F480468

General Info

Members Datasets Scaffolds Average Seq Length
779 416 747 413

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000544|Ga0213875_100005448
Length 438
Sequence MGSGPAASRRPGMTAAECQTNSMTNLRIDPERLWGELMETAAIGGTAKGGICRLTLTDLDRQVRDWFAARAEKLGCTVSVDDMGVMYARRAGTSDVPPIVMGSHLDTQPTGGKFDGALGVLGALEALRTMVEAGYETYAPIEVVNWTNEEGSRFTPAMLASGTFAGVFTRDWAAARRDRAGVTFGEALETIGYRGAEPCGARRLSAHFELHIEQGPILEAENIEIGAVTGVQGMRWYEVTITGQDAHTGATPMRLRKNALLGAARVVEAVEQIAQANAPLAVGTVGSMEVKPNSPNVVPGEVFFTVDLRHPEASLLDTMEQIFLREVDTVCRPLGLDVRLAKIWDQPPVRFDSDCVDAVRHAAAEAGYSVRDIVSGAGHDSAYVARVAPTAMIFVPCRGGISHNEAEFTSQEQCAMGAQVLLQAVLRYDRMLADRSKQ

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
7 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
8 2643221591 Devosia sp. Root685 Isolate Unclassified
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
11 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
12 2773857925 Microvirga vignae BR3299 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
15 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
16 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
17 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
18 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
19 2842694124 Methylopila sp. R-72369 Isolate Unclassified
20 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
21 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
22 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
23 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
24 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
25 2909042592 Labrys sp. LIt4 Isolate Nodule
26 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
27 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
28 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
268 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
269 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
345 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 641522639 Methylobacterium sp. 4-46 Isolate Nodule
415 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
416 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 0
Isolates 4.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 2.18
Rhizoplane 6.03
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000076 3300001979 Bacteria 33154
2 JGI25158J39367_1002299 3300002739 Bacteria 3145
3 JGI25152J39213_1001304 3300002773 Bacteria 11151
4 JGI25152J39213_1010362 3300002773 Bacteria 2138
5 JGI25159J45721_1001122 3300002987 Bacteria 11451
6 JGI25151J46595_10000394 3300003187 Bacteria 45418
7 JGI25153J46596_10001582 3300003215 Bacteria 13486
8 JGI25153J46596_10003331 3300003215 Bacteria 9026
9 JGI25153J46596_10009375 3300003215 Bacteria 4560
10 rootH1_10208989 3300003323 Bacteria 1793
11 JGI25160J50197_1006532 3300003354 Bacteria 4705
12 JGI25161J50226_1000107 3300003374 Bacteria 65408
13 Ga0055532_1000494 3300003758 Bacteria 17548
14 Ga0055526_1012791 3300003771 Bacteria 3622
15 Ga0055524_1012176 3300003775 Bacteria 3317
16 Ga0055528_1006645 3300003790 Bacteria 5219
17 Ga0055540_1024873 3300003792 Bacteria 1477
18 Ga0055543_1000582 3300004625 Bacteria 20167
19 Ga0065712_10067769 3300005290 Bacteria 45188
20 Ga0070676_10022031 3300005328 Bacteria 3571
21 Ga0070683_100001114 3300005329 Bacteria 20301
22 Ga0070683_100034427 3300005329 Bacteria 4627
23 Ga0070683_100082404 3300005329 Bacteria 3012
24 Ga0070690_100115331 3300005330 Bacteria 1797
25 Ga0070670_100001165 3300005331 Bacteria 20884
26 Ga0070670_100003204 3300005331 Bacteria 13509
27 Ga0070670_100025105 3300005331 Bacteria 5128
28 Ga0070670_100079322 3300005331 Bacteria 2821
29 Ga0070677_10002369 3300005333 Bacteria 6019
30 Ga0070677_10010834 3300005333 Bacteria 3129
31 Ga0070666_10008457 3300005335 Bacteria 6393
32 Ga0070680_100005216 3300005336 Bacteria 9830
33 Ga0070680_100057820 3300005336 Bacteria 3171
34 Ga0070680_100247849 3300005336 Bacteria 1506
35 Ga0070682_100118364 3300005337 Bacteria 1775
36 Ga0068868_100003512 3300005338 Bacteria 10918
37 Ga0070689_100019627 3300005340 Bacteria 4999
38 Ga0070689_100125242 3300005340 Bacteria 2056
39 Ga0070691_10039736 3300005341 Bacteria 2223
40 Ga0070668_100267313 3300005347 Bacteria 1424
41 Ga0070669_100201815 3300005353 Bacteria 1565
42 Ga0070675_100000071 3300005354 Bacteria 59417
43 Ga0070675_100094106 3300005354 Bacteria 2514
44 Ga0070675_100132395 3300005354 Bacteria 2126
45 Ga0070671_100002286 3300005355 Bacteria 14787
46 Ga0070671_100003482 3300005355 Bacteria 12282
47 Ga0070671_100089703 3300005355 Bacteria 2574
48 Ga0070674_100008781 3300005356 Bacteria 6030
49 Ga0070674_100030405 3300005356 Bacteria 3568
50 Ga0070674_100049116 3300005356 Bacteria 2900
51 Ga0070674_100051325 3300005356 Bacteria 2842
52 Ga0070673_100000149 3300005364 Bacteria 33510
53 Ga0070673_100002286 3300005364 Bacteria 11623
54 Ga0070673_100082757 3300005364 Bacteria 2606
55 Ga0070673_100284031 3300005364 Bacteria 1452
56 Ga0070688_100081022 3300005365 Bacteria 2101
57 Ga0070659_100010769 3300005366 Bacteria 6742
58 Ga0070709_10054644 3300005434 Bacteria 2518
59 Ga0070714_100010182 3300005435 Bacteria 7422
60 Ga0070714_100041674 3300005435 Unclassified 3876
61 Ga0070713_100241072 3300005436 Bacteria 1646
62 Ga0070710_10062530 3300005437 Bacteria 2124
63 Ga0070711_100032057 3300005439 Bacteria 3491
64 Ga0070705_100000143 3300005440 Bacteria 42135
65 Ga0070700_100017074 3300005441 Bacteria 4144
66 Ga0070694_100012220 3300005444 Bacteria 5334
67 Ga0070678_100000010 3300005456 Bacteria 58577
68 Ga0070678_100009904 3300005456 Bacteria 5793
69 Ga0068867_100004805 3300005459 Bacteria 9509
70 Ga0070706_100015055 3300005467 Bacteria 7143
71 Ga0070707_100198662 3300005468 Bacteria 1954
72 Ga0070698_100107185 3300005471 Bacteria 2762
73 Ga0070698_100146484 3300005471 Bacteria 2310
74 Ga0070698_100386087 3300005471 Bacteria 1333
75 Ga0070699_100002082 3300005518 Bacteria 18106
76 Ga0070699_100111107 3300005518 Bacteria 2406
77 Ga0070699_100140716 3300005518 Bacteria 2130
78 Ga0070679_100063247 3300005530 Bacteria 3689
79 Ga0070684_100021509 3300005535 Bacteria 5369
80 Ga0070684_100051132 3300005535 Bacteria 3590
81 Ga0070684_100170378 3300005535 Bacteria 1977
82 Ga0068853_100068148 3300005539 Bacteria 3093
83 Ga0068853_100256698 3300005539 Bacteria 1606
84 Ga0070672_100000312 3300005543 Bacteria 27513
85 Ga0070686_100165796 3300005544 Bacteria 1559
86 Ga0070695_100035558 3300005545 Bacteria 3130
87 Ga0070696_100003018 3300005546 Bacteria 11169
88 Ga0070696_100062774 3300005546 Unclassified 2601
89 Ga0070693_100002656 3300005547 Bacteria 8230
90 Ga0070693_100052052 3300005547 Bacteria 2346
91 Ga0070665_100095184 3300005548 Bacteria 2983
92 Ga0070665_100324164 3300005548 Bacteria 1545
93 Ga0070704_100005394 3300005549 Bacteria 7446
94 Ga0070664_100001594 3300005564 Bacteria 18144
95 Ga0068857_100002875 3300005577 Bacteria 14164
96 Ga0068857_100009471 3300005577 Bacteria 8458
97 Ga0068854_100056670 3300005578 Bacteria 2825
98 Ga0070702_100025538 3300005615 Bacteria 3167
99 Ga0068852_100091853 3300005616 Bacteria 2718
100 Ga0068852_100169573 3300005616 Bacteria 2045
101 Ga0068859_100000869 3300005617 Bacteria 30827
102 Ga0068859_100064483 3300005617 Bacteria 3696
103 Ga0068859_100100598 3300005617 Bacteria 2947
104 Ga0068864_100001555 3300005618 Bacteria 18895
105 Ga0068864_100074804 3300005618 Bacteria 2956
106 Ga0068861_100082580 3300005719 Bacteria 2519
107 Ga0068861_100085041 3300005719 Bacteria 2484
108 Ga0068861_100310716 3300005719 Bacteria 1369
109 Ga0068851_10000460 3300005834 Bacteria 17963
110 Ga0068863_100035080 3300005841 Bacteria 4778
111 Ga0068863_100126771 3300005841 Bacteria 2436
112 Ga0068863_100261937 3300005841 Bacteria 1672
113 Ga0068860_100000965 3300005843 Bacteria 31831
114 Ga0068860_100238015 3300005843 Bacteria 1770
115 Ga0068862_100002655 3300005844 Bacteria 15736
116 Ga0081455_10003599 3300005937 Bacteria 17790
117 Ga0081455_10033552 3300005937 Bacteria 4611
118 Ga0081455_10086939 3300005937 Bacteria 2545
119 Ga0081538_10007364 3300005981 Bacteria 9531
120 Ga0081538_10010571 3300005981 Bacteria 7562
121 Ga0081540_1000462 3300005983 Bacteria 40336
122 Ga0081540_1010684 3300005983 Bacteria 6191
123 Ga0081539_10009443 3300005985 Bacteria 8150
124 Ga0081539_10013124 3300005985 Bacteria 6278
125 Ga0081539_10021831 3300005985 Bacteria 4260
126 Ga0070717_10025365 3300006028 Bacteria 4713
127 Ga0075365_10005638 3300006038 Bacteria 6777
128 Ga0075368_10033338 3300006042 Bacteria 2003
129 Ga0075368_10038410 3300006042 Bacteria 1874
130 Ga0075363_100012523 3300006048 Bacteria 4093
131 Ga0070712_100159011 3300006175 Bacteria 1743
132 Ga0075362_10001115 3300006177 Bacteria 8339
133 Ga0075367_10000846 3300006178 Bacteria 12177
134 Ga0075367_10035335 3300006178 Bacteria 2892
135 Ga0075367_10060570 3300006178 Bacteria 2257
136 Ga0075366_10004394 3300006195 Bacteria 7564
137 Ga0097621_100000056 3300006237 Bacteria 59138
138 Ga0068871_100000774 3300006358 Bacteria 21535
139 Ga0075428_100001670 3300006844 Bacteria 23642
140 Ga0075428_100015143 3300006844 Bacteria 8560
141 Ga0075428_100142799 3300006844 Bacteria 2603
142 Ga0075430_100001905 3300006846 Bacteria 17105
143 Ga0075431_100000020 3300006847 Bacteria 82958
144 Ga0075431_100000201 3300006847 Bacteria 43911
145 Ga0075431_100002907 3300006847 Bacteria 16575
146 Ga0075431_100036917 3300006847 Bacteria 5033
147 Ga0075431_100144076 3300006847 Bacteria 2455
148 Ga0075434_100130212 3300006871 Bacteria 2534
149 Ga0075434_100171590 3300006871 Bacteria 2189
150 Ga0075434_100194124 3300006871 Bacteria 2051
151 Ga0075429_100007922 3300006880 Bacteria 9229
152 Ga0075429_100017086 3300006880 Bacteria 6274
153 Ga0075429_100056526 3300006880 Bacteria 3416
154 Ga0075436_100001270 3300006914 Bacteria 17140
155 Ga0097620_100000869 3300006931 Bacteria 30827
156 Ga0097620_100064479 3300006931 Bacteria 3696
157 Ga0097620_100100605 3300006931 Bacteria 2947
158 Ga0075435_100066615 3300007076 Bacteria 2930
159 Ga0075435_100095765 3300007076 Bacteria 2455
160 Ga0105240_10222301 3300009093 Bacteria 2199
161 Ga0111539_10007616 3300009094 Bacteria 13837
162 Ga0105245_10226059 3300009098 Bacteria 1808
163 Ga0114129_10000437 3300009147 Bacteria 49415
164 Ga0114129_10038882 3300009147 Bacteria 6707
165 Ga0114129_10087332 3300009147 Bacteria 4325
166 Ga0114129_10115763 3300009147 Bacteria 3695
167 Ga0114129_10201076 3300009147 Bacteria 2698
168 Ga0105241_10093328 3300009174 Bacteria 2378
169 Ga0105242_10086692 3300009176 Bacteria 2628
170 Ga0105248_10006927 3300009177 Bacteria 12422
171 Ga0105248_10449194 3300009177 Bacteria 1453
172 Ga0105237_10081456 3300009545 Bacteria 3228
173 Ga0105237_10315768 3300009545 Bacteria 1566
174 Ga0105238_10427139 3300009551 Bacteria 1320
175 Ga0105249_10102490 3300009553 Bacteria 2694
176 Ga0105239_10045357 3300010375 Bacteria 4817
177 Ga0105239_10078451 3300010375 Bacteria 3634
178 Ga0105239_10098173 3300010375 Bacteria 3237
179 Ga0105246_10019311 3300011119 Bacteria 4353
180 Ga0157370_10003214 3300013104 Bacteria 19310
181 Ga0157374_10000729 3300013296 Bacteria 28724
182 Ga0157378_10044739 3300013297 Bacteria 3932
183 Ga0163162_10002289 3300013306 Bacteria 17976
184 Ga0163162_10089770 3300013306 Bacteria 3154
185 Ga0163162_10103771 3300013306 Bacteria 2937
186 Ga0157372_10005703 3300013307 Bacteria 13253
187 Ga0157372_10129475 3300013307 Bacteria 2903
188 Ga0157372_10132123 3300013307 Bacteria 2873
189 Ga0157375_10002204 3300013308 Bacteria 16840
190 Ga0157375_10153367 3300013308 Bacteria 2441
191 Ga0157380_10062555 3300014326 Bacteria 2982
192 Ga0182008_10046213 3300014497 Bacteria 2164
193 Ga0157376_10018572 3300014969 Bacteria 5335
194 Ga0157376_10030414 3300014969 Bacteria 4311
195 Ga0157376_10131633 3300014969 Bacteria 2233
196 Ga0163161_10045977 3300017792 Bacteria 3149
197 Ga0163161_10047292 3300017792 Bacteria 3107
198 Ga0213876_10000673 3300021384 Bacteria 24333
199 Ga0213875_10000544 3300021388 Bacteria 30876
200 Ga0213875_10004901 3300021388 Bacteria 7267
201 Ga0213875_10007859 3300021388 Bacteria 5481
202 Ga0213875_10009221 3300021388 Bacteria 5007
203 Ga0209436_100011 3300025208 Bacteria 139405
204 Ga0209129_1000256 3300025258 Bacteria 55133
205 Ga0209129_1000727 3300025258 Bacteria 21221
206 Ga0209673_1003792 3300025273 Bacteria 8587
207 Ga0209130_1000081 3300025284 Bacteria 166440
208 Ga0209130_1002240 3300025284 Bacteria 10097
209 Ga0209025_1000114 3300025294 Bacteria 218921
210 Ga0209025_1003369 3300025294 Bacteria 15282
211 Ga0209564_1000225 3300025295 Bacteria 126209
212 Ga0209758_1000274 3300025297 Bacteria 102644
213 Ga0209758_1000463 3300025297 Bacteria 67158
214 Ga0209758_1001254 3300025297 Bacteria 31419
215 Ga0209758_1004307 3300025297 Bacteria 11994
