F480468
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 779 | 416 | 747 | 413 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000544|Ga0213875_100005448 |
| Length | 438 |
| Sequence | MGSGPAASRRPGMTAAECQTNSMTNLRIDPERLWGELMETAAIGGTAKGGICRLTLTDLDRQVRDWFAARAEKLGCTVSVDDMGVMYARRAGTSDVPPIVMGSHLDTQPTGGKFDGALGVLGALEALRTMVEAGYETYAPIEVVNWTNEEGSRFTPAMLASGTFAGVFTRDWAAARRDRAGVTFGEALETIGYRGAEPCGARRLSAHFELHIEQGPILEAENIEIGAVTGVQGMRWYEVTITGQDAHTGATPMRLRKNALLGAARVVEAVEQIAQANAPLAVGTVGSMEVKPNSPNVVPGEVFFTVDLRHPEASLLDTMEQIFLREVDTVCRPLGLDVRLAKIWDQPPVRFDSDCVDAVRHAAAEAGYSVRDIVSGAGHDSAYVARVAPTAMIFVPCRGGISHNEAEFTSQEQCAMGAQVLLQAVLRYDRMLADRSKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 5 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 6 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 7 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 8 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 9 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 10 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 11 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 12 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 13 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 14 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 15 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 16 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 17 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 18 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 19 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 20 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 21 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 22 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 23 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 24 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 25 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 26 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 27 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 28 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 38 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 268 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 269 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 344 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 345 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 405 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 415 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 416 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.89 |
| Metatranscriptomes | 0 |
| Isolates | 4.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.22 |
| Nodule | 2.18 |
| Rhizoplane | 6.03 |
| Rhizosphere | 77.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000076 | 3300001979 | Bacteria | 33154 |
| 2 | JGI25158J39367_1002299 | 3300002739 | Bacteria | 3145 |
| 3 | JGI25152J39213_1001304 | 3300002773 | Bacteria | 11151 |
| 4 | JGI25152J39213_1010362 | 3300002773 | Bacteria | 2138 |
| 5 | JGI25159J45721_1001122 | 3300002987 | Bacteria | 11451 |
| 6 | JGI25151J46595_10000394 | 3300003187 | Bacteria | 45418 |
| 7 | JGI25153J46596_10001582 | 3300003215 | Bacteria | 13486 |
| 8 | JGI25153J46596_10003331 | 3300003215 | Bacteria | 9026 |
| 9 | JGI25153J46596_10009375 | 3300003215 | Bacteria | 4560 |
| 10 | rootH1_10208989 | 3300003323 | Bacteria | 1793 |
| 11 | JGI25160J50197_1006532 | 3300003354 | Bacteria | 4705 |
| 12 | JGI25161J50226_1000107 | 3300003374 | Bacteria | 65408 |
| 13 | Ga0055532_1000494 | 3300003758 | Bacteria | 17548 |
| 14 | Ga0055526_1012791 | 3300003771 | Bacteria | 3622 |
| 15 | Ga0055524_1012176 | 3300003775 | Bacteria | 3317 |
| 16 | Ga0055528_1006645 | 3300003790 | Bacteria | 5219 |
| 17 | Ga0055540_1024873 | 3300003792 | Bacteria | 1477 |
| 18 | Ga0055543_1000582 | 3300004625 | Bacteria | 20167 |
| 19 | Ga0065712_10067769 | 3300005290 | Bacteria | 45188 |
| 20 | Ga0070676_10022031 | 3300005328 | Bacteria | 3571 |
| 21 | Ga0070683_100001114 | 3300005329 | Bacteria | 20301 |
| 22 | Ga0070683_100034427 | 3300005329 | Bacteria | 4627 |
| 23 | Ga0070683_100082404 | 3300005329 | Bacteria | 3012 |
| 24 | Ga0070690_100115331 | 3300005330 | Bacteria | 1797 |
| 25 | Ga0070670_100001165 | 3300005331 | Bacteria | 20884 |
| 26 | Ga0070670_100003204 | 3300005331 | Bacteria | 13509 |
| 27 | Ga0070670_100025105 | 3300005331 | Bacteria | 5128 |
| 28 | Ga0070670_100079322 | 3300005331 | Bacteria | 2821 |
| 29 | Ga0070677_10002369 | 3300005333 | Bacteria | 6019 |
| 30 | Ga0070677_10010834 | 3300005333 | Bacteria | 3129 |
| 31 | Ga0070666_10008457 | 3300005335 | Bacteria | 6393 |
| 32 | Ga0070680_100005216 | 3300005336 | Bacteria | 9830 |
| 33 | Ga0070680_100057820 | 3300005336 | Bacteria | 3171 |
| 34 | Ga0070680_100247849 | 3300005336 | Bacteria | 1506 |
| 35 | Ga0070682_100118364 | 3300005337 | Bacteria | 1775 |
| 36 | Ga0068868_100003512 | 3300005338 | Bacteria | 10918 |
| 37 | Ga0070689_100019627 | 3300005340 | Bacteria | 4999 |
| 38 | Ga0070689_100125242 | 3300005340 | Bacteria | 2056 |
| 39 | Ga0070691_10039736 | 3300005341 | Bacteria | 2223 |
| 40 | Ga0070668_100267313 | 3300005347 | Bacteria | 1424 |
| 41 | Ga0070669_100201815 | 3300005353 | Bacteria | 1565 |
| 42 | Ga0070675_100000071 | 3300005354 | Bacteria | 59417 |
| 43 | Ga0070675_100094106 | 3300005354 | Bacteria | 2514 |
| 44 | Ga0070675_100132395 | 3300005354 | Bacteria | 2126 |
| 45 | Ga0070671_100002286 | 3300005355 | Bacteria | 14787 |
| 46 | Ga0070671_100003482 | 3300005355 | Bacteria | 12282 |
| 47 | Ga0070671_100089703 | 3300005355 | Bacteria | 2574 |
| 48 | Ga0070674_100008781 | 3300005356 | Bacteria | 6030 |
| 49 | Ga0070674_100030405 | 3300005356 | Bacteria | 3568 |
| 50 | Ga0070674_100049116 | 3300005356 | Bacteria | 2900 |
| 51 | Ga0070674_100051325 | 3300005356 | Bacteria | 2842 |
| 52 | Ga0070673_100000149 | 3300005364 | Bacteria | 33510 |
| 53 | Ga0070673_100002286 | 3300005364 | Bacteria | 11623 |
| 54 | Ga0070673_100082757 | 3300005364 | Bacteria | 2606 |
| 55 | Ga0070673_100284031 | 3300005364 | Bacteria | 1452 |
| 56 | Ga0070688_100081022 | 3300005365 | Bacteria | 2101 |
| 57 | Ga0070659_100010769 | 3300005366 | Bacteria | 6742 |
| 58 | Ga0070709_10054644 | 3300005434 | Bacteria | 2518 |
| 59 | Ga0070714_100010182 | 3300005435 | Bacteria | 7422 |
| 60 | Ga0070714_100041674 | 3300005435 | Unclassified | 3876 |
| 61 | Ga0070713_100241072 | 3300005436 | Bacteria | 1646 |
| 62 | Ga0070710_10062530 | 3300005437 | Bacteria | 2124 |
| 63 | Ga0070711_100032057 | 3300005439 | Bacteria | 3491 |
| 64 | Ga0070705_100000143 | 3300005440 | Bacteria | 42135 |
| 65 | Ga0070700_100017074 | 3300005441 | Bacteria | 4144 |
| 66 | Ga0070694_100012220 | 3300005444 | Bacteria | 5334 |
| 67 | Ga0070678_100000010 | 3300005456 | Bacteria | 58577 |
| 68 | Ga0070678_100009904 | 3300005456 | Bacteria | 5793 |
| 69 | Ga0068867_100004805 | 3300005459 | Bacteria | 9509 |
| 70 | Ga0070706_100015055 | 3300005467 | Bacteria | 7143 |
| 71 | Ga0070707_100198662 | 3300005468 | Bacteria | 1954 |
| 72 | Ga0070698_100107185 | 3300005471 | Bacteria | 2762 |
| 73 | Ga0070698_100146484 | 3300005471 | Bacteria | 2310 |
| 74 | Ga0070698_100386087 | 3300005471 | Bacteria | 1333 |
| 75 | Ga0070699_100002082 | 3300005518 | Bacteria | 18106 |
| 76 | Ga0070699_100111107 | 3300005518 | Bacteria | 2406 |
| 77 | Ga0070699_100140716 | 3300005518 | Bacteria | 2130 |
| 78 | Ga0070679_100063247 | 3300005530 | Bacteria | 3689 |
| 79 | Ga0070684_100021509 | 3300005535 | Bacteria | 5369 |
| 80 | Ga0070684_100051132 | 3300005535 | Bacteria | 3590 |
| 81 | Ga0070684_100170378 | 3300005535 | Bacteria | 1977 |
| 82 | Ga0068853_100068148 | 3300005539 | Bacteria | 3093 |
| 83 | Ga0068853_100256698 | 3300005539 | Bacteria | 1606 |
| 84 | Ga0070672_100000312 | 3300005543 | Bacteria | 27513 |
| 85 | Ga0070686_100165796 | 3300005544 | Bacteria | 1559 |
| 86 | Ga0070695_100035558 | 3300005545 | Bacteria | 3130 |
| 87 | Ga0070696_100003018 | 3300005546 | Bacteria | 11169 |
| 88 | Ga0070696_100062774 | 3300005546 | Unclassified | 2601 |
| 89 | Ga0070693_100002656 | 3300005547 | Bacteria | 8230 |
| 90 | Ga0070693_100052052 | 3300005547 | Bacteria | 2346 |
| 91 | Ga0070665_100095184 | 3300005548 | Bacteria | 2983 |
| 92 | Ga0070665_100324164 | 3300005548 | Bacteria | 1545 |
| 93 | Ga0070704_100005394 | 3300005549 | Bacteria | 7446 |
| 94 | Ga0070664_100001594 | 3300005564 | Bacteria | 18144 |
| 95 | Ga0068857_100002875 | 3300005577 | Bacteria | 14164 |
| 96 | Ga0068857_100009471 | 3300005577 | Bacteria | 8458 |
| 97 | Ga0068854_100056670 | 3300005578 | Bacteria | 2825 |
| 98 | Ga0070702_100025538 | 3300005615 | Bacteria | 3167 |
| 99 | Ga0068852_100091853 | 3300005616 | Bacteria | 2718 |
| 100 | Ga0068852_100169573 | 3300005616 | Bacteria | 2045 |
| 101 | Ga0068859_100000869 | 3300005617 | Bacteria | 30827 |
| 102 | Ga0068859_100064483 | 3300005617 | Bacteria | 3696 |
| 103 | Ga0068859_100100598 | 3300005617 | Bacteria | 2947 |
| 104 | Ga0068864_100001555 | 3300005618 | Bacteria | 18895 |
| 105 | Ga0068864_100074804 | 3300005618 | Bacteria | 2956 |
| 106 | Ga0068861_100082580 | 3300005719 | Bacteria | 2519 |
| 107 | Ga0068861_100085041 | 3300005719 | Bacteria | 2484 |
| 108 | Ga0068861_100310716 | 3300005719 | Bacteria | 1369 |
| 109 | Ga0068851_10000460 | 3300005834 | Bacteria | 17963 |
| 110 | Ga0068863_100035080 | 3300005841 | Bacteria | 4778 |
| 111 | Ga0068863_100126771 | 3300005841 | Bacteria | 2436 |
| 112 | Ga0068863_100261937 | 3300005841 | Bacteria | 1672 |
| 113 | Ga0068860_100000965 | 3300005843 | Bacteria | 31831 |
| 114 | Ga0068860_100238015 | 3300005843 | Bacteria | 1770 |
| 115 | Ga0068862_100002655 | 3300005844 | Bacteria | 15736 |
| 116 | Ga0081455_10003599 | 3300005937 | Bacteria | 17790 |
| 117 | Ga0081455_10033552 | 3300005937 | Bacteria | 4611 |
| 118 | Ga0081455_10086939 | 3300005937 | Bacteria | 2545 |
| 119 | Ga0081538_10007364 | 3300005981 | Bacteria | 9531 |
| 120 | Ga0081538_10010571 | 3300005981 | Bacteria | 7562 |
| 121 | Ga0081540_1000462 | 3300005983 | Bacteria | 40336 |
| 122 | Ga0081540_1010684 | 3300005983 | Bacteria | 6191 |
| 123 | Ga0081539_10009443 | 3300005985 | Bacteria | 8150 |
| 124 | Ga0081539_10013124 | 3300005985 | Bacteria | 6278 |
| 125 | Ga0081539_10021831 | 3300005985 | Bacteria | 4260 |
| 126 | Ga0070717_10025365 | 3300006028 | Bacteria | 4713 |
| 127 | Ga0075365_10005638 | 3300006038 | Bacteria | 6777 |
| 128 | Ga0075368_10033338 | 3300006042 | Bacteria | 2003 |
| 129 | Ga0075368_10038410 | 3300006042 | Bacteria | 1874 |
| 130 | Ga0075363_100012523 | 3300006048 | Bacteria | 4093 |
| 131 | Ga0070712_100159011 | 3300006175 | Bacteria | 1743 |
| 132 | Ga0075362_10001115 | 3300006177 | Bacteria | 8339 |
| 133 | Ga0075367_10000846 | 3300006178 | Bacteria | 12177 |
| 134 | Ga0075367_10035335 | 3300006178 | Bacteria | 2892 |
| 135 | Ga0075367_10060570 | 3300006178 | Bacteria | 2257 |
| 136 | Ga0075366_10004394 | 3300006195 | Bacteria | 7564 |
| 137 | Ga0097621_100000056 | 3300006237 | Bacteria | 59138 |
| 138 | Ga0068871_100000774 | 3300006358 | Bacteria | 21535 |
| 139 | Ga0075428_100001670 | 3300006844 | Bacteria | 23642 |
| 140 | Ga0075428_100015143 | 3300006844 | Bacteria | 8560 |
| 141 | Ga0075428_100142799 | 3300006844 | Bacteria | 2603 |
| 142 | Ga0075430_100001905 | 3300006846 | Bacteria | 17105 |
| 143 | Ga0075431_100000020 | 3300006847 | Bacteria | 82958 |
| 144 | Ga0075431_100000201 | 3300006847 | Bacteria | 43911 |
| 145 | Ga0075431_100002907 | 3300006847 | Bacteria | 16575 |
| 146 | Ga0075431_100036917 | 3300006847 | Bacteria | 5033 |
| 147 | Ga0075431_100144076 | 3300006847 | Bacteria | 2455 |
| 148 | Ga0075434_100130212 | 3300006871 | Bacteria | 2534 |
| 149 | Ga0075434_100171590 | 3300006871 | Bacteria | 2189 |
| 150 | Ga0075434_100194124 | 3300006871 | Bacteria | 2051 |
| 151 | Ga0075429_100007922 | 3300006880 | Bacteria | 9229 |
| 152 | Ga0075429_100017086 | 3300006880 | Bacteria | 6274 |
| 153 | Ga0075429_100056526 | 3300006880 | Bacteria | 3416 |
| 154 | Ga0075436_100001270 | 3300006914 | Bacteria | 17140 |
| 155 | Ga0097620_100000869 | 3300006931 | Bacteria | 30827 |
| 156 | Ga0097620_100064479 | 3300006931 | Bacteria | 3696 |
| 157 | Ga0097620_100100605 | 3300006931 | Bacteria | 2947 |
| 158 | Ga0075435_100066615 | 3300007076 | Bacteria | 2930 |
| 159 | Ga0075435_100095765 | 3300007076 | Bacteria | 2455 |
| 160 | Ga0105240_10222301 | 3300009093 | Bacteria | 2199 |
| 161 | Ga0111539_10007616 | 3300009094 | Bacteria | 13837 |
| 162 | Ga0105245_10226059 | 3300009098 | Bacteria | 1808 |
| 163 | Ga0114129_10000437 | 3300009147 | Bacteria | 49415 |
| 164 | Ga0114129_10038882 | 3300009147 | Bacteria | 6707 |
| 165 | Ga0114129_10087332 | 3300009147 | Bacteria | 4325 |
| 166 | Ga0114129_10115763 | 3300009147 | Bacteria | 3695 |
| 167 | Ga0114129_10201076 | 3300009147 | Bacteria | 2698 |
| 168 | Ga0105241_10093328 | 3300009174 | Bacteria | 2378 |
| 169 | Ga0105242_10086692 | 3300009176 | Bacteria | 2628 |
| 170 | Ga0105248_10006927 | 3300009177 | Bacteria | 12422 |
| 171 | Ga0105248_10449194 | 3300009177 | Bacteria | 1453 |
| 172 | Ga0105237_10081456 | 3300009545 | Bacteria | 3228 |
| 173 | Ga0105237_10315768 | 3300009545 | Bacteria | 1566 |
| 174 | Ga0105238_10427139 | 3300009551 | Bacteria | 1320 |
| 175 | Ga0105249_10102490 | 3300009553 | Bacteria | 2694 |
