 53
589 3300044901 Ga0466960_0246272 Ga0466960_0246272_68_229 53
590 3300044901 Ga0466960_0625786 Ga0466960_0625786_305_466 53
591 3300045049 Ga0466959_0003822 Ga0466959_0003822_6739_6900 53
592 3300045049 Ga0466959_0016881 Ga0466959_0016881_4495_4656 53
593 3300045836 Ga0466958_0004215 Ga0466958_0004215_5410_5571 53
594 3300045836 Ga0466958_0408481 Ga0466958_0408481_484_645 53
595 3300045976 Ga0466967_0006708 Ga0466967_0006708_6812_6973 53
596 3300045976 Ga0466967_0121834 Ga0466967_0121834_325_486 53
597 3300045976 Ga0466967_0137376 Ga0466967_0137376_1284_1445 53
598 3300045976 Ga0466967_0278864 Ga0466967_0278864_1122_1283 53
599 3300045976 Ga0466967_1484160 Ga0466967_1484160_199_360 53
600 3300046455 Ga0495603_0773586 Ga0495603_0773586_286_447 53
601 3300046460 Ga0495638_0002160 Ga0495638_0002160_2151_2312 53
602 3300046506 Ga0495583_0082586 Ga0495583_0082586_1085_1246 53
603 3300046513 Ga0495616_0106594 Ga0495616_0106594_1029_1190 53
604 3300046524 Ga0495648_0007758 Ga0495648_0007758_3411_3572 53
605 3300046530 Ga0495654_0073171 Ga0495654_0073171_249_410 53
606 3300046616 Ga0495668_0029180 Ga0495668_0029180_835_996 53
607 3300046616 Ga0495668_0144997 Ga0495668_0144997_310_471 53
608 3300046648 Ga0495611_0162983 Ga0495611_0162983_552_713 53
609 3300046660 Ga0495625_0295414 Ga0495625_0295414_701_862 53
610 3300046660 Ga0495625_0297939 Ga0495625_0297939_749_910 53
611 3300046663 Ga0495635_0534623 Ga0495635_0534623_17_178 53
612 3300046692 Ga0495671_0596562 Ga0495671_0596562_116_277 53
613 3300046694 Ga0495649_0281899 Ga0495649_0281899_175_336 53
614 3300047320 Ga0495672_0006087 Ga0495672_0006087_6909_7070 53
615 3300047320 Ga0495672_0101140 Ga0495672_0101140_699_860 53
616 3300047469 Ga0495673_0006204 Ga0495673_0006204_5406_5567 53
617 3300047472 Ga0495686_0011572 Ga0495686_0011572_619_780 53
618 3300048091 Ga0495626_0233447 Ga0495626_0233447_307_468 53
619 3300048903 Ga0496100_0000091 Ga0496100_0000091_28062_28223 53
620 3300048903 Ga0496100_0000686 Ga0496100_0000686_1015_1176 53
621 3300048903 Ga0496100_0000796 Ga0496100_0000796_9932_10093 53
622 3300048903 Ga0496100_0001186 Ga0496100_0001186_7932_8111 53
623 3300048904 Ga0496101_0000082 Ga0496101_0000082_81882_82061 53
624 3300048904 Ga0496101_0000095 Ga0496101_0000095_22765_22926 53
625 3300048904 Ga0496101_0000700 Ga0496101_0000700_3603_3764 53
626 3300048904 Ga0496101_0003381 Ga0496101_0003381_556_717 53
627 3300048904 Ga0496101_0031004 Ga0496101_0031004_954_1115 53
628 3300048905 Ga0496102_0000135 Ga0496102_0000135_78504_78683 53
629 3300048905 Ga0496102_0002203 Ga0496102_0002203_8306_8467 53
630 3300048905 Ga0496102_0011693 Ga0496102_0011693_3054_3215 53
631 3300048905 Ga0496102_0025687 Ga0496102_0025687_3091_3252 53
632 3300048905 Ga0496102_0029148 Ga0496102_0029148_3382_3543 53
633 3300048905 Ga0496102_0417392 Ga0496102_0417392_924_1085 53