216 Ga0207426_1000008 3300025302 Bacteria 848730
217 Ga0207426_1000181 3300025302 Bacteria 158308
218 Ga0209051_1015211 3300025303 Bacteria 3551
219 Ga0209257_1024367 3300025304 Bacteria 2096
220 Ga0207697_10042424 3300025315 Bacteria 1869
221 Ga0207697_10048270 3300025315 Bacteria 1756
222 Ga0207656_10000449 3300025321 Bacteria 13758
223 Ga0207682_10001278 3300025893 Bacteria 11560
224 Ga0207682_10006187 3300025893 Bacteria 4836
225 Ga0207692_10051992 3300025898 Bacteria 2080
226 Ga0207642_10113858 3300025899 Bacteria 1382
227 Ga0207680_10015536 3300025903 Bacteria 3975
228 Ga0207680_10170722 3300025903 Bacteria 1465
229 Ga0207647_10006008 3300025904 Bacteria 8847
230 Ga0207699_10050655 3300025906 Bacteria 2450
231 Ga0207645_10007946 3300025907 Bacteria 7447
232 Ga0207684_10042087 3300025910 Bacteria 3872
233 Ga0207707_10043005 3300025912 Bacteria 3942
234 Ga0207695_10019831 3300025913 Bacteria 7729
235 Ga0207693_10002435 3300025915 Bacteria 16162
236 Ga0207693_10012366 3300025915 Bacteria 6893
237 Ga0207693_10110886 3300025915 Bacteria 2151
238 Ga0207693_10165006 3300025915 Bacteria 1743
239 Ga0207660_10001466 3300025917 Bacteria 15866
240 Ga0207652_10045927 3300025921 Bacteria 3725
241 Ga0207681_10159173 3300025923 Bacteria 1700
242 Ga0207650_10000612 3300025925 Bacteria 28481
243 Ga0207650_10003218 3300025925 Bacteria 11255
244 Ga0207650_10020245 3300025925 Bacteria 4690
245 Ga0207659_10000756 3300025926 Bacteria 19182
246 Ga0207659_10039129 3300025926 Bacteria 3304
247 Ga0207700_10031471 3300025928 Bacteria 3770
248 Ga0207664_10061747 3300025929 Unclassified 2991
249 Ga0207644_10000182 3300025931 Bacteria 44971
250 Ga0207644_10005789 3300025931 Bacteria 8045
251 Ga0207644_10028334 3300025931 Bacteria 3877
252 Ga0207706_10014234 3300025933 Bacteria 7211
253 Ga0207706_10079339 3300025933 Bacteria 2887
254 Ga0207686_10164092 3300025934 Bacteria 1560
255 Ga0207670_10003938 3300025936 Bacteria 7924
256 Ga0207670_10086809 3300025936 Bacteria 2202
257 Ga0207669_10015166 3300025937 Bacteria 3879
258 Ga0207665_10027801 3300025939 Bacteria 3736
259 Ga0207691_10001156 3300025940 Bacteria 26211
260 Ga0207691_10005054 3300025940 Bacteria 12728
261 Ga0207691_10032387 3300025940 Bacteria 4873
262 Ga0207711_10015014 3300025941 Bacteria 6433
263 Ga0207689_10047865 3300025942 Bacteria 3528
264 Ga0207661_10001359 3300025944 Bacteria 16398
265 Ga0207661_10014103 3300025944 Bacteria 5849
266 Ga0207679_10004539 3300025945 Bacteria 8647
267 Ga0207679_10135078 3300025945 Bacteria 1985
268 Ga0207651_10000237 3300025960 Bacteria 23905
269 Ga0207651_10003911 3300025960 Bacteria 7393
270 Ga0207712_10001669 3300025961 Bacteria 14905
271 Ga0207668_10125597 3300025972 Bacteria 1950
272 Ga0207640_10074107 3300025981 Bacteria 2303
273 Ga0207677_10010146 3300026023 Bacteria 5321
274 Ga0207677_10060908 3300026023 Bacteria 2611
275 Ga0207639_10058282 3300026041 Bacteria 2970
276 Ga0207678_10042432 3300026067 Bacteria 3940
277 Ga0207678_10099389 3300026067 Bacteria 2485
278 Ga0207708_10007893 3300026075 Bacteria 7886
279 Ga0207708_10017644 3300026075 Bacteria 5374
280 Ga0207708_10122092 3300026075 Bacteria 2030
281 Ga0207702_10203627 3300026078 Bacteria 1836
282 Ga0207641_10082861 3300026088 Bacteria 2787
283 Ga0207641_10169682 3300026088 Bacteria 1990
284 Ga0207648_10022746 3300026089 Bacteria 5625
285 Ga0207648_10025180 3300026089 Bacteria 5305
286 Ga0207648_10051001 3300026089 Bacteria 3617
287 Ga0207648_10228141 3300026089 Bacteria 1656
288 Ga0207676_10004709 3300026095 Bacteria 9665
289 Ga0207676_10015783 3300026095 Bacteria 5460
290 Ga0207676_10016953 3300026095 Bacteria 5275
291 Ga0207674_10001607 3300026116 Bacteria 29084
292 Ga0207675_100020296 3300026118 Bacteria 6196
293 Ga0207675_100100309 3300026118 Bacteria 2727
294 Ga0207675_100105289 3300026118 Bacteria 2659
295 Ga0207683_10000429 3300026121 Bacteria 38858
296 Ga0207683_10004106 3300026121 Bacteria 12581
297 Ga0207698_10003095 3300026142 Bacteria 9984
298 Ga0207698_10251426 3300026142 Bacteria 1618
299 Ga0209371_1001447 3300027312 Bacteria 16086
300 Ga0209813_10003422 3300027866 Bacteria 3713
301 Ga0209813_10036363 3300027866 Bacteria 1479
302 Ga0268266_10178750 3300028379 Bacteria 1931
303 Ga0268265_10002137 3300028380 Bacteria 15334
304 Ga0268264_10001432 3300028381 Bacteria 22307
305 Ga0265337_1000974 3300028556 Bacteria 15013
306 Ga0265326_10000532 3300028558 Bacteria 14482
307 Ga0265319_1003936 3300028563 Bacteria 7550
308 Ga0265334_10000118 3300028573 Bacteria 51429
309 Ga0265318_10000794 3300028577 Bacteria 20891
310 Ga0265323_10000061 3300028653 Bacteria 59769
311 Ga0265336_10000312 3300028666 Bacteria 33065
312 Ga0265338_10000013 3300028800 Bacteria 379065
313 Ga0265324_10001301 3300029957 Bacteria 14649
314 Ga0268256_1000474 3300030500 Bacteria 34547
315 Ga0265330_10054590 3300031235 Bacteria 1746
316 Ga0265332_10001742 3300031238 Bacteria 11810
317 Ga0265332_10009754 3300031238 Bacteria 4285
318 Ga0265325_10004625 3300031241 Bacteria 8642
319 Ga0265325_10011637 3300031241 Bacteria 5053
320 Ga0265325_10018837 3300031241 Bacteria 3826
321 Ga0265325_10063935 3300031241 Bacteria 1861
322 Ga0265340_10002898 3300031247 Bacteria 9768
323 Ga0265340_10006865 3300031247 Bacteria 6226
324 Ga0265340_10038504 3300031247 Bacteria 2364
325 Ga0265339_10000145 3300031249 Bacteria 58275
326 Ga0265339_10004195 3300031249 Bacteria 9880
327 Ga0265339_10008849 3300031249 Bacteria 6374
328 Ga0265339_10037461 3300031249 Bacteria 2710
329 Ga0265331_10002268 3300031250 Bacteria 13147
330 Ga0265316_10036780 3300031344 Bacteria 3957
331 Ga0265316_10055308 3300031344 Bacteria 3104
332 Ga0307408_100187294 3300031548 Bacteria 1665
333 Ga0265313_10000173 3300031595 Bacteria 68499
334 Ga0265313_10024061 3300031595 Bacteria 3262
335 Ga0265313_10025642 3300031595 Bacteria 3117
336 Ga0265313_10033468 3300031595 Bacteria 2611
337 Ga0316575_10017105 3300031665 Bacteria 2751
338 Ga0265314_10004506 3300031711 Bacteria 12905
339 Ga0265314_10050991 3300031711 Bacteria 2885
340 Ga0265314_10061231 3300031711 Bacteria 2564
341 Ga0265342_10003830 3300031712 Bacteria 12110
342 Ga0265342_10014206 3300031712 Bacteria 5295
343 Ga0265342_10024919 3300031712 Bacteria 3769
344 Ga0265342_10062689 3300031712 Bacteria 2187
345 Ga0307516_10046143 3300031730 Bacteria 4301
346 Ga0307410_10029855 3300031852 Bacteria 3477
347 Ga0307409_100063204 3300031995 Bacteria 2902
348 Ga0307416_100261194 3300032002 Bacteria 1693
349 Ga0307414_10027394 3300032004 Bacteria 3682
350 Ga0307414_10044899 3300032004 Bacteria 3023
351 Ga0307414_10065737 3300032004 Bacteria 2589
352 Ga0307415_100062560 3300032126 Bacteria 2582
353 Ga0373930_0003675 3300034816 Bacteria 2452
354 Ga0373926_0030940 3300035083 Bacteria 1886
355 Ga0373944_0001411 3300035089 Bacteria 6054
356 Ga0373952_0005427 3300035092 Bacteria 2332
357 Ga0373923_0008421 3300035111 Bacteria 3676
358 Ga0373936_0006574 3300035113 Bacteria 4377
359 Ga0373945_0000996 3300035116 Bacteria 8462
360 Ga0373954_0033651 3300035118 Bacteria 2371
361 Ga0373956_0027329 3300035119 Bacteria 2477
362 Ga0373957_0011252 3300035120 Bacteria 2981
363 Ga0373943_0005000 3300035170 Bacteria 5982
364 Ga0373946_0009373 3300035171 Bacteria 3605
365 Ga0373955_0000998 3300035172 Bacteria 12004
366 Ga0373961_0017805 3300035241 Bacteria 1848
367 Ga0373924_0009058 3300035410 Bacteria 3640
368 Ga0373931_0010331 3300035691 Bacteria 4486
369 Ga0373931_0234037 3300035691 Bacteria 1111
370 Ga0373935_0005842 3300035692 Bacteria 7289
371 Ga0373935_0018325 3300035692 Bacteria 4257
372 Ga0373935_0048158 3300035692 Bacteria 2698
373 Ga0373927_0001137 3300035695 Bacteria 20140
374 Ga0373927_0025778 3300035695 Bacteria 3844
375 Ga0373927_0099374 3300035695 Bacteria 1892
376 Ga0373933_0004475 3300035724 Bacteria 7663
377 Ga0373933_0013328 3300035724 Bacteria 4555
378 Ga0373933_0051462 3300035724 Bacteria 2462
379 Ga0373947_0000866 3300035725 Bacteria 18297
380 Ga0373947_0022758 3300035725 Bacteria 3638
381 Ga0373937_0002009 3300036401 Bacteria 16986
382 Ga0373937_0019871 3300036401 Bacteria 6016
383 Ga0373925_0004518 3300037068 Bacteria 10513
384 Ga0373925_0153215 3300037068 Bacteria 1811
385 Ga0373925_0168634 3300037068 Bacteria 1727
386 Ga0395899_0021478 3300037312 Bacteria 4897
387 Ga0395900_0004380 3300037418 Bacteria 14982
388 Ga0395900_0291329 3300037418 Bacteria 1621
389 Ga0395898_0079678 3300037466 Bacteria 3159
390 Ga0395898_0142248 3300037466 Bacteria 2297
391 Ga0436364_0124138 3300037853 Bacteria 39695
392 Ga0436364_0520243 3300037853 Bacteria 17658
393 Ga0436364_0711362 3300037853 Bacteria 2583
394 Ga0436364_1064204 3300037853 Bacteria 1918
395 Ga0436364_1070065 3300037853 Bacteria 32747
396 Ga0436364_1318907 3300037853 Bacteria 7994
397 Ga0395901_0102892 3300038443 Bacteria 2997
398 Ga0436365_0007138 3300039437 Bacteria 1588
399 Ga0436365_0153483 3300039437 Bacteria 5114
400 Ga0436365_0287489 3300039437 Bacteria 4676
401 Ga0436365_0368498 3300039437 Bacteria 1525
402 Ga0436365_0402221 3300039437 Bacteria 3274
403 Ga0436365_0920278 3300039437 Bacteria 78160
404 Ga0436365_1530619 3300039437 Bacteria 1654
405 Ga0436360_1260076 3300039438 Bacteria 1660
406 Ga0436363_0945108 3300039450 Bacteria 2726
407 Ga0436363_1307388 3300039450 Bacteria 5545
408 Ga0436362_0821772 3300039453 Bacteria 3277
409 Ga0439453_0000303 3300041408 Bacteria 5113
410 Ga0439465_0012607 3300041413 Bacteria 2643
411 Ga0439443_002130 3300042003 Bacteria 2323
412 Ga0466961_0184879 3300044693 Bacteria 1293
413 Ga0466963_0075740 3300044694 Bacteria 2271
414 Ga0451576_0021895 3300045051 Bacteria 6940
415 Ga0451576_0054093 3300045051 Bacteria 4203
416 Ga0466967_0542382 3300045976 Bacteria 1144
417 Ga0495627_002437 3300046453 Bacteria 8971
418 Ga0495592_0020724 3300046454 Bacteria 5001
419 Ga0495591_001814 3300046458 Bacteria 12652
420 Ga0495629_0001678 3300046459 Bacteria 17382
421 Ga0495651_0000610 3300046462 Bacteria 27759
422 Ga0495651_0025597 3300046462 Bacteria 4594
423 Ga0495651_0127850 3300046462 Bacteria 1859
424 Ga0495653_0025224 3300046463 Bacteria 4782
425 Ga0495580_0092293 3300046472 Bacteria 2107
426 Ga0495582_0061204 3300046473 Bacteria 2079
427 Ga0495639_0103973 3300046475 Bacteria 1343
428 Ga0495662_0008776 3300046476 Bacteria 4971
429 Ga0495662_0044135 3300046476 Bacteria 2152
430 Ga0495662_0098147 3300046476 Bacteria 1432
431 Ga0495664_0016514 3300046477 Bacteria 4207
432 Ga0495664_0059336 3300046477 Bacteria 2277
433 Ga0495607_0012195 3300046501 Bacteria 5681
434 Ga0495607_0039646 3300046501 Bacteria 2812
435 Ga0495606_0001557 3300046507 Bacteria 30137
436 Ga0495606_0012545 3300046507 Bacteria 6787
437 Ga0495608_0006351 3300046511 Bacteria 8388
438 Ga0495608_0096067 3300046511 Bacteria 1914
439 Ga0495610_0001005 3300046512 Bacteria 26004
440 Ga0495610_0010487 3300046512 Bacteria 5754
441 Ga0495610_0034384 3300046512 Bacteria 2611
442 Ga0495620_0002604 3300046515 Bacteria 10435
443 Ga0495628_0062018 3300046516 Bacteria 2931
444 Ga0495628_0137743 3300046516 Bacteria 1864
445 Ga0495630_0002608 3300046517 Bacteria 12495
446 Ga0495632_0002766 3300046519 Bacteria 13029
447 Ga0495652_0036439 3300046529 Bacteria 4277
448 Ga0495654_0071769 3300046530 Bacteria 1640
449 Ga0495665_0012191 3300046531 Bacteria 4652
450 Ga0495640_0002140 3300046533 Bacteria 15784
451 Ga0495587_0006491 3300046536 Bacteria 7621
452 Ga0495587_0092621 3300046536 Bacteria 1745
453 Ga0495598_0002725 3300046537 Bacteria 3666
454 Ga0495621_0052085 3300046539 Bacteria 1466
455 Ga0495645_0087925 3300046543 Bacteria 2223
456 Ga0495645_0129786 3300046543 Bacteria 1767
457 Ga0495645_0166329 3300046543 Bacteria 1521
458 Ga0495667_0019448 3300046559 Bacteria 4582
459 Ga0495634_0006471 3300046642 Bacteria 8900
460 Ga0495634_0009370 3300046642 Bacteria 7223
461 Ga0495634_0057181 3300046642 Bacteria 2604
462 Ga0495634_0063775 3300046642 Bacteria 2444
463 Ga0495625_0085858 3300046660 Bacteria 2184
464 Ga0495635_0015802 3300046663 Bacteria 5272
465 Ga0495635_0045940 3300046663 Bacteria 3012
466 Ga0495635_0075589 3300046663 Bacteria 2307
467 Ga0495661_0000884 3300046665 Bacteria 27652
468 Ga0495657_0037776 3300046675 Bacteria 3326
469 Ga0495657_0120806 3300046675 Bacteria 1650
470 Ga0495599_0024822 3300046678 Bacteria 3749
471 Ga0495623_0010233 3300046679 Bacteria 6068
472 Ga0495623_0065686 3300046679 Bacteria 2268
473 Ga0495646_0028281 3300046680 Bacteria 3512
474 Ga0495647_0016477 3300046681 Bacteria 2602
475 Ga0495613_0019822 3300046689 Bacteria 5013
476 Ga0495613_0108184 3300046689 Bacteria 2005
477 Ga0495624_0011975 3300046690 Bacteria 5946
478 Ga0495624_0062130 3300046690 Bacteria 2338
479 Ga0495589_0001432 3300046794 Bacteria 13762
480 Ga0495600_0034059 3300046809 Bacteria 3307
481 Ga0495581_0046320 3300047315 Bacteria 2512