| 176 | Ga0105239_10045357 | 3300010375 | Bacteria | 4817 |
| 177 | Ga0105239_10078451 | 3300010375 | Bacteria | 3634 |
| 178 | Ga0105239_10098173 | 3300010375 | Bacteria | 3237 |
| 179 | Ga0105246_10019311 | 3300011119 | Bacteria | 4353 |
| 180 | Ga0157370_10003214 | 3300013104 | Bacteria | 19310 |
| 181 | Ga0157374_10000729 | 3300013296 | Bacteria | 28724 |
| 182 | Ga0157378_10044739 | 3300013297 | Bacteria | 3932 |
| 183 | Ga0163162_10002289 | 3300013306 | Bacteria | 17976 |
| 184 | Ga0163162_10089770 | 3300013306 | Bacteria | 3154 |
| 185 | Ga0163162_10103771 | 3300013306 | Bacteria | 2937 |
| 186 | Ga0157372_10005703 | 3300013307 | Bacteria | 13253 |
| 187 | Ga0157372_10129475 | 3300013307 | Bacteria | 2903 |
| 188 | Ga0157372_10132123 | 3300013307 | Bacteria | 2873 |
| 189 | Ga0157375_10002204 | 3300013308 | Bacteria | 16840 |
| 190 | Ga0157375_10153367 | 3300013308 | Bacteria | 2441 |
| 191 | Ga0157380_10062555 | 3300014326 | Bacteria | 2982 |
| 192 | Ga0182008_10046213 | 3300014497 | Bacteria | 2164 |
| 193 | Ga0157376_10018572 | 3300014969 | Bacteria | 5335 |
| 194 | Ga0157376_10030414 | 3300014969 | Bacteria | 4311 |
| 195 | Ga0157376_10131633 | 3300014969 | Bacteria | 2233 |
| 196 | Ga0163161_10045977 | 3300017792 | Bacteria | 3149 |
| 197 | Ga0163161_10047292 | 3300017792 | Bacteria | 3107 |
| 198 | Ga0213876_10000673 | 3300021384 | Bacteria | 24333 |
| 199 | Ga0213875_10000544 | 3300021388 | Bacteria | 30876 |
| 200 | Ga0213875_10004901 | 3300021388 | Bacteria | 7267 |
| 201 | Ga0213875_10007859 | 3300021388 | Bacteria | 5481 |
| 202 | Ga0213875_10009221 | 3300021388 | Bacteria | 5007 |
| 203 | Ga0209436_100011 | 3300025208 | Bacteria | 139405 |
| 204 | Ga0209129_1000256 | 3300025258 | Bacteria | 55133 |
| 205 | Ga0209129_1000727 | 3300025258 | Bacteria | 21221 |
| 206 | Ga0209673_1003792 | 3300025273 | Bacteria | 8587 |
| 207 | Ga0209130_1000081 | 3300025284 | Bacteria | 166440 |
| 208 | Ga0209130_1002240 | 3300025284 | Bacteria | 10097 |
| 209 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 210 | Ga0209025_1003369 | 3300025294 | Bacteria | 15282 |
| 211 | Ga0209564_1000225 | 3300025295 | Bacteria | 126209 |
| 212 | Ga0209758_1000274 | 3300025297 | Bacteria | 102644 |
| 213 | Ga0209758_1000463 | 3300025297 | Bacteria | 67158 |
| 214 | Ga0209758_1001254 | 3300025297 | Bacteria | 31419 |
| 215 | Ga0209758_1004307 | 3300025297 | Bacteria | 11994 |
| 216 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 217 | Ga0207426_1000181 | 3300025302 | Bacteria | 158308 |
| 218 | Ga0209051_1015211 | 3300025303 | Bacteria | 3551 |
| 219 | Ga0209257_1024367 | 3300025304 | Bacteria | 2096 |
| 220 | Ga0207697_10042424 | 3300025315 | Bacteria | 1869 |
| 221 | Ga0207697_10048270 | 3300025315 | Bacteria | 1756 |
| 222 | Ga0207656_10000449 | 3300025321 | Bacteria | 13758 |
| 223 | Ga0207682_10001278 | 3300025893 | Bacteria | 11560 |
| 224 | Ga0207682_10006187 | 3300025893 | Bacteria | 4836 |
| 225 | Ga0207692_10051992 | 3300025898 | Bacteria | 2080 |
| 226 | Ga0207642_10113858 | 3300025899 | Bacteria | 1382 |
| 227 | Ga0207680_10015536 | 3300025903 | Bacteria | 3975 |
| 228 | Ga0207680_10170722 | 3300025903 | Bacteria | 1465 |
| 229 | Ga0207647_10006008 | 3300025904 | Bacteria | 8847 |
| 230 | Ga0207699_10050655 | 3300025906 | Bacteria | 2450 |
| 231 | Ga0207645_10007946 | 3300025907 | Bacteria | 7447 |
| 232 | Ga0207684_10042087 | 3300025910 | Bacteria | 3872 |
| 233 | Ga0207707_10043005 | 3300025912 | Bacteria | 3942 |
| 234 | Ga0207695_10019831 | 3300025913 | Bacteria | 7729 |
| 235 | Ga0207693_10002435 | 3300025915 | Bacteria | 16162 |
| 236 | Ga0207693_10012366 | 3300025915 | Bacteria | 6893 |
| 237 | Ga0207693_10110886 | 3300025915 | Bacteria | 2151 |
| 238 | Ga0207693_10165006 | 3300025915 | Bacteria | 1743 |
| 239 | Ga0207660_10001466 | 3300025917 | Bacteria | 15866 |
| 240 | Ga0207652_10045927 | 3300025921 | Bacteria | 3725 |
| 241 | Ga0207681_10159173 | 3300025923 | Bacteria | 1700 |
| 242 | Ga0207650_10000612 | 3300025925 | Bacteria | 28481 |
| 243 | Ga0207650_10003218 | 3300025925 | Bacteria | 11255 |
| 244 | Ga0207650_10020245 | 3300025925 | Bacteria | 4690 |
| 245 | Ga0207659_10000756 | 3300025926 | Bacteria | 19182 |
| 246 | Ga0207659_10039129 | 3300025926 | Bacteria | 3304 |
| 247 | Ga0207700_10031471 | 3300025928 | Bacteria | 3770 |
| 248 | Ga0207664_10061747 | 3300025929 | Unclassified | 2991 |
| 249 | Ga0207644_10000182 | 3300025931 | Bacteria | 44971 |
| 250 | Ga0207644_10005789 | 3300025931 | Bacteria | 8045 |
| 251 | Ga0207644_10028334 | 3300025931 | Bacteria | 3877 |
| 252 | Ga0207706_10014234 | 3300025933 | Bacteria | 7211 |
| 253 | Ga0207706_10079339 | 3300025933 | Bacteria | 2887 |
| 254 | Ga0207686_10164092 | 3300025934 | Bacteria | 1560 |
| 255 | Ga0207670_10003938 | 3300025936 | Bacteria | 7924 |
| 256 | Ga0207670_10086809 | 3300025936 | Bacteria | 2202 |
| 257 | Ga0207669_10015166 | 3300025937 | Bacteria | 3879 |
| 258 | Ga0207665_10027801 | 3300025939 | Bacteria | 3736 |
| 259 | Ga0207691_10001156 | 3300025940 | Bacteria | 26211 |
| 260 | Ga0207691_10005054 | 3300025940 | Bacteria | 12728 |
| 261 | Ga0207691_10032387 | 3300025940 | Bacteria | 4873 |
| 262 | Ga0207711_10015014 | 3300025941 | Bacteria | 6433 |
| 263 | Ga0207689_10047865 | 3300025942 | Bacteria | 3528 |
| 264 | Ga0207661_10001359 | 3300025944 | Bacteria | 16398 |
| 265 | Ga0207661_10014103 | 3300025944 | Bacteria | 5849 |
| 266 | Ga0207679_10004539 | 3300025945 | Bacteria | 8647 |
| 267 | Ga0207679_10135078 | 3300025945 | Bacteria | 1985 |
| 268 | Ga0207651_10000237 | 3300025960 | Bacteria | 23905 |
| 269 | Ga0207651_10003911 | 3300025960 | Bacteria | 7393 |
| 270 | Ga0207712_10001669 | 3300025961 | Bacteria | 14905 |
| 271 | Ga0207668_10125597 | 3300025972 | Bacteria | 1950 |
| 272 | Ga0207640_10074107 | 3300025981 | Bacteria | 2303 |
| 273 | Ga0207677_10010146 | 3300026023 | Bacteria | 5321 |
| 274 | Ga0207677_10060908 | 3300026023 | Bacteria | 2611 |
| 275 | Ga0207639_10058282 | 3300026041 | Bacteria | 2970 |
| 276 | Ga0207678_10042432 | 3300026067 | Bacteria | 3940 |
| 277 | Ga0207678_10099389 | 3300026067 | Bacteria | 2485 |
| 278 | Ga0207708_10007893 | 3300026075 | Bacteria | 7886 |
| 279 | Ga0207708_10017644 | 3300026075 | Bacteria | 5374 |
| 280 | Ga0207708_10122092 | 3300026075 | Bacteria | 2030 |
| 281 | Ga0207702_10203627 | 3300026078 | Bacteria | 1836 |
| 282 | Ga0207641_10082861 | 3300026088 | Bacteria | 2787 |
| 283 | Ga0207641_10169682 | 3300026088 | Bacteria | 1990 |
| 284 | Ga0207648_10022746 | 3300026089 | Bacteria | 5625 |
| 285 | Ga0207648_10025180 | 3300026089 | Bacteria | 5305 |
| 286 | Ga0207648_10051001 | 3300026089 | Bacteria | 3617 |
| 287 | Ga0207648_10228141 | 3300026089 | Bacteria | 1656 |
| 288 | Ga0207676_10004709 | 3300026095 | Bacteria | 9665 |
| 289 | Ga0207676_10015783 | 3300026095 | Bacteria | 5460 |
| 290 | Ga0207676_10016953 | 3300026095 | Bacteria | 5275 |
| 291 | Ga0207674_10001607 | 3300026116 | Bacteria | 29084 |
| 292 | Ga0207675_100020296 | 3300026118 | Bacteria | 6196 |
| 293 | Ga0207675_100100309 | 3300026118 | Bacteria | 2727 |
| 294 | Ga0207675_100105289 | 3300026118 | Bacteria | 2659 |
| 295 | Ga0207683_10000429 | 3300026121 | Bacteria | 38858 |
| 296 | Ga0207683_10004106 | 3300026121 | Bacteria | 12581 |
| 297 | Ga0207698_10003095 | 3300026142 | Bacteria | 9984 |
| 298 | Ga0207698_10251426 | 3300026142 | Bacteria | 1618 |
| 299 | Ga0209371_1001447 | 3300027312 | Bacteria | 16086 |
| 300 | Ga0209813_10003422 | 3300027866 | Bacteria | 3713 |
| 301 | Ga0209813_10036363 | 3300027866 | Bacteria | 1479 |
| 302 | Ga0268266_10178750 | 3300028379 | Bacteria | 1931 |
| 303 | Ga0268265_10002137 | 3300028380 | Bacteria | 15334 |
| 304 | Ga0268264_10001432 | 3300028381 | Bacteria | 22307 |
| 305 | Ga0265337_1000974 | 3300028556 | Bacteria | 15013 |
| 306 | Ga0265326_10000532 | 3300028558 | Bacteria | 14482 |
| 307 | Ga0265319_1003936 | 3300028563 | Bacteria | 7550 |
| 308 | Ga0265334_10000118 | 3300028573 | Bacteria | 51429 |
| 309 | Ga0265318_10000794 | 3300028577 | Bacteria | 20891 |
| 310 | Ga0265323_10000061 | 3300028653 | Bacteria | 59769 |
| 311 | Ga0265336_10000312 | 3300028666 | Bacteria | 33065 |
| 312 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 313 | Ga0265324_10001301 | 3300029957 | Bacteria | 14649 |
| 314 | Ga0268256_1000474 | 3300030500 | Bacteria | 34547 |
| 315 | Ga0265330_10054590 | 3300031235 | Bacteria | 1746 |
| 316 | Ga0265332_10001742 | 3300031238 | Bacteria | 11810 |
| 317 | Ga0265332_10009754 | 3300031238 | Bacteria | 4285 |
| 318 | Ga0265325_10004625 | 3300031241 | Bacteria | 8642 |
| 319 | Ga0265325_10011637 | 3300031241 | Bacteria | 5053 |
| 320 | Ga0265325_10018837 | 3300031241 | Bacteria | 3826 |
| 321 | Ga0265325_10063935 | 3300031241 | Bacteria | 1861 |
| 322 | Ga0265340_10002898 | 3300031247 | Bacteria | 9768 |
| 323 | Ga0265340_10006865 | 3300031247 | Bacteria | 6226 |
| 324 | Ga0265340_10038504 | 3300031247 | Bacteria | 2364 |
| 325 | Ga0265339_10000145 | 3300031249 | Bacteria | 58275 |
| 326 | Ga0265339_10004195 | 3300031249 | Bacteria | 9880 |
| 327 | Ga0265339_10008849 | 3300031249 | Bacteria | 6374 |
| 328 | Ga0265339_10037461 | 3300031249 | Bacteria | 2710 |
| 329 | Ga0265331_10002268 | 3300031250 | Bacteria | 13147 |
| 330 | Ga0265316_10036780 | 3300031344 | Bacteria | 3957 |
| 331 | Ga0265316_10055308 | 3300031344 | Bacteria | 3104 |
| 332 | Ga0307408_100187294 | 3300031548 | Bacteria | 1665 |
| 333 | Ga0265313_10000173 | 3300031595 | Bacteria | 68499 |
| 334 | Ga0265313_10024061 | 3300031595 | Bacteria | 3262 |
| 335 | Ga0265313_10025642 | 3300031595 | Bacteria | 3117 |
| 336 | Ga0265313_10033468 | 3300031595 | Bacteria | 2611 |
| 337 | Ga0316575_10017105 | 3300031665 | Bacteria | 2751 |
| 338 | Ga0265314_10004506 | 3300031711 | Bacteria | 12905 |
| 339 | Ga0265314_10050991 | 3300031711 | Bacteria | 2885 |
| 340 | Ga0265314_10061231 | 3300031711 | Bacteria | 2564 |
| 341 | Ga0265342_10003830 | 3300031712 | Bacteria | 12110 |
| 342 | Ga0265342_10014206 | 3300031712 | Bacteria | 5295 |
| 343 | Ga0265342_10024919 | 3300031712 | Bacteria | 3769 |
| 344 | Ga0265342_10062689 | 3300031712 | Bacteria | 2187 |
| 345 | Ga0307516_10046143 | 3300031730 | Bacteria | 4301 |
| 346 | Ga0307410_10029855 | 3300031852 | Bacteria | 3477 |
| 347 | Ga0307409_100063204 | 3300031995 | Bacteria | 2902 |
| 348 | Ga0307416_100261194 | 3300032002 | Bacteria | 1693 |
| 349 | Ga0307414_10027394 | 3300032004 | Bacteria | 3682 |
| 350 | Ga0307414_10044899 | 3300032004 | Bacteria | 3023 |
| 351 | Ga0307414_10065737 | 3300032004 | Bacteria | 2589 |
| 352 | Ga0307415_100062560 | 3300032126 | Bacteria | 2582 |
| 353 | Ga0373930_0003675 | 3300034816 | Bacteria | 2452 |
| 354 | Ga0373926_0030940 | 3300035083 | Bacteria | 1886 |
| 355 | Ga0373944_0001411 | 3300035089 | Bacteria | 6054 |
| 356 | Ga0373952_0005427 | 3300035092 | Bacteria | 2332 |
| 357 | Ga0373923_0008421 | 3300035111 | Bacteria | 3676 |
| 358 | Ga0373936_0006574 | 3300035113 | Bacteria | 4377 |
| 359 | Ga0373945_0000996 | 3300035116 | Bacteria | 8462 |
| 360 | Ga0373954_0033651 | 3300035118 | Bacteria | 2371 |
| 361 | Ga0373956_0027329 | 3300035119 | Bacteria | 2477 |
| 362 | Ga0373957_0011252 | 3300035120 | Bacteria | 2981 |
| 363 | Ga0373943_0005000 | 3300035170 | Bacteria | 5982 |
| 364 | Ga0373946_0009373 | 3300035171 | Bacteria | 3605 |
| 365 | Ga0373955_0000998 | 3300035172 | Bacteria | 12004 |
| 366 | Ga0373961_0017805 | 3300035241 | Bacteria | 1848 |
| 367 | Ga0373924_0009058 | 3300035410 | Bacteria | 3640 |
| 368 | Ga0373931_0010331 | 3300035691 | Bacteria | 4486 |
| 369 | Ga0373931_0234037 | 3300035691 | Bacteria | 1111 |
| 370 | Ga0373935_0005842 | 3300035692 | Bacteria | 7289 |
| 371 | Ga0373935_0018325 | 3300035692 | Bacteria | 4257 |
| 372 | Ga0373935_0048158 | 3300035692 | Bacteria | 2698 |
| 373 | Ga0373927_0001137 | 3300035695 | Bacteria | 20140 |
| 374 | Ga0373927_0025778 | 3300035695 | Bacteria | 3844 |
| 375 | Ga0373927_0099374 | 3300035695 | Bacteria | 1892 |
| 376 | Ga0373933_0004475 | 3300035724 | Bacteria | 7663 |
| 377 | Ga0373933_0013328 | 3300035724 | Bacteria | 4555 |
| 378 | Ga0373933_0051462 | 3300035724 | Bacteria | 2462 |
| 379 | Ga0373947_0000866 | 3300035725 | Bacteria | 18297 |
| 380 | Ga0373947_0022758 | 3300035725 | Bacteria | 3638 |
| 381 | Ga0373937_0002009 | 3300036401 | Bacteria | 16986 |
| 382 | Ga0373937_0019871 | 3300036401 | Bacteria | 6016 |
| 383 | Ga0373925_0004518 | 3300037068 | Bacteria | 10513 |
| 384 | Ga0373925_0153215 | 3300037068 | Bacteria | 1811 |
| 385 | Ga0373925_0168634 | 3300037068 | Bacteria | 1727 |
| 386 | Ga0395899_0021478 | 3300037312 | Bacteria | 4897 |
| 387 | Ga0395900_0004380 | 3300037418 | Bacteria | 14982 |
| 388 | Ga0395900_0291329 | 3300037418 | Bacteria | 1621 |
| 389 | Ga0395898_0079678 | 3300037466 | Bacteria | 3159 |
| 390 | Ga0395898_0142248 | 3300037466 | Bacteria | 2297 |
| 391 | Ga0436364_0124138 | 3300037853 | Bacteria | 39695 |
| 392 | Ga0436364_0520243 | 3300037853 | Bacteria | 17658 |
| 393 | Ga0436364_0711362 | 3300037853 | Bacteria | 2583 |
| 394 | Ga0436364_1064204 | 3300037853 | Bacteria | 1918 |
| 395 | Ga0436364_1070065 | 3300037853 | Bacteria | 32747 |
| 396 | Ga0436364_1318907 | 3300037853 | Bacteria | 7994 |
| 397 | Ga0395901_0102892 | 3300038443 | Bacteria | 2997 |