634 3300048905 Ga0496102_0517331 Ga0496102_0517331_268_429 53
635 3300048905 Ga0496102_0579127 Ga0496102_0579127_698_859 53
636 3300048905 Ga0496102_0670824 Ga0496102_0670824_346_507 53
637 3300048906 Ga0496103_0000092 Ga0496103_0000092_22286_22465 53
638 3300048906 Ga0496103_0004617 Ga0496103_0004617_4359_4520 53
639 3300048906 Ga0496103_0014028 Ga0496103_0014028_2414_2575 53
640 3300048906 Ga0496103_0053908 Ga0496103_0053908_1167_1328 53
641 3300048906 Ga0496103_0121577 Ga0496103_0121577_1443_1604 53
642 3300048906 Ga0496103_0592268 Ga0496103_0592268_313_474 53
643 3300048907 Ga0496104_0000782 Ga0496104_0000782_20181_20342 53
644 3300048907 Ga0496104_0015064 Ga0496104_0015064_3950_4111 53
645 3300048907 Ga0496104_0705622 Ga0496104_0705622_714_875 53
646 3300048907 Ga0496104_0816992 Ga0496104_0816992_604_765 53
647 3300048907 Ga0496104_1005465 Ga0496104_1005465_328_489 53
648 3300048908 Ga0496105_0001884 Ga0496105_0001884_7541_7702 53
649 3300048908 Ga0496105_0087768 Ga0496105_0087768_1271_1432 53
650 3300048908 Ga0496105_0206248 Ga0496105_0206248_923_1084 53
651 3300048908 Ga0496105_0317249 Ga0496105_0317249_558_719 53
652 3300048908 Ga0496105_0385145 Ga0496105_0385145_436_615 53
653 3300048909 Ga0496106_0000650 Ga0496106_0000650_20954_21115 53
654 3300048909 Ga0496106_0024358 Ga0496106_0024358_3872_4051 53
655 3300048909 Ga0496106_0029608 Ga0496106_0029608_697_858 53
656 3300048909 Ga0496106_0058371 Ga0496106_0058371_2252_2413 53
657 3300048909 Ga0496106_0125318 Ga0496106_0125318_1137_1298 53
658 3300048910 Ga0496107_0000765 Ga0496107_0000765_843_1004 53
659 3300048910 Ga0496107_0002093 Ga0496107_0002093_9527_9688 53
660 3300048910 Ga0496107_0054359 Ga0496107_0054359_2148_2327 53
661 3300048910 Ga0496107_0595265 Ga0496107_0595265_615_776 53
662 3300048911 Ga0496108_0000330 Ga0496108_0000330_21178_21339 53
663 3300048911 Ga0496108_0003630 Ga0496108_0003630_4850_5011 53
664 3300048911 Ga0496108_0056199 Ga0496108_0056199_772_933 53
665 3300048911 Ga0496108_0726969 Ga0496108_0726969_133_294 53
666 3300048911 Ga0496108_1048256 Ga0496108_1048256_73_234 53
667 3300048912 Ga0496109_0000302 Ga0496109_0000302_39165_39326 53
668 3300048912 Ga0496109_0012077 Ga0496109_0012077_2818_2979 53
669 3300048912 Ga0496109_0332539 Ga0496109_0332539_529_690 53
670 3300048912 Ga0496109_0487347 Ga0496109_0487347_171_332 53
671 3300048913 Ga0496110_0009685 Ga0496110_0009685_5109_5270 53
672 3300048913 Ga0496110_0010070 Ga0496110_0010070_7315_7476 53
673 3300048913 Ga0496110_0283516 Ga0496110_0283516_597_758 53
674 3300048913 Ga0496110_0862637 Ga0496110_0862637_467_628 53
675 3300048914 Ga0496111_0025868 Ga0496111_0025868_3548_3709 53
676 3300048914 Ga0496111_0075367 Ga0496111_0075367_882_1043 53
677 3300048914 Ga0496111_0222566 Ga0496111_0222566_530_691 53