482 Ga0495581_0055881 3300047315 Bacteria 2278
483 Ga0495604_0000493 3300047317 Bacteria 34632
484 Ga0495604_0096244 3300047317 Bacteria 2185
485 Ga0495674_0014377 3300047319 Bacteria 7410
486 Ga0495674_0088628 3300047319 Bacteria 2646
487 Ga0495672_0119053 3300047320 Bacteria 1406
488 Ga0495676_0088524 3300047321 Bacteria 2322
489 Ga0495680_0018467 3300047322 Bacteria 5919
490 Ga0495675_0000723 3300047444 Bacteria 20653
491 Ga0495675_0074569 3300047444 Bacteria 2138
492 Ga0495679_002009 3300047446 Bacteria 10777
493 Ga0495681_0004810 3300047470 Bacteria 9148
494 Ga0495681_0022626 3300047470 Bacteria 3359
495 Ga0495681_0025078 3300047470 Bacteria 3125
496 Ga0495684_0003088 3300047471 Bacteria 13080
497 Ga0495684_0017567 3300047471 Bacteria 5506
498 Ga0495684_0021791 3300047471 Bacteria 4932
499 Ga0495686_0000301 3300047472 Bacteria 84924
500 Ga0495686_0008314 3300047472 Bacteria 7631
501 Ga0495602_0048600 3300048088 Bacteria 3810
502 Ga0496100_0001298 3300048903 Bacteria 12193
503 Ga0496100_0003349 3300048903 Bacteria 8349
504 Ga0496101_0010229 3300048904 Bacteria 6191
505 Ga0496102_0005180 3300048905 Bacteria 11067
506 Ga0496102_0035401 3300048905 Bacteria 4494
507 Ga0496102_0061264 3300048905 Bacteria 3443
508 Ga0496104_0010021 3300048907 Bacteria 8459
509 Ga0496104_0014023 3300048907 Bacteria 7232
510 Ga0496104_0035082 3300048907 Bacteria 4682
511 Ga0496104_0183507 3300048907 Bacteria 2002
512 Ga0496105_0007910 3300048908 Bacteria 8259
513 Ga0496105_0085462 3300048908 Bacteria 2606
514 Ga0496105_0140891 3300048908 Bacteria 1985
515 Ga0496106_0001584 3300048909 Bacteria 17100
516 Ga0496106_0023015 3300048909 Bacteria 4628
517 Ga0496106_0048951 3300048909 Bacteria 3184
518 Ga0496106_0155489 3300048909 Bacteria 1806
519 Ga0496107_0001180 3300048910 Bacteria 15869
520 Ga0496107_0003731 3300048910 Bacteria 10232
521 Ga0496107_0011522 3300048910 Bacteria 6160
522 Ga0496108_0000249 3300048911 Bacteria 47869
523 Ga0496108_0006169 3300048911 Bacteria 9695
524 Ga0496108_0007323 3300048911 Bacteria 8947
525 Ga0496108_0007378 3300048911 Bacteria 8914
526 Ga0496108_0282254 3300048911 Bacteria 1446
527 Ga0496109_0000754 3300048912 Bacteria 26955
528 Ga0496109_0001895 3300048912 Bacteria 17360
529 Ga0496109_0006710 3300048912 Bacteria 9689
530 Ga0496109_0016050 3300048912 Bacteria 6545
531 Ga0496109_0019466 3300048912 Bacteria 5989
532 Ga0496110_0000037 3300048913 Bacteria 64495
533 Ga0496110_0000172 3300048913 Bacteria 39832
534 Ga0496110_0001523 3300048913 Bacteria 16824
535 Ga0496110_0007225 3300048913 Bacteria 8849
536 Ga0496110_0126086 3300048913 Bacteria 2310
537 Ga0496111_0004089 3300048914 Bacteria 9165
538 Ga0496111_0004342 3300048914 Bacteria 8946
539 Ga0496111_0085144 3300048914 Bacteria 2311
540 Ga0496112_0010902 3300048915 Bacteria 8275
541 Ga0496112_0041007 3300048915 Bacteria 4528
542 Ga0496113_0027474 3300048916 Bacteria 4080
543 Ga0496113_0027772 3300048916 Bacteria 4061
544 Ga0496113_0039052 3300048916 Bacteria 3493
545 Ga0496113_0092902 3300048916 Bacteria 2328
546 Ga0496114_0020854 3300048917 Bacteria 5321
547 Ga0496115_0011903 3300048918 Bacteria 6534
548 Ga0496115_0083805 3300048918 Bacteria 2598
549 Ga0496116_0081607 3300048919 Bacteria 2004
550 Ga0496118_0010338 3300048921 Bacteria 9250
551 Ga0496119_0007536 3300048922 Bacteria 9779
552 Ga0496120_0002850 3300048923 Bacteria 16652
553 Ga0496121_0044519 3300048924 Bacteria 3827
554 Ga0496121_0143989 3300048924 Bacteria 1764
555 Ga0496124_0003272 3300048927 Bacteria 20008
556 Ga0496124_0024561 3300048927 Bacteria 5475
557 Ga0496124_0081935 3300048927 Bacteria 2650
558 Ga0496125_0002278 3300048928 Bacteria 25448
559 Ga0496126_0052724 3300048929 Bacteria 3695
560 Ga0496126_0056165 3300048929 Bacteria 3560
561 Ga0495678_008214 3300049459 Bacteria 5296
562 Ga0501032_0022335 3300049569 Bacteria 4386
563 Ga0501032_0053160 3300049569 Bacteria 2728
564 Ga0501033_0018340 3300049570 Bacteria 5287
565 Ga0501033_0056564 3300049570 Bacteria 2899
566 Ga0501034_0000439 3300049571 Bacteria 68932
567 Ga0501034_0000810 3300049571 Bacteria 46526
568 Ga0501034_0013989 3300049571 Bacteria 8259
569 Ga0501034_0019814 3300049571 Bacteria 6875
570 Ga0501034_0026979 3300049571 Bacteria 5843
571 Ga0501034_0176715 3300049571 Bacteria 2101
572 Ga0501034_0235854 3300049571 Bacteria 1777
573 Ga0501034_0347688 3300049571 Bacteria 1411
574 Ga0501036_0013370 3300049572 Bacteria 6819
575 Ga0501036_0062191 3300049572 Bacteria 3162
576 Ga0501036_0168931 3300049572 Bacteria 1843
577 Ga0501037_0011196 3300049573 Bacteria 6602
578 Ga0501037_0012720 3300049573 Bacteria 6199
579 Ga0501037_0053330 3300049573 Bacteria 2957
580 Ga0501037_0111982 3300049573 Bacteria 1965
581 Ga0501038_0002575 3300049574 Bacteria 16927
582 Ga0501038_0085541 3300049574 Bacteria 2651
583 Ga0501038_0107486 3300049574 Bacteria 2314
584 Ga0501039_0036603 3300049575 Bacteria 3788
585 Ga0501039_0047383 3300049575 Bacteria 3322
586 Ga0501039_0053273 3300049575 Bacteria 3130
587 Ga0501039_0061618 3300049575 Bacteria 2906
588 Ga0501039_0088852 3300049575 Bacteria 2407
589 Ga0501039_0245039 3300049575 Bacteria 1409
590 Ga0501039_0334705 3300049575 Bacteria 1190
591 Ga0501040_0003065 3300049576 Bacteria 10837
592 Ga0501040_0037634 3300049576 Bacteria 3288
593 Ga0501040_0082435 3300049576 Bacteria 2230
594 Ga0501041_0095615 3300049577 Bacteria 1836
595 Ga0501042_0017146 3300049578 Bacteria 4990
596 Ga0501043_0003139 3300049579 Bacteria 13681
597 Ga0501043_0041605 3300049579 Bacteria 3610
598 Ga0501043_0086433 3300049579 Bacteria 2464
599 Ga0501043_0092077 3300049579 Bacteria 2383
600 Ga0501043_0154934 3300049579 Bacteria 1792
601 Ga0501043_0277233 3300049579 Bacteria 1286
602 Ga0501046_0032611 3300049580 Bacteria 4217
603 Ga0501046_0040654 3300049580 Bacteria 3714
604 Ga0501046_0071176 3300049580 Bacteria 2702
605 Ga0501046_0169760 3300049580 Bacteria 1638
606 Ga0501047_0000073 3300049581 Bacteria 125990
607 Ga0501047_0020149 3300049581 Bacteria 6403
608 Ga0501047_0024859 3300049581 Bacteria 5751
609 Ga0501047_0153668 3300049581 Bacteria 2176
610 Ga0501047_0301531 3300049581 Bacteria 1444
611 Ga0501048_0000014 3300049582 Bacteria 75001
612 Ga0501048_0000737 3300049582 Bacteria 23982
613 Ga0501048_0045246 3300049582 Bacteria 3145
614 Ga0501067_0062323 3300049583 Bacteria 2064
615 Ga0501068_0113161 3300049584 Bacteria 1688
616 Ga0501068_0146194 3300049584 Bacteria 1484
617 Ga0501069_0002360 3300049585 Bacteria 9568
618 Ga0501069_0023850 3300049585 Bacteria 3335
619 Ga0501069_0099949 3300049585 Bacteria 1646
620 Ga0501070_0001477 3300049586 Bacteria 21037
621 Ga0501070_0009332 3300049586 Bacteria 8295
622 Ga0501070_0019243 3300049586 Bacteria 5726
623 Ga0501070_0035175 3300049586 Bacteria 4186
624 Ga0501070_0192404 3300049586 Bacteria 1676
625 Ga0501070_0200019 3300049586 Bacteria 1641
626 Ga0501071_0059959 3300049587 Bacteria 2754
627 Ga0501072_0012149 3300049588 Bacteria 6580
628 Ga0501072_0017304 3300049588 Bacteria 5540
629 Ga0501072_0035137 3300049588 Bacteria 3928
630 Ga0501072_0071395 3300049588 Bacteria 2743
631 Ga0501072_0138002 3300049588 Bacteria 1944
632 Ga0501072_0189251 3300049588 Bacteria 1642
633 Ga0501072_0201423 3300049588 Bacteria 1587
634 Ga0501073_0004868 3300049589 Bacteria 10079
635 Ga0501073_0024118 3300049589 Bacteria 4368
636 Ga0501073_0119942 3300049589 Bacteria 1823
637 Ga0501074_0011359 3300049590 Bacteria 6472
638 Ga0501074_0017979 3300049590 Bacteria 5135
639 Ga0501074_0051662 3300049590 Bacteria 2966
640 Ga0501074_0143040 3300049590 Bacteria 1710
641 Ga0501074_0175316 3300049590 Bacteria 1530
642 Ga0501075_0018520 3300049591 Bacteria 5040
643 Ga0501076_0000841 3300049592 Bacteria 19891
644 Ga0501076_0003123 3300049592 Bacteria 11544
645 Ga0501076_0025102 3300049592 Bacteria 4610
646 Ga0501076_0060113 3300049592 Bacteria 3023
647 Ga0501077_0029765 3300049593 Bacteria 3472
648 Ga0501077_0032318 3300049593 Bacteria 3331
649 Ga0501079_0011565 3300049741 Bacteria 6738
650 Ga0501079_0041719 3300049741 Bacteria 3543
651 Ga0501079_0061836 3300049741 Bacteria 2888
652 Ga0501079_0063174 3300049741 Bacteria 2857
653 Ga0501079_0076301 3300049741 Bacteria 2592
654 Ga0501079_0099588 3300049741 Bacteria 2252
655 Ga0501079_0108392 3300049741 Bacteria 2156
656 Ga0501079_0143373 3300049741 Bacteria 1861
657 Ga0501080_0004174 3300049742 Bacteria 12814
658 Ga0501080_0017561 3300049742 Bacteria 6617
659 Ga0501080_0023875 3300049742 Bacteria 5667
660 Ga0501080_0093386 3300049742 Bacteria 2794
661 Ga0501080_0173637 3300049742 Bacteria 1986
662 Ga0501081_0006654 3300049743 Bacteria 7514
663 Ga0501081_0016051 3300049743 Bacteria 4946
664 Ga0501081_0017788 3300049743 Bacteria 4711
665 Ga0501083_0000139 3300049744 Bacteria 49384
666 Ga0501083_0018040 3300049744 Bacteria 4919
667 Ga0501083_0200398 3300049744 Bacteria 1302
668 Ga0501083_0214539 3300049744 Bacteria 1254
669 Ga0501035_0001020 3300049822 Bacteria 29508
670 Ga0501035_0090676 3300049822 Bacteria 2690
671 Ga0501035_0091227 3300049822 Bacteria 2681
672 Ga0501035_0159336 3300049822 Bacteria 1954
673 Ga0501044_0010689 3300049823 Bacteria 9959
674 Ga0501044_0019808 3300049823 Bacteria 7188
675 Ga0501044_0031481 3300049823 Bacteria 5583
676 Ga0501044_0062365 3300049823 Bacteria 3810
677 Ga0501044_0144876 3300049823 Bacteria 2362
678 Ga0501044_0194296 3300049823 Bacteria 1990
679 Ga0501044_0230003 3300049823 Bacteria 1802
680 Ga0501044_0255644 3300049823 Bacteria 1691
681 Ga0501045_0002675 3300049824 Bacteria 12155
682 Ga0501045_0176141 3300049824 Bacteria 1593
683 Ga0501045_0225930 3300049824 Bacteria 1393
684 nmdc:mga03683_1555_c1 3300050489 Bacteria 6843
685 nmdc:mga03n38_5019_c1 3300050490 Bacteria 4460
686 nmdc:mga0yw44_19014_c1 3300050492 Bacteria 3778
687 nmdc:mga0yw44_45873_c1 3300050492 Bacteria 2622
688 nmdc:mga0yw44_59129_c1 3300050492 Bacteria 2344
689 nmdc:mga06z11_1311_c1 3300050494 Bacteria 9197
690 nmdc:mga04h51_17470_c1 3300050495 Bacteria 2099
691 nmdc:mga04h51_304_c1 3300050495 Bacteria 12497
692 nmdc:mga07m45_88670_c1 3300050496 Bacteria 1770
693 nmdc:mga05p37_31241_c1 3300050507 Bacteria 6505
694 nmdc:mga05p37_5052_c1 3300050507 Bacteria 15464
695 nmdc:mga09592_110940_c1 3300050508 Bacteria 2353
696 nmdc:mga09592_33207_c1 3300050508 Bacteria 4306
697 nmdc:mga0qj67_135190_c1 3300050509 Bacteria 1998
698 nmdc:mga0qj67_16983_c1 3300050509 Bacteria 5529
699 nmdc:mga0qj67_17568_c1 3300050509 Bacteria 5441
700 nmdc:mga06r32_1357_c1 3300050510 Bacteria 22092
701 nmdc:mga06r32_150494_c1 3300050510 Bacteria 2305
702 nmdc:mga06r32_2353_c1 3300050510 Bacteria 16934
703 nmdc:mga06r32_32_c1 3300050510 Bacteria 83882
704 nmdc:mga06r32_340496_c1 3300050510 Bacteria 1484
705 nmdc:mga08y16_1157_c1 3300050511 Bacteria 25991
706 nmdc:mga08y16_137340_c1 3300050511 Bacteria 2541
707 nmdc:mga08y16_16138_c1 3300050511 Bacteria 7851
708 nmdc:mga08y16_170940_c1 3300050511 Bacteria 2257
709 nmdc:mga0n895_146258_c1 3300050512 Bacteria 2393
710 nmdc:mga0rr50_123860_c1 3300050513 Bacteria 2061
711 nmdc:mga0rr50_211542_c1 3300050513 Bacteria 1598
712 nmdc:mga0rr50_70470_c1 3300050513 Bacteria 2664
713 nmdc:mga08x19_22394_c1 3300050514 Bacteria 3914
714 Ga0495601_0014404 3300053077 Bacteria 4765
715 Ga0495612_0005267 3300053078 Bacteria 5343
716 Ga0495612_0021731 3300053078 Bacteria 2574
717 Ga0500610_0018722 3300053079 Bacteria 3355
718 Ga0495595_0000433 3300053084 Bacteria 15833
719 Ga0495595_0016956 3300053084 Bacteria 3125
720 Ga0495619_0001178 3300053085 Bacteria 17227
721 Ga0495619_0024566 3300053085 Bacteria 3866
722 Ga0500651_0093660 3300053093 Bacteria 1847
723 Ga0500641_0002826 3300053096 Bacteria 6155
724 Ga0500593_006931 3300053117 Bacteria 4570
725 Ga0500618_000875 3300053125 Bacteria 16083
726 Ga0500618_002296 3300053125 Bacteria 7361
727 Ga0500658_0003580 3300053134 Bacteria 5865
728 Ga0500568_0000266 3300053139 Bacteria 44327
729 Ga0500616_0003409 3300053153 Bacteria 12184
730 Ga0500627_0046683 3300053158 Bacteria 1877
731 Ga0500636_0043152 3300053177 Bacteria 2663
732 Ga0501084_0001395 3300054114 Bacteria 19105
733 Ga0501084_0010467 3300054114 Bacteria 7665
734 Ga0501084_0025150 3300054114 Bacteria 4968
735 Ga0501084_0035864 3300054114 Bacteria 4146
736 Ga0501084_0080925 3300054114 Bacteria 2724
737 Ga0501084_0186316 3300054114 Bacteria 1751
738 Ga0501084_0215252 3300054114 Bacteria 1621
739 Ga0501082_0000106 3300060353 Bacteria 65983
740 Ga0501082_0016399 3300060353 Bacteria 6377
741 Ga0501082_0087331 3300060353 Bacteria 2691
742 Ga0501082_0139642 3300060353 Bacteria 2103
743 Ga0501082_0203591 3300060353 Bacteria 1722
744 Ga0530510_0085051 3300061734 Bacteria 2304
745 Ga0530510_0137457 3300061734 Bacteria 1799
746 Ga0530510_0157975 3300061734 Bacteria 1676
747 Ga0530510_0310192 3300061734 Bacteria 1182