| 398 | Ga0436365_0007138 | 3300039437 | Bacteria | 1588 |
| 399 | Ga0436365_0153483 | 3300039437 | Bacteria | 5114 |
| 400 | Ga0436365_0287489 | 3300039437 | Bacteria | 4676 |
| 401 | Ga0436365_0368498 | 3300039437 | Bacteria | 1525 |
| 402 | Ga0436365_0402221 | 3300039437 | Bacteria | 3274 |
| 403 | Ga0436365_0920278 | 3300039437 | Bacteria | 78160 |
| 404 | Ga0436365_1530619 | 3300039437 | Bacteria | 1654 |
| 405 | Ga0436360_1260076 | 3300039438 | Bacteria | 1660 |
| 406 | Ga0436363_0945108 | 3300039450 | Bacteria | 2726 |
| 407 | Ga0436363_1307388 | 3300039450 | Bacteria | 5545 |
| 408 | Ga0436362_0821772 | 3300039453 | Bacteria | 3277 |
| 409 | Ga0439453_0000303 | 3300041408 | Bacteria | 5113 |
| 410 | Ga0439465_0012607 | 3300041413 | Bacteria | 2643 |
| 411 | Ga0439443_002130 | 3300042003 | Bacteria | 2323 |
| 412 | Ga0466961_0184879 | 3300044693 | Bacteria | 1293 |
| 413 | Ga0466963_0075740 | 3300044694 | Bacteria | 2271 |
| 414 | Ga0451576_0021895 | 3300045051 | Bacteria | 6940 |
| 415 | Ga0451576_0054093 | 3300045051 | Bacteria | 4203 |
| 416 | Ga0466967_0542382 | 3300045976 | Bacteria | 1144 |
| 417 | Ga0495627_002437 | 3300046453 | Bacteria | 8971 |
| 418 | Ga0495592_0020724 | 3300046454 | Bacteria | 5001 |
| 419 | Ga0495591_001814 | 3300046458 | Bacteria | 12652 |
| 420 | Ga0495629_0001678 | 3300046459 | Bacteria | 17382 |
| 421 | Ga0495651_0000610 | 3300046462 | Bacteria | 27759 |
| 422 | Ga0495651_0025597 | 3300046462 | Bacteria | 4594 |
| 423 | Ga0495651_0127850 | 3300046462 | Bacteria | 1859 |
| 424 | Ga0495653_0025224 | 3300046463 | Bacteria | 4782 |
| 425 | Ga0495580_0092293 | 3300046472 | Bacteria | 2107 |
| 426 | Ga0495582_0061204 | 3300046473 | Bacteria | 2079 |
| 427 | Ga0495639_0103973 | 3300046475 | Bacteria | 1343 |
| 428 | Ga0495662_0008776 | 3300046476 | Bacteria | 4971 |
| 429 | Ga0495662_0044135 | 3300046476 | Bacteria | 2152 |
| 430 | Ga0495662_0098147 | 3300046476 | Bacteria | 1432 |
| 431 | Ga0495664_0016514 | 3300046477 | Bacteria | 4207 |
| 432 | Ga0495664_0059336 | 3300046477 | Bacteria | 2277 |
| 433 | Ga0495607_0012195 | 3300046501 | Bacteria | 5681 |
| 434 | Ga0495607_0039646 | 3300046501 | Bacteria | 2812 |
| 435 | Ga0495606_0001557 | 3300046507 | Bacteria | 30137 |
| 436 | Ga0495606_0012545 | 3300046507 | Bacteria | 6787 |
| 437 | Ga0495608_0006351 | 3300046511 | Bacteria | 8388 |
| 438 | Ga0495608_0096067 | 3300046511 | Bacteria | 1914 |
| 439 | Ga0495610_0001005 | 3300046512 | Bacteria | 26004 |
| 440 | Ga0495610_0010487 | 3300046512 | Bacteria | 5754 |
| 441 | Ga0495610_0034384 | 3300046512 | Bacteria | 2611 |
| 442 | Ga0495620_0002604 | 3300046515 | Bacteria | 10435 |
| 443 | Ga0495628_0062018 | 3300046516 | Bacteria | 2931 |
| 444 | Ga0495628_0137743 | 3300046516 | Bacteria | 1864 |
| 445 | Ga0495630_0002608 | 3300046517 | Bacteria | 12495 |
| 446 | Ga0495632_0002766 | 3300046519 | Bacteria | 13029 |
| 447 | Ga0495652_0036439 | 3300046529 | Bacteria | 4277 |
| 448 | Ga0495654_0071769 | 3300046530 | Bacteria | 1640 |
| 449 | Ga0495665_0012191 | 3300046531 | Bacteria | 4652 |
| 450 | Ga0495640_0002140 | 3300046533 | Bacteria | 15784 |
| 451 | Ga0495587_0006491 | 3300046536 | Bacteria | 7621 |
| 452 | Ga0495587_0092621 | 3300046536 | Bacteria | 1745 |
| 453 | Ga0495598_0002725 | 3300046537 | Bacteria | 3666 |
| 454 | Ga0495621_0052085 | 3300046539 | Bacteria | 1466 |
| 455 | Ga0495645_0087925 | 3300046543 | Bacteria | 2223 |
| 456 | Ga0495645_0129786 | 3300046543 | Bacteria | 1767 |
| 457 | Ga0495645_0166329 | 3300046543 | Bacteria | 1521 |
| 458 | Ga0495667_0019448 | 3300046559 | Bacteria | 4582 |
| 459 | Ga0495634_0006471 | 3300046642 | Bacteria | 8900 |
| 460 | Ga0495634_0009370 | 3300046642 | Bacteria | 7223 |
| 461 | Ga0495634_0057181 | 3300046642 | Bacteria | 2604 |
| 462 | Ga0495634_0063775 | 3300046642 | Bacteria | 2444 |
| 463 | Ga0495625_0085858 | 3300046660 | Bacteria | 2184 |
| 464 | Ga0495635_0015802 | 3300046663 | Bacteria | 5272 |
| 465 | Ga0495635_0045940 | 3300046663 | Bacteria | 3012 |
| 466 | Ga0495635_0075589 | 3300046663 | Bacteria | 2307 |
| 467 | Ga0495661_0000884 | 3300046665 | Bacteria | 27652 |
| 468 | Ga0495657_0037776 | 3300046675 | Bacteria | 3326 |
| 469 | Ga0495657_0120806 | 3300046675 | Bacteria | 1650 |
| 470 | Ga0495599_0024822 | 3300046678 | Bacteria | 3749 |
| 471 | Ga0495623_0010233 | 3300046679 | Bacteria | 6068 |
| 472 | Ga0495623_0065686 | 3300046679 | Bacteria | 2268 |
| 473 | Ga0495646_0028281 | 3300046680 | Bacteria | 3512 |
| 474 | Ga0495647_0016477 | 3300046681 | Bacteria | 2602 |
| 475 | Ga0495613_0019822 | 3300046689 | Bacteria | 5013 |
| 476 | Ga0495613_0108184 | 3300046689 | Bacteria | 2005 |
| 477 | Ga0495624_0011975 | 3300046690 | Bacteria | 5946 |
| 478 | Ga0495624_0062130 | 3300046690 | Bacteria | 2338 |
| 479 | Ga0495589_0001432 | 3300046794 | Bacteria | 13762 |
| 480 | Ga0495600_0034059 | 3300046809 | Bacteria | 3307 |
| 481 | Ga0495581_0046320 | 3300047315 | Bacteria | 2512 |
| 482 | Ga0495581_0055881 | 3300047315 | Bacteria | 2278 |
| 483 | Ga0495604_0000493 | 3300047317 | Bacteria | 34632 |
| 484 | Ga0495604_0096244 | 3300047317 | Bacteria | 2185 |
| 485 | Ga0495674_0014377 | 3300047319 | Bacteria | 7410 |
| 486 | Ga0495674_0088628 | 3300047319 | Bacteria | 2646 |
| 487 | Ga0495672_0119053 | 3300047320 | Bacteria | 1406 |
| 488 | Ga0495676_0088524 | 3300047321 | Bacteria | 2322 |
| 489 | Ga0495680_0018467 | 3300047322 | Bacteria | 5919 |
| 490 | Ga0495675_0000723 | 3300047444 | Bacteria | 20653 |
| 491 | Ga0495675_0074569 | 3300047444 | Bacteria | 2138 |
| 492 | Ga0495679_002009 | 3300047446 | Bacteria | 10777 |
| 493 | Ga0495681_0004810 | 3300047470 | Bacteria | 9148 |
| 494 | Ga0495681_0022626 | 3300047470 | Bacteria | 3359 |
| 495 | Ga0495681_0025078 | 3300047470 | Bacteria | 3125 |
| 496 | Ga0495684_0003088 | 3300047471 | Bacteria | 13080 |
| 497 | Ga0495684_0017567 | 3300047471 | Bacteria | 5506 |
| 498 | Ga0495684_0021791 | 3300047471 | Bacteria | 4932 |
| 499 | Ga0495686_0000301 | 3300047472 | Bacteria | 84924 |
| 500 | Ga0495686_0008314 | 3300047472 | Bacteria | 7631 |
| 501 | Ga0495602_0048600 | 3300048088 | Bacteria | 3810 |
| 502 | Ga0496100_0001298 | 3300048903 | Bacteria | 12193 |
| 503 | Ga0496100_0003349 | 3300048903 | Bacteria | 8349 |
| 504 | Ga0496101_0010229 | 3300048904 | Bacteria | 6191 |
| 505 | Ga0496102_0005180 | 3300048905 | Bacteria | 11067 |
| 506 | Ga0496102_0035401 | 3300048905 | Bacteria | 4494 |
| 507 | Ga0496102_0061264 | 3300048905 | Bacteria | 3443 |
| 508 | Ga0496104_0010021 | 3300048907 | Bacteria | 8459 |
| 509 | Ga0496104_0014023 | 3300048907 | Bacteria | 7232 |
| 510 | Ga0496104_0035082 | 3300048907 | Bacteria | 4682 |
| 511 | Ga0496104_0183507 | 3300048907 | Bacteria | 2002 |
| 512 | Ga0496105_0007910 | 3300048908 | Bacteria | 8259 |
| 513 | Ga0496105_0085462 | 3300048908 | Bacteria | 2606 |
| 514 | Ga0496105_0140891 | 3300048908 | Bacteria | 1985 |
| 515 | Ga0496106_0001584 | 3300048909 | Bacteria | 17100 |
| 516 | Ga0496106_0023015 | 3300048909 | Bacteria | 4628 |
| 517 | Ga0496106_0048951 | 3300048909 | Bacteria | 3184 |
| 518 | Ga0496106_0155489 | 3300048909 | Bacteria | 1806 |
| 519 | Ga0496107_0001180 | 3300048910 | Bacteria | 15869 |
| 520 | Ga0496107_0003731 | 3300048910 | Bacteria | 10232 |
| 521 | Ga0496107_0011522 | 3300048910 | Bacteria | 6160 |
| 522 | Ga0496108_0000249 | 3300048911 | Bacteria | 47869 |
| 523 | Ga0496108_0006169 | 3300048911 | Bacteria | 9695 |
| 524 | Ga0496108_0007323 | 3300048911 | Bacteria | 8947 |
| 525 | Ga0496108_0007378 | 3300048911 | Bacteria | 8914 |
| 526 | Ga0496108_0282254 | 3300048911 | Bacteria | 1446 |
| 527 | Ga0496109_0000754 | 3300048912 | Bacteria | 26955 |
| 528 | Ga0496109_0001895 | 3300048912 | Bacteria | 17360 |
| 529 | Ga0496109_0006710 | 3300048912 | Bacteria | 9689 |
| 530 | Ga0496109_0016050 | 3300048912 | Bacteria | 6545 |
| 531 | Ga0496109_0019466 | 3300048912 | Bacteria | 5989 |
| 532 | Ga0496110_0000037 | 3300048913 | Bacteria | 64495 |
| 533 | Ga0496110_0000172 | 3300048913 | Bacteria | 39832 |
| 534 | Ga0496110_0001523 | 3300048913 | Bacteria | 16824 |
| 535 | Ga0496110_0007225 | 3300048913 | Bacteria | 8849 |
| 536 | Ga0496110_0126086 | 3300048913 | Bacteria | 2310 |
| 537 | Ga0496111_0004089 | 3300048914 | Bacteria | 9165 |
| 538 | Ga0496111_0004342 | 3300048914 | Bacteria | 8946 |
| 539 | Ga0496111_0085144 | 3300048914 | Bacteria | 2311 |
| 540 | Ga0496112_0010902 | 3300048915 | Bacteria | 8275 |
| 541 | Ga0496112_0041007 | 3300048915 | Bacteria | 4528 |
| 542 | Ga0496113_0027474 | 3300048916 | Bacteria | 4080 |
| 543 | Ga0496113_0027772 | 3300048916 | Bacteria | 4061 |
| 544 | Ga0496113_0039052 | 3300048916 | Bacteria | 3493 |
| 545 | Ga0496113_0092902 | 3300048916 | Bacteria | 2328 |
| 546 | Ga0496114_0020854 | 3300048917 | Bacteria | 5321 |
| 547 | Ga0496115_0011903 | 3300048918 | Bacteria | 6534 |
| 548 | Ga0496115_0083805 | 3300048918 | Bacteria | 2598 |
| 549 | Ga0496116_0081607 | 3300048919 | Bacteria | 2004 |
| 550 | Ga0496118_0010338 | 3300048921 | Bacteria | 9250 |
| 551 | Ga0496119_0007536 | 3300048922 | Bacteria | 9779 |
| 552 | Ga0496120_0002850 | 3300048923 | Bacteria | 16652 |
| 553 | Ga0496121_0044519 | 3300048924 | Bacteria | 3827 |
| 554 | Ga0496121_0143989 | 3300048924 | Bacteria | 1764 |
| 555 | Ga0496124_0003272 | 3300048927 | Bacteria | 20008 |
| 556 | Ga0496124_0024561 | 3300048927 | Bacteria | 5475 |
| 557 | Ga0496124_0081935 | 3300048927 | Bacteria | 2650 |
| 558 | Ga0496125_0002278 | 3300048928 | Bacteria | 25448 |
| 559 | Ga0496126_0052724 | 3300048929 | Bacteria | 3695 |
| 560 | Ga0496126_0056165 | 3300048929 | Bacteria | 3560 |
| 561 | Ga0495678_008214 | 3300049459 | Bacteria | 5296 |
| 562 | Ga0501032_0022335 | 3300049569 | Bacteria | 4386 |
| 563 | Ga0501032_0053160 | 3300049569 | Bacteria | 2728 |
| 564 | Ga0501033_0018340 | 3300049570 | Bacteria | 5287 |
| 565 | Ga0501033_0056564 | 3300049570 | Bacteria | 2899 |
| 566 | Ga0501034_0000439 | 3300049571 | Bacteria | 68932 |
| 567 | Ga0501034_0000810 | 3300049571 | Bacteria | 46526 |
| 568 | Ga0501034_0013989 | 3300049571 | Bacteria | 8259 |
| 569 | Ga0501034_0019814 | 3300049571 | Bacteria | 6875 |
| 570 | Ga0501034_0026979 | 3300049571 | Bacteria | 5843 |
| 571 | Ga0501034_0176715 | 3300049571 | Bacteria | 2101 |
| 572 | Ga0501034_0235854 | 3300049571 | Bacteria | 1777 |
| 573 | Ga0501034_0347688 | 3300049571 | Bacteria | 1411 |
| 574 | Ga0501036_0013370 | 3300049572 | Bacteria | 6819 |
| 575 | Ga0501036_0062191 | 3300049572 | Bacteria | 3162 |
| 576 | Ga0501036_0168931 | 3300049572 | Bacteria | 1843 |
| 577 | Ga0501037_0011196 | 3300049573 | Bacteria | 6602 |
| 578 | Ga0501037_0012720 | 3300049573 | Bacteria | 6199 |
| 579 | Ga0501037_0053330 | 3300049573 | Bacteria | 2957 |
| 580 | Ga0501037_0111982 | 3300049573 | Bacteria | 1965 |
| 581 | Ga0501038_0002575 | 3300049574 | Bacteria | 16927 |
| 582 | Ga0501038_0085541 | 3300049574 | Bacteria | 2651 |
| 583 | Ga0501038_0107486 | 3300049574 | Bacteria | 2314 |
| 584 | Ga0501039_0036603 | 3300049575 | Bacteria | 3788 |
| 585 | Ga0501039_0047383 | 3300049575 | Bacteria | 3322 |
| 586 | Ga0501039_0053273 | 3300049575 | Bacteria | 3130 |
| 587 | Ga0501039_0061618 | 3300049575 | Bacteria | 2906 |
| 588 | Ga0501039_0088852 | 3300049575 | Bacteria | 2407 |
| 589 | Ga0501039_0245039 | 3300049575 | Bacteria | 1409 |
| 590 | Ga0501039_0334705 | 3300049575 | Bacteria | 1190 |
| 591 | Ga0501040_0003065 | 3300049576 | Bacteria | 10837 |
| 592 | Ga0501040_0037634 | 3300049576 | Bacteria | 3288 |
| 593 | Ga0501040_0082435 | 3300049576 | Bacteria | 2230 |
| 594 | Ga0501041_0095615 | 3300049577 | Bacteria | 1836 |
| 595 | Ga0501042_0017146 | 3300049578 | Bacteria | 4990 |
| 596 | Ga0501043_0003139 | 3300049579 | Bacteria | 13681 |
| 597 | Ga0501043_0041605 | 3300049579 | Bacteria | 3610 |
| 598 | Ga0501043_0086433 | 3300049579 | Bacteria | 2464 |
| 599 | Ga0501043_0092077 | 3300049579 | Bacteria | 2383 |
| 600 | Ga0501043_0154934 | 3300049579 | Bacteria | 1792 |
| 601 | Ga0501043_0277233 | 3300049579 | Bacteria | 1286 |
| 602 | Ga0501046_0032611 | 3300049580 | Bacteria | 4217 |
| 603 | Ga0501046_0040654 | 3300049580 | Bacteria | 3714 |
| 604 | Ga0501046_0071176 | 3300049580 | Bacteria | 2702 |
| 605 | Ga0501046_0169760 | 3300049580 | Bacteria | 1638 |
| 606 | Ga0501047_0000073 | 3300049581 | Bacteria | 125990 |
| 607 | Ga0501047_0020149 | 3300049581 | Bacteria | 6403 |
| 608 | Ga0501047_0024859 | 3300049581 | Bacteria | 5751 |
| 609 | Ga0501047_0153668 | 3300049581 | Bacteria | 2176 |
| 610 | Ga0501047_0301531 | 3300049581 | Bacteria | 1444 |
| 611 | Ga0501048_0000014 | 3300049582 | Bacteria | 75001 |
| 612 | Ga0501048_0000737 | 3300049582 | Bacteria | 23982 |
| 613 | Ga0501048_0045246 | 3300049582 | Bacteria | 3145 |
| 614 | Ga0501067_0062323 | 3300049583 | Bacteria | 2064 |
| 615 | Ga0501068_0113161 | 3300049584 | Bacteria | 1688 |
| 616 | Ga0501068_0146194 | 3300049584 | Bacteria | 1484 |
| 617 | Ga0501069_0002360 | 3300049585 | Bacteria | 9568 |
| 618 | Ga0501069_0023850 | 3300049585 | Bacteria | 3335 |
| 619 | Ga0501069_0099949 | 3300049585 | Bacteria | 1646 |
| 620 | Ga0501070_0001477 | 3300049586 | Bacteria | 21037 |
| 621 | Ga0501070_0009332 | 3300049586 | Bacteria | 8295 |
| 622 | Ga0501070_0019243 | 3300049586 | Bacteria | 5726 |