678 3300048914 Ga0496111_0414221 Ga0496111_0414221_497_658 53
679 3300048915 Ga0496112_0077564 Ga0496112_0077564_2097_2258 53
680 3300048915 Ga0496112_0220605 Ga0496112_0220605_1487_1648 53
681 3300048915 Ga0496112_0330994 Ga0496112_0330994_325_486 53
682 3300048915 Ga0496112_0488408 Ga0496112_0488408_765_926 53
683 3300048916 Ga0496113_0015654 Ga0496113_0015654_4615_4776 53
684 3300048916 Ga0496113_0389256 Ga0496113_0389256_518_679 53
685 3300048917 Ga0496114_0000191 Ga0496114_0000191_8926_9087 53
686 3300048917 Ga0496114_0000680 Ga0496114_0000680_1264_1425 53
687 3300048917 Ga0496114_0036460 Ga0496114_0036460_2321_2482 53
688 3300048917 Ga0496114_0243715 Ga0496114_0243715_175_336 53
689 3300048918 Ga0496115_0000858 Ga0496115_0000858_6474_6635 53
690 3300048918 Ga0496115_0007950 Ga0496115_0007950_4843_5004 53
691 3300048918 Ga0496115_0017415 Ga0496115_0017415_415_576 53
692 3300048918 Ga0496115_0426270 Ga0496115_0426270_18_179 53
693 3300048918 Ga0496115_0524643 Ga0496115_0524643_723_884 53
694 3300048919 Ga0496116_0000238 Ga0496116_0000238_21421_21600 53
695 3300048919 Ga0496116_0147676 Ga0496116_0147676_351_512 53
696 3300048920 Ga0496117_0000019 Ga0496117_0000019_102770_102949 53
697 3300048920 Ga0496117_0009287 Ga0496117_0009287_7719_7880 53
698 3300048921 Ga0496118_0000020 Ga0496118_0000020_366308_366487 53
699 3300048921 Ga0496118_0009566 Ga0496118_0009566_1867_2028 53
700 3300048922 Ga0496119_0002014 Ga0496119_0002014_13046_13207 53
701 3300048922 Ga0496119_0020848 Ga0496119_0020848_2881_3042 53
702 3300048922 Ga0496119_0063658 Ga0496119_0063658_1145_1324 53
703 3300048922 Ga0496119_0409295 Ga0496119_0409295_122_283 53
704 3300048922 Ga0496119_0454464 Ga0496119_0454464_258_434 53
705 3300048923 Ga0496120_0038883 Ga0496120_0038883_1863_2024 53
706 3300048923 Ga0496120_0484311 Ga0496120_0484311_56_235 53
707 3300048924 Ga0496121_0000004 Ga0496121_0000004_810452_810613 53
708 3300048924 Ga0496121_0000064 Ga0496121_0000064_168207_168386 53
709 3300048925 Ga0496122_0000085 Ga0496122_0000085_68107_68268 53
710 3300048926 Ga0496123_0022496 Ga0496123_0022496_385_546 53
711 3300048927 Ga0496124_0000030 Ga0496124_0000030_22791_22952 53
712 3300048928 Ga0496125_0000003 Ga0496125_0000003_379155_379316 53
713 3300048929 Ga0496126_0000001 Ga0496126_0000001_810452_810613 53
714 3300048929 Ga0496126_0000668 Ga0496126_0000668_41873_42034 53
715 3300048929 Ga0496126_0148977 Ga0496126_0148977_1794_1955 53
716 3300048929 Ga0496126_0847289 Ga0496126_0847289_391_552 53
717 3300049569 Ga0501032_0026467 Ga0501032_0026467_1726_1887 53
718 3300049571 Ga0501034_0004879 Ga0501034_0004879_3245_3406 53
719 3300049571 Ga0501034_1506387 Ga0501034_1506387_259_420 53
720 3300049572 Ga0501036_0246260 Ga0501036_0246260_1058_1219 53
721 3300049573 Ga0501037_0006383 Ga0501037_0006383_1982_2143 53
722 3300049574 Ga0501038_0002452 Ga0501038_0002452_6474_6635 53