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0200398 Ga0501083_0200398_248_1261 318
2 iso_pu_bacteria 2510917030 2511196297 323
3 3300045976 Ga0466967_0542382 Ga0466967_0542382_112_1125 332
4 3300003775 Ga0055524_1012176 Ga0055524_10121763 335
5 3300035691 Ga0373931_0234037 Ga0373931_0234037_22_1098 341
6 3300009551 Ga0105238_10427139 Ga0105238_104271392 343
7 3300061734 Ga0530510_0310192 Ga0530510_0310192_38_1135 346
8 3300025903 Ga0207680_10015536 Ga0207680_100155362 348
9 3300005437 Ga0070710_10062530 Ga0070710_100625301 349
10 3300049575 Ga0501039_0334705 Ga0501039_0334705_61_1137 351
11 3300049744 Ga0501083_0214539 Ga0501083_0214539_174_1244 351
12 3300049824 Ga0501045_0225930 Ga0501045_0225930_310_1380 351
13 3300046475 Ga0495639_0103973 Ga0495639_0103973_35_1138 352
14 3300047321 Ga0495676_0088524 Ga0495676_0088524_1205_2308 352
15 3300037853 Ga0436364_1064204 Ga0436364_1064204_829_1905 354
16 3300038443 Ga0395901_0102892 Ga0395901_0102892_1900_2982 356
17 3300048924 Ga0496121_0143989 Ga0496121_0143989_13_1095 356
18 3300047471 Ga0495684_0021791 Ga0495684_0021791_43_1173 361
19 3300048907 Ga0496104_0183507 Ga0496104_0183507_879_1985 364
20 3300005535 Ga0070684_100170378 Ga0070684_1001703781 366
21 3300005616 Ga0068852_100091853 Ga0068852_1000918533 366
22 3300009174 Ga0105241_10093328 Ga0105241_100933282 366
23 3300026142 Ga0207698_10251426 Ga0207698_102514262 366
24 3300049588 Ga0501072_0201423 Ga0501072_0201423_456_1571 366
25 3300005518 Ga0070699_100140716 Ga0070699_1001407162 371
26 3300025944 Ga0207661_10014103 Ga0207661_100141032 373
27 iso_pu_bacteria 2885350715 2885357253 373
28 3300005468 Ga0070707_100198662 Ga0070707_1001986622 375
29 3300035692 Ga0373935_0018325 Ga0373935_0018325_1696_2892 380
30 3300049581 Ga0501047_0153668 Ga0501047_0153668_934_2139 382
31 3300002739 JGI25158J39367_1002299 JGI25158J39367_10022993 383
32 3300002773 JGI25152J39213_1010362 JGI25152J39213_10103621 383
33 3300002987 JGI25159J45721_1001122 JGI25159J45721_100112211 383
34 3300003215 JGI25153J46596_10009375 JGI25153J46596_100093754 383
35 3300003354 JGI25160J50197_1006532 JGI25160J50197_10065322 383
36 3300003374 JGI25161J50226_1000107 JGI25161J50226_100010720 383
37 3300003771 Ga0055526_1012791 Ga0055526_10127912 383
38 3300003790 Ga0055528_1006645 Ga0055528_10066455 383
39 3300003792 Ga0055540_1024873 Ga0055540_10248731 383
40 3300004625 Ga0055543_1000582 Ga0055543_100058211 383
41 3300005337 Ga0070682_100118364 Ga0070682_1001183642 383
42 3300025208 Ga0209436_100011 Ga0209436_10001147 383
43 3300025258 Ga0209129_1000256 Ga0209129_10002569 383
44 3300025273 Ga0209673_1003792 Ga0209673_10037928 383
45 3300025284 Ga0209130_1000081 Ga0209130_1000081121 383
46 3300025295 Ga0209564_1000225 Ga0209564_100022511 383
47 3300025297 Ga0209758_1001254 Ga0209758_100125422 383
48 3300025302 Ga0207426_1000008 Ga0207426_1000008601 383
49 3300025303 Ga0209051_1015211 Ga0209051_10152114 383
50 3300025304 Ga0209257_1024367 Ga0209257_10243672 383
51 3300041413 Ga0439465_0012607 Ga0439465_0012607_1240_2478 383
52 3300053134 Ga0500658_0003580 Ga0500658_0003580_1158_2390 383
53 3300039437 Ga0436365_0368498 Ga0436365_0368498_315_1514 385
54 3300053093 Ga0500651_0093660 Ga0500651_0093660_282_1520 385
55 3300053139 Ga0500568_0000266 Ga0500568_0000266_29515_30753 385
56 iso_pu_bacteria 2842482326 2842487355 387
57 3300002773 JGI25152J39213_1001304 JGI25152J39213_10013049 389
58 3300003215 JGI25153J46596_10003331 JGI25153J46596_100033316 389
59 3300025258 Ga0209129_1000727 Ga0209129_100072712 389
60 3300025294 Ga0209025_1003369 Ga0209025_10033694 389
61 3300025297 Ga0209758_1000463 Ga0209758_100046326 389
62 3300005356 Ga0070674_100051325 Ga0070674_1000513252 390
63 3300009545 Ga0105237_10315768 Ga0105237_103157681 393
64 3300049579 Ga0501043_0277233 Ga0501043_0277233_63_1274 393
65 iso_pu_bacteria 2835312727 2835316481 393
66 iso_pu_bacteria 2894232714 2894242604 393
67 3300005353 Ga0070669_100201815 Ga0070669_1002018151 394
68 3300005471 Ga0070698_100146484 Ga0070698_1001464843 394
69 3300005518 Ga0070699_100111107 Ga0070699_1001111072 394
70 3300006880 Ga0075429_100017086 Ga0075429_1000170864 394
71 3300009147 Ga0114129_10115763 Ga0114129_101157633 394
72 3300014326 Ga0157380_10062555 Ga0157380_100625553 394
73 3300031730 Ga0307516_10046143 Ga0307516_100461432 394
74 3300045051 Ga0451576_0054093 Ga0451576_0054093_1614_2858 394
75 3300050507 nmdc:mga05p37_31241_c1 nmdc:mga05p37_31241_c1_4895_6142 394
76 3300050508 nmdc:mga09592_33207_c1 nmdc:mga09592_33207_c1_2955_4202 394
77 3300060353 Ga0501082_0139642 Ga0501082_0139642_102_1349 394
78 3300031548 Ga0307408_100187294 Ga0307408_1001872942 395
79 3300044693 Ga0466961_0184879 Ga0466961_0184879_66_1271 396
80 3300049579 Ga0501043_0154934 Ga0501043_0154934_421_1671 396
81 3300049586 Ga0501070_0192404 Ga0501070_0192404_230_1480 396
82 3300049588 Ga0501072_0138002 Ga0501072_0138002_707_1912 396
83 3300049590 Ga0501074_0175316 Ga0501074_0175316_38_1288 396
84 3300049823 Ga0501044_0255644 Ga0501044_0255644_274_1524 396
85 3300010375 Ga0105239_10078451 Ga0105239_100784513 397
86 3300025913 Ga0207695_10019831 Ga0207695_100198315 397
87 3300031247 Ga0265340_10006865 Ga0265340_100068655 397
88 3300031711 Ga0265314_10050991 Ga0265314_100509912 397
89 3300032004 Ga0307414_10044899 Ga0307414_100448993 397
90 3300035111 Ga0373923_0008421 Ga0373923_0008421_880_2118 397
91 3300035118 Ga0373954_0033651 Ga0373954_0033651_638_1876 397
92 3300035119 Ga0373956_0027329 Ga0373956_0027329_668_1906 397
93 3300035120 Ga0373957_0011252 Ga0373957_0011252_572_1810 397
94 3300035410 Ga0373924_0009058 Ga0373924_0009058_623_1861 397
95 3300035695 Ga0373927_0025778 Ga0373927_0025778_1578_2822 397
96 3300035724 Ga0373933_0004475 Ga0373933_0004475_5941_7179 397
97 3300036401 Ga0373937_0019871 Ga0373937_0019871_1761_2999 397
98 3300045051 Ga0451576_0021895 Ga0451576_0021895_5440_6750 397
99 3300046454 Ga0495592_0020724 Ga0495592_0020724_750_1988 397
100 3300046459 Ga0495629_0001678 Ga0495629_0001678_8615_9853 397
101 3300046462 Ga0495651_0000610 Ga0495651_0000610_3047_4285 397
102 3300046463 Ga0495653_0025224 Ga0495653_0025224_1570_2808 397
103 3300046476 Ga0495662_0044135 Ga0495662_0044135_890_2128 397
104 3300046477 Ga0495664_0059336 Ga0495664_0059336_811_2049 397
105 3300046511 Ga0495608_0006351 Ga0495608_0006351_3906_5144 397
106 3300046516 Ga0495628_0062018 Ga0495628_0062018_822_2060 397
107 3300046529 Ga0495652_0036439 Ga0495652_0036439_726_1964 397
108 3300046533 Ga0495640_0002140 Ga0495640_0002140_6766_8004 397
109 3300046536 Ga0495587_0006491 Ga0495587_0006491_2442_3680 397
110 3300046543 Ga0495645_0129786 Ga0495645_0129786_309_1547 397
111 3300046559 Ga0495667_0019448 Ga0495667_0019448_3248_4486 397
112 3300046642 Ga0495634_0009370 Ga0495634_0009370_473_1711 397
113 3300046663 Ga0495635_0015802 Ga0495635_0015802_1286_2524 397
114 3300046675 Ga0495657_0037776 Ga0495657_0037776_1889_3127 397
115 3300046678 Ga0495599_0024822 Ga0495599_0024822_1890_3128 397
116 3300046679 Ga0495623_0010233 Ga0495623_0010233_1573_2811 397
117 3300046680 Ga0495646_0028281 Ga0495646_0028281_504_1742 397
118 3300046689 Ga0495613_0019822 Ga0495613_0019822_1462_2700 397
119 3300046690 Ga0495624_0062130 Ga0495624_0062130_1049_2287 397
120 3300046809 Ga0495600_0034059 Ga0495600_0034059_1569_2807 397
121 3300047315 Ga0495581_0055881 Ga0495581_0055881_239_1477 397
122 3300047317 Ga0495604_0000493 Ga0495604_0000493_30120_31358 397
123 3300047319 Ga0495674_0014377 Ga0495674_0014377_4716_5954 397
124 3300047322 Ga0495680_0018467 Ga0495680_0018467_1567_2805 397
125 3300047444 Ga0495675_0000723 Ga0495675_0000723_2899_4137 397
126 3300047471 Ga0495684_0017567 Ga0495684_0017567_822_2060 397
127 3300048088 Ga0495602_0048600 Ga0495602_0048600_2460_3698 397
128 3300048929 Ga0496126_0056165 Ga0496126_0056165_2089_3351 397
129 3300053078 Ga0495612_0005267 Ga0495612_0005267_1577_2815 397
130 3300053084 Ga0495595_0016956 Ga0495595_0016956_345_1583 397
131 3300031241 Ga0265325_10063935 Ga0265325_100639352 398
132 3300048913 Ga0496110_0126086 Ga0496110_0126086_918_2171 398
133 3300049572 Ga0501036_0062191 Ga0501036_0062191_1434_2684 398
134 3300049576 Ga0501040_0003065 Ga0501040_0003065_1583_2833 398
135 3300049578 Ga0501042_0017146 Ga0501042_0017146_1244_2494 398
136 3300049582 Ga0501048_0045246 Ga0501048_0045246_1841_3091 398
137 3300049588 Ga0501072_0017304 Ga0501072_0017304_2524_3774 398
138 3300049590 Ga0501074_0017979 Ga0501074_0017979_2886_4136 398
139 3300049591 Ga0501075_0018520 Ga0501075_0018520_3642_4892 398
140 3300049592 Ga0501076_0000841 Ga0501076_0000841_12910_14160 398
141 3300049593 Ga0501077_0032318 Ga0501077_0032318_260_1510 398
142 3300049741 Ga0501079_0041719 Ga0501079_0041719_1377_2627 398
143 3300049742 Ga0501080_0017561 Ga0501080_0017561_136_1386 398
144 3300049743 Ga0501081_0006654 Ga0501081_0006654_1844_3094 398
145 3300049824 Ga0501045_0002675 Ga0501045_0002675_2271_3521 398
146 3300054114 Ga0501084_0001395 Ga0501084_0001395_16316_17566 398
147 3300060353 Ga0501082_0016399 Ga0501082_0016399_343_1593 398
148 3300061734 Ga0530510_0157975 Ga0530510_0157975_331_1581 398
149 3300005354 Ga0070675_100132395 Ga0070675_1001323952 399
150 3300005356 Ga0070674_100049116 Ga0070674_1000491163 399
151 3300005548 Ga0070665_100324164 Ga0070665_1003241641 399
152 3300006042 Ga0075368_10033338 Ga0075368_100333382 399
153 3300006048 Ga0075363_100012523 Ga0075363_1000125234 399
154 3300006178 Ga0075367_10000846 Ga0075367_100008464 399
155 3300006844 Ga0075428_100015143 Ga0075428_1000151437 399
156 3300006847 Ga0075431_100036917 Ga0075431_1000369173 399
157 3300006847 Ga0075431_100144076 Ga0075431_1001440762 399
158 3300006880 Ga0075429_100056526 Ga0075429_1000565263 399
159 3300006914 Ga0075436_100001270 Ga0075436_10000127011 399
160 3300007076 Ga0075435_100095765 Ga0075435_1000957652 399
161 3300009147 Ga0114129_10038882 Ga0114129_100388823 399
162 3300009147 Ga0114129_10087332 Ga0114129_100873324 399
163 3300026075 Ga0207708_10122092 Ga0207708_101220922 399
164 3300026118 Ga0207675_100020296 Ga0207675_1000202964 399
165 3300027866 Ga0209813_10003422 Ga0209813_100034224 399
166 3300028379 Ga0268266_10178750 Ga0268266_101787501 399
167 3300031238 Ga0265332_10001742 Ga0265332_1000174212 399
168 3300031241 Ga0265325_10018837 Ga0265325_100188374 399
169 3300031247 Ga0265340_10002898 Ga0265340_100028982 399
170 3300031247 Ga0265340_10038504 Ga0265340_100385042 399
171 3300031249 Ga0265339_10008849 Ga0265339_100088497 399
172 3300031249 Ga0265339_10037461 Ga0265339_100374612 399
173 3300031344 Ga0265316_10036780 Ga0265316_100367802 399
174 3300031711 Ga0265314_10061231 Ga0265314_100612311 399
175 3300031712 Ga0265342_10003830 Ga0265342_1000383012 399
176 3300031712 Ga0265342_10014206 Ga0265342_100142062 399
177 3300032002 Ga0307416_100261194 Ga0307416_1002611942 399
178 3300048907 Ga0496104_0014023 Ga0496104_0014023_1538_2860 399
179 3300048909 Ga0496106_0155489 Ga0496106_0155489_231_1496 399
180 3300048911 Ga0496108_0007323 Ga0496108_0007323_1602_2924 399
181 3300048912 Ga0496109_0019466 Ga0496109_0019466_183_1505 399
182 3300048913 Ga0496110_0007225 Ga0496110_0007225_1586_2908 399
183 3300048916 Ga0496113_0039052 Ga0496113_0039052_1688_3010 399
184 3300049570 Ga0501033_0056564 Ga0501033_0056564_841_2103 399
185 3300049573 Ga0501037_0011196 Ga0501037_0011196_3576_4838 399
186 3300049574 Ga0501038_0002575 Ga0501038_0002575_10471_11733 399
187 3300049575 Ga0501039_0047383 Ga0501039_0047383_1603_2862 399
188 3300049575 Ga0501039_0245039 Ga0501039_0245039_131_1393 399
189 3300049577 Ga0501041_0095615 Ga0501041_0095615_336_1595 399
190 3300049579 Ga0501043_0092077 Ga0501043_0092077_808_2070 399
191 3300049580 Ga0501046_0169760 Ga0501046_0169760_204_1463 399
192 3300049588 Ga0501072_0035137 Ga0501072_0035137_2235_3494 399
193 3300049592 Ga0501076_0025102 Ga0501076_0025102_224_1483 399
194 3300049741 Ga0501079_0143373 Ga0501079_0143373_40_1299 399
195 3300049823 Ga0501044_0031481 Ga0501044_0031481_18_1280 399
196 3300050490 nmdc:mga03n38_5019_c1 nmdc:mga03n38_5019_c1_3168_4433 399
197 3300050492 nmdc:mga0yw44_59129_c1 nmdc:mga0yw44_59129_c1_107_1372 399
198 3300050494 nmdc:mga06z11_1311_c1 nmdc:mga06z11_1311_c1_4086_5351 399
199 3300050495 nmdc:mga04h51_304_c1 nmdc:mga04h51_304_c1_2600_3865 399
200 3300050509 nmdc:mga0qj67_135190_c1 nmdc:mga0qj67_135190_c1_238_1491 399
201 3300050513 nmdc:mga0rr50_123860_c1 nmdc:mga0rr50_123860_c1_545_1807 399
202 3300050514 nmdc:mga08x19_22394_c1 nmdc:mga08x19_22394_c1_2046_3308 399
203 3300054114 Ga0501084_0035864 Ga0501084_0035864_2459_3718 399
204 3300061734 Ga0530510_0137457 Ga0530510_0137457_251_1510 399
205 iso_pu_bacteria 2524023205 2524438845 399
206 iso_pu_bacteria 2617270742 2617384692 399
207 iso_pu_bacteria 2744054633 2745074664 399
208 3300005330 Ga0070690_100115331 Ga0070690_1001153311 400
209 3300005340 Ga0070689_100019627 Ga0070689_1000196272 400
210 3300005366 Ga0070659_100010769 Ga0070659_1000107694 400
211 3300006042 Ga0075368_10038410 Ga0075368_100384101 400
212 3300006178 Ga0075367_10060570 Ga0075367_100605702 400
213 3300009093 Ga0105240_10222301 Ga0105240_102223012 400
214 3300009098 Ga0105245_10226059 Ga0105245_102260592 400
215 3300009545 Ga0105237_10081456 Ga0105237_100814562 400
216 3300013104 Ga0157370_10003214 Ga0157370_100032142 400
217 3300013307 Ga0157372_10005703 Ga0157372_100057036 400
218 3300021388 Ga0213875_10004901 Ga0213875_100049015 400
219 3300025936 Ga0207670_10086809 Ga0207670_100868092 400
220 3300026067 Ga0207678_10099389 Ga0207678_100993892 400
221 3300027866 Ga0209813_10036363 Ga0209813_100363631 400
222 3300037853 Ga0436364_1070065 Ga0436364_1070065_25034_26281 400
223 3300049571 Ga0501034_0235854 Ga0501034_0235854_420_1673 400
224 3300049588 Ga0501072_0012149 Ga0501072_0012149_584_1840 400
225 3300049742 Ga0501080_0173637 Ga0501080_0173637_36_1280 400
226 3300050492 nmdc:mga0yw44_45873_c1 nmdc:mga0yw44_45873_c1_652_1926 400
227 3300050495 nmdc:mga04h51_17470_c1 nmdc:mga04h51_17470_c1_391_1665 400
228 3300053079 Ga0500610_0018722 Ga0500610_0018722_369_1625 400
229 3300053096 Ga0500641_0002826 Ga0500641_0002826_1591_2847 400
230 3300054114 Ga0501084_0080925 Ga0501084_0080925_1122_2378 400
231 iso_pu_bacteria 3003930520 3003935982 400
232 3300003215 JGI25153J46596_10001582 JGI25153J46596_100015829 401
233 3300005331 Ga0070670_100025105 Ga0070670_1000251053 401
234 3300005331 Ga0070670_100079322 Ga0070670_1000793222 401
235 3300005333 Ga0070677_10010834 Ga0070677_100108343 401
236 3300005356 Ga0070674_100008781 Ga0070674_1000087813 401
237 3300005364 Ga0070673_100284031 Ga0070673_1002840311 401
238 3300005456 Ga0070678_100009904 Ga0070678_1000099042 401
239 3300005544 Ga0070686_100165796 Ga0070686_1001657961 401
240 3300005841 Ga0068863_100261937 Ga0068863_1002619371 401
241 3300005985 Ga0081539_10009443 Ga0081539_100094433 401
242 3300025297 Ga0209758_1000274 Ga0209758_10002744 401
243 3300025893 Ga0207682_10001278 Ga0207682_100012783 401
244 3300025903 Ga0207680_10170722 Ga0207680_101707221 401
245 3300025937 Ga0207669_10015166 Ga0207669_100151663 401
246 3300025940 Ga0207691_10005054 Ga0207691_100050544 401
247 3300026089 Ga0207648_10022746 Ga0207648_100227463 401
248 3300026121 Ga0207683_10004106 Ga0207683_100041064 401
249 3300046453 Ga0495627_002437 Ga0495627_002437_4149_5429 401
250 3300046458 Ga0495591_001814 Ga0495591_001814_4667_5947 401
251 3300046501 Ga0495607_0012195 Ga0495607_0012195_3896_5176 401
252 3300046519 Ga0495632_0002766 Ga0495632_0002766_4473_5753 401
253 3300046537 Ga0495598_0002725 Ga0495598_0002725_429_1688 401
254 3300046539 Ga0495621_0052085 Ga0495621_0052085_104_1363 401
255 3300046665 Ga0495661_0000884 Ga0495661_0000884_7722_9002 401
256 3300047470 Ga0495681_0004810 Ga0495681_0004810_3344_4624 401
257 3300060353 Ga0501082_0000106 Ga0501082_0000106_26373_27677 401
258 3300005364 Ga0070673_100082757 Ga0070673_1000827571 402
259 3300006871 Ga0075434_100171590 Ga0075434_1001715902 402
260 3300009553 Ga0105249_10102490 Ga0105249_101024903 402
261 3300025923 Ga0207681_10159173 Ga0207681_101591732 402
262 3300031238 Ga0265332_10009754 Ga0265332_100097543 402
263 3300031344 Ga0265316_10055308 Ga0265316_100553082 402
264 3300031595 Ga0265313_10024061 Ga0265313_100240613 402
265 3300031712 Ga0265342_10024919 Ga0265342_100249192 402
266 3300039437 Ga0436365_0287489 Ga0436365_0287489_1840_3105 402
267 3300048903 Ga0496100_0003349 Ga0496100_0003349_188_1447 402
268 3300050492 nmdc:mga0yw44_19014_c1 nmdc:mga0yw44_19014_c1_1878_3125 402
269 3300050496 nmdc:mga07m45_88670_c1 nmdc:mga07m45_88670_c1_244_1506 402
270 3300006178 Ga0075367_10035335 Ga0075367_100353353 403
271 3300046512 Ga0495610_0010487 Ga0495610_0010487_771_2051 403
272 3300046515 Ga0495620_0002604 Ga0495620_0002604_6436_7716 403
273 3300046530 Ga0495654_0071769 Ga0495654_0071769_48_1328 403
274 3300047470 Ga0495681_0025078 Ga0495681_0025078_1748_3028 403
275 3300049581 Ga0501047_0024859 Ga0501047_0024859_1039_2301 403
276 3300049589 Ga0501073_0004868 Ga0501073_0004868_2138_3400 403
277 iso_pu_bacteria 2545555834 2545676048 403
278 iso_pu_bacteria 3003665799 3003668294 403
279 iso_pu_bacteria 641522639 641645483 403
280 iso_pu_bacteria 643348564 643603707 403
281 3300006038 Ga0075365_10005638 Ga0075365_100056385 404
282 3300006871 Ga0075434_100194124 Ga0075434_1001941241 404
283 3300035692 Ga0373935_0048158 Ga0373935_0048158_897_2168 404
284 3300035725 Ga0373947_0022758 Ga0373947_0022758_1857_3128 404
285 3300037068 Ga0373925_0168634 Ga0373925_0168634_440_1711 404
286 3300046473 Ga0495582_0061204 Ga0495582_0061204_690_1961 404
287 3300049570 Ga0501033_0018340 Ga0501033_0018340_1129_2394 404
288 3300049823 Ga0501044_0230003 Ga0501044_0230003_293_1528 404
289 3300050512 nmdc:mga0n895_146258_c1 nmdc:mga0n895_146258_c1_1065_2333 404
290 3300050513 nmdc:mga0rr50_70470_c1 nmdc:mga0rr50_70470_c1_1200_2468 404
291 iso_pu_bacteria 2871488783 2871492010 404
292 iso_pu_bacteria 2881147464 2881153182 404
293 3300005329 Ga0070683_100082404 Ga0070683_1000824043 405
294 3300005530 Ga0070679_100063247 Ga0070679_1000632472 405
295 3300005719 Ga0068861_100082580 Ga0068861_1000825801 405
296 3300009147 Ga0114129_10201076 Ga0114129_102010762 405
297 3300039437 Ga0436365_0153483 Ga0436365_0153483_1591_2853 405
298 3300049575 Ga0501039_0088852 Ga0501039_0088852_1021_2280 405
299 3300049576 Ga0501040_0082435 Ga0501040_0082435_651_1928 405
300 3300049741 Ga0501079_0061836 Ga0501079_0061836_1184_2443 405
301 3300050510 nmdc:mga06r32_340496_c1 nmdc:mga06r32_340496_c1_106_1422 405
302 3300060353 Ga0501082_0203591 Ga0501082_0203591_18_1295 405
303 iso_pu_bacteria 2773857925 2774870079 405
304 iso_pu_bacteria 2909042592 2909043278 405
305 3300005548 Ga0070665_100095184 Ga0070665_1000951842 406
306 3300005577 Ga0068857_100002875 Ga0068857_1000028753 406
307 3300005937 Ga0081455_10003599 Ga0081455_1000359914 406
308 3300006177 Ga0075362_10001115 Ga0075362_100011156 406
309 3300025915 Ga0207693_10002435 Ga0207693_1000243510 406
310 3300025921 Ga0207652_10045927 Ga0207652_100459271 406
311 3300047320 Ga0495672_0119053 Ga0495672_0119053_25_1281 406
312 3300048919 Ga0496116_0081607 Ga0496116_0081607_272_1510 406
313 3300050489 nmdc:mga03683_1555_c1 nmdc:mga03683_1555_c1_4070_5314 406
314 iso_pu_bacteria 2842694124 2842695935 406
315 3300005331 Ga0070670_100001165 Ga0070670_1000011658 407
316 3300005355 Ga0070671_100003482 Ga0070671_10000348210 407
317 3300005364 Ga0070673_100002286 Ga0070673_1000022865 407
318 3300005365 Ga0070688_100081022 Ga0070688_1000810221 407
319 3300005439 Ga0070711_100032057 Ga0070711_1000320572 407
320 3300006028 Ga0070717_10025365 Ga0070717_100253652 407
321 3300010375 Ga0105239_10045357 Ga0105239_100453575 407
322 3300010375 Ga0105239_10098173 Ga0105239_100981734 407
323 3300014969 Ga0157376_10131633 Ga0157376_101316331 407
324 3300021388 Ga0213875_10007859 Ga0213875_100078593 407
325 3300025904 Ga0207647_10006008 Ga0207647_100060082 407
326 3300025925 Ga0207650_10003218 Ga0207650_100032184 407
327 3300025931 Ga0207644_10005789 Ga0207644_100057893 407
328 3300025945 Ga0207679_10135078 Ga0207679_101350782 407
329 3300025960 Ga0207651_10003911 Ga0207651_100039113 407
330 3300026078 Ga0207702_10203627 Ga0207702_102036272 407
331 3300028556 Ga0265337_1000974 Ga0265337_100097418 407
332 3300028558 Ga0265326_10000532 Ga0265326_100005326 407
333 3300028563 Ga0265319_1003936 Ga0265319_10039367 407
334 3300028573 Ga0265334_10000118 Ga0265334_100001182 407
335 3300028577 Ga0265318_10000794 Ga0265318_100007943 407
336 3300028653 Ga0265323_10000061 Ga0265323_1000006127 407
337 3300028666 Ga0265336_10000312 Ga0265336_1000031221 407
338 3300028800 Ga0265338_10000013 Ga0265338_10000013297 407
339 3300029957 Ga0265324_10001301 Ga0265324_100013019 407
340 3300031249 Ga0265339_10000145 Ga0265339_1000014541 407
341 3300031595 Ga0265313_10000173 Ga0265313_1000017361 407
342 3300035724 Ga0373933_0051462 Ga0373933_0051462_612_1850 407
343 3300037853 Ga0436364_0520243 Ga0436364_0520243_11478_12734 407
344 3300039437 Ga0436365_0402221 Ga0436365_0402221_822_2075 407
345 3300039438 Ga0436360_1260076 Ga0436360_1260076_315_1556 407
346 3300039450 Ga0436363_1307388 Ga0436363_1307388_466_1719 407
347 3300046462 Ga0495651_0025597 Ga0495651_0025597_328_1566 407
348 3300046511 Ga0495608_0096067 Ga0495608_0096067_103_1341 407
349 3300046512 Ga0495610_0001005 Ga0495610_0001005_3924_5165 407
350 3300046516 Ga0495628_0137743 Ga0495628_0137743_610_1848 407
351 3300046536 Ga0495587_0092621 Ga0495587_0092621_390_1628 407
352 3300046543 Ga0495645_0087925 Ga0495645_0087925_140_1378 407
353 3300046679 Ga0495623_0065686 Ga0495623_0065686_907_2145 407
354 3300047317 Ga0495604_0096244 Ga0495604_0096244_844_2082 407
355 3300047472 Ga0495686_0008314 Ga0495686_0008314_3277_4518 407
356 3300048908 Ga0496105_0140891 Ga0496105_0140891_452_1768 407
357 3300048924 Ga0496121_0044519 Ga0496121_0044519_1026_2300 407
358 3300048927 Ga0496124_0024561 Ga0496124_0024561_3150_4424 407
359 3300049459 Ga0495678_008214 Ga0495678_008214_3870_5111 407
360 3300049582 Ga0501048_0000737 Ga0501048_0000737_14663_15904 407
361 iso_pu_bacteria 2775506901 2776260590 407
362 3300003758 Ga0055532_1000494 Ga0055532_10004942 408
363 3300031995 Ga0307409_100063204 Ga0307409_1000632041 408
364 3300032126 Ga0307415_100062560 Ga0307415_1000625602 408
365 3300037068 Ga0373925_0153215 Ga0373925_0153215_108_1394 408
366 3300039450 Ga0436363_0945108 Ga0436363_0945108_142_1443 408
367 3300039453 Ga0436362_0821772 Ga0436362_0821772_245_1546 408
368 3300041408 Ga0439453_0000303 Ga0439453_0000303_250_1494 408
369 3300042003 Ga0439443_002130 Ga0439443_002130_574_1818 408
370 3300046476 Ga0495662_0008776 Ga0495662_0008776_3183_4469 408
371 3300046477 Ga0495664_0016514 Ga0495664_0016514_470_1756 408
372 3300046642 Ga0495634_0063775 Ga0495634_0063775_356_1642 408
373 3300046663 Ga0495635_0045940 Ga0495635_0045940_435_1721 408
374 iso_pu_bacteria 2842333319 2842336133 408
375 iso_pu_bacteria 2844533157 2844538136 408
376 3300005328 Ga0070676_10022031 Ga0070676_100220313 409
377 3300005329 Ga0070683_100001114 Ga0070683_10000111411 409
378 3300005331 Ga0070670_100003204 Ga0070670_1000032042 409
379 3300005333 Ga0070677_10002369 Ga0070677_100023693 409
380 3300005335 Ga0070666_10008457 Ga0070666_100084573 409
381 3300005336 Ga0070680_100057820 Ga0070680_1000578202 409
382 3300005338 Ga0068868_100003512 Ga0068868_1000035126 409
383 3300005354 Ga0070675_100000071 Ga0070675_10000007135 409
384 3300005355 Ga0070671_100002286 Ga0070671_1000022866 409
385 3300005356 Ga0070674_100030405 Ga0070674_1000304052 409
386 3300005364 Ga0070673_100000149 Ga0070673_10000014923 409
387 3300005456 Ga0070678_100000010 Ga0070678_10000001034 409
388 3300005459 Ga0068867_100004805 Ga0068867_1000048053 409
389 3300005467 Ga0070706_100015055 Ga0070706_1000150554 409
390 3300005535 Ga0070684_100021509 Ga0070684_1000215092 409
391 3300005543 Ga0070672_100000312 Ga0070672_10000031224 409
392 3300005547 Ga0070693_100052052 Ga0070693_1000520522 409
393 3300005564 Ga0070664_100001594 Ga0070664_10000159414 409
394 3300005578 Ga0068854_100056670 Ga0068854_1000566702 409
395 3300005617 Ga0068859_100100598 Ga0068859_1001005982 409
396 3300005618 Ga0068864_100001555 Ga0068864_1000015555 409
397 3300005834 Ga0068851_10000460 Ga0068851_100004605 409
398 3300005841 Ga0068863_100035080 Ga0068863_1000350804 409
399 3300006237 Ga0097621_100000056 Ga0097621_10000005642 409
400 3300006358 Ga0068871_100000774 Ga0068871_1000007745 409
401 3300006846 Ga0075430_100001905 Ga0075430_1000019056 409
402 3300006847 Ga0075431_100000201 Ga0075431_10000020116 409
403 3300006931 Ga0097620_100100605 Ga0097620_1001006052 409
404 3300009176 Ga0105242_10086692 Ga0105242_100866922 409
405 3300013296 Ga0157374_10000729 Ga0157374_1000072914 409
406 3300013297 Ga0157378_10044739 Ga0157378_100447392 409
407 3300013306 Ga0163162_10002289 Ga0163162_100022894 409
408 3300013306 Ga0163162_10103771 Ga0163162_101037712 409
409 3300013308 Ga0157375_10002204 Ga0157375_100022049 409
410 3300014969 Ga0157376_10018572 Ga0157376_100185723 409
411 3300014969 Ga0157376_10030414 Ga0157376_100304144 409
412 3300017792 Ga0163161_10047292 Ga0163161_100472922 409
413 3300025315 Ga0207697_10048270 Ga0207697_100482702 409
414 3300025321 Ga0207656_10000449 Ga0207656_100004494 409
415 3300025893 Ga0207682_10006187 Ga0207682_100061872 409
416 3300025907 Ga0207645_10007946 Ga0207645_100079467 409
417 3300025910 Ga0207684_10042087 Ga0207684_100420873 409
418 3300025912 Ga0207707_10043005 Ga0207707_100430052 409
419 3300025925 Ga0207650_10000612 Ga0207650_1000061228 409
420 3300025925 Ga0207650_10020245 Ga0207650_100202452 409
421 3300025926 Ga0207659_10000756 Ga0207659_1000075611 409
422 3300025926 Ga0207659_10039129 Ga0207659_100391293 409
423 3300025931 Ga0207644_10000182 Ga0207644_1000018227 409
424 3300025933 Ga0207706_10014234 Ga0207706_100142341 409
425 3300025934 Ga0207686_10164092 Ga0207686_101640921 409
426 3300025940 Ga0207691_10001156 Ga0207691_1000115613 409
427 3300025940 Ga0207691_10032387 Ga0207691_100323872 409
428 3300025944 Ga0207661_10001359 Ga0207661_1000135911 409
429 3300025945 Ga0207679_10004539 Ga0207679_100045395 409
430 3300025960 Ga0207651_10000237 Ga0207651_100002376 409
431 3300025981 Ga0207640_10074107 Ga0207640_100741071 409
432 3300026023 Ga0207677_10010146 Ga0207677_100101463 409
433 3300026023 Ga0207677_10060908 Ga0207677_100609081 409
434 3300026075 Ga0207708_10017644 Ga0207708_100176443 409
435 3300026088 Ga0207641_10082861 Ga0207641_100828612 409
436 3300026088 Ga0207641_10169682 Ga0207641_101696822 409
437 3300026089 Ga0207648_10025180 Ga0207648_100251804 409
438 3300026089 Ga0207648_10051001 Ga0207648_100510012 409
439 3300026089 Ga0207648_10228141 Ga0207648_102281412 409
440 3300026095 Ga0207676_10004709 Ga0207676_100047095 409
441 3300026095 Ga0207676_10016953 Ga0207676_100169534 409
442 3300026121 Ga0207683_10000429 Ga0207683_1000042914 409
443 3300026142 Ga0207698_10003095 Ga0207698_100030954 409
444 3300031235 Ga0265330_10054590 Ga0265330_100545902 409
445 3300031250 Ga0265331_10002268 Ga0265331_100022682 409
446 3300031711 Ga0265314_10004506 Ga0265314_100045062 409
447 3300031712 Ga0265342_10062689 Ga0265342_100626893 409
448 3300032004 Ga0307414_10065737 Ga0307414_100657371 409
449 3300048909 Ga0496106_0048951 Ga0496106_0048951_763_2016 409
450 3300048911 Ga0496108_0000249 Ga0496108_0000249_26529_27782 409
451 3300048911 Ga0496108_0282254 Ga0496108_0282254_77_1330 409
452 3300048912 Ga0496109_0000754 Ga0496109_0000754_4881_6134 409
453 3300048913 Ga0496110_0000037 Ga0496110_0000037_35906_37159 409
454 3300048914 Ga0496111_0085144 Ga0496111_0085144_1042_2295 409
455 3300050509 nmdc:mga0qj67_17568_c1 nmdc:mga0qj67_17568_c1_1726_2973 409
456 3300050510 nmdc:mga06r32_1357_c1 nmdc:mga06r32_1357_c1_9459_10706 409
457 3300053085 Ga0495619_0024566 Ga0495619_0024566_58_1305 409
458 3300053125 Ga0500618_002296 Ga0500618_002296_1962_3209 409
459 3300053153 Ga0500616_0003409 Ga0500616_0003409_9571_10827 409
460 iso_pu_bacteria 2508501050 2508730936 409
461 iso_pu_bacteria 2615840698 2616555933 409
462 iso_pu_bacteria 2643221651 2644289679 409
463 iso_pu_bacteria 8005682033 8005686194 409
464 3300003187 JGI25151J46595_10000394 JGI25151J46595_1000039443 410
465 3300005290 Ga0065712_10067769 Ga0065712_100677699 410
466 3300005329 Ga0070683_100034427 Ga0070683_1000344273 410
467 3300005336 Ga0070680_100005216 Ga0070680_10000521610 410
468 3300005347 Ga0070668_100267313 Ga0070668_1002673131 410
469 3300005434 Ga0070709_10054644 Ga0070709_100546441 410
470 3300005435 Ga0070714_100010182 Ga0070714_1000101821 410
471 3300005436 Ga0070713_100241072 Ga0070713_1002410721 410
472 3300005440 Ga0070705_100000143 Ga0070705_1000001436 410
473 3300005441 Ga0070700_100017074 Ga0070700_1000170744 410
474 3300005444 Ga0070694_100012220 Ga0070694_1000122206 410
475 3300005471 Ga0070698_100107185 Ga0070698_1001071853 410
476 3300005518 Ga0070699_100002082 Ga0070699_10000208217 410
477 3300005535 Ga0070684_100051132 Ga0070684_1000511323 410
478 3300005539 Ga0068853_100256698 Ga0068853_1002566981 410
479 3300005545 Ga0070695_100035558 Ga0070695_1000355583 410
480 3300005546 Ga0070696_100003018 Ga0070696_1000030187 410
481 3300005547 Ga0070693_100002656 Ga0070693_1000026566 410
482 3300005549 Ga0070704_100005394 Ga0070704_1000053949 410
483 3300005577 Ga0068857_100009471 Ga0068857_1000094715 410
484 3300005615 Ga0070702_100025538 Ga0070702_1000255383 410
485 3300005616 Ga0068852_100169573 Ga0068852_1001695732 410
486 3300005617 Ga0068859_100000869 Ga0068859_10000086912 410
487 3300005719 Ga0068861_100085041 Ga0068861_1000850413 410
488 3300005841 Ga0068863_100126771 Ga0068863_1001267712 410
489 3300005843 Ga0068860_100000965 Ga0068860_10000096510 410
490 3300005844 Ga0068862_100002655 Ga0068862_1000026554 410
491 3300006175 Ga0070712_100159011 Ga0070712_1001590111 410
492 3300006195 Ga0075366_10004394 Ga0075366_100043944 410
493 3300006847 Ga0075431_100002907 Ga0075431_1000029077 410
494 3300006880 Ga0075429_100007922 Ga0075429_1000079221 410
495 3300006931 Ga0097620_100000869 Ga0097620_10000086918 410
496 3300011119 Ga0105246_10019311 Ga0105246_100193113 410
497 3300013307 Ga0157372_10129475 Ga0157372_101294752 410
498 3300013307 Ga0157372_10132123 Ga0157372_101321232 410
499 3300014497 Ga0182008_10046213 Ga0182008_100462132 410
500 3300017792 Ga0163161_10045977 Ga0163161_100459773 410
501 3300021388 Ga0213875_10000544 Ga0213875_100005448 410
502 3300025284 Ga0209130_1002240 Ga0209130_10022406 410
503 3300025294 Ga0209025_1000114 Ga0209025_100011488 410
504 3300025297 Ga0209758_1004307 Ga0209758_100430710 410
505 3300025302 Ga0207426_1000181 Ga0207426_100018183 410
506 3300025315 Ga0207697_10042424 Ga0207697_100424242 410
507 3300025898 Ga0207692_10051992 Ga0207692_100519922 410
508 3300025906 Ga0207699_10050655 Ga0207699_100506552 410
509 3300025915 Ga0207693_10012366 Ga0207693_100123664 410
510 3300025915 Ga0207693_10110886 Ga0207693_101108862 410
511 3300025915 Ga0207693_10165006 Ga0207693_101650061 410
512 3300025917 Ga0207660_10001466 Ga0207660_100014665 410
513 3300025928 Ga0207700_10031471 Ga0207700_100314712 410
514 3300025933 Ga0207706_10079339 Ga0207706_100793392 410
515 3300025942 Ga0207689_10047865 Ga0207689_100478653 410
516 3300026067 Ga0207678_10042432 Ga0207678_100424324 410
517 3300026075 Ga0207708_10007893 Ga0207708_100078935 410
518 3300026116 Ga0207674_10001607 Ga0207674_1000160723 410
519 3300026118 Ga0207675_100105289 Ga0207675_1001052892 410
520 3300028380 Ga0268265_10002137 Ga0268265_100021374 410
521 3300028381 Ga0268264_10001432 Ga0268264_100014322 410
522 3300031241 Ga0265325_10004625 Ga0265325_100046259 410
523 3300031249 Ga0265339_10004195 Ga0265339_1000419510 410
524 3300031595 Ga0265313_10033468 Ga0265313_100334683 410
525 3300035172 Ga0373955_0000998 Ga0373955_0000998_3574_4824 410
526 3300035695 Ga0373927_0099374 Ga0373927_0099374_314_1573 410
527 3300035724 Ga0373933_0013328 Ga0373933_0013328_3162_4412 410
528 3300036401 Ga0373937_0002009 Ga0373937_0002009_12702_13952 410
529 3300037312 Ga0395899_0021478 Ga0395899_0021478_1855_3114 410
530 3300037418 Ga0395900_0004380 Ga0395900_0004380_10156_11415 410
531 3300037418 Ga0395900_0291329 Ga0395900_0291329_255_1514 410
532 3300037466 Ga0395898_0079678 Ga0395898_0079678_282_1541 410
533 3300037466 Ga0395898_0142248 Ga0395898_0142248_991_2250 410
534 3300037853 Ga0436364_0124138 Ga0436364_0124138_3161_4411 410
535 3300037853 Ga0436364_0711362 Ga0436364_0711362_281_1567 410
536 3300039437 Ga0436365_0007138 Ga0436365_0007138_26_1285 410
537 3300039437 Ga0436365_1530619 Ga0436365_1530619_385_1644 410
538 3300044694 Ga0466963_0075740 Ga0466963_0075740_208_1458 410
539 3300046462 Ga0495651_0127850 Ga0495651_0127850_33_1283 410
540 3300046501 Ga0495607_0039646 Ga0495607_0039646_1424_2704 410
541 3300046507 Ga0495606_0001557 Ga0495606_0001557_10495_11775 410
542 3300046507 Ga0495606_0012545 Ga0495606_0012545_2973_4253 410
543 3300046675 Ga0495657_0120806 Ga0495657_0120806_68_1318 410
544 3300046794 Ga0495589_0001432 Ga0495589_0001432_6384_7664 410
545 3300047444 Ga0495675_0074569 Ga0495675_0074569_377_1627 410
546 3300047446 Ga0495679_002009 Ga0495679_002009_5596_6876 410
547 3300047470 Ga0495681_0022626 Ga0495681_0022626_734_2014 410
548 3300048905 Ga0496102_0005180 Ga0496102_0005180_9641_10891 410
549 3300048909 Ga0496106_0023015 Ga0496106_0023015_2567_3817 410
550 3300048910 Ga0496107_0003731 Ga0496107_0003731_5392_6642 410
551 3300048921 Ga0496118_0010338 Ga0496118_0010338_3851_5131 410
552 3300048922 Ga0496119_0007536 Ga0496119_0007536_4145_5425 410
553 3300048923 Ga0496120_0002850 Ga0496120_0002850_3915_5195 410
554 3300048927 Ga0496124_0003272 Ga0496124_0003272_7281_8561 410
555 3300048928 Ga0496125_0002278 Ga0496125_0002278_16805_18085 410
556 3300048929 Ga0496126_0052724 Ga0496126_0052724_2250_3530 410
557 3300049569 Ga0501032_0022335 Ga0501032_0022335_638_1903 410
558 3300049571 Ga0501034_0000439 Ga0501034_0000439_53263_54534 410
559 3300049571 Ga0501034_0000810 Ga0501034_0000810_35136_36401 410
560 3300049572 Ga0501036_0013370 Ga0501036_0013370_3300_4565 410
561 3300049573 Ga0501037_0012720 Ga0501037_0012720_4064_5329 410
562 3300049573 Ga0501037_0053330 Ga0501037_0053330_1030_2301 410
563 3300049574 Ga0501038_0107486 Ga0501038_0107486_673_1944 410
564 3300049575 Ga0501039_0053273 Ga0501039_0053273_88_1359 410
565 3300049579 Ga0501043_0003139 Ga0501043_0003139_4463_5728 410
566 3300049579 Ga0501043_0086433 Ga0501043_0086433_213_1484 410
567 3300049580 Ga0501046_0032611 Ga0501046_0032611_1915_3165 410
568 3300049580 Ga0501046_0040654 Ga0501046_0040654_296_1561 410
569 3300049581 Ga0501047_0000073 Ga0501047_0000073_22407_23672 410
570 3300049582 Ga0501048_0000014 Ga0501048_0000014_69751_71016 410
571 3300049584 Ga0501068_0146194 Ga0501068_0146194_189_1439 410
572 3300049585 Ga0501069_0002360 Ga0501069_0002360_5676_6944 410
573 3300049585 Ga0501069_0023850 Ga0501069_0023850_1977_3245 410
574 3300049585 Ga0501069_0099949 Ga0501069_0099949_364_1635 410
575 3300049586 Ga0501070_0001477 Ga0501070_0001477_11412_12680 410
576 3300049586 Ga0501070_0035175 Ga0501070_0035175_2855_4120 410
577 3300049590 Ga0501074_0011359 Ga0501074_0011359_1980_3245 410
578 3300049741 Ga0501079_0076301 Ga0501079_0076301_1156_2427 410
579 3300049741 Ga0501079_0099588 Ga0501079_0099588_47_1297 410
580 3300049742 Ga0501080_0004174 Ga0501080_0004174_4494_5759 410
581 3300049743 Ga0501081_0017788 Ga0501081_0017788_1334_2584 410
582 3300049744 Ga0501083_0000139 Ga0501083_0000139_27628_28893 410
583 3300049822 Ga0501035_0001020 Ga0501035_0001020_26317_27585 410
584 3300049822 Ga0501035_0090676 Ga0501035_0090676_1080_2351 410
585 3300049823 Ga0501044_0019808 Ga0501044_0019808_4645_5910 410
586 3300049823 Ga0501044_0062365 Ga0501044_0062365_1395_2666 410
587 3300050508 nmdc:mga09592_110940_c1 nmdc:mga09592_110940_c1_1059_2309 410
588 3300050509 nmdc:mga0qj67_16983_c1 nmdc:mga0qj67_16983_c1_3492_4739 410
589 3300050510 nmdc:mga06r32_2353_c1 nmdc:mga06r32_2353_c1_9103_10353 410
590 3300053077 Ga0495601_0014404 Ga0495601_0014404_3231_4481 410
591 3300053078 Ga0495612_0021731 Ga0495612_0021731_979_2229 410
592 3300053084 Ga0495595_0000433 Ga0495595_0000433_690_1940 410
593 3300053085 Ga0495619_0001178 Ga0495619_0001178_1957_3207 410
594 3300053117 Ga0500593_006931 Ga0500593_006931_604_1860 410
595 3300054114 Ga0501084_0025150 Ga0501084_0025150_521_1771 410
596 iso_pu_bacteria 2582581316 2585334929 410
597 iso_pu_bacteria 2821443989 2821449011 410
598 iso_pu_bacteria 2945961074 2945964199 410
599 3300005340 Ga0070689_100125242 Ga0070689_1001252422 411
600 3300005341 Ga0070691_10039736 Ga0070691_100397361 411
601 3300005354 Ga0070675_100094106 Ga0070675_1000941062 411
602 3300005355 Ga0070671_100089703 Ga0070671_1000897032 411
603 3300005617 Ga0068859_100064483 Ga0068859_1000644832 411
604 3300005618 Ga0068864_100074804 Ga0068864_1000748042 411
605 3300005983 Ga0081540_1000462 Ga0081540_100046234 411
606 3300006931 Ga0097620_100064479 Ga0097620_1000644792 411
607 3300009094 Ga0111539_10007616 Ga0111539_1000761615 411
608 3300009177 Ga0105248_10006927 Ga0105248_100069279 411
609 3300009177 Ga0105248_10449194 Ga0105248_104491942 411
610 3300013306 Ga0163162_10089770 Ga0163162_100897703 411
611 3300013308 Ga0157375_10153367 Ga0157375_101533672 411
612 3300025931 Ga0207644_10028334 Ga0207644_100283342 411
613 3300025936 Ga0207670_10003938 Ga0207670_100039385 411
614 3300025939 Ga0207665_10027801 Ga0207665_100278012 411
615 3300025941 Ga0207711_10015014 Ga0207711_100150143 411
616 3300025972 Ga0207668_10125597 Ga0207668_101255972 411
617 3300026095 Ga0207676_10015783 Ga0207676_100157833 411
618 3300026118 Ga0207675_100100309 Ga0207675_1001003093 411
619 3300031665 Ga0316575_10017105 Ga0316575_100171052 411
620 3300031852 Ga0307410_10029855 Ga0307410_100298552 411
621 3300032004 Ga0307414_10027394 Ga0307414_100273941 411
622 3300034816 Ga0373930_0003675 Ga0373930_0003675_440_1702 411
623 3300035092 Ga0373952_0005427 Ga0373952_0005427_724_1986 411
624 3300035241 Ga0373961_0017805 Ga0373961_0017805_557_1819 411
625 3300035691 Ga0373931_0010331 Ga0373931_0010331_36_1298 411
626 3300046543 Ga0495645_0166329 Ga0495645_0166329_70_1332 411
627 3300048903 Ga0496100_0001298 Ga0496100_0001298_385_1659 411
628 3300048904 Ga0496101_0010229 Ga0496101_0010229_385_1659 411
629 3300048905 Ga0496102_0035401 Ga0496102_0035401_2320_3594 411
630 3300048905 Ga0496102_0061264 Ga0496102_0061264_1933_3198 411
631 3300048907 Ga0496104_0010021 Ga0496104_0010021_4227_5501 411
632 3300048908 Ga0496105_0007910 Ga0496105_0007910_2991_4265 411
633 3300048908 Ga0496105_0085462 Ga0496105_0085462_582_1847 411
634 3300048909 Ga0496106_0001584 Ga0496106_0001584_5227_6501 411
635 3300048910 Ga0496107_0001180 Ga0496107_0001180_5455_6729 411
636 3300048910 Ga0496107_0011522 Ga0496107_0011522_1231_2496 411
637 3300048911 Ga0496108_0006169 Ga0496108_0006169_6450_7724 411
638 3300048912 Ga0496109_0001895 Ga0496109_0001895_10623_11897 411
639 3300048912 Ga0496109_0016050 Ga0496109_0016050_969_2234 411
640 3300048913 Ga0496110_0000172 Ga0496110_0000172_13530_14804 411
641 3300048914 Ga0496111_0004342 Ga0496111_0004342_5442_6716 411
642 3300048915 Ga0496112_0041007 Ga0496112_0041007_999_2273 411
643 3300048916 Ga0496113_0027772 Ga0496113_0027772_2219_3493 411
644 3300048916 Ga0496113_0092902 Ga0496113_0092902_915_2177 411
645 3300048917 Ga0496114_0020854 Ga0496114_0020854_1447_2712 411
646 3300048918 Ga0496115_0011903 Ga0496115_0011903_2967_4241 411
647 3300048918 Ga0496115_0083805 Ga0496115_0083805_744_2009 411
648 3300048927 Ga0496124_0081935 Ga0496124_0081935_725_2008 411
649 3300049571 Ga0501034_0013989 Ga0501034_0013989_3448_4701 411
650 3300049571 Ga0501034_0019814 Ga0501034_0019814_4191_5465 411
651 3300049579 Ga0501043_0041605 Ga0501043_0041605_272_1546 411
652 3300049581 Ga0501047_0020149 Ga0501047_0020149_920_2173 411
653 3300049586 Ga0501070_0200019 Ga0501070_0200019_31_1305 411
654 3300049823 Ga0501044_0010689 Ga0501044_0010689_6868_8121 411
655 3300050511 nmdc:mga08y16_16138_c1 nmdc:mga08y16_16138_c1_1657_2910 411
656 3300053158 Ga0500627_0046683 Ga0500627_0046683_429_1703 411
657 iso_pu_bacteria 2617270742 2617385606 411
658 iso_pu_bacteria 2643221591 2643964909 411
659 3300005435 Ga0070714_100041674 Ga0070714_1000416742 412
660 3300005471 Ga0070698_100386087 Ga0070698_1003860871 412
661 3300005539 Ga0068853_100068148 Ga0068853_1000681483 412
662 3300005937 Ga0081455_10033552 Ga0081455_100335524 412
663 3300005981 Ga0081538_10007364 Ga0081538_100073643 412
664 3300005981 Ga0081538_10010571 Ga0081538_100105715 412
665 3300005983 Ga0081540_1010684 Ga0081540_10106848 412
666 3300005985 Ga0081539_10013124 Ga0081539_100131248 412
667 3300006844 Ga0075428_100142799 Ga0075428_1001427992 412
668 3300021388 Ga0213875_10009221 Ga0213875_100092215 412
669 3300025929 Ga0207664_10061747 Ga0207664_100617473 412
670 3300026041 Ga0207639_10058282 Ga0207639_100582822 412
671 3300037853 Ga0436364_1318907 Ga0436364_1318907_3896_5188 412
672 3300046512 Ga0495610_0034384 Ga0495610_0034384_478_1734 412
673 3300048907 Ga0496104_0035082 Ga0496104_0035082_762_2039 412
674 3300048911 Ga0496108_0007378 Ga0496108_0007378_4608_5885 412
675 3300048912 Ga0496109_0006710 Ga0496109_0006710_736_2013 412
676 3300048913 Ga0496110_0001523 Ga0496110_0001523_10773_12050 412
677 3300048914 Ga0496111_0004089 Ga0496111_0004089_1134_2411 412
678 3300048915 Ga0496112_0010902 Ga0496112_0010902_4652_5929 412
679 3300048916 Ga0496113_0027474 Ga0496113_0027474_115_1392 412
680 3300049569 Ga0501032_0053160 Ga0501032_0053160_578_1858 412
681 3300049571 Ga0501034_0347688 Ga0501034_0347688_36_1316 412
682 3300049573 Ga0501037_0111982 Ga0501037_0111982_36_1316 412
683 3300049574 Ga0501038_0085541 Ga0501038_0085541_548_1828 412
684 3300049575 Ga0501039_0061618 Ga0501039_0061618_347_1609 412
685 3300049580 Ga0501046_0071176 Ga0501046_0071176_663_1943 412
686 3300049581 Ga0501047_0301531 Ga0501047_0301531_129_1409 412
687 3300049583 Ga0501067_0062323 Ga0501067_0062323_147_1427 412
688 3300049584 Ga0501068_0113161 Ga0501068_0113161_207_1487 412
689 3300049586 Ga0501070_0019243 Ga0501070_0019243_1411_2691 412
690 3300049590 Ga0501074_0143040 Ga0501074_0143040_342_1622 412
691 3300049741 Ga0501079_0108392 Ga0501079_0108392_48_1328 412
692 3300049744 Ga0501083_0018040 Ga0501083_0018040_2007_3287 412
693 3300049822 Ga0501035_0091227 Ga0501035_0091227_916_2196 412
694 3300049822 Ga0501035_0159336 Ga0501035_0159336_639_1919 412
695 3300050510 nmdc:mga06r32_150494_c1 nmdc:mga06r32_150494_c1_719_1981 412
696 3300050511 nmdc:mga08y16_170940_c1 nmdc:mga08y16_170940_c1_585_1847 412
697 iso_pu_bacteria 2751185821 2753460224 412
698 3300003323 rootH1_10208989 rootH1_102089892 413
699 3300005336 Ga0070680_100247849 Ga0070680_1002478491 413
700 3300005719 Ga0068861_100310716 Ga0068861_1003107161 413
701 3300005985 Ga0081539_10021831 Ga0081539_100218313 413
702 3300006844 Ga0075428_100001670 Ga0075428_10000167013 413
703 3300006847 Ga0075431_100000020 Ga0075431_10000002029 413
704 3300006871 Ga0075434_100130212 Ga0075434_1001302123 413
705 3300007076 Ga0075435_100066615 Ga0075435_1000666153 413
706 3300009147 Ga0114129_10000437 Ga0114129_1000043719 413
707 3300025899 Ga0207642_10113858 Ga0207642_101138581 413
708 3300027312 Ga0209371_1001447 Ga0209371_10014473 413
709 3300030500 Ga0268256_1000474 Ga0268256_100047419 413
710 3300031241 Ga0265325_10011637 Ga0265325_100116375 413
711 3300031595 Ga0265313_10025642 Ga0265313_100256422 413
712 3300046660 Ga0495625_0085858 Ga0495625_0085858_106_1377 413
713 3300049571 Ga0501034_0176715 Ga0501034_0176715_383_1648 413
714 3300049572 Ga0501036_0168931 Ga0501036_0168931_439_1710 413
715 3300049575 Ga0501039_0036603 Ga0501039_0036603_679_1950 413
716 3300049576 Ga0501040_0037634 Ga0501040_0037634_730_1995 413
717 3300049587 Ga0501071_0059959 Ga0501071_0059959_59_1330 413
718 3300049588 Ga0501072_0189251 Ga0501072_0189251_39_1304 413
719 3300049589 Ga0501073_0119942 Ga0501073_0119942_275_1540 413
720 3300049592 Ga0501076_0003123 Ga0501076_0003123_6265_7536 413
721 3300049592 Ga0501076_0060113 Ga0501076_0060113_1169_2434 413
722 3300049593 Ga0501077_0029765 Ga0501077_0029765_504_1775 413
723 3300049741 Ga0501079_0011565 Ga0501079_0011565_4860_6131 413
724 3300049742 Ga0501080_0093386 Ga0501080_0093386_1154_2425 413
725 3300049743 Ga0501081_0016051 Ga0501081_0016051_1579_2844 413
726 3300049823 Ga0501044_0144876 Ga0501044_0144876_697_1962 413
727 3300049824 Ga0501045_0176141 Ga0501045_0176141_227_1492 413
728 3300050507 nmdc:mga05p37_5052_c1 nmdc:mga05p37_5052_c1_8453_9724 413
729 3300050510 nmdc:mga06r32_32_c1 nmdc:mga06r32_32_c1_69546_70817 413
730 3300050511 nmdc:mga08y16_1157_c1 nmdc:mga08y16_1157_c1_23352_24623 413
731 3300050511 nmdc:mga08y16_137340_c1 nmdc:mga08y16_137340_c1_301_1569 413
732 3300050513 nmdc:mga0rr50_211542_c1 nmdc:mga0rr50_211542_c1_113_1411 413
733 3300054114 Ga0501084_0010467 Ga0501084_0010467_193_1464 413
734 3300054114 Ga0501084_0186316 Ga0501084_0186316_431_1696 413
735 3300060353 Ga0501082_0087331 Ga0501082_0087331_1012_2277 413
736 3300061734 Ga0530510_0085051 Ga0530510_0085051_524_1795 413
737 3300005546 Ga0070696_100062774 Ga0070696_1000627743 414
738 3300005843 Ga0068860_100238015 Ga0068860_1002380152 414
739 3300005937 Ga0081455_10086939 Ga0081455_100869392 414
740 3300025961 Ga0207712_10001669 Ga0207712_100016698 414
741 3300035083 Ga0373926_0030940 Ga0373926_0030940_359_1669 414
742 3300035089 Ga0373944_0001411 Ga0373944_0001411_2709_4019 414
743 3300035113 Ga0373936_0006574 Ga0373936_0006574_1985_3295 414
744 3300035116 Ga0373945_0000996 Ga0373945_0000996_4088_5398 414
745 3300035170 Ga0373943_0005000 Ga0373943_0005000_543_1853 414
746 3300035171 Ga0373946_0009373 Ga0373946_0009373_1932_3242 414
747 3300035692 Ga0373935_0005842 Ga0373935_0005842_3914_5224 414
748 3300035695 Ga0373927_0001137 Ga0373927_0001137_12229_13539 414
749 3300035725 Ga0373947_0000866 Ga0373947_0000866_4548_5858 414
750 3300037068 Ga0373925_0004518 Ga0373925_0004518_4327_5637 414
751 3300046472 Ga0495580_0092293 Ga0495580_0092293_621_1931 414
752 3300046476 Ga0495662_0098147 Ga0495662_0098147_51_1361 414
753 3300046517 Ga0495630_0002608 Ga0495630_0002608_6799_8109 414
754 3300046531 Ga0495665_0012191 Ga0495665_0012191_921_2231 414
755 3300046642 Ga0495634_0006471 Ga0495634_0006471_3992_5302 414
756 3300046642 Ga0495634_0057181 Ga0495634_0057181_870_2180 414
757 3300046663 Ga0495635_0075589 Ga0495635_0075589_468_1778 414
758 3300046681 Ga0495647_0016477 Ga0495647_0016477_534_1844 414
759 3300046689 Ga0495613_0108184 Ga0495613_0108184_456_1766 414
760 3300046690 Ga0495624_0011975 Ga0495624_0011975_902_2212 414
761 3300047315 Ga0495581_0046320 Ga0495581_0046320_866_2176 414
762 3300047319 Ga0495674_0088628 Ga0495674_0088628_1032_2342 414
763 3300047471 Ga0495684_0003088 Ga0495684_0003088_8513_9823 414
764 3300049571 Ga0501034_0026979 Ga0501034_0026979_926_2215 414
765 3300049586 Ga0501070_0009332 Ga0501070_0009332_1285_2574 414
766 3300049588 Ga0501072_0071395 Ga0501072_0071395_447_1736 414
767 3300049589 Ga0501073_0024118 Ga0501073_0024118_2301_3590 414
768 3300049590 Ga0501074_0051662 Ga0501074_0051662_1660_2949 414
769 3300049741 Ga0501079_0063174 Ga0501079_0063174_200_1489 414
770 3300049742 Ga0501080_0023875 Ga0501080_0023875_3024_4313 414
771 3300049823 Ga0501044_0194296 Ga0501044_0194296_255_1544 414
772 3300053177 Ga0500636_0043152 Ga0500636_0043152_506_1750 414
773 3300054114 Ga0501084_0215252 Ga0501084_0215252_212_1495 414
774 iso_pu_bacteria 2775507266 2778178008 415
775 3300021384 Ga0213876_10000673 Ga0213876_100006738 417
776 3300039437 Ga0436365_0920278 Ga0436365_0920278_22317_23579 417
777 3300047472 Ga0495686_0000301 Ga0495686_0000301_81755_83041 417
778 3300001979 JGI24740J21852_10000076 JGI24740J21852_1000007639 420
779 3300053125 Ga0500618_000875 Ga0500618_000875_983_2245 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

100

427

0.95

PF04389

Peptidase_M28

Peptidase family M28

86

198

0.81

PF07687

M20_dimer

Peptidase dimerisation domain

229

333

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tp4-assembly1.cif.gz_A crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9584 5 412
5tp4-assembly1.cif.gz_B crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9465 5 412
5tp4-assembly1.cif.gz_A crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9401 5 412
4wjb-assembly1.cif.gz_D x-ray crystal structure of a putative amidohydrolase/peptidase from burkholderia cenocepacia 0.9394 4 415
5thw-assembly2.cif.gz_D crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia multivorans 0.938 5 416
ID Description Score Start End Superfamily
5tp4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.96 217 327 3.30.70.360
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9561 217 329 3.30.70.360
5i4mB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9436 1 416 3.40.630.10
af_Q655X8_256_387_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9395 217 330 3.40.630.10
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9386 217 330 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A356HR59-F1-model_v4 deleted 0.9825 4 131
AF-A0A536UMS7-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9817 6 161 GO:0016813
AF-A0A2M9G9E3-F1-model_v4 Zn-dependent hydrolase 0.9795 4 412 GO:0016813
GO:0046872
AF-X1QY92-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.979 3 127 GO:0016813
AF-A0A7C7YXV9-F1-model_v4 Zn-dependent hydrolase 0.9741 7 415 GO:0016813
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.3 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map