| 623 | Ga0501070_0035175 | 3300049586 | Bacteria | 4186 |
| 624 | Ga0501070_0192404 | 3300049586 | Bacteria | 1676 |
| 625 | Ga0501070_0200019 | 3300049586 | Bacteria | 1641 |
| 626 | Ga0501071_0059959 | 3300049587 | Bacteria | 2754 |
| 627 | Ga0501072_0012149 | 3300049588 | Bacteria | 6580 |
| 628 | Ga0501072_0017304 | 3300049588 | Bacteria | 5540 |
| 629 | Ga0501072_0035137 | 3300049588 | Bacteria | 3928 |
| 630 | Ga0501072_0071395 | 3300049588 | Bacteria | 2743 |
| 631 | Ga0501072_0138002 | 3300049588 | Bacteria | 1944 |
| 632 | Ga0501072_0189251 | 3300049588 | Bacteria | 1642 |
| 633 | Ga0501072_0201423 | 3300049588 | Bacteria | 1587 |
| 634 | Ga0501073_0004868 | 3300049589 | Bacteria | 10079 |
| 635 | Ga0501073_0024118 | 3300049589 | Bacteria | 4368 |
| 636 | Ga0501073_0119942 | 3300049589 | Bacteria | 1823 |
| 637 | Ga0501074_0011359 | 3300049590 | Bacteria | 6472 |
| 638 | Ga0501074_0017979 | 3300049590 | Bacteria | 5135 |
| 639 | Ga0501074_0051662 | 3300049590 | Bacteria | 2966 |
| 640 | Ga0501074_0143040 | 3300049590 | Bacteria | 1710 |
| 641 | Ga0501074_0175316 | 3300049590 | Bacteria | 1530 |
| 642 | Ga0501075_0018520 | 3300049591 | Bacteria | 5040 |
| 643 | Ga0501076_0000841 | 3300049592 | Bacteria | 19891 |
| 644 | Ga0501076_0003123 | 3300049592 | Bacteria | 11544 |
| 645 | Ga0501076_0025102 | 3300049592 | Bacteria | 4610 |
| 646 | Ga0501076_0060113 | 3300049592 | Bacteria | 3023 |
| 647 | Ga0501077_0029765 | 3300049593 | Bacteria | 3472 |
| 648 | Ga0501077_0032318 | 3300049593 | Bacteria | 3331 |
| 649 | Ga0501079_0011565 | 3300049741 | Bacteria | 6738 |
| 650 | Ga0501079_0041719 | 3300049741 | Bacteria | 3543 |
| 651 | Ga0501079_0061836 | 3300049741 | Bacteria | 2888 |
| 652 | Ga0501079_0063174 | 3300049741 | Bacteria | 2857 |
| 653 | Ga0501079_0076301 | 3300049741 | Bacteria | 2592 |
| 654 | Ga0501079_0099588 | 3300049741 | Bacteria | 2252 |
| 655 | Ga0501079_0108392 | 3300049741 | Bacteria | 2156 |
| 656 | Ga0501079_0143373 | 3300049741 | Bacteria | 1861 |
| 657 | Ga0501080_0004174 | 3300049742 | Bacteria | 12814 |
| 658 | Ga0501080_0017561 | 3300049742 | Bacteria | 6617 |
| 659 | Ga0501080_0023875 | 3300049742 | Bacteria | 5667 |
| 660 | Ga0501080_0093386 | 3300049742 | Bacteria | 2794 |
| 661 | Ga0501080_0173637 | 3300049742 | Bacteria | 1986 |
| 662 | Ga0501081_0006654 | 3300049743 | Bacteria | 7514 |
| 663 | Ga0501081_0016051 | 3300049743 | Bacteria | 4946 |
| 664 | Ga0501081_0017788 | 3300049743 | Bacteria | 4711 |
| 665 | Ga0501083_0000139 | 3300049744 | Bacteria | 49384 |
| 666 | Ga0501083_0018040 | 3300049744 | Bacteria | 4919 |
| 667 | Ga0501083_0200398 | 3300049744 | Bacteria | 1302 |
| 668 | Ga0501083_0214539 | 3300049744 | Bacteria | 1254 |
| 669 | Ga0501035_0001020 | 3300049822 | Bacteria | 29508 |
| 670 | Ga0501035_0090676 | 3300049822 | Bacteria | 2690 |
| 671 | Ga0501035_0091227 | 3300049822 | Bacteria | 2681 |
| 672 | Ga0501035_0159336 | 3300049822 | Bacteria | 1954 |
| 673 | Ga0501044_0010689 | 3300049823 | Bacteria | 9959 |
| 674 | Ga0501044_0019808 | 3300049823 | Bacteria | 7188 |
| 675 | Ga0501044_0031481 | 3300049823 | Bacteria | 5583 |
| 676 | Ga0501044_0062365 | 3300049823 | Bacteria | 3810 |
| 677 | Ga0501044_0144876 | 3300049823 | Bacteria | 2362 |
| 678 | Ga0501044_0194296 | 3300049823 | Bacteria | 1990 |
| 679 | Ga0501044_0230003 | 3300049823 | Bacteria | 1802 |
| 680 | Ga0501044_0255644 | 3300049823 | Bacteria | 1691 |
| 681 | Ga0501045_0002675 | 3300049824 | Bacteria | 12155 |
| 682 | Ga0501045_0176141 | 3300049824 | Bacteria | 1593 |
| 683 | Ga0501045_0225930 | 3300049824 | Bacteria | 1393 |
| 684 | nmdc:mga03683_1555_c1 | 3300050489 | Bacteria | 6843 |
| 685 | nmdc:mga03n38_5019_c1 | 3300050490 | Bacteria | 4460 |
| 686 | nmdc:mga0yw44_19014_c1 | 3300050492 | Bacteria | 3778 |
| 687 | nmdc:mga0yw44_45873_c1 | 3300050492 | Bacteria | 2622 |
| 688 | nmdc:mga0yw44_59129_c1 | 3300050492 | Bacteria | 2344 |
| 689 | nmdc:mga06z11_1311_c1 | 3300050494 | Bacteria | 9197 |
| 690 | nmdc:mga04h51_17470_c1 | 3300050495 | Bacteria | 2099 |
| 691 | nmdc:mga04h51_304_c1 | 3300050495 | Bacteria | 12497 |
| 692 | nmdc:mga07m45_88670_c1 | 3300050496 | Bacteria | 1770 |
| 693 | nmdc:mga05p37_31241_c1 | 3300050507 | Bacteria | 6505 |
| 694 | nmdc:mga05p37_5052_c1 | 3300050507 | Bacteria | 15464 |
| 695 | nmdc:mga09592_110940_c1 | 3300050508 | Bacteria | 2353 |
| 696 | nmdc:mga09592_33207_c1 | 3300050508 | Bacteria | 4306 |
| 697 | nmdc:mga0qj67_135190_c1 | 3300050509 | Bacteria | 1998 |
| 698 | nmdc:mga0qj67_16983_c1 | 3300050509 | Bacteria | 5529 |
| 699 | nmdc:mga0qj67_17568_c1 | 3300050509 | Bacteria | 5441 |
| 700 | nmdc:mga06r32_1357_c1 | 3300050510 | Bacteria | 22092 |
| 701 | nmdc:mga06r32_150494_c1 | 3300050510 | Bacteria | 2305 |
| 702 | nmdc:mga06r32_2353_c1 | 3300050510 | Bacteria | 16934 |
| 703 | nmdc:mga06r32_32_c1 | 3300050510 | Bacteria | 83882 |
| 704 | nmdc:mga06r32_340496_c1 | 3300050510 | Bacteria | 1484 |
| 705 | nmdc:mga08y16_1157_c1 | 3300050511 | Bacteria | 25991 |
| 706 | nmdc:mga08y16_137340_c1 | 3300050511 | Bacteria | 2541 |
| 707 | nmdc:mga08y16_16138_c1 | 3300050511 | Bacteria | 7851 |
| 708 | nmdc:mga08y16_170940_c1 | 3300050511 | Bacteria | 2257 |
| 709 | nmdc:mga0n895_146258_c1 | 3300050512 | Bacteria | 2393 |
| 710 | nmdc:mga0rr50_123860_c1 | 3300050513 | Bacteria | 2061 |
| 711 | nmdc:mga0rr50_211542_c1 | 3300050513 | Bacteria | 1598 |
| 712 | nmdc:mga0rr50_70470_c1 | 3300050513 | Bacteria | 2664 |
| 713 | nmdc:mga08x19_22394_c1 | 3300050514 | Bacteria | 3914 |
| 714 | Ga0495601_0014404 | 3300053077 | Bacteria | 4765 |
| 715 | Ga0495612_0005267 | 3300053078 | Bacteria | 5343 |
| 716 | Ga0495612_0021731 | 3300053078 | Bacteria | 2574 |
| 717 | Ga0500610_0018722 | 3300053079 | Bacteria | 3355 |
| 718 | Ga0495595_0000433 | 3300053084 | Bacteria | 15833 |
| 719 | Ga0495595_0016956 | 3300053084 | Bacteria | 3125 |
| 720 | Ga0495619_0001178 | 3300053085 | Bacteria | 17227 |
| 721 | Ga0495619_0024566 | 3300053085 | Bacteria | 3866 |
| 722 | Ga0500651_0093660 | 3300053093 | Bacteria | 1847 |
| 723 | Ga0500641_0002826 | 3300053096 | Bacteria | 6155 |
| 724 | Ga0500593_006931 | 3300053117 | Bacteria | 4570 |
| 725 | Ga0500618_000875 | 3300053125 | Bacteria | 16083 |
| 726 | Ga0500618_002296 | 3300053125 | Bacteria | 7361 |
| 727 | Ga0500658_0003580 | 3300053134 | Bacteria | 5865 |
| 728 | Ga0500568_0000266 | 3300053139 | Bacteria | 44327 |
| 729 | Ga0500616_0003409 | 3300053153 | Bacteria | 12184 |
| 730 | Ga0500627_0046683 | 3300053158 | Bacteria | 1877 |
| 731 | Ga0500636_0043152 | 3300053177 | Bacteria | 2663 |
| 732 | Ga0501084_0001395 | 3300054114 | Bacteria | 19105 |
| 733 | Ga0501084_0010467 | 3300054114 | Bacteria | 7665 |
| 734 | Ga0501084_0025150 | 3300054114 | Bacteria | 4968 |
| 735 | Ga0501084_0035864 | 3300054114 | Bacteria | 4146 |
| 736 | Ga0501084_0080925 | 3300054114 | Bacteria | 2724 |
| 737 | Ga0501084_0186316 | 3300054114 | Bacteria | 1751 |
| 738 | Ga0501084_0215252 | 3300054114 | Bacteria | 1621 |
| 739 | Ga0501082_0000106 | 3300060353 | Bacteria | 65983 |
| 740 | Ga0501082_0016399 | 3300060353 | Bacteria | 6377 |
| 741 | Ga0501082_0087331 | 3300060353 | Bacteria | 2691 |
| 742 | Ga0501082_0139642 | 3300060353 | Bacteria | 2103 |
| 743 | Ga0501082_0203591 | 3300060353 | Bacteria | 1722 |
| 744 | Ga0530510_0085051 | 3300061734 | Bacteria | 2304 |
| 745 | Ga0530510_0137457 | 3300061734 | Bacteria | 1799 |
| 746 | Ga0530510_0157975 | 3300061734 | Bacteria | 1676 |
| 747 | Ga0530510_0310192 | 3300061734 | Bacteria | 1182 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0200398 | Ga0501083_0200398_248_1261 | 318 |
| 2 | iso_pu_bacteria | 2510917030 | 2511196297 | 323 |
| 3 | 3300045976 | Ga0466967_0542382 | Ga0466967_0542382_112_1125 | 332 |
| 4 | 3300003775 | Ga0055524_1012176 | Ga0055524_10121763 | 335 |
| 5 | 3300035691 | Ga0373931_0234037 | Ga0373931_0234037_22_1098 | 341 |
| 6 | 3300009551 | Ga0105238_10427139 | Ga0105238_104271392 | 343 |
| 7 | 3300061734 | Ga0530510_0310192 | Ga0530510_0310192_38_1135 | 346 |
| 8 | 3300025903 | Ga0207680_10015536 | Ga0207680_100155362 | 348 |
| 9 | 3300005437 | Ga0070710_10062530 | Ga0070710_100625301 | 349 |
| 10 | 3300049575 | Ga0501039_0334705 | Ga0501039_0334705_61_1137 | 351 |
| 11 | 3300049744 | Ga0501083_0214539 | Ga0501083_0214539_174_1244 | 351 |
| 12 | 3300049824 | Ga0501045_0225930 | Ga0501045_0225930_310_1380 | 351 |
| 13 | 3300046475 | Ga0495639_0103973 | Ga0495639_0103973_35_1138 | 352 |
| 14 | 3300047321 | Ga0495676_0088524 | Ga0495676_0088524_1205_2308 | 352 |
| 15 | 3300037853 | Ga0436364_1064204 | Ga0436364_1064204_829_1905 | 354 |
| 16 | 3300038443 | Ga0395901_0102892 | Ga0395901_0102892_1900_2982 | 356 |
| 17 | 3300048924 | Ga0496121_0143989 | Ga0496121_0143989_13_1095 | 356 |
| 18 | 3300047471 | Ga0495684_0021791 | Ga0495684_0021791_43_1173 | 361 |
| 19 | 3300048907 | Ga0496104_0183507 | Ga0496104_0183507_879_1985 | 364 |
| 20 | 3300005535 | Ga0070684_100170378 | Ga0070684_1001703781 | 366 |
| 21 | 3300005616 | Ga0068852_100091853 | Ga0068852_1000918533 | 366 |
| 22 | 3300009174 | Ga0105241_10093328 | Ga0105241_100933282 | 366 |
| 23 | 3300026142 | Ga0207698_10251426 | Ga0207698_102514262 | 366 |
| 24 | 3300049588 | Ga0501072_0201423 | Ga0501072_0201423_456_1571 | 366 |
| 25 | 3300005518 | Ga0070699_100140716 | Ga0070699_1001407162 | 371 |
| 26 | 3300025944 | Ga0207661_10014103 | Ga0207661_100141032 | 373 |
| 27 | iso_pu_bacteria | 2885350715 | 2885357253 | 373 |
| 28 | 3300005468 | Ga0070707_100198662 | Ga0070707_1001986622 | 375 |
| 29 | 3300035692 | Ga0373935_0018325 | Ga0373935_0018325_1696_2892 | 380 |
| 30 | 3300049581 | Ga0501047_0153668 | Ga0501047_0153668_934_2139 | 382 |
| 31 | 3300002739 | JGI25158J39367_1002299 | JGI25158J39367_10022993 | 383 |
| 32 | 3300002773 | JGI25152J39213_1010362 | JGI25152J39213_10103621 | 383 |
| 33 | 3300002987 | JGI25159J45721_1001122 | JGI25159J45721_100112211 | 383 |
| 34 | 3300003215 | JGI25153J46596_10009375 | JGI25153J46596_100093754 | 383 |
| 35 | 3300003354 | JGI25160J50197_1006532 | JGI25160J50197_10065322 | 383 |
| 36 | 3300003374 | JGI25161J50226_1000107 | JGI25161J50226_100010720 | 383 |
| 37 | 3300003771 | Ga0055526_1012791 | Ga0055526_10127912 | 383 |
| 38 | 3300003790 | Ga0055528_1006645 | Ga0055528_10066455 | 383 |
| 39 | 3300003792 | Ga0055540_1024873 | Ga0055540_10248731 | 383 |
| 40 | 3300004625 | Ga0055543_1000582 | Ga0055543_100058211 | 383 |
| 41 | 3300005337 | Ga0070682_100118364 | Ga0070682_1001183642 | 383 |
| 42 | 3300025208 | Ga0209436_100011 | Ga0209436_10001147 | 383 |
| 43 | 3300025258 | Ga0209129_1000256 | Ga0209129_10002569 | 383 |
| 44 | 3300025273 | Ga0209673_1003792 | Ga0209673_10037928 | 383 |
| 45 | 3300025284 | Ga0209130_1000081 | Ga0209130_1000081121 | 383 |
| 46 | 3300025295 | Ga0209564_1000225 | Ga0209564_100022511 | 383 |
| 47 | 3300025297 | Ga0209758_1001254 | Ga0209758_100125422 | 383 |
| 48 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008601 | 383 |
| 49 | 3300025303 | Ga0209051_1015211 | Ga0209051_10152114 | 383 |
| 50 | 3300025304 | Ga0209257_1024367 | Ga0209257_10243672 | 383 |
| 51 | 3300041413 | Ga0439465_0012607 | Ga0439465_0012607_1240_2478 | 383 |
| 52 | 3300053134 | Ga0500658_0003580 | Ga0500658_0003580_1158_2390 | 383 |
| 53 | 3300039437 | Ga0436365_0368498 | Ga0436365_0368498_315_1514 | 385 |
| 54 | 3300053093 | Ga0500651_0093660 | Ga0500651_0093660_282_1520 | 385 |
| 55 | 3300053139 | Ga0500568_0000266 | Ga0500568_0000266_29515_30753 | 385 |
| 56 | iso_pu_bacteria | 2842482326 | 2842487355 | 387 |
| 57 | 3300002773 | JGI25152J39213_1001304 | JGI25152J39213_10013049 | 389 |
| 58 | 3300003215 | JGI25153J46596_10003331 | JGI25153J46596_100033316 | 389 |
| 59 | 3300025258 | Ga0209129_1000727 | Ga0209129_100072712 | 389 |
| 60 | 3300025294 | Ga0209025_1003369 | Ga0209025_10033694 | 389 |
| 61 | 3300025297 | Ga0209758_1000463 | Ga0209758_100046326 | 389 |
| 62 | 3300005356 | Ga0070674_100051325 | Ga0070674_1000513252 | 390 |
| 63 | 3300009545 | Ga0105237_10315768 | Ga0105237_103157681 | 393 |
| 64 | 3300049579 | Ga0501043_0277233 | Ga0501043_0277233_63_1274 | 393 |
| 65 | iso_pu_bacteria | 2835312727 | 2835316481 | 393 |
| 66 | iso_pu_bacteria | 2894232714 | 2894242604 | 393 |
| 67 | 3300005353 | Ga0070669_100201815 | Ga0070669_1002018151 | 394 |
| 68 | 3300005471 | Ga0070698_100146484 | Ga0070698_1001464843 | 394 |
| 69 | 3300005518 | Ga0070699_100111107 | Ga0070699_1001111072 | 394 |
| 70 | 3300006880 | Ga0075429_100017086 | Ga0075429_1000170864 | 394 |
| 71 | 3300009147 | Ga0114129_10115763 | Ga0114129_101157633 | 394 |
| 72 | 3300014326 | Ga0157380_10062555 | Ga0157380_100625553 | 394 |
| 73 | 3300031730 | Ga0307516_10046143 | Ga0307516_100461432 | 394 |
| 74 | 3300045051 | Ga0451576_0054093 | Ga0451576_0054093_1614_2858 | 394 |
| 75 | 3300050507 | nmdc:mga05p37_31241_c1 | nmdc:mga05p37_31241_c1_4895_6142 | 394 |
| 76 | 3300050508 | nmdc:mga09592_33207_c1 | nmdc:mga09592_33207_c1_2955_4202 | 394 |
| 77 | 3300060353 | Ga0501082_0139642 | Ga0501082_0139642_102_1349 | 394 |
| 78 | 3300031548 | Ga0307408_100187294 | Ga0307408_1001872942 | 395 |
| 79 | 3300044693 | Ga0466961_0184879 | Ga0466961_0184879_66_1271 | 396 |
| 80 | 3300049579 | Ga0501043_0154934 | Ga0501043_0154934_421_1671 | 396 |