723 3300049575 Ga0501039_0000368 Ga0501039_0000368_21764_21925 53
724 3300049579 Ga0501043_0000976 Ga0501043_0000976_11057_11218 53
725 3300049581 Ga0501047_1121627 Ga0501047_1121627_74_235 53
726 3300049585 Ga0501069_0897767 Ga0501069_0897767_95_256 53
727 3300049586 Ga0501070_0040869 Ga0501070_0040869_2828_2989 53
728 3300049586 Ga0501070_0220116 Ga0501070_0220116_1197_1358 53
729 3300049589 Ga0501073_0172132 Ga0501073_0172132_672_833 53
730 3300049742 Ga0501080_0107341 Ga0501080_0107341_1342_1503 53
731 3300050489 nmdc:mga03683_189414_c1 nmdc:mga03683_189414_c1_24_185 53
732 3300050489 nmdc:mga03683_56638_c1 nmdc:mga03683_56638_c1_848_1009 53
733 3300050489 nmdc:mga03683_77071_c1 nmdc:mga03683_77071_c1_481_642 53
734 3300050490 nmdc:mga03n38_404113_c1 nmdc:mga03n38_404113_c1_375_536 53
735 3300050490 nmdc:mga03n38_422250_c1 nmdc:mga03n38_422250_c1_290_451 53
736 3300050490 nmdc:mga03n38_572947_c1 nmdc:mga03n38_572947_c1_98_259 53
737 3300050490 nmdc:mga03n38_661647_c1 nmdc:mga03n38_661647_c1_404_565 53
738 3300050490 nmdc:mga03n38_80859_c1 nmdc:mga03n38_80859_c1_1102_1263 53
739 3300050491 nmdc:mga00v17_21387_c1 nmdc:mga00v17_21387_c1_3053_3214 53
740 3300050491 nmdc:mga00v17_389413_c1 nmdc:mga00v17_389413_c1_97_258 53
741 3300050491 nmdc:mga00v17_724141_c1 nmdc:mga00v17_724141_c1_342_503 53
742 3300050491 nmdc:mga00v17_9757_c1 nmdc:mga00v17_9757_c1_4109_4270 53
743 3300050492 nmdc:mga0yw44_11851_c1 nmdc:mga0yw44_11851_c1_3112_3273 53
744 3300050492 nmdc:mga0yw44_164373_c1 nmdc:mga0yw44_164373_c1_400_561 53
745 3300050492 nmdc:mga0yw44_463577_c1 nmdc:mga0yw44_463577_c1_511_672 53
746 3300050492 nmdc:mga0yw44_753388_c1 nmdc:mga0yw44_753388_c1_70_231 53
747 3300050492 nmdc:mga0yw44_76095_c1 nmdc:mga0yw44_76095_c1_1796_1957 53
748 3300050494 nmdc:mga06z11_679669_c1 nmdc:mga06z11_679669_c1_194_355 53
749 3300050494 nmdc:mga06z11_99076_c1 nmdc:mga06z11_99076_c1_965_1126 53
750 3300050496 nmdc:mga07m45_109469_c1 nmdc:mga07m45_109469_c1_741_902 53
751 3300050496 nmdc:mga07m45_204662_c1 nmdc:mga07m45_204662_c1_83_244 53
752 3300050496 nmdc:mga07m45_283332_c1 nmdc:mga07m45_283332_c1_379_540 53
753 3300050496 nmdc:mga07m45_340665_c1 nmdc:mga07m45_340665_c1_543_704 53
754 3300050496 nmdc:mga07m45_6576_c1 nmdc:mga07m45_6576_c1_638_799 53
755 3300050509 nmdc:mga0qj67_246989_c1 nmdc:mga0qj67_246989_c1_1063_1224 53
756 3300050513 nmdc:mga0rr50_611645_c1 nmdc:mga0rr50_611645_c1_527_688 53
757 3300050516 nmdc:mga0sz30_10903_c1 nmdc:mga0sz30_10903_c1_2197_2358 53
758 3300050516 nmdc:mga0sz30_116287_c1 nmdc:mga0sz30_116287_c1_116_277 53
759 3300050516 nmdc:mga0sz30_12193_c1 nmdc:mga0sz30_12193_c1_3165_3326 53
760 3300050516 nmdc:mga0sz30_136194_c1 nmdc:mga0sz30_136194_c1_571_732 53
761 3300050516 nmdc:mga0sz30_244975_c1 nmdc:mga0sz30_244975_c1_46_207 53