| 81 | 3300049586 | Ga0501070_0192404 | Ga0501070_0192404_230_1480 | 396 |
| 82 | 3300049588 | Ga0501072_0138002 | Ga0501072_0138002_707_1912 | 396 |
| 83 | 3300049590 | Ga0501074_0175316 | Ga0501074_0175316_38_1288 | 396 |
| 84 | 3300049823 | Ga0501044_0255644 | Ga0501044_0255644_274_1524 | 396 |
| 85 | 3300010375 | Ga0105239_10078451 | Ga0105239_100784513 | 397 |
| 86 | 3300025913 | Ga0207695_10019831 | Ga0207695_100198315 | 397 |
| 87 | 3300031247 | Ga0265340_10006865 | Ga0265340_100068655 | 397 |
| 88 | 3300031711 | Ga0265314_10050991 | Ga0265314_100509912 | 397 |
| 89 | 3300032004 | Ga0307414_10044899 | Ga0307414_100448993 | 397 |
| 90 | 3300035111 | Ga0373923_0008421 | Ga0373923_0008421_880_2118 | 397 |
| 91 | 3300035118 | Ga0373954_0033651 | Ga0373954_0033651_638_1876 | 397 |
| 92 | 3300035119 | Ga0373956_0027329 | Ga0373956_0027329_668_1906 | 397 |
| 93 | 3300035120 | Ga0373957_0011252 | Ga0373957_0011252_572_1810 | 397 |
| 94 | 3300035410 | Ga0373924_0009058 | Ga0373924_0009058_623_1861 | 397 |
| 95 | 3300035695 | Ga0373927_0025778 | Ga0373927_0025778_1578_2822 | 397 |
| 96 | 3300035724 | Ga0373933_0004475 | Ga0373933_0004475_5941_7179 | 397 |
| 97 | 3300036401 | Ga0373937_0019871 | Ga0373937_0019871_1761_2999 | 397 |
| 98 | 3300045051 | Ga0451576_0021895 | Ga0451576_0021895_5440_6750 | 397 |
| 99 | 3300046454 | Ga0495592_0020724 | Ga0495592_0020724_750_1988 | 397 |
| 100 | 3300046459 | Ga0495629_0001678 | Ga0495629_0001678_8615_9853 | 397 |
| 101 | 3300046462 | Ga0495651_0000610 | Ga0495651_0000610_3047_4285 | 397 |
| 102 | 3300046463 | Ga0495653_0025224 | Ga0495653_0025224_1570_2808 | 397 |
| 103 | 3300046476 | Ga0495662_0044135 | Ga0495662_0044135_890_2128 | 397 |
| 104 | 3300046477 | Ga0495664_0059336 | Ga0495664_0059336_811_2049 | 397 |
| 105 | 3300046511 | Ga0495608_0006351 | Ga0495608_0006351_3906_5144 | 397 |
| 106 | 3300046516 | Ga0495628_0062018 | Ga0495628_0062018_822_2060 | 397 |
| 107 | 3300046529 | Ga0495652_0036439 | Ga0495652_0036439_726_1964 | 397 |
| 108 | 3300046533 | Ga0495640_0002140 | Ga0495640_0002140_6766_8004 | 397 |
| 109 | 3300046536 | Ga0495587_0006491 | Ga0495587_0006491_2442_3680 | 397 |
| 110 | 3300046543 | Ga0495645_0129786 | Ga0495645_0129786_309_1547 | 397 |
| 111 | 3300046559 | Ga0495667_0019448 | Ga0495667_0019448_3248_4486 | 397 |
| 112 | 3300046642 | Ga0495634_0009370 | Ga0495634_0009370_473_1711 | 397 |
| 113 | 3300046663 | Ga0495635_0015802 | Ga0495635_0015802_1286_2524 | 397 |
| 114 | 3300046675 | Ga0495657_0037776 | Ga0495657_0037776_1889_3127 | 397 |
| 115 | 3300046678 | Ga0495599_0024822 | Ga0495599_0024822_1890_3128 | 397 |
| 116 | 3300046679 | Ga0495623_0010233 | Ga0495623_0010233_1573_2811 | 397 |
| 117 | 3300046680 | Ga0495646_0028281 | Ga0495646_0028281_504_1742 | 397 |
| 118 | 3300046689 | Ga0495613_0019822 | Ga0495613_0019822_1462_2700 | 397 |
| 119 | 3300046690 | Ga0495624_0062130 | Ga0495624_0062130_1049_2287 | 397 |
| 120 | 3300046809 | Ga0495600_0034059 | Ga0495600_0034059_1569_2807 | 397 |
| 121 | 3300047315 | Ga0495581_0055881 | Ga0495581_0055881_239_1477 | 397 |
| 122 | 3300047317 | Ga0495604_0000493 | Ga0495604_0000493_30120_31358 | 397 |
| 123 | 3300047319 | Ga0495674_0014377 | Ga0495674_0014377_4716_5954 | 397 |
| 124 | 3300047322 | Ga0495680_0018467 | Ga0495680_0018467_1567_2805 | 397 |
| 125 | 3300047444 | Ga0495675_0000723 | Ga0495675_0000723_2899_4137 | 397 |
| 126 | 3300047471 | Ga0495684_0017567 | Ga0495684_0017567_822_2060 | 397 |
| 127 | 3300048088 | Ga0495602_0048600 | Ga0495602_0048600_2460_3698 | 397 |
| 128 | 3300048929 | Ga0496126_0056165 | Ga0496126_0056165_2089_3351 | 397 |
| 129 | 3300053078 | Ga0495612_0005267 | Ga0495612_0005267_1577_2815 | 397 |
| 130 | 3300053084 | Ga0495595_0016956 | Ga0495595_0016956_345_1583 | 397 |
| 131 | 3300031241 | Ga0265325_10063935 | Ga0265325_100639352 | 398 |
| 132 | 3300048913 | Ga0496110_0126086 | Ga0496110_0126086_918_2171 | 398 |
| 133 | 3300049572 | Ga0501036_0062191 | Ga0501036_0062191_1434_2684 | 398 |
| 134 | 3300049576 | Ga0501040_0003065 | Ga0501040_0003065_1583_2833 | 398 |
| 135 | 3300049578 | Ga0501042_0017146 | Ga0501042_0017146_1244_2494 | 398 |
| 136 | 3300049582 | Ga0501048_0045246 | Ga0501048_0045246_1841_3091 | 398 |
| 137 | 3300049588 | Ga0501072_0017304 | Ga0501072_0017304_2524_3774 | 398 |
| 138 | 3300049590 | Ga0501074_0017979 | Ga0501074_0017979_2886_4136 | 398 |
| 139 | 3300049591 | Ga0501075_0018520 | Ga0501075_0018520_3642_4892 | 398 |
| 140 | 3300049592 | Ga0501076_0000841 | Ga0501076_0000841_12910_14160 | 398 |
| 141 | 3300049593 | Ga0501077_0032318 | Ga0501077_0032318_260_1510 | 398 |
| 142 | 3300049741 | Ga0501079_0041719 | Ga0501079_0041719_1377_2627 | 398 |
| 143 | 3300049742 | Ga0501080_0017561 | Ga0501080_0017561_136_1386 | 398 |
| 144 | 3300049743 | Ga0501081_0006654 | Ga0501081_0006654_1844_3094 | 398 |
| 145 | 3300049824 | Ga0501045_0002675 | Ga0501045_0002675_2271_3521 | 398 |
| 146 | 3300054114 | Ga0501084_0001395 | Ga0501084_0001395_16316_17566 | 398 |
| 147 | 3300060353 | Ga0501082_0016399 | Ga0501082_0016399_343_1593 | 398 |
| 148 | 3300061734 | Ga0530510_0157975 | Ga0530510_0157975_331_1581 | 398 |
| 149 | 3300005354 | Ga0070675_100132395 | Ga0070675_1001323952 | 399 |
| 150 | 3300005356 | Ga0070674_100049116 | Ga0070674_1000491163 | 399 |
| 151 | 3300005548 | Ga0070665_100324164 | Ga0070665_1003241641 | 399 |
| 152 | 3300006042 | Ga0075368_10033338 | Ga0075368_100333382 | 399 |
| 153 | 3300006048 | Ga0075363_100012523 | Ga0075363_1000125234 | 399 |
| 154 | 3300006178 | Ga0075367_10000846 | Ga0075367_100008464 | 399 |
| 155 | 3300006844 | Ga0075428_100015143 | Ga0075428_1000151437 | 399 |
| 156 | 3300006847 | Ga0075431_100036917 | Ga0075431_1000369173 | 399 |
| 157 | 3300006847 | Ga0075431_100144076 | Ga0075431_1001440762 | 399 |
| 158 | 3300006880 | Ga0075429_100056526 | Ga0075429_1000565263 | 399 |
| 159 | 3300006914 | Ga0075436_100001270 | Ga0075436_10000127011 | 399 |
| 160 | 3300007076 | Ga0075435_100095765 | Ga0075435_1000957652 | 399 |
| 161 | 3300009147 | Ga0114129_10038882 | Ga0114129_100388823 | 399 |
| 162 | 3300009147 | Ga0114129_10087332 | Ga0114129_100873324 | 399 |
| 163 | 3300026075 | Ga0207708_10122092 | Ga0207708_101220922 | 399 |
| 164 | 3300026118 | Ga0207675_100020296 | Ga0207675_1000202964 | 399 |
| 165 | 3300027866 | Ga0209813_10003422 | Ga0209813_100034224 | 399 |
| 166 | 3300028379 | Ga0268266_10178750 | Ga0268266_101787501 | 399 |
| 167 | 3300031238 | Ga0265332_10001742 | Ga0265332_1000174212 | 399 |
| 168 | 3300031241 | Ga0265325_10018837 | Ga0265325_100188374 | 399 |
| 169 | 3300031247 | Ga0265340_10002898 | Ga0265340_100028982 | 399 |
| 170 | 3300031247 | Ga0265340_10038504 | Ga0265340_100385042 | 399 |
| 171 | 3300031249 | Ga0265339_10008849 | Ga0265339_100088497 | 399 |
| 172 | 3300031249 | Ga0265339_10037461 | Ga0265339_100374612 | 399 |
| 173 | 3300031344 | Ga0265316_10036780 | Ga0265316_100367802 | 399 |
| 174 | 3300031711 | Ga0265314_10061231 | Ga0265314_100612311 | 399 |
| 175 | 3300031712 | Ga0265342_10003830 | Ga0265342_1000383012 | 399 |
| 176 | 3300031712 | Ga0265342_10014206 | Ga0265342_100142062 | 399 |
| 177 | 3300032002 | Ga0307416_100261194 | Ga0307416_1002611942 | 399 |
| 178 | 3300048907 | Ga0496104_0014023 | Ga0496104_0014023_1538_2860 | 399 |
| 179 | 3300048909 | Ga0496106_0155489 | Ga0496106_0155489_231_1496 | 399 |
| 180 | 3300048911 | Ga0496108_0007323 | Ga0496108_0007323_1602_2924 | 399 |
| 181 | 3300048912 | Ga0496109_0019466 | Ga0496109_0019466_183_1505 | 399 |
| 182 | 3300048913 | Ga0496110_0007225 | Ga0496110_0007225_1586_2908 | 399 |
| 183 | 3300048916 | Ga0496113_0039052 | Ga0496113_0039052_1688_3010 | 399 |
| 184 | 3300049570 | Ga0501033_0056564 | Ga0501033_0056564_841_2103 | 399 |
| 185 | 3300049573 | Ga0501037_0011196 | Ga0501037_0011196_3576_4838 | 399 |
| 186 | 3300049574 | Ga0501038_0002575 | Ga0501038_0002575_10471_11733 | 399 |
| 187 | 3300049575 | Ga0501039_0047383 | Ga0501039_0047383_1603_2862 | 399 |
| 188 | 3300049575 | Ga0501039_0245039 | Ga0501039_0245039_131_1393 | 399 |
| 189 | 3300049577 | Ga0501041_0095615 | Ga0501041_0095615_336_1595 | 399 |
| 190 | 3300049579 | Ga0501043_0092077 | Ga0501043_0092077_808_2070 | 399 |
| 191 | 3300049580 | Ga0501046_0169760 | Ga0501046_0169760_204_1463 | 399 |
| 192 | 3300049588 | Ga0501072_0035137 | Ga0501072_0035137_2235_3494 | 399 |
| 193 | 3300049592 | Ga0501076_0025102 | Ga0501076_0025102_224_1483 | 399 |
| 194 | 3300049741 | Ga0501079_0143373 | Ga0501079_0143373_40_1299 | 399 |
| 195 | 3300049823 | Ga0501044_0031481 | Ga0501044_0031481_18_1280 | 399 |
| 196 | 3300050490 | nmdc:mga03n38_5019_c1 | nmdc:mga03n38_5019_c1_3168_4433 | 399 |
| 197 | 3300050492 | nmdc:mga0yw44_59129_c1 | nmdc:mga0yw44_59129_c1_107_1372 | 399 |
| 198 | 3300050494 | nmdc:mga06z11_1311_c1 | nmdc:mga06z11_1311_c1_4086_5351 | 399 |
| 199 | 3300050495 | nmdc:mga04h51_304_c1 | nmdc:mga04h51_304_c1_2600_3865 | 399 |
| 200 | 3300050509 | nmdc:mga0qj67_135190_c1 | nmdc:mga0qj67_135190_c1_238_1491 | 399 |
| 201 | 3300050513 | nmdc:mga0rr50_123860_c1 | nmdc:mga0rr50_123860_c1_545_1807 | 399 |
| 202 | 3300050514 | nmdc:mga08x19_22394_c1 | nmdc:mga08x19_22394_c1_2046_3308 | 399 |
| 203 | 3300054114 | Ga0501084_0035864 | Ga0501084_0035864_2459_3718 | 399 |
| 204 | 3300061734 | Ga0530510_0137457 | Ga0530510_0137457_251_1510 | 399 |
| 205 | iso_pu_bacteria | 2524023205 | 2524438845 | 399 |
| 206 | iso_pu_bacteria | 2617270742 | 2617384692 | 399 |
| 207 | iso_pu_bacteria | 2744054633 | 2745074664 | 399 |
| 208 | 3300005330 | Ga0070690_100115331 | Ga0070690_1001153311 | 400 |
| 209 | 3300005340 | Ga0070689_100019627 | Ga0070689_1000196272 | 400 |
| 210 | 3300005366 | Ga0070659_100010769 | Ga0070659_1000107694 | 400 |
| 211 | 3300006042 | Ga0075368_10038410 | Ga0075368_100384101 | 400 |
| 212 | 3300006178 | Ga0075367_10060570 | Ga0075367_100605702 | 400 |
| 213 | 3300009093 | Ga0105240_10222301 | Ga0105240_102223012 | 400 |
| 214 | 3300009098 | Ga0105245_10226059 | Ga0105245_102260592 | 400 |
| 215 | 3300009545 | Ga0105237_10081456 | Ga0105237_100814562 | 400 |
| 216 | 3300013104 | Ga0157370_10003214 | Ga0157370_100032142 | 400 |
| 217 | 3300013307 | Ga0157372_10005703 | Ga0157372_100057036 | 400 |
| 218 | 3300021388 | Ga0213875_10004901 | Ga0213875_100049015 | 400 |
| 219 | 3300025936 | Ga0207670_10086809 | Ga0207670_100868092 | 400 |
| 220 | 3300026067 | Ga0207678_10099389 | Ga0207678_100993892 | 400 |
| 221 | 3300027866 | Ga0209813_10036363 | Ga0209813_100363631 | 400 |
| 222 | 3300037853 | Ga0436364_1070065 | Ga0436364_1070065_25034_26281 | 400 |
| 223 | 3300049571 | Ga0501034_0235854 | Ga0501034_0235854_420_1673 | 400 |
| 224 | 3300049588 | Ga0501072_0012149 | Ga0501072_0012149_584_1840 | 400 |
| 225 | 3300049742 | Ga0501080_0173637 | Ga0501080_0173637_36_1280 | 400 |
| 226 | 3300050492 | nmdc:mga0yw44_45873_c1 | nmdc:mga0yw44_45873_c1_652_1926 | 400 |
| 227 | 3300050495 | nmdc:mga04h51_17470_c1 | nmdc:mga04h51_17470_c1_391_1665 | 400 |
| 228 | 3300053079 | Ga0500610_0018722 | Ga0500610_0018722_369_1625 | 400 |
| 229 | 3300053096 | Ga0500641_0002826 | Ga0500641_0002826_1591_2847 | 400 |
| 230 | 3300054114 | Ga0501084_0080925 | Ga0501084_0080925_1122_2378 | 400 |
| 231 | iso_pu_bacteria | 3003930520 | 3003935982 | 400 |
| 232 | 3300003215 | JGI25153J46596_10001582 | JGI25153J46596_100015829 | 401 |
| 233 | 3300005331 | Ga0070670_100025105 | Ga0070670_1000251053 | 401 |
| 234 | 3300005331 | Ga0070670_100079322 | Ga0070670_1000793222 | 401 |
| 235 | 3300005333 | Ga0070677_10010834 | Ga0070677_100108343 | 401 |
| 236 | 3300005356 | Ga0070674_100008781 | Ga0070674_1000087813 | 401 |
| 237 | 3300005364 | Ga0070673_100284031 | Ga0070673_1002840311 | 401 |
| 238 | 3300005456 | Ga0070678_100009904 | Ga0070678_1000099042 | 401 |
| 239 | 3300005544 | Ga0070686_100165796 | Ga0070686_1001657961 | 401 |
| 240 | 3300005841 | Ga0068863_100261937 | Ga0068863_1002619371 | 401 |
| 241 | 3300005985 | Ga0081539_10009443 | Ga0081539_100094433 | 401 |
| 242 | 3300025297 | Ga0209758_1000274 | Ga0209758_10002744 | 401 |
| 243 | 3300025893 | Ga0207682_10001278 | Ga0207682_100012783 | 401 |
| 244 | 3300025903 | Ga0207680_10170722 | Ga0207680_101707221 | 401 |
| 245 | 3300025937 | Ga0207669_10015166 | Ga0207669_100151663 | 401 |
| 246 | 3300025940 | Ga0207691_10005054 | Ga0207691_100050544 | 401 |
| 247 | 3300026089 | Ga0207648_10022746 | Ga0207648_100227463 | 401 |
| 248 | 3300026121 | Ga0207683_10004106 | Ga0207683_100041064 | 401 |
| 249 | 3300046453 | Ga0495627_002437 | Ga0495627_002437_4149_5429 | 401 |
| 250 | 3300046458 | Ga0495591_001814 | Ga0495591_001814_4667_5947 | 401 |
| 251 | 3300046501 | Ga0495607_0012195 | Ga0495607_0012195_3896_5176 | 401 |
| 252 | 3300046519 | Ga0495632_0002766 | Ga0495632_0002766_4473_5753 | 401 |
| 253 | 3300046537 | Ga0495598_0002725 | Ga0495598_0002725_429_1688 | 401 |
| 254 | 3300046539 | Ga0495621_0052085 | Ga0495621_0052085_104_1363 | 401 |
| 255 | 3300046665 | Ga0495661_0000884 | Ga0495661_0000884_7722_9002 | 401 |
| 256 | 3300047470 | Ga0495681_0004810 | Ga0495681_0004810_3344_4624 | 401 |
| 257 | 3300060353 | Ga0501082_0000106 | Ga0501082_0000106_26373_27677 | 401 |
| 258 | 3300005364 | Ga0070673_100082757 | Ga0070673_1000827571 | 402 |
| 259 | 3300006871 | Ga0075434_100171590 | Ga0075434_1001715902 | 402 |
| 260 | 3300009553 | Ga0105249_10102490 | Ga0105249_101024903 | 402 |
| 261 | 3300025923 | Ga0207681_10159173 | Ga0207681_101591732 | 402 |
| 262 | 3300031238 | Ga0265332_10009754 | Ga0265332_100097543 | 402 |
| 263 | 3300031344 | Ga0265316_10055308 | Ga0265316_100553082 | 402 |
| 264 | 3300031595 | Ga0265313_10024061 | Ga0265313_100240613 | 402 |
| 265 | 3300031712 | Ga0265342_10024919 | Ga0265342_100249192 | 402 |
| 266 | 3300039437 | Ga0436365_0287489 | Ga0436365_0287489_1840_3105 | 402 |
| 267 | 3300048903 | Ga0496100_0003349 | Ga0496100_0003349_188_1447 | 402 |
| 268 | 3300050492 | nmdc:mga0yw44_19014_c1 | nmdc:mga0yw44_19014_c1_1878_3125 | 402 |
| 269 | 3300050496 | nmdc:mga07m45_88670_c1 | nmdc:mga07m45_88670_c1_244_1506 | 402 |
| 270 | 3300006178 | Ga0075367_10035335 | Ga0075367_100353353 | 403 |
| 271 | 3300046512 | Ga0495610_0010487 | Ga0495610_0010487_771_2051 | 403 |
| 272 | 3300046515 | Ga0495620_0002604 | Ga0495620_0002604_6436_7716 | 403 |
| 273 | 3300046530 | Ga0495654_0071769 | Ga0495654_0071769_48_1328 | 403 |
| 274 | 3300047470 | Ga0495681_0025078 | Ga0495681_0025078_1748_3028 | 403 |
| 275 | 3300049581 | Ga0501047_0024859 | Ga0501047_0024859_1039_2301 | 403 |
| 276 | 3300049589 | Ga0501073_0004868 | Ga0501073_0004868_2138_3400 | 403 |
| 277 | iso_pu_bacteria | 2545555834 | 2545676048 | 403 |
| 278 | iso_pu_bacteria | 3003665799 | 3003668294 | 403 |
| 279 | iso_pu_bacteria | 641522639 | 641645483 | 403 |
| 280 | iso_pu_bacteria | 643348564 | 643603707 | 403 |
| 281 | 3300006038 | Ga0075365_10005638 | Ga0075365_100056385 | 404 |
| 282 | 3300006871 | Ga0075434_100194124 | Ga0075434_1001941241 | 404 |
| 283 | 3300035692 | Ga0373935_0048158 | Ga0373935_0048158_897_2168 | 404 |
| 284 | 3300035725 | Ga0373947_0022758 | Ga0373947_0022758_1857_3128 | 404 |
| 285 | 3300037068 | Ga0373925_0168634 | Ga0373925_0168634_440_1711 | 404 |
| 286 | 3300046473 | Ga0495582_0061204 | Ga0495582_0061204_690_1961 | 404 |
| 287 | 3300049570 | Ga0501033_0018340 | Ga0501033_0018340_1129_2394 | 404 |
| 288 | 3300049823 | Ga0501044_0230003 | Ga0501044_0230003_293_1528 | 404 |
| 289 | 3300050512 | nmdc:mga0n895_146258_c1 | nmdc:mga0n895_146258_c1_1065_2333 | 404 |
| 290 | 3300050513 | nmdc:mga0rr50_70470_c1 | nmdc:mga0rr50_70470_c1_1200_2468 | 404 |
| 291 | iso_pu_bacteria | 2871488783 | 2871492010 | 404 |
| 292 | iso_pu_bacteria | 2881147464 | 2881153182 | 404 |
| 293 | 3300005329 | Ga0070683_100082404 | Ga0070683_1000824043 | 405 |
| 294 | 3300005530 | Ga0070679_100063247 | Ga0070679_1000632472 | 405 |
| 295 | 3300005719 | Ga0068861_100082580 | Ga0068861_1000825801 | 405 |
| 296 | 3300009147 | Ga0114129_10201076 | Ga0114129_102010762 | 405 |
| 297 | 3300039437 | Ga0436365_0153483 | Ga0436365_0153483_1591_2853 | 405 |
| 298 | 3300049575 | Ga0501039_0088852 | Ga0501039_0088852_1021_2280 | 405 |
| 299 | 3300049576 | Ga0501040_0082435 | Ga0501040_0082435_651_1928 | 405 |
| 300 | 3300049741 | Ga0501079_0061836 | Ga0501079_0061836_1184_2443 | 405 |
| 301 | 3300050510 | nmdc:mga06r32_340496_c1 | nmdc:mga06r32_340496_c1_106_1422 | 405 |
| 302 | 3300060353 | Ga0501082_0203591 | Ga0501082_0203591_18_1295 | 405 |
| 303 | iso_pu_bacteria | 2773857925 | 2774870079 | 405 |
| 304 | iso_pu_bacteria | 2909042592 | 2909043278 | 405 |
| 305 | 3300005548 | Ga0070665_100095184 | Ga0070665_1000951842 | 406 |
| 306 | 3300005577 | Ga0068857_100002875 | Ga0068857_1000028753 | 406 |
| 307 | 3300005937 | Ga0081455_10003599 | Ga0081455_1000359914 | 406 |
| 308 | 3300006177 | Ga0075362_10001115 | Ga0075362_100011156 | 406 |
| 309 | 3300025915 | Ga0207693_10002435 | Ga0207693_1000243510 | 406 |
| 310 | 3300025921 | Ga0207652_10045927 | Ga0207652_100459271 | 406 |
| 311 | 3300047320 | Ga0495672_0119053 | Ga0495672_0119053_25_1281 | 406 |
| 312 | 3300048919 | Ga0496116_0081607 | Ga0496116_0081607_272_1510 | 406 |
| 313 | 3300050489 | nmdc:mga03683_1555_c1 | nmdc:mga03683_1555_c1_4070_5314 | 406 |
| 314 | iso_pu_bacteria | 2842694124 | 2842695935 | 406 |
| 315 | 3300005331 | Ga0070670_100001165 | Ga0070670_1000011658 | 407 |
| 316 | 3300005355 | Ga0070671_100003482 | Ga0070671_10000348210 | 407 |
| 317 | 3300005364 | Ga0070673_100002286 | Ga0070673_1000022865 | 407 |
| 318 | 3300005365 | Ga0070688_100081022 | Ga0070688_1000810221 | 407 |
| 319 | 3300005439 | Ga0070711_100032057 | Ga0070711_1000320572 | 407 |
| 320 | 3300006028 | Ga0070717_10025365 | Ga0070717_100253652 | 407 |
| 321 | 3300010375 | Ga0105239_10045357 | Ga0105239_100453575 | 407 |
| 322 | 3300010375 | Ga0105239_10098173 | Ga0105239_100981734 | 407 |
| 323 | 3300014969 | Ga0157376_10131633 | Ga0157376_101316331 | 407 |
| 324 | 3300021388 | Ga0213875_10007859 | Ga0213875_100078593 | 407 |
| 325 | 3300025904 | Ga0207647_10006008 | Ga0207647_100060082 | 407 |
| 326 | 3300025925 | Ga0207650_10003218 | Ga0207650_100032184 | 407 |
| 327 | 3300025931 | Ga0207644_10005789 | Ga0207644_100057893 | 407 |
| 328 | 3300025945 | Ga0207679_10135078 | Ga0207679_101350782 | 407 |
| 329 | 3300025960 | Ga0207651_10003911 | Ga0207651_100039113 | 407 |
| 330 | 3300026078 | Ga0207702_10203627 | Ga0207702_102036272 | 407 |
| 331 | 3300028556 | Ga0265337_1000974 | Ga0265337_100097418 | 407 |
| 332 | 3300028558 | Ga0265326_10000532 | Ga0265326_100005326 | 407 |
| 333 | 3300028563 | Ga0265319_1003936 | Ga0265319_10039367 | 407 |
| 334 | 3300028573 | Ga0265334_10000118 | Ga0265334_100001182 | 407 |
| 335 | 3300028577 | Ga0265318_10000794 | Ga0265318_100007943 | 407 |
| 336 | 3300028653 | Ga0265323_10000061 | Ga0265323_1000006127 | 407 |
| 337 | 3300028666 | Ga0265336_10000312 | Ga0265336_1000031221 | 407 |
| 338 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013297 | 407 |
| 339 | 3300029957 | Ga0265324_10001301 | Ga0265324_100013019 | 407 |
| 340 | 3300031249 | Ga0265339_10000145 | Ga0265339_1000014541 | 407 |
| 341 | 3300031595 | Ga0265313_10000173 | Ga0265313_1000017361 | 407 |
| 342 | 3300035724 | Ga0373933_0051462 | Ga0373933_0051462_612_1850 | 407 |
| 343 | 3300037853 | Ga0436364_0520243 | Ga0436364_0520243_11478_12734 | 407 |
| 344 | 3300039437 | Ga0436365_0402221 | Ga0436365_0402221_822_2075 | 407 |
| 345 | 3300039438 | Ga0436360_1260076 | Ga0436360_1260076_315_1556 | 407 |
| 346 | 3300039450 | Ga0436363_1307388 | Ga0436363_1307388_466_1719 | 407 |
| 347 | 3300046462 | Ga0495651_0025597 | Ga0495651_0025597_328_1566 | 407 |
| 348 | 3300046511 | Ga0495608_0096067 | Ga0495608_0096067_103_1341 | 407 |
| 349 | 3300046512 | Ga0495610_0001005 | Ga0495610_0001005_3924_5165 | 407 |
| 350 | 3300046516 | Ga0495628_0137743 | Ga0495628_0137743_610_1848 | 407 |
| 351 | 3300046536 | Ga0495587_0092621 | Ga0495587_0092621_390_1628 | 407 |
| 352 | 3300046543 | Ga0495645_0087925 | Ga0495645_0087925_140_1378 | 407 |
| 353 | 3300046679 | Ga0495623_0065686 | Ga0495623_0065686_907_2145 | 407 |
| 354 | 3300047317 | Ga0495604_0096244 | Ga0495604_0096244_844_2082 | 407 |
| 355 | 3300047472 | Ga0495686_0008314 | Ga0495686_0008314_3277_4518 | 407 |
| 356 | 3300048908 | Ga0496105_0140891 | Ga0496105_0140891_452_1768 | 407 |
| 357 | 3300048924 | Ga0496121_0044519 | Ga0496121_0044519_1026_2300 | 407 |
| 358 | 3300048927 | Ga0496124_0024561 | Ga0496124_0024561_3150_4424 | 407 |
| 359 | 3300049459 | Ga0495678_008214 | Ga0495678_008214_3870_5111 | 407 |
| 360 | 3300049582 | Ga0501048_0000737 | Ga0501048_0000737_14663_15904 | 407 |
| 361 | iso_pu_bacteria | 2775506901 | 2776260590 | 407 |
| 362 | 3300003758 | Ga0055532_1000494 | Ga0055532_10004942 | 408 |
| 363 | 3300031995 | Ga0307409_100063204 | Ga0307409_1000632041 | 408 |
| 364 | 3300032126 | Ga0307415_100062560 | Ga0307415_1000625602 | 408 |
| 365 | 3300037068 | Ga0373925_0153215 | Ga0373925_0153215_108_1394 | 408 |
| 366 | 3300039450 | Ga0436363_0945108 | Ga0436363_0945108_142_1443 | 408 |
| 367 | 3300039453 | Ga0436362_0821772 | Ga0436362_0821772_245_1546 | 408 |
| 368 | 3300041408 | Ga0439453_0000303 | Ga0439453_0000303_250_1494 | 408 |
| 369 | 3300042003 | Ga0439443_002130 | Ga0439443_002130_574_1818 | 408 |
| 370 | 3300046476 | Ga0495662_0008776 | Ga0495662_0008776_3183_4469 | 408 |
| 371 | 3300046477 | Ga0495664_0016514 | Ga0495664_0016514_470_1756 | 408 |
| 372 | 3300046642 | Ga0495634_0063775 | Ga0495634_0063775_356_1642 | 408 |
| 373 | 3300046663 | Ga0495635_0045940 | Ga0495635_0045940_435_1721 | 408 |
| 374 | iso_pu_bacteria | 2842333319 | 2842336133 | 408 |
| 375 | iso_pu_bacteria | 2844533157 | 2844538136 | 408 |
| 376 | 3300005328 | Ga0070676_10022031 | Ga0070676_100220313 | 409 |
| 377 | 3300005329 | Ga0070683_100001114 | Ga0070683_10000111411 | 409 |
| 378 | 3300005331 | Ga0070670_100003204 | Ga0070670_1000032042 | 409 |
| 379 | 3300005333 | Ga0070677_10002369 | Ga0070677_100023693 | 409 |
| 380 | 3300005335 | Ga0070666_10008457 | Ga0070666_100084573 | 409 |
| 381 | 3300005336 | Ga0070680_100057820 | Ga0070680_1000578202 | 409 |
| 382 | 3300005338 | Ga0068868_100003512 | Ga0068868_1000035126 | 409 |
| 383 | 3300005354 | Ga0070675_100000071 | Ga0070675_10000007135 | 409 |
| 384 | 3300005355 | Ga0070671_100002286 | Ga0070671_1000022866 | 409 |
| 385 | 3300005356 | Ga0070674_100030405 | Ga0070674_1000304052 | 409 |
| 386 | 3300005364 | Ga0070673_100000149 | Ga0070673_10000014923 | 409 |
| 387 | 3300005456 | Ga0070678_100000010 | Ga0070678_10000001034 | 409 |
| 388 | 3300005459 | Ga0068867_100004805 | Ga0068867_1000048053 | 409 |
| 389 | 3300005467 | Ga0070706_100015055 | Ga0070706_1000150554 | 409 |
| 390 | 3300005535 | Ga0070684_100021509 | Ga0070684_1000215092 | 409 |
| 391 | 3300005543 | Ga0070672_100000312 | Ga0070672_10000031224 | 409 |
| 392 | 3300005547 | Ga0070693_100052052 | Ga0070693_1000520522 | 409 |
| 393 | 3300005564 | Ga0070664_100001594 | Ga0070664_10000159414 | 409 |
| 394 | 3300005578 | Ga0068854_100056670 | Ga0068854_1000566702 | 409 |
| 395 | 3300005617 | Ga0068859_100100598 | Ga0068859_1001005982 | 409 |
| 396 | 3300005618 | Ga0068864_100001555 | Ga0068864_1000015555 | 409 |
| 397 | 3300005834 | Ga0068851_10000460 | Ga0068851_100004605 | 409 |
| 398 | 3300005841 | Ga0068863_100035080 | Ga0068863_1000350804 | 409 |
| 399 | 3300006237 | Ga0097621_100000056 | Ga0097621_10000005642 | 409 |
| 400 | 3300006358 | Ga0068871_100000774 | Ga0068871_1000007745 | 409 |
| 401 | 3300006846 | Ga0075430_100001905 | Ga0075430_1000019056 | 409 |
| 402 | 3300006847 | Ga0075431_100000201 | Ga0075431_10000020116 | 409 |
| 403 | 3300006931 | Ga0097620_100100605 | Ga0097620_1001006052 | 409 |
| 404 | 3300009176 | Ga0105242_10086692 | Ga0105242_100866922 | 409 |
| 405 | 3300013296 | Ga0157374_10000729 | Ga0157374_1000072914 | 409 |
| 406 | 3300013297 | Ga0157378_10044739 | Ga0157378_100447392 | 409 |
| 407 | 3300013306 | Ga0163162_10002289 | Ga0163162_100022894 | 409 |
| 408 | 3300013306 | Ga0163162_10103771 | Ga0163162_101037712 | 409 |
| 409 | 3300013308 | Ga0157375_10002204 | Ga0157375_100022049 | 409 |
| 410 | 3300014969 | Ga0157376_10018572 | Ga0157376_100185723 | 409 |
| 411 | 3300014969 | Ga0157376_10030414 | Ga0157376_100304144 | 409 |
| 412 | 3300017792 | Ga0163161_10047292 | Ga0163161_100472922 | 409 |
| 413 | 3300025315 | Ga0207697_10048270 | Ga0207697_100482702 | 409 |
| 414 | 3300025321 | Ga0207656_10000449 | Ga0207656_100004494 | 409 |
| 415 | 3300025893 | Ga0207682_10006187 | Ga0207682_100061872 | 409 |
| 416 | 3300025907 | Ga0207645_10007946 | Ga0207645_100079467 | 409 |
| 417 | 3300025910 | Ga0207684_10042087 | Ga0207684_100420873 | 409 |
| 418 | 3300025912 | Ga0207707_10043005 | Ga0207707_100430052 | 409 |
| 419 | 3300025925 | Ga0207650_10000612 | Ga0207650_1000061228 | 409 |
| 420 | 3300025925 | Ga0207650_10020245 | Ga0207650_100202452 | 409 |
| 421 | 3300025926 | Ga0207659_10000756 | Ga0207659_1000075611 | 409 |
| 422 | 3300025926 | Ga0207659_10039129 | Ga0207659_100391293 | 409 |
| 423 | 3300025931 | Ga0207644_10000182 | Ga0207644_1000018227 | 409 |
| 424 | 3300025933 | Ga0207706_10014234 | Ga0207706_100142341 | 409 |
| 425 | 3300025934 | Ga0207686_10164092 | Ga0207686_101640921 | 409 |
| 426 | 3300025940 | Ga0207691_10001156 | Ga0207691_1000115613 | 409 |
| 427 | 3300025940 | Ga0207691_10032387 | Ga0207691_100323872 | 409 |
| 428 | 3300025944 | Ga0207661_10001359 | Ga0207661_1000135911 | 409 |
| 429 | 3300025945 | Ga0207679_10004539 | Ga0207679_100045395 | 409 |
| 430 | 3300025960 | Ga0207651_10000237 | Ga0207651_100002376 | 409 |
| 431 | 3300025981 | Ga0207640_10074107 | Ga0207640_100741071 | 409 |
| 432 | 3300026023 | Ga0207677_10010146 | Ga0207677_100101463 | 409 |
| 433 | 3300026023 | Ga0207677_10060908 | Ga0207677_100609081 | 409 |
| 434 | 3300026075 | Ga0207708_10017644 | Ga0207708_100176443 | 409 |
| 435 | 3300026088 | Ga0207641_10082861 | Ga0207641_100828612 | 409 |
| 436 | 3300026088 | Ga0207641_10169682 | Ga0207641_101696822 | 409 |
| 437 | 3300026089 | Ga0207648_10025180 | Ga0207648_100251804 | 409 |
| 438 | 3300026089 | Ga0207648_10051001 | Ga0207648_100510012 | 409 |
| 439 | 3300026089 | Ga0207648_10228141 | Ga0207648_102281412 | 409 |
| 440 | 3300026095 | Ga0207676_10004709 | Ga0207676_100047095 | 409 |
| 441 | 3300026095 | Ga0207676_10016953 | Ga0207676_100169534 | 409 |
| 442 | 3300026121 | Ga0207683_10000429 | Ga0207683_1000042914 | 409 |
| 443 | 3300026142 | Ga0207698_10003095 | Ga0207698_100030954 | 409 |
| 444 | 3300031235 | Ga0265330_10054590 | Ga0265330_100545902 | 409 |