762 3300050516 nmdc:mga0sz30_265077_c1 nmdc:mga0sz30_265077_c1_108_269 53
763 3300050516 nmdc:mga0sz30_305970_c1 nmdc:mga0sz30_305970_c1_140_301 53
764 3300050516 nmdc:mga0sz30_3712_c1 nmdc:mga0sz30_3712_c1_1605_1766 53
765 3300050516 nmdc:mga0sz30_413534_c1 nmdc:mga0sz30_413534_c1_304_465 53
766 3300050516 nmdc:mga0sz30_715_c2 nmdc:mga0sz30_715_c2_2889_3050 53
767 3300050516 nmdc:mga0sz30_79678_c1 nmdc:mga0sz30_79678_c1_671_832 53
768 3300053079 Ga0500610_0020120 Ga0500610_0020120_1723_1884 53
769 3300053087 Ga0500643_003798 Ga0500643_003798_862_1023 53
770 3300053088 Ga0500644_0017466 Ga0500644_0017466_1389_1550 53
771 3300053098 Ga0500650_0373112 Ga0500650_0373112_338_499 53
772 3300053104 Ga0500556_0021703 Ga0500556_0021703_1635_1796 53
773 3300053104 Ga0500556_0045515 Ga0500556_0045515_1087_1266 53
774 3300053108 Ga0500562_007101 Ga0500562_007101_860_1021 53
775 3300053122 Ga0500608_369968 Ga0500608_369968_118_291 53
776 3300053146 Ga0500588_0160108 Ga0500588_0160108_247_408 53
777 3300053153 Ga0500616_0006585 Ga0500616_0006585_6788_6949 53
778 3300053153 Ga0500616_0046613 Ga0500616_0046613_652_831 53
779 3300053727 Ga0500611_235738 Ga0500611_235738_175_336 53
780 3300061719 Ga0466962_0023472 Ga0466962_0023472_2318_2479 53

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n1q-assembly1.cif.gz_A crystal structure of a dps protein from bacillus brevis 0.9905 9 49
5ca3-assembly1.cif.gz_A crystal structure of the glycosynthase mutant d324n of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.9863 8 45
3w7t-assembly1.cif.gz_A escherichia coli k12 ygjk complexed with mannose 0.9851 8 45
5jno-assembly1.cif.gz_B crystal structure of the bd1-ntpr complex from bend3 and pich 0.9846 11 45
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.9843 9 49
ID Description Score Start End Superfamily
af_I1MN29_151_271_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.002 12 45 1.25.40.10
af_A0A1D6NXM7_295_374_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 1.001 8 52 1.20.58.180
af_Q5VRH2_276_355_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9991 8 52 1.20.58.180
af_E9QEW1_175_361_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9989 8 50 1.25.40.10
af_A4HST6_211_307_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9946 12 50 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2E7UYB9-F1-model_v4 Uncharacterized protein 1.011 8 49
AF-A0A829PH36-F1-model_v4 Uncharacterized protein 1.01 8 53
AF-A0A1H7MZB7-F1-model_v4 Uncharacterized protein 1.007 9 49
AF-A0A1F6MEJ1-F1-model_v4 Transcription elongation factor GreA/GreB N-terminal domain-containing protein 1.007 9 50
AF-A0A1C7ND58-F1-model_v4 Charged multivesicular body protein 7 1.006 9 50 GO:0000815
GO:0005771
GO:0006900
GO:0009898
GO:0032511

Feature Viewer

pLDDT pTM Quality
88.35 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map