| 445 | 3300031250 | Ga0265331_10002268 | Ga0265331_100022682 | 409 |
| 446 | 3300031711 | Ga0265314_10004506 | Ga0265314_100045062 | 409 |
| 447 | 3300031712 | Ga0265342_10062689 | Ga0265342_100626893 | 409 |
| 448 | 3300032004 | Ga0307414_10065737 | Ga0307414_100657371 | 409 |
| 449 | 3300048909 | Ga0496106_0048951 | Ga0496106_0048951_763_2016 | 409 |
| 450 | 3300048911 | Ga0496108_0000249 | Ga0496108_0000249_26529_27782 | 409 |
| 451 | 3300048911 | Ga0496108_0282254 | Ga0496108_0282254_77_1330 | 409 |
| 452 | 3300048912 | Ga0496109_0000754 | Ga0496109_0000754_4881_6134 | 409 |
| 453 | 3300048913 | Ga0496110_0000037 | Ga0496110_0000037_35906_37159 | 409 |
| 454 | 3300048914 | Ga0496111_0085144 | Ga0496111_0085144_1042_2295 | 409 |
| 455 | 3300050509 | nmdc:mga0qj67_17568_c1 | nmdc:mga0qj67_17568_c1_1726_2973 | 409 |
| 456 | 3300050510 | nmdc:mga06r32_1357_c1 | nmdc:mga06r32_1357_c1_9459_10706 | 409 |
| 457 | 3300053085 | Ga0495619_0024566 | Ga0495619_0024566_58_1305 | 409 |
| 458 | 3300053125 | Ga0500618_002296 | Ga0500618_002296_1962_3209 | 409 |
| 459 | 3300053153 | Ga0500616_0003409 | Ga0500616_0003409_9571_10827 | 409 |
| 460 | iso_pu_bacteria | 2508501050 | 2508730936 | 409 |
| 461 | iso_pu_bacteria | 2615840698 | 2616555933 | 409 |
| 462 | iso_pu_bacteria | 2643221651 | 2644289679 | 409 |
| 463 | iso_pu_bacteria | 8005682033 | 8005686194 | 409 |
| 464 | 3300003187 | JGI25151J46595_10000394 | JGI25151J46595_1000039443 | 410 |
| 465 | 3300005290 | Ga0065712_10067769 | Ga0065712_100677699 | 410 |
| 466 | 3300005329 | Ga0070683_100034427 | Ga0070683_1000344273 | 410 |
| 467 | 3300005336 | Ga0070680_100005216 | Ga0070680_10000521610 | 410 |
| 468 | 3300005347 | Ga0070668_100267313 | Ga0070668_1002673131 | 410 |
| 469 | 3300005434 | Ga0070709_10054644 | Ga0070709_100546441 | 410 |
| 470 | 3300005435 | Ga0070714_100010182 | Ga0070714_1000101821 | 410 |
| 471 | 3300005436 | Ga0070713_100241072 | Ga0070713_1002410721 | 410 |
| 472 | 3300005440 | Ga0070705_100000143 | Ga0070705_1000001436 | 410 |
| 473 | 3300005441 | Ga0070700_100017074 | Ga0070700_1000170744 | 410 |
| 474 | 3300005444 | Ga0070694_100012220 | Ga0070694_1000122206 | 410 |
| 475 | 3300005471 | Ga0070698_100107185 | Ga0070698_1001071853 | 410 |
| 476 | 3300005518 | Ga0070699_100002082 | Ga0070699_10000208217 | 410 |
| 477 | 3300005535 | Ga0070684_100051132 | Ga0070684_1000511323 | 410 |
| 478 | 3300005539 | Ga0068853_100256698 | Ga0068853_1002566981 | 410 |
| 479 | 3300005545 | Ga0070695_100035558 | Ga0070695_1000355583 | 410 |
| 480 | 3300005546 | Ga0070696_100003018 | Ga0070696_1000030187 | 410 |
| 481 | 3300005547 | Ga0070693_100002656 | Ga0070693_1000026566 | 410 |
| 482 | 3300005549 | Ga0070704_100005394 | Ga0070704_1000053949 | 410 |
| 483 | 3300005577 | Ga0068857_100009471 | Ga0068857_1000094715 | 410 |
| 484 | 3300005615 | Ga0070702_100025538 | Ga0070702_1000255383 | 410 |
| 485 | 3300005616 | Ga0068852_100169573 | Ga0068852_1001695732 | 410 |
| 486 | 3300005617 | Ga0068859_100000869 | Ga0068859_10000086912 | 410 |
| 487 | 3300005719 | Ga0068861_100085041 | Ga0068861_1000850413 | 410 |
| 488 | 3300005841 | Ga0068863_100126771 | Ga0068863_1001267712 | 410 |
| 489 | 3300005843 | Ga0068860_100000965 | Ga0068860_10000096510 | 410 |
| 490 | 3300005844 | Ga0068862_100002655 | Ga0068862_1000026554 | 410 |
| 491 | 3300006175 | Ga0070712_100159011 | Ga0070712_1001590111 | 410 |
| 492 | 3300006195 | Ga0075366_10004394 | Ga0075366_100043944 | 410 |
| 493 | 3300006847 | Ga0075431_100002907 | Ga0075431_1000029077 | 410 |
| 494 | 3300006880 | Ga0075429_100007922 | Ga0075429_1000079221 | 410 |
| 495 | 3300006931 | Ga0097620_100000869 | Ga0097620_10000086918 | 410 |
| 496 | 3300011119 | Ga0105246_10019311 | Ga0105246_100193113 | 410 |
| 497 | 3300013307 | Ga0157372_10129475 | Ga0157372_101294752 | 410 |
| 498 | 3300013307 | Ga0157372_10132123 | Ga0157372_101321232 | 410 |
| 499 | 3300014497 | Ga0182008_10046213 | Ga0182008_100462132 | 410 |
| 500 | 3300017792 | Ga0163161_10045977 | Ga0163161_100459773 | 410 |
| 501 | 3300021388 | Ga0213875_10000544 | Ga0213875_100005448 | 410 |
| 502 | 3300025284 | Ga0209130_1002240 | Ga0209130_10022406 | 410 |
| 503 | 3300025294 | Ga0209025_1000114 | Ga0209025_100011488 | 410 |
| 504 | 3300025297 | Ga0209758_1004307 | Ga0209758_100430710 | 410 |
| 505 | 3300025302 | Ga0207426_1000181 | Ga0207426_100018183 | 410 |
| 506 | 3300025315 | Ga0207697_10042424 | Ga0207697_100424242 | 410 |
| 507 | 3300025898 | Ga0207692_10051992 | Ga0207692_100519922 | 410 |
| 508 | 3300025906 | Ga0207699_10050655 | Ga0207699_100506552 | 410 |
| 509 | 3300025915 | Ga0207693_10012366 | Ga0207693_100123664 | 410 |
| 510 | 3300025915 | Ga0207693_10110886 | Ga0207693_101108862 | 410 |
| 511 | 3300025915 | Ga0207693_10165006 | Ga0207693_101650061 | 410 |
| 512 | 3300025917 | Ga0207660_10001466 | Ga0207660_100014665 | 410 |
| 513 | 3300025928 | Ga0207700_10031471 | Ga0207700_100314712 | 410 |
| 514 | 3300025933 | Ga0207706_10079339 | Ga0207706_100793392 | 410 |
| 515 | 3300025942 | Ga0207689_10047865 | Ga0207689_100478653 | 410 |
| 516 | 3300026067 | Ga0207678_10042432 | Ga0207678_100424324 | 410 |
| 517 | 3300026075 | Ga0207708_10007893 | Ga0207708_100078935 | 410 |
| 518 | 3300026116 | Ga0207674_10001607 | Ga0207674_1000160723 | 410 |
| 519 | 3300026118 | Ga0207675_100105289 | Ga0207675_1001052892 | 410 |
| 520 | 3300028380 | Ga0268265_10002137 | Ga0268265_100021374 | 410 |
| 521 | 3300028381 | Ga0268264_10001432 | Ga0268264_100014322 | 410 |
| 522 | 3300031241 | Ga0265325_10004625 | Ga0265325_100046259 | 410 |
| 523 | 3300031249 | Ga0265339_10004195 | Ga0265339_1000419510 | 410 |
| 524 | 3300031595 | Ga0265313_10033468 | Ga0265313_100334683 | 410 |
| 525 | 3300035172 | Ga0373955_0000998 | Ga0373955_0000998_3574_4824 | 410 |
| 526 | 3300035695 | Ga0373927_0099374 | Ga0373927_0099374_314_1573 | 410 |
| 527 | 3300035724 | Ga0373933_0013328 | Ga0373933_0013328_3162_4412 | 410 |
| 528 | 3300036401 | Ga0373937_0002009 | Ga0373937_0002009_12702_13952 | 410 |
| 529 | 3300037312 | Ga0395899_0021478 | Ga0395899_0021478_1855_3114 | 410 |
| 530 | 3300037418 | Ga0395900_0004380 | Ga0395900_0004380_10156_11415 | 410 |
| 531 | 3300037418 | Ga0395900_0291329 | Ga0395900_0291329_255_1514 | 410 |
| 532 | 3300037466 | Ga0395898_0079678 | Ga0395898_0079678_282_1541 | 410 |
| 533 | 3300037466 | Ga0395898_0142248 | Ga0395898_0142248_991_2250 | 410 |
| 534 | 3300037853 | Ga0436364_0124138 | Ga0436364_0124138_3161_4411 | 410 |
| 535 | 3300037853 | Ga0436364_0711362 | Ga0436364_0711362_281_1567 | 410 |
| 536 | 3300039437 | Ga0436365_0007138 | Ga0436365_0007138_26_1285 | 410 |
| 537 | 3300039437 | Ga0436365_1530619 | Ga0436365_1530619_385_1644 | 410 |
| 538 | 3300044694 | Ga0466963_0075740 | Ga0466963_0075740_208_1458 | 410 |
| 539 | 3300046462 | Ga0495651_0127850 | Ga0495651_0127850_33_1283 | 410 |
| 540 | 3300046501 | Ga0495607_0039646 | Ga0495607_0039646_1424_2704 | 410 |
| 541 | 3300046507 | Ga0495606_0001557 | Ga0495606_0001557_10495_11775 | 410 |
| 542 | 3300046507 | Ga0495606_0012545 | Ga0495606_0012545_2973_4253 | 410 |
| 543 | 3300046675 | Ga0495657_0120806 | Ga0495657_0120806_68_1318 | 410 |
| 544 | 3300046794 | Ga0495589_0001432 | Ga0495589_0001432_6384_7664 | 410 |
| 545 | 3300047444 | Ga0495675_0074569 | Ga0495675_0074569_377_1627 | 410 |
| 546 | 3300047446 | Ga0495679_002009 | Ga0495679_002009_5596_6876 | 410 |
| 547 | 3300047470 | Ga0495681_0022626 | Ga0495681_0022626_734_2014 | 410 |
| 548 | 3300048905 | Ga0496102_0005180 | Ga0496102_0005180_9641_10891 | 410 |
| 549 | 3300048909 | Ga0496106_0023015 | Ga0496106_0023015_2567_3817 | 410 |
| 550 | 3300048910 | Ga0496107_0003731 | Ga0496107_0003731_5392_6642 | 410 |
| 551 | 3300048921 | Ga0496118_0010338 | Ga0496118_0010338_3851_5131 | 410 |
| 552 | 3300048922 | Ga0496119_0007536 | Ga0496119_0007536_4145_5425 | 410 |
| 553 | 3300048923 | Ga0496120_0002850 | Ga0496120_0002850_3915_5195 | 410 |
| 554 | 3300048927 | Ga0496124_0003272 | Ga0496124_0003272_7281_8561 | 410 |
| 555 | 3300048928 | Ga0496125_0002278 | Ga0496125_0002278_16805_18085 | 410 |
| 556 | 3300048929 | Ga0496126_0052724 | Ga0496126_0052724_2250_3530 | 410 |
| 557 | 3300049569 | Ga0501032_0022335 | Ga0501032_0022335_638_1903 | 410 |
| 558 | 3300049571 | Ga0501034_0000439 | Ga0501034_0000439_53263_54534 | 410 |
| 559 | 3300049571 | Ga0501034_0000810 | Ga0501034_0000810_35136_36401 | 410 |
| 560 | 3300049572 | Ga0501036_0013370 | Ga0501036_0013370_3300_4565 | 410 |
| 561 | 3300049573 | Ga0501037_0012720 | Ga0501037_0012720_4064_5329 | 410 |
| 562 | 3300049573 | Ga0501037_0053330 | Ga0501037_0053330_1030_2301 | 410 |
| 563 | 3300049574 | Ga0501038_0107486 | Ga0501038_0107486_673_1944 | 410 |
| 564 | 3300049575 | Ga0501039_0053273 | Ga0501039_0053273_88_1359 | 410 |
| 565 | 3300049579 | Ga0501043_0003139 | Ga0501043_0003139_4463_5728 | 410 |
| 566 | 3300049579 | Ga0501043_0086433 | Ga0501043_0086433_213_1484 | 410 |
| 567 | 3300049580 | Ga0501046_0032611 | Ga0501046_0032611_1915_3165 | 410 |
| 568 | 3300049580 | Ga0501046_0040654 | Ga0501046_0040654_296_1561 | 410 |
| 569 | 3300049581 | Ga0501047_0000073 | Ga0501047_0000073_22407_23672 | 410 |
| 570 | 3300049582 | Ga0501048_0000014 | Ga0501048_0000014_69751_71016 | 410 |
| 571 | 3300049584 | Ga0501068_0146194 | Ga0501068_0146194_189_1439 | 410 |
| 572 | 3300049585 | Ga0501069_0002360 | Ga0501069_0002360_5676_6944 | 410 |
| 573 | 3300049585 | Ga0501069_0023850 | Ga0501069_0023850_1977_3245 | 410 |
| 574 | 3300049585 | Ga0501069_0099949 | Ga0501069_0099949_364_1635 | 410 |
| 575 | 3300049586 | Ga0501070_0001477 | Ga0501070_0001477_11412_12680 | 410 |
| 576 | 3300049586 | Ga0501070_0035175 | Ga0501070_0035175_2855_4120 | 410 |
| 577 | 3300049590 | Ga0501074_0011359 | Ga0501074_0011359_1980_3245 | 410 |
| 578 | 3300049741 | Ga0501079_0076301 | Ga0501079_0076301_1156_2427 | 410 |
| 579 | 3300049741 | Ga0501079_0099588 | Ga0501079_0099588_47_1297 | 410 |
| 580 | 3300049742 | Ga0501080_0004174 | Ga0501080_0004174_4494_5759 | 410 |
| 581 | 3300049743 | Ga0501081_0017788 | Ga0501081_0017788_1334_2584 | 410 |
| 582 | 3300049744 | Ga0501083_0000139 | Ga0501083_0000139_27628_28893 | 410 |
| 583 | 3300049822 | Ga0501035_0001020 | Ga0501035_0001020_26317_27585 | 410 |
| 584 | 3300049822 | Ga0501035_0090676 | Ga0501035_0090676_1080_2351 | 410 |
| 585 | 3300049823 | Ga0501044_0019808 | Ga0501044_0019808_4645_5910 | 410 |
| 586 | 3300049823 | Ga0501044_0062365 | Ga0501044_0062365_1395_2666 | 410 |
| 587 | 3300050508 | nmdc:mga09592_110940_c1 | nmdc:mga09592_110940_c1_1059_2309 | 410 |
| 588 | 3300050509 | nmdc:mga0qj67_16983_c1 | nmdc:mga0qj67_16983_c1_3492_4739 | 410 |
| 589 | 3300050510 | nmdc:mga06r32_2353_c1 | nmdc:mga06r32_2353_c1_9103_10353 | 410 |
| 590 | 3300053077 | Ga0495601_0014404 | Ga0495601_0014404_3231_4481 | 410 |
| 591 | 3300053078 | Ga0495612_0021731 | Ga0495612_0021731_979_2229 | 410 |
| 592 | 3300053084 | Ga0495595_0000433 | Ga0495595_0000433_690_1940 | 410 |
| 593 | 3300053085 | Ga0495619_0001178 | Ga0495619_0001178_1957_3207 | 410 |
| 594 | 3300053117 | Ga0500593_006931 | Ga0500593_006931_604_1860 | 410 |
| 595 | 3300054114 | Ga0501084_0025150 | Ga0501084_0025150_521_1771 | 410 |
| 596 | iso_pu_bacteria | 2582581316 | 2585334929 | 410 |
| 597 | iso_pu_bacteria | 2821443989 | 2821449011 | 410 |
| 598 | iso_pu_bacteria | 2945961074 | 2945964199 | 410 |
| 599 | 3300005340 | Ga0070689_100125242 | Ga0070689_1001252422 | 411 |
| 600 | 3300005341 | Ga0070691_10039736 | Ga0070691_100397361 | 411 |
| 601 | 3300005354 | Ga0070675_100094106 | Ga0070675_1000941062 | 411 |
| 602 | 3300005355 | Ga0070671_100089703 | Ga0070671_1000897032 | 411 |
| 603 | 3300005617 | Ga0068859_100064483 | Ga0068859_1000644832 | 411 |
| 604 | 3300005618 | Ga0068864_100074804 | Ga0068864_1000748042 | 411 |
| 605 | 3300005983 | Ga0081540_1000462 | Ga0081540_100046234 | 411 |
| 606 | 3300006931 | Ga0097620_100064479 | Ga0097620_1000644792 | 411 |
| 607 | 3300009094 | Ga0111539_10007616 | Ga0111539_1000761615 | 411 |
| 608 | 3300009177 | Ga0105248_10006927 | Ga0105248_100069279 | 411 |
| 609 | 3300009177 | Ga0105248_10449194 | Ga0105248_104491942 | 411 |
| 610 | 3300013306 | Ga0163162_10089770 | Ga0163162_100897703 | 411 |
| 611 | 3300013308 | Ga0157375_10153367 | Ga0157375_101533672 | 411 |
| 612 | 3300025931 | Ga0207644_10028334 | Ga0207644_100283342 | 411 |
| 613 | 3300025936 | Ga0207670_10003938 | Ga0207670_100039385 | 411 |
| 614 | 3300025939 | Ga0207665_10027801 | Ga0207665_100278012 | 411 |
| 615 | 3300025941 | Ga0207711_10015014 | Ga0207711_100150143 | 411 |
| 616 | 3300025972 | Ga0207668_10125597 | Ga0207668_101255972 | 411 |
| 617 | 3300026095 | Ga0207676_10015783 | Ga0207676_100157833 | 411 |
| 618 | 3300026118 | Ga0207675_100100309 | Ga0207675_1001003093 | 411 |
| 619 | 3300031665 | Ga0316575_10017105 | Ga0316575_100171052 | 411 |
| 620 | 3300031852 | Ga0307410_10029855 | Ga0307410_100298552 | 411 |
| 621 | 3300032004 | Ga0307414_10027394 | Ga0307414_100273941 | 411 |
| 622 | 3300034816 | Ga0373930_0003675 | Ga0373930_0003675_440_1702 | 411 |
| 623 | 3300035092 | Ga0373952_0005427 | Ga0373952_0005427_724_1986 | 411 |
| 624 | 3300035241 | Ga0373961_0017805 | Ga0373961_0017805_557_1819 | 411 |
| 625 | 3300035691 | Ga0373931_0010331 | Ga0373931_0010331_36_1298 | 411 |
| 626 | 3300046543 | Ga0495645_0166329 | Ga0495645_0166329_70_1332 | 411 |
| 627 | 3300048903 | Ga0496100_0001298 | Ga0496100_0001298_385_1659 | 411 |
| 628 | 3300048904 | Ga0496101_0010229 | Ga0496101_0010229_385_1659 | 411 |
| 629 | 3300048905 | Ga0496102_0035401 | Ga0496102_0035401_2320_3594 | 411 |
| 630 | 3300048905 | Ga0496102_0061264 | Ga0496102_0061264_1933_3198 | 411 |
| 631 | 3300048907 | Ga0496104_0010021 | Ga0496104_0010021_4227_5501 | 411 |
| 632 | 3300048908 | Ga0496105_0007910 | Ga0496105_0007910_2991_4265 | 411 |
| 633 | 3300048908 | Ga0496105_0085462 | Ga0496105_0085462_582_1847 | 411 |
| 634 | 3300048909 | Ga0496106_0001584 | Ga0496106_0001584_5227_6501 | 411 |
| 635 | 3300048910 | Ga0496107_0001180 | Ga0496107_0001180_5455_6729 | 411 |
| 636 | 3300048910 | Ga0496107_0011522 | Ga0496107_0011522_1231_2496 | 411 |
| 637 | 3300048911 | Ga0496108_0006169 | Ga0496108_0006169_6450_7724 | 411 |
| 638 | 3300048912 | Ga0496109_0001895 | Ga0496109_0001895_10623_11897 | 411 |
| 639 | 3300048912 | Ga0496109_0016050 | Ga0496109_0016050_969_2234 | 411 |
| 640 | 3300048913 | Ga0496110_0000172 | Ga0496110_0000172_13530_14804 | 411 |
| 641 | 3300048914 | Ga0496111_0004342 | Ga0496111_0004342_5442_6716 | 411 |
| 642 | 3300048915 | Ga0496112_0041007 | Ga0496112_0041007_999_2273 | 411 |
| 643 | 3300048916 | Ga0496113_0027772 | Ga0496113_0027772_2219_3493 | 411 |
| 644 | 3300048916 | Ga0496113_0092902 | Ga0496113_0092902_915_2177 | 411 |
| 645 | 3300048917 | Ga0496114_0020854 | Ga0496114_0020854_1447_2712 | 411 |
| 646 | 3300048918 | Ga0496115_0011903 | Ga0496115_0011903_2967_4241 | 411 |
| 647 | 3300048918 | Ga0496115_0083805 | Ga0496115_0083805_744_2009 | 411 |
| 648 | 3300048927 | Ga0496124_0081935 | Ga0496124_0081935_725_2008 | 411 |
| 649 | 3300049571 | Ga0501034_0013989 | Ga0501034_0013989_3448_4701 | 411 |
| 650 | 3300049571 | Ga0501034_0019814 | Ga0501034_0019814_4191_5465 | 411 |
| 651 | 3300049579 | Ga0501043_0041605 | Ga0501043_0041605_272_1546 | 411 |
| 652 | 3300049581 | Ga0501047_0020149 | Ga0501047_0020149_920_2173 | 411 |
| 653 | 3300049586 | Ga0501070_0200019 | Ga0501070_0200019_31_1305 | 411 |
| 654 | 3300049823 | Ga0501044_0010689 | Ga0501044_0010689_6868_8121 | 411 |
| 655 | 3300050511 | nmdc:mga08y16_16138_c1 | nmdc:mga08y16_16138_c1_1657_2910 | 411 |
| 656 | 3300053158 | Ga0500627_0046683 | Ga0500627_0046683_429_1703 | 411 |
| 657 | iso_pu_bacteria | 2617270742 | 2617385606 | 411 |
| 658 | iso_pu_bacteria | 2643221591 | 2643964909 | 411 |
| 659 | 3300005435 | Ga0070714_100041674 | Ga0070714_1000416742 | 412 |
| 660 | 3300005471 | Ga0070698_100386087 | Ga0070698_1003860871 | 412 |
| 661 | 3300005539 | Ga0068853_100068148 | Ga0068853_1000681483 | 412 |
| 662 | 3300005937 | Ga0081455_10033552 | Ga0081455_100335524 | 412 |
| 663 | 3300005981 | Ga0081538_10007364 | Ga0081538_100073643 | 412 |
| 664 | 3300005981 | Ga0081538_10010571 | Ga0081538_100105715 | 412 |
| 665 | 3300005983 | Ga0081540_1010684 | Ga0081540_10106848 | 412 |
| 666 | 3300005985 | Ga0081539_10013124 | Ga0081539_100131248 | 412 |
| 667 | 3300006844 | Ga0075428_100142799 | Ga0075428_1001427992 | 412 |
| 668 | 3300021388 | Ga0213875_10009221 | Ga0213875_100092215 | 412 |
| 669 | 3300025929 | Ga0207664_10061747 | Ga0207664_100617473 | 412 |
| 670 | 3300026041 | Ga0207639_10058282 | Ga0207639_100582822 | 412 |
| 671 | 3300037853 | Ga0436364_1318907 | Ga0436364_1318907_3896_5188 | 412 |
| 672 | 3300046512 | Ga0495610_0034384 | Ga0495610_0034384_478_1734 | 412 |
| 673 | 3300048907 | Ga0496104_0035082 | Ga0496104_0035082_762_2039 | 412 |
| 674 | 3300048911 | Ga0496108_0007378 | Ga0496108_0007378_4608_5885 | 412 |
| 675 | 3300048912 | Ga0496109_0006710 | Ga0496109_0006710_736_2013 | 412 |
| 676 | 3300048913 | Ga0496110_0001523 | Ga0496110_0001523_10773_12050 | 412 |
| 677 | 3300048914 | Ga0496111_0004089 | Ga0496111_0004089_1134_2411 | 412 |
| 678 | 3300048915 | Ga0496112_0010902 | Ga0496112_0010902_4652_5929 | 412 |
| 679 | 3300048916 | Ga0496113_0027474 | Ga0496113_0027474_115_1392 | 412 |
| 680 | 3300049569 | Ga0501032_0053160 | Ga0501032_0053160_578_1858 | 412 |
| 681 | 3300049571 | Ga0501034_0347688 | Ga0501034_0347688_36_1316 | 412 |
| 682 | 3300049573 | Ga0501037_0111982 | Ga0501037_0111982_36_1316 | 412 |
| 683 | 3300049574 | Ga0501038_0085541 | Ga0501038_0085541_548_1828 | 412 |
| 684 | 3300049575 | Ga0501039_0061618 | Ga0501039_0061618_347_1609 | 412 |
| 685 | 3300049580 | Ga0501046_0071176 | Ga0501046_0071176_663_1943 | 412 |
| 686 | 3300049581 | Ga0501047_0301531 | Ga0501047_0301531_129_1409 | 412 |
| 687 | 3300049583 | Ga0501067_0062323 | Ga0501067_0062323_147_1427 | 412 |
| 688 | 3300049584 | Ga0501068_0113161 | Ga0501068_0113161_207_1487 | 412 |
| 689 | 3300049586 | Ga0501070_0019243 | Ga0501070_0019243_1411_2691 | 412 |
| 690 | 3300049590 | Ga0501074_0143040 | Ga0501074_0143040_342_1622 | 412 |
| 691 | 3300049741 | Ga0501079_0108392 | Ga0501079_0108392_48_1328 | 412 |
| 692 | 3300049744 | Ga0501083_0018040 | Ga0501083_0018040_2007_3287 | 412 |
| 693 | 3300049822 | Ga0501035_0091227 | Ga0501035_0091227_916_2196 | 412 |
| 694 | 3300049822 | Ga0501035_0159336 | Ga0501035_0159336_639_1919 | 412 |
| 695 | 3300050510 | nmdc:mga06r32_150494_c1 | nmdc:mga06r32_150494_c1_719_1981 | 412 |
| 696 | 3300050511 | nmdc:mga08y16_170940_c1 | nmdc:mga08y16_170940_c1_585_1847 | 412 |
| 697 | iso_pu_bacteria | 2751185821 | 2753460224 | 412 |
| 698 | 3300003323 | rootH1_10208989 | rootH1_102089892 | 413 |
| 699 | 3300005336 | Ga0070680_100247849 | Ga0070680_1002478491 | 413 |
| 700 | 3300005719 | Ga0068861_100310716 | Ga0068861_1003107161 | 413 |
| 701 | 3300005985 | Ga0081539_10021831 | Ga0081539_100218313 | 413 |
| 702 | 3300006844 | Ga0075428_100001670 | Ga0075428_10000167013 | 413 |
| 703 | 3300006847 | Ga0075431_100000020 | Ga0075431_10000002029 | 413 |
| 704 | 3300006871 | Ga0075434_100130212 | Ga0075434_1001302123 | 413 |
| 705 | 3300007076 | Ga0075435_100066615 | Ga0075435_1000666153 | 413 |
| 706 | 3300009147 | Ga0114129_10000437 | Ga0114129_1000043719 | 413 |
| 707 | 3300025899 | Ga0207642_10113858 | Ga0207642_101138581 | 413 |
| 708 | 3300027312 | Ga0209371_1001447 | Ga0209371_10014473 | 413 |
| 709 | 3300030500 | Ga0268256_1000474 | Ga0268256_100047419 | 413 |
| 710 | 3300031241 | Ga0265325_10011637 | Ga0265325_100116375 | 413 |
| 711 | 3300031595 | Ga0265313_10025642 | Ga0265313_100256422 | 413 |
| 712 | 3300046660 | Ga0495625_0085858 | Ga0495625_0085858_106_1377 | 413 |
| 713 | 3300049571 | Ga0501034_0176715 | Ga0501034_0176715_383_1648 | 413 |
| 714 | 3300049572 | Ga0501036_0168931 | Ga0501036_0168931_439_1710 | 413 |
| 715 | 3300049575 | Ga0501039_0036603 | Ga0501039_0036603_679_1950 | 413 |
| 716 | 3300049576 | Ga0501040_0037634 | Ga0501040_0037634_730_1995 | 413 |
| 717 | 3300049587 | Ga0501071_0059959 | Ga0501071_0059959_59_1330 | 413 |
| 718 | 3300049588 | Ga0501072_0189251 | Ga0501072_0189251_39_1304 | 413 |
| 719 | 3300049589 | Ga0501073_0119942 | Ga0501073_0119942_275_1540 | 413 |
| 720 | 3300049592 | Ga0501076_0003123 | Ga0501076_0003123_6265_7536 | 413 |
| 721 | 3300049592 | Ga0501076_0060113 | Ga0501076_0060113_1169_2434 | 413 |
| 722 | 3300049593 | Ga0501077_0029765 | Ga0501077_0029765_504_1775 | 413 |
| 723 | 3300049741 | Ga0501079_0011565 | Ga0501079_0011565_4860_6131 | 413 |
| 724 | 3300049742 | Ga0501080_0093386 | Ga0501080_0093386_1154_2425 | 413 |
| 725 | 3300049743 | Ga0501081_0016051 | Ga0501081_0016051_1579_2844 | 413 |
| 726 | 3300049823 | Ga0501044_0144876 | Ga0501044_0144876_697_1962 | 413 |
| 727 | 3300049824 | Ga0501045_0176141 | Ga0501045_0176141_227_1492 | 413 |
| 728 | 3300050507 | nmdc:mga05p37_5052_c1 | nmdc:mga05p37_5052_c1_8453_9724 | 413 |
| 729 | 3300050510 | nmdc:mga06r32_32_c1 | nmdc:mga06r32_32_c1_69546_70817 | 413 |
| 730 | 3300050511 | nmdc:mga08y16_1157_c1 | nmdc:mga08y16_1157_c1_23352_24623 | 413 |
| 731 | 3300050511 | nmdc:mga08y16_137340_c1 | nmdc:mga08y16_137340_c1_301_1569 | 413 |
| 732 | 3300050513 | nmdc:mga0rr50_211542_c1 | nmdc:mga0rr50_211542_c1_113_1411 | 413 |
| 733 | 3300054114 | Ga0501084_0010467 | Ga0501084_0010467_193_1464 | 413 |
| 734 | 3300054114 | Ga0501084_0186316 | Ga0501084_0186316_431_1696 | 413 |
| 735 | 3300060353 | Ga0501082_0087331 | Ga0501082_0087331_1012_2277 | 413 |
| 736 | 3300061734 | Ga0530510_0085051 | Ga0530510_0085051_524_1795 | 413 |
| 737 | 3300005546 | Ga0070696_100062774 | Ga0070696_1000627743 | 414 |
| 738 | 3300005843 | Ga0068860_100238015 | Ga0068860_1002380152 | 414 |
| 739 | 3300005937 | Ga0081455_10086939 | Ga0081455_100869392 | 414 |
| 740 | 3300025961 | Ga0207712_10001669 | Ga0207712_100016698 | 414 |
| 741 | 3300035083 | Ga0373926_0030940 | Ga0373926_0030940_359_1669 | 414 |
| 742 | 3300035089 | Ga0373944_0001411 | Ga0373944_0001411_2709_4019 | 414 |
| 743 | 3300035113 | Ga0373936_0006574 | Ga0373936_0006574_1985_3295 | 414 |
| 744 | 3300035116 | Ga0373945_0000996 | Ga0373945_0000996_4088_5398 | 414 |
| 745 | 3300035170 | Ga0373943_0005000 | Ga0373943_0005000_543_1853 | 414 |
| 746 | 3300035171 | Ga0373946_0009373 | Ga0373946_0009373_1932_3242 | 414 |
| 747 | 3300035692 | Ga0373935_0005842 | Ga0373935_0005842_3914_5224 | 414 |
| 748 | 3300035695 | Ga0373927_0001137 | Ga0373927_0001137_12229_13539 | 414 |
| 749 | 3300035725 | Ga0373947_0000866 | Ga0373947_0000866_4548_5858 | 414 |
| 750 | 3300037068 | Ga0373925_0004518 | Ga0373925_0004518_4327_5637 | 414 |
| 751 | 3300046472 | Ga0495580_0092293 | Ga0495580_0092293_621_1931 | 414 |
| 752 | 3300046476 | Ga0495662_0098147 | Ga0495662_0098147_51_1361 | 414 |
| 753 | 3300046517 | Ga0495630_0002608 | Ga0495630_0002608_6799_8109 | 414 |
| 754 | 3300046531 | Ga0495665_0012191 | Ga0495665_0012191_921_2231 | 414 |
| 755 | 3300046642 | Ga0495634_0006471 | Ga0495634_0006471_3992_5302 | 414 |
| 756 | 3300046642 | Ga0495634_0057181 | Ga0495634_0057181_870_2180 | 414 |
| 757 | 3300046663 | Ga0495635_0075589 | Ga0495635_0075589_468_1778 | 414 |
| 758 | 3300046681 | Ga0495647_0016477 | Ga0495647_0016477_534_1844 | 414 |
| 759 | 3300046689 | Ga0495613_0108184 | Ga0495613_0108184_456_1766 | 414 |
| 760 | 3300046690 | Ga0495624_0011975 | Ga0495624_0011975_902_2212 | 414 |
| 761 | 3300047315 | Ga0495581_0046320 | Ga0495581_0046320_866_2176 | 414 |
| 762 | 3300047319 | Ga0495674_0088628 | Ga0495674_0088628_1032_2342 | 414 |
| 763 | 3300047471 | Ga0495684_0003088 | Ga0495684_0003088_8513_9823 | 414 |
| 764 | 3300049571 | Ga0501034_0026979 | Ga0501034_0026979_926_2215 | 414 |
| 765 | 3300049586 | Ga0501070_0009332 | Ga0501070_0009332_1285_2574 | 414 |
| 766 | 3300049588 | Ga0501072_0071395 | Ga0501072_0071395_447_1736 | 414 |
| 767 | 3300049589 | Ga0501073_0024118 | Ga0501073_0024118_2301_3590 | 414 |
| 768 | 3300049590 | Ga0501074_0051662 | Ga0501074_0051662_1660_2949 | 414 |
| 769 | 3300049741 | Ga0501079_0063174 | Ga0501079_0063174_200_1489 | 414 |
| 770 | 3300049742 | Ga0501080_0023875 | Ga0501080_0023875_3024_4313 | 414 |
| 771 | 3300049823 | Ga0501044_0194296 | Ga0501044_0194296_255_1544 | 414 |
| 772 | 3300053177 | Ga0500636_0043152 | Ga0500636_0043152_506_1750 | 414 |
| 773 | 3300054114 | Ga0501084_0215252 | Ga0501084_0215252_212_1495 | 414 |
| 774 | iso_pu_bacteria | 2775507266 | 2778178008 | 415 |
| 775 | 3300021384 | Ga0213876_10000673 | Ga0213876_100006738 | 417 |
| 776 | 3300039437 | Ga0436365_0920278 | Ga0436365_0920278_22317_23579 | 417 |
| 777 | 3300047472 | Ga0495686_0000301 | Ga0495686_0000301_81755_83041 | 417 |
| 778 | 3300001979 | JGI24740J21852_10000076 | JGI24740J21852_1000007639 | 420 |
| 779 | 3300053125 | Ga0500618_000875 | Ga0500618_000875_983_2245 | 420 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tp4-assembly1.cif.gz_A | crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria | 0.9584 | 5 | 412 |
| 5tp4-assembly1.cif.gz_B | crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria | 0.9465 | 5 | 412 |
| 5tp4-assembly1.cif.gz_A | crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria | 0.9401 | 5 | 412 |
| 4wjb-assembly1.cif.gz_D | x-ray crystal structure of a putative amidohydrolase/peptidase from burkholderia cenocepacia | 0.9394 | 4 | 415 |
| 5thw-assembly2.cif.gz_D | crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia multivorans | 0.938 | 5 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tp4B02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.96 | 217 | 327 | 3.30.70.360 |
| 3n5fB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9561 | 217 | 329 | 3.30.70.360 |
| 5i4mB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9436 | 1 | 416 | 3.40.630.10 |
| af_Q655X8_256_387_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9395 | 217 | 330 | 3.40.630.10 |
| 5i4mA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9386 | 217 | 330 | 3.30.70.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356HR59-F1-model_v4 | deleted | 0.9825 | 4 | 131 |
|
| AF-A0A536UMS7-F1-model_v4 | M20/M25/M40 family metallo-hydrolase | 0.9817 | 6 | 161 |
GO:0016813
|
| AF-A0A2M9G9E3-F1-model_v4 | Zn-dependent hydrolase | 0.9795 | 4 | 412 |
GO:0016813
GO:0046872 |
| AF-X1QY92-F1-model_v4 | Peptidase M20 dimerisation domain-containing protein | 0.979 | 3 | 127 |
GO:0016813
|
| AF-A0A7C7YXV9-F1-model_v4 | Zn-dependent hydrolase | 0.9741 | 7 | 415 |
GO:0016813
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar