F480446

General Info

Members Datasets Scaffolds Average Seq Length
778 421 675 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746768|2785366704
Length 315
Sequence HAPPGSPEPDISEIDQNEASPSEAAHSEASPPEATDNGTGTAATPTSPVDLEPIVPASSRRTRIPRWLRRTTGPVLLLALWQLLSGTGVLTADVLASPGRIAQVAGDLIADGSLVSAMTTSLQRVAGGLLLGALVGTGLALVSGLFRIGEDIVDAPVQMLRTVPFVGLIPLFIIWFGIGEAPKIAIITLGVTFPLYLNIYAGIRGVDSQLIEAGESLGLSRWGLVRHVILPGALPGAMTGLRYSLGIAWLALVFAEQVNADSGIGFLMVQARDFLRTDVIVVCLIVYAFLGLLADFVVRSLERLLLQWRPTFTGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231021 Pseudomonas sp. GM78 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
12 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
13 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
14 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
23 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
24 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
25 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
26 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
27 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
28 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
29 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
30 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
31 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
32 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
33 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
34 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
35 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
36 2643221578 Streptomyces sp. Root63 Isolate Unclassified
37 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
38 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
39 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
40 2643221647 Streptomyces sp. Root369 Isolate Unclassified
41 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
42 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
43 2643221692 Nocardia sp. Root136 Isolate Unclassified
44 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
45 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
46 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
47 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
48 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
49 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
50 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
51 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
52 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
53 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
54 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
55 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
56 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
57 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
58 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
59 2849560528 Caulobacter zeae 410 Isolate Unclassified
60 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
61 2851153111 Caulobacter radicis 736 Isolate Unclassified
62 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
63 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
64 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
65 2862574272 Streptomyces sp. AcE210 Isolate Nodule
66 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
67 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
68 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
69 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
70 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
71 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
72 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
73 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
74 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
75 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
76 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
77 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
78 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
79 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
80 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
81 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
82 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
83 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
84 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
85 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
86 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
87 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
88 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
89 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
90 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
93 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
94 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
95 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
99 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
100 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
101 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
102 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
103 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
104 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
105 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
109 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
110 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
111 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
114 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
115 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
116 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
117 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
118 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
124 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
127 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
143 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
209 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
247 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
248 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
251 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
258 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
259 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
382 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
388 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
391 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
392 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
393 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
394 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
395 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
400 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
401 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
402 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
403 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
404 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
408 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
409 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
410 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
411 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
412 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
413 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
414 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
415 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
416 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
417 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
418 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
419 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
420 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
421 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.76
Metatranscriptomes 0
Isolates 13.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.4
Nodule 1.54
Rhizoplane 4.37
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 14.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3039297 2162886007 Bacteria 3638
2 JGI24739J22299_10064354 3300001989 Bacteria 1153
3 JGI25162J39368_1000054 3300002737 Bacteria 147779
4 JGI25163J39215_1000106 3300002771 Bacteria 35005
5 JGI25164J39214_1000029 3300002772 Bacteria 147779
6 JGI25406J46586_10002057 3300003203 Bacteria 9500
7 JGI25165J46597_1000111 3300003214 Bacteria 147779
8 rootH2_10025695 3300003320 Bacteria 4019
9 rootL2_10029067 3300003322 Bacteria 10650
10 rootL2_10158374 3300003322 Bacteria 1357
11 Ga0055526_1022180 3300003771 Bacteria 2172
12 Ga0055537_1003505 3300003773 Bacteria 4806
13 Ga0055524_1012948 3300003775 Bacteria 3174
14 Ga0055536_1000005 3300003781 Bacteria 383598
15 Ga0055536_1000734 3300003781 Bacteria 22052
16 Ga0055536_1006940 3300003781 Bacteria 5160
17 Ga0055536_1008111 3300003781 Bacteria 4576
18 Ga0055534_1011018 3300003784 Bacteria 1858
19 Ga0055528_1008429 3300003790 Bacteria 4418
20 Ga0055530_10000001 3300003791 Bacteria 383067
21 Ga0055530_10000066 3300003791 Bacteria 93405
22 Ga0055530_10000165 3300003791 Bacteria 60120
23 Ga0055530_10000222 3300003791 Bacteria 50412
24 Ga0055530_10039056 3300003791 Bacteria 1175
25 Ga0055540_1000186 3300003792 Bacteria 60120
26 Ga0055540_1000258 3300003792 Bacteria 47854
27 Ga0055531_10001339 3300003794 Bacteria 18391
28 Ga0055531_10003634 3300003794 Bacteria 9731
29 Ga0055531_10005696 3300003794 Bacteria 7228
30 Ga0065165_1001271 3300005262 Bacteria 28528
31 Ga0065714_10003126 3300005288 Bacteria 11417
32 Ga0065714_10009959 3300005288 Bacteria 3772
33 Ga0065714_10011828 3300005288 Bacteria 5184
34 Ga0065714_10064839 3300005288 Bacteria 17232
35 Ga0065704_10097097 3300005289 Bacteria 2409
36 Ga0065704_10097927 3300005289 Bacteria 2370
37 Ga0065712_10067982 3300005290 Bacteria 18146
38 Ga0070658_10001281 3300005327 Bacteria 21475
39 Ga0070666_10162510 3300005335 Bacteria 1561
40 Ga0070680_100011064 3300005336 Bacteria 6973
41 Ga0070682_100524627 3300005337 Unclassified 922
42 Ga0070660_100019870 3300005339 Bacteria 4928
43 Ga0070668_100002528 3300005347 Bacteria 13464
44 Ga0070668_100017490 3300005347 Bacteria 5374
45 Ga0070669_100001571 3300005353 Bacteria 16556
46 Ga0070669_100001764 3300005353 Bacteria 15594
47 Ga0070671_100003686 3300005355 Bacteria 12015
48 Ga0070671_100003780 3300005355 Bacteria 11876
49 Ga0070667_100020533 3300005367 Bacteria 5484
50 Ga0070667_100028263 3300005367 Bacteria 4668
51 Ga0070678_100039767 3300005456 Bacteria 3321
52 Ga0070681_10003845 3300005458 Bacteria 14121
53 Ga0070679_100007593 3300005530 Bacteria 10147
54 Ga0070697_100077656 3300005536 Bacteria 2732
55 Ga0070672_100374900 3300005543 Bacteria 1216
56 Ga0070665_100000107 3300005548 Bacteria 156048
57 Ga0070665_100008246 3300005548 Bacteria 10542
58 Ga0070665_100033770 3300005548 Bacteria 5146
59 Ga0068855_100005081 3300005563 Bacteria 16038
60 Ga0068855_100276610 3300005563 Bacteria 1866
61 Ga0068854_100072783 3300005578 Bacteria 2517
62 Ga0068856_100411476 3300005614 Bacteria 1372
63 Ga0068863_100018630 3300005841 Bacteria 6642
64 Ga0068860_100015006 3300005843 Bacteria 7571
65 Ga0068862_100000074 3300005844 Bacteria 118036
66 Ga0068862_100016576 3300005844 Bacteria 6136
67 Ga0081539_10000417 3300005985 Bacteria 90642
68 Ga0075363_100070972 3300006048 Bacteria 1892
69 Ga0075364_10005137 3300006051 Bacteria 7590
70 Ga0075364_10005211 3300006051 Bacteria 7545
71 Ga0075362_10019711 3300006177 Bacteria 2809
72 Ga0075369_10006670 3300006186 Bacteria 4376
73 Ga0075366_10143609 3300006195 Bacteria 1444
74 Ga0075370_10177081 3300006353 Bacteria 1255
75 Ga0068865_100244176 3300006881 Bacteria 1414
76 Ga0097620_100210162 3300006931 Bacteria 2032
77 Ga0079104_1000006 3300006946 Bacteria 396255
78 Ga0099826_10000572 3300006948 Bacteria 18513
79 Ga0105251_10000005 3300009011 Bacteria 259226
80 Ga0105251_10005637 3300009011 Bacteria 8135
81 Ga0105251_10030203 3300009011 Bacteria 2723
82 Ga0105251_10030612 3300009011 Bacteria 2700
83 Ga0105244_10001015 3300009036 Bacteria 23506
84 Ga0105244_10001477 3300009036 Bacteria 18965
85 Ga0105250_10004047 3300009092 Bacteria 6822
86 Ga0105250_10012357 3300009092 Bacteria 3526
87 Ga0105240_10014297 3300009093 Bacteria 10839
88 Ga0105247_10119490 3300009101 Bacteria 1706
89 Ga0105243_10000144 3300009148 Bacteria 81484
90 Ga0105243_10024932 3300009148 Bacteria 4566
91 Ga0105248_10003233 3300009177 Bacteria 18069
92 Ga0105248_10037790 3300009177 Bacteria 5403
93 Ga0105238_10012868 3300009551 Bacteria 8444
94 Ga0105249_10027254 3300009553 Bacteria 5156
95 Ga0105249_10160716 3300009553 Bacteria 2171
96 Ga0105239_10132598 3300010375 Bacteria 2772
97 Ga0105239_10811772 3300010375 Bacteria 1072
98 Ga0105246_10019373 3300011119 Bacteria 4347
99 Ga0105246_10049033 3300011119 Bacteria 2890
100 Ga0157371_10000063 3300013102 Bacteria 169490
101 Ga0157371_10000925 3300013102 Bacteria 32949
102 Ga0157370_10002160 3300013104 Bacteria 24009
103 Ga0157370_10030558 3300013104 Bacteria 5278
104 Ga0157370_10032695 3300013104 Bacteria 5078
105 Ga0157369_10227871 3300013105 Bacteria 1949
106 Ga0163162_10000551 3300013306 Bacteria 34607
107 Ga0163162_10031044 3300013306 Bacteria 5298
108 Ga0182008_10000785 3300014497 Bacteria 22221
109 Ga0182008_10001096 3300014497 Bacteria 18678
110 Ga0182006_1003571 3300015261 Bacteria 7926
111 Ga0182006_1006128 3300015261 Bacteria 5622
112 Ga0182006_1007784 3300015261 Bacteria 4885
113 Ga0182007_10000682 3300015262 Bacteria 19509
114 Ga0182007_10001650 3300015262 Bacteria 11813
115 Ga0182005_1015072 3300015265 Bacteria 2157
116 Ga0183367_1003 3300015688 Bacteria 814276
117 Ga0163161_10003171 3300017792 Bacteria 11599
118 Ga0213872_10159707 3300021361 Bacteria 981
119 Ga0213876_10161140 3300021384 Unclassified 1193
120 Ga0209760_100015 3300025207 Bacteria 176281
121 Ga0207427_100001 3300025231 Bacteria 1410763
122 Ga0209437_100003 3300025233 Bacteria 1517827
123 Ga0209026_1002402 3300025250 Bacteria 7062
124 Ga0209233_1000007 3300025261 Bacteria 1411234
125 Ga0209565_1000281 3300025263 Bacteria 50202
126 Ga0209673_1001574 3300025273 Bacteria 20330
127 Ga0209675_1000097 3300025291 Bacteria 131546
128 Ga0209675_1019109 3300025291 Bacteria 1896
129 Ga0209676_1000003 3300025292 Bacteria 1454178
130 Ga0209676_1000070 3300025292 Bacteria 312074
131 Ga0209676_1000673 3300025292 Bacteria 48566
132 Ga0209676_1000927 3300025292 Bacteria 36244
133 Ga0209676_1004357 3300025292 Bacteria 7923
134 Ga0209676_1021711 3300025292 Bacteria 2147
135 Ga0209676_1047271 3300025292 Bacteria 1158
136 Ga0209025_1013670 3300025294 Bacteria 5075
137 Ga0209564_1000557 3300025295 Bacteria 59834
138 Ga0209564_1019939 3300025295 Bacteria 2481
139 Ga0209758_1000608 3300025297 Bacteria 55483
140 Ga0209758_1001275 3300025297 Bacteria 31177
141 Ga0209758_1001477 3300025297 Bacteria 27508
142 Ga0209050_1000004 3300025298 Bacteria 1600040
143 Ga0209050_1000037 3300025298 Bacteria 415612
144 Ga0209050_1000038 3300025298 Bacteria 412635
145 Ga0209050_1000627 3300025298 Bacteria 55036
146 Ga0209050_1002783 3300025298 Bacteria 14009
147 Ga0209050_1011541 3300025298 Bacteria 4169
148 Ga0209050_1027233 3300025298 Bacteria 1889
149 Ga0209256_1001941 3300025299 Bacteria 18811
150 Ga0209256_1003017 3300025299 Bacteria 12452
151 Ga0209256_1013803 3300025299 Bacteria 2969
152 Ga0209051_1000006 3300025303 Bacteria 1015785
153 Ga0209051_1000040 3300025303 Bacteria 315055
154 Ga0209257_1000328 3300025304 Bacteria 99542
155 Ga0209257_1001043 3300025304 Bacteria 36902
156 Ga0209257_1001060 3300025304 Bacteria 36360
157 Ga0209257_1002314 3300025304 Bacteria 19259
158 Ga0209257_1009271 3300025304 Bacteria 5322
159 Ga0209257_1012736 3300025304 Bacteria 3842
160 Ga0207696_1003663 3300025711 Bacteria 6900
161 Ga0207696_1041113 3300025711 Bacteria 1352
162 Ga0207655_1003129 3300025728 Bacteria 12523
163 Ga0207713_1000036 3300025735 Bacteria 259717
164 Ga0207713_1001885 3300025735 Bacteria 15929
165 Ga0207713_1031618 3300025735 Bacteria 2336
166 Ga0207713_1045466 3300025735 Bacteria 1793
167 Ga0207710_10105809 3300025900 Bacteria 1331
168 Ga0207680_10137414 3300025903 Bacteria 1617
169 Ga0207705_10025961 3300025909 Bacteria 4180
170 Ga0207654_10068346 3300025911 Bacteria 2101
171 Ga0207707_10003543 3300025912 Bacteria 13814
172 Ga0207695_10012701 3300025913 Bacteria 10085
173 Ga0207660_10167993 3300025917 Bacteria 1696
174 Ga0207657_10281967 3300025919 Unclassified 1319
175 Ga0207652_10011650 3300025921 Bacteria 7094
176 Ga0207681_10001221 3300025923 Bacteria 16554
177 Ga0207681_10001397 3300025923 Bacteria 15603
178 Ga0207694_10007190 3300025924 Bacteria 8454
179 Ga0207644_10055190 3300025931 Bacteria 2863
180 Ga0207709_10001160 3300025935 Bacteria 19160
181 Ga0207709_10205008 3300025935 Bacteria 1411
182 Ga0207704_10185123 3300025938 Bacteria 1509
183 Ga0207711_10003235 3300025941 Bacteria 14198
184 Ga0207711_10017238 3300025941 Bacteria 6003
185 Ga0207711_10382345 3300025941 Bacteria 1306
186 Ga0207667_10021876 3300025949 Bacteria 7077
187 Ga0207712_10032850 3300025961 Bacteria 3504
188 Ga0207712_10146774 3300025961 Bacteria 1817
189 Ga0207668_10001443 3300025972 Bacteria 13995
190 Ga0207668_10006938 3300025972 Bacteria 6722
191 Ga0207658_10001032 3300025986 Bacteria 22661
192 Ga0207658_10092397 3300025986 Bacteria 2350
193 Ga0207702_10042525 3300026078 Bacteria 3812
194 Ga0207641_10003617 3300026088 Bacteria 13640
195 Ga0207683_10217077 3300026121 Bacteria 1742
196 Ga0209281_1000011 3300027111 Bacteria 695292
197 Ga0209371_1000609 3300027312 Bacteria 31984
198 Ga0268266_10000354 3300028379 Bacteria 70983
199 Ga0268266_10007811 3300028379 Bacteria 9588
200 Ga0268266_10009243 3300028379 Bacteria 8694
201 Ga0268266_10417546 3300028379 Bacteria 1271
202 Ga0268265_10000847 3300028380 Bacteria 28741
203 Ga0268265_10005338 3300028380 Bacteria 8804
204 Ga0268265_10097822 3300028380 Bacteria 2362
205 Ga0265319_1026094 3300028563 Bacteria 2085
206 Ga0265318_10000139 3300028577 Bacteria 66471
207 Ga0307517_10048414 3300028786 Bacteria 4374
208 Ga0307517_10074950 3300028786 Bacteria 2975
209 Ga0307515_10000524 3300028794 Bacteria 91311
210 Ga0307515_10027774 3300028794 Bacteria 9653
211 Ga0307515_10058201 3300028794 Bacteria 5571
212 Ga0268256_1000527 3300030500 Bacteria 31984
213 Ga0307511_10011009 3300030521 Bacteria 8931
214 Ga0307511_10037288 3300030521 Bacteria 4202
215 Ga0307511_10100046 3300030521 Bacteria 1909
216 Ga0307512_10006750 3300030522 Bacteria 11541
217 Ga0307512_10015575 3300030522 Bacteria 7039
218 Ga0307512_10040433 3300030522 Bacteria 3892
219 Ga0316177_1222324 3300030731 Bacteria 2013
220 Ga0265330_10003994 3300031235 Bacteria 7570
221 Ga0265332_10003516 3300031238 Bacteria 7534
222 Ga0265328_10002301 3300031239 Bacteria 8605
223 Ga0265320_10002481 3300031240 Bacteria 12829
224 Ga0265329_10000367 3300031242 Bacteria 23949
225 Ga0265339_10077377 3300031249 Bacteria 1763
226 Ga0265331_10004641 3300031250 Bacteria 8517
227 Ga0265327_10000175 3300031251 Bacteria 137193
228 Ga0265316_10008789 3300031344 Bacteria 9334
229 Ga0307513_10015813 3300031456 Bacteria 9134
230 Ga0307513_10103139 3300031456 Bacteria 2869
231 Ga0307509_10002942 3300031507 Bacteria 26804
232 Ga0307509_10003139 3300031507 Bacteria 25603
233 Ga0307508_10029395 3300031616 Bacteria 4968
234 Ga0307508_10049105 3300031616 Bacteria 3758
235 Ga0307508_10229675 3300031616 Bacteria 1454
236 Ga0307508_10241856 3300031616 Bacteria 1402
237 Ga0307514_10004958 3300031649 Bacteria 12072
238 Ga0265314_10013933 3300031711 Bacteria 6466
239 Ga0265342_10001175 3300031712 Bacteria 24900
240 Ga0307516_10006745 3300031730 Bacteria 13416
241 Ga0307518_10178376 3300031838 Bacteria 1439
242 Ga0307518_10186862 3300031838 Bacteria 1393
243 Ga0307412_10038740 3300031911 Bacteria 3072
244 Ga0307414_10440785 3300032004 Bacteria 1140
245 Ga0307507_10007410 3300033179 Bacteria 15995
246 Ga0307507_10193809 3300033179 Bacteria 1422
247 Ga0307510_10009355 3300033180 Bacteria 11671
248 Ga0307510_10024282 3300033180 Bacteria 7007
249 Ga0307510_10054411 3300033180 Bacteria 4192
250 Ga0307510_10058361 3300033180 Bacteria 3996
251 Ga0307510_10219888 3300033180 Bacteria 1412
252 Ga0395898_0002157 3300037466 Bacteria 24154
253 Ga0395901_0161915 3300038443 Bacteria 2350
254 Ga0436365_0466215 3300039437 Bacteria 7739
255 Ga0436361_0804027 3300039447 Bacteria 6492
256 Ga0436361_0989786 3300039447 Bacteria 1846
257 Ga0436363_1493638 3300039450 Bacteria 2636
258 Ga0439438_000200 3300041405 Bacteria 27336
259 Ga0439438_000450 3300041405 Bacteria 18562
260 Ga0439438_000666 3300041405 Bacteria 15441
261 Ga0439447_006761 3300041407 Bacteria 3688
262 Ga0439461_0009575 3300041410 Bacteria 1760
263 Ga0439466_0013030 3300041411 Bacteria 3050
264 Ga0451841_0680686 3300041498 Bacteria 1075
265 Ga0451851_0122701 3300041507 Bacteria 1141
266 Ga0451853_1601412 3300041512 Bacteria 2011
267 Ga0451853_3602439 3300041512 Bacteria 5479
268 Ga0439448_0008535 3300042005 Bacteria 3003
269 Ga0439449_0014725 3300042007 Bacteria 2939
270 Ga0439452_000115 3300042010 Bacteria 63101
271 Ga0439452_000826 3300042010 Bacteria 14386
272 Ga0439455_0037657 3300042012 Bacteria 1227
273 Ga0439456_000816 3300042013 Bacteria 6313
274 Ga0439463_000202 3300042016 Bacteria 16002
275 Ga0439463_026153 3300042016 Bacteria 1465
276 Ga0450900_006822 3300042136 Bacteria 1392
277 Ga0439446_0004310 3300042156 Bacteria 3601
278 Ga0439458_0004574 3300042157 Bacteria 3166
279 Ga0439435_0002850 3300042436 Bacteria 3505
280 Ga0466969_0015985 3300044656 Bacteria 3933
281 Ga0466972_0004929 3300044658 Bacteria 6699
282 Ga0466961_0012375 3300044693 Bacteria 5455
283 Ga0466960_0003455 3300044901 Bacteria 6079
284 Ga0495617_000044 3300046452 Bacteria 119709
285 Ga0495617_013499 3300046452 Bacteria 2781
286 Ga0495617_015757 3300046452 Bacteria 2558
287 Ga0495617_061724 3300046452 Bacteria 1239
288 Ga0495627_000008 3300046453 Bacteria 572150
289 Ga0495627_002624 3300046453 Bacteria 8462
290 Ga0495627_005481 3300046453 Bacteria 5111
291 Ga0495627_012240 3300046453 Bacteria 3052
292 Ga0495592_0020586 3300046454 Bacteria 5020
293 Ga0495603_0000009 3300046455 Bacteria 72869
294 Ga0495603_0009296 3300046455 Bacteria 5944
295 Ga0495603_0297721 3300046455 Bacteria 926
296 Ga0495590_0000698 3300046457 Bacteria 15366
297 Ga0495590_0002258 3300046457 Bacteria 8044
298 Ga0495591_000018 3300046458 Bacteria 232216
299 Ga0495591_000088 3300046458 Bacteria 102486
300 Ga0495591_000300 3300046458 Bacteria 45180
301 Ga0495591_010704 3300046458 Bacteria 3531
302 Ga0495629_0022313 3300046459 Bacteria 4513
303 Ga0495638_0000160 3300046460 Bacteria 105110
304 Ga0495638_0000589 3300046460 Bacteria 41015
305 Ga0495638_0004745 3300046460 Bacteria 10253
306 Ga0495638_0007339 3300046460 Bacteria 7916
307 Ga0495638_0010099 3300046460 Bacteria 6577
308 Ga0495638_0020681 3300046460 Bacteria 4345
309 Ga0495638_0035080 3300046460 Bacteria 3198
310 Ga0495638_0064881 3300046460 Bacteria 2249
311 Ga0495638_0092995 3300046460 Bacteria 1814
312 Ga0495638_0095347 3300046460 Bacteria 1787
313 Ga0495651_0021486 3300046462 Bacteria 5016
314 Ga0495653_0000002 3300046463 Bacteria 507262
315 Ga0495650_0000017 3300046471 Bacteria 542552
316 Ga0495650_0007765 3300046471 Bacteria 6382
317 Ga0495650_0010868 3300046471 Bacteria 5045
318 Ga0495605_0000067 3300046474 Bacteria 138871
319 Ga0495605_0000088 3300046474 Bacteria 119191
320 Ga0495605_0000158 3300046474 Bacteria 86829
321 Ga0495605_0000522 3300046474 Bacteria 32534
322 Ga0495605_0000806 3300046474 Bacteria 22409
323 Ga0495605_0004355 3300046474 Bacteria 8326
324 Ga0495605_0007282 3300046474 Bacteria 6285
325 Ga0495605_0012723 3300046474 Bacteria 4660
326 Ga0495605_0017337 3300046474 Bacteria 3880
327 Ga0495605_0023420 3300046474 Bacteria 3247
328 Ga0495605_0043272 3300046474 Bacteria 2233
329 Ga0495605_0069504 3300046474 Bacteria 1667
330 Ga0495605_0090255 3300046474 Bacteria 1421
331 Ga0495662_0000110 3300046476 Bacteria 30405
332 Ga0495664_0001686 3300046477 Bacteria 11750
333 Ga0495584_0000083 3300046491 Bacteria 66118
334 Ga0495584_0001678 3300046491 Bacteria 12983
335 Ga0495584_0002197 3300046491 Bacteria 11125
336 Ga0495584_0003188 3300046491 Bacteria 9116
337 Ga0495584_0015439 3300046491 Bacteria 3892
338 Ga0495584_0017141 3300046491 Bacteria 3691
339 Ga0495585_0000142 3300046492 Bacteria 79060
340 Ga0495585_0043610 3300046492 Bacteria 2507
341 Ga0495585_0085816 3300046492 Bacteria 1701
342 Ga0495585_0136201 3300046492 Bacteria 1289
343 Ga0495594_0001521 3300046499 Bacteria 12044
344 Ga0495594_0043677 3300046499 Bacteria 2457
345 Ga0495594_0151081 3300046499 Bacteria 1318
346 Ga0495596_0000089 3300046500 Bacteria 63864
347 Ga0495607_0000032 3300046501 Bacteria 153288
348 Ga0495607_0006881 3300046501 Bacteria 7930
349 Ga0495607_0010063 3300046501 Bacteria 6370
350 Ga0495607_0013334 3300046501 Bacteria 5389
351 Ga0495607_0021527 3300046501 Bacteria 4055
352 Ga0495607_0057620 3300046501 Bacteria 2225
353 Ga0495607_0087450 3300046501 Bacteria 1696
354 Ga0495607_0155298 3300046501 Bacteria 1167
355 Ga0495607_0175258 3300046501 Bacteria 1079
356 Ga0495583_0000135 3300046506 Bacteria 123916
357 Ga0495583_0000457 3300046506 Bacteria 60714
358 Ga0495583_0002118 3300046506 Bacteria 17775
359 Ga0495606_0000200 3300046507 Bacteria 104194
360 Ga0495606_0000545 3300046507 Bacteria 60465
361 Ga0495606_0000729 3300046507 Bacteria 50871
362 Ga0495606_0025101 3300046507 Bacteria 4276
363 Ga0495610_0000058 3300046512 Bacteria 137991
364 Ga0495610_0004442 3300046512 Bacteria 10365
365 Ga0495610_0005995 3300046512 Bacteria 8496
366 Ga0495610_0009917 3300046512 Bacteria 5959
367 Ga0495610_0010854 3300046512 Bacteria 5625
368 Ga0495610_0012925 3300046512 Bacteria 4989
369 Ga0495610_0019749 3300046512 Bacteria 3758
370 Ga0495610_0033846 3300046512 Bacteria 2637
371 Ga0495610_0074419 3300046512 Bacteria 1576
372 Ga0495616_0000031 3300046513 Bacteria 130957
373 Ga0495616_0000429 3300046513 Bacteria 32137
374 Ga0495618_0081775 3300046514 Bacteria 2063
375 Ga0495620_0000034 3300046515 Bacteria 117942
376 Ga0495620_0000207 3300046515 Bacteria 44260
377 Ga0495620_0001291 3300046515 Bacteria 15265
378 Ga0495620_0003917 3300046515 Bacteria 8483
379 Ga0495620_0008610 3300046515 Bacteria 5471
380 Ga0495620_0009072 3300046515 Bacteria 5308
381 Ga0495620_0048421 3300046515 Bacteria 1824
382 Ga0495628_0009638 3300046516 Bacteria 8239
383 Ga0495628_0229975 3300046516 Bacteria 1390
384 Ga0495631_0002052 3300046518 Bacteria 11733
385 Ga0495631_0007823 3300046518 Bacteria 5419
386 Ga0495632_0000495 3300046519 Bacteria 37144
387 Ga0495632_0000607 3300046519 Bacteria 33188
388 Ga0495632_0000748 3300046519 Bacteria 29283
389 Ga0495632_0003572 3300046519 Bacteria 10964
390 Ga0495632_0015353 3300046519 Bacteria 4299
391 Ga0495637_0007004 3300046520 Bacteria 5616
392 Ga0495637_0009342 3300046520 Bacteria 4785
393 Ga0495637_0012102 3300046520 Bacteria 4133
394 Ga0495637_0012438 3300046520 Bacteria 4069
395 Ga0495637_0013550 3300046520 Bacteria 3866
396 Ga0495637_0033500 3300046520 Bacteria 2255
397 Ga0495643_0005942 3300046522 Bacteria 8142
398 Ga0495643_0007143 3300046522 Bacteria 7244
399 Ga0495643_0011709 3300046522 Bacteria 5325
400 Ga0495644_0001087 3300046523 Bacteria 11262
401 Ga0495644_0004478 3300046523 Bacteria 5489
402 Ga0495644_0055487 3300046523 Bacteria 1489
403 Ga0495644_0059130 3300046523 Bacteria 1441
404 Ga0495648_0000239 3300046524 Bacteria 62900
405 Ga0495648_0001250 3300046524 Bacteria 25409
406 Ga0495648_0004517 3300046524 Bacteria 11863
407 Ga0495648_0013500 3300046524 Bacteria 6031
408 Ga0495648_0015275 3300046524 Bacteria 5584
409 Ga0495648_0021510 3300046524 Bacteria 4463
410 Ga0495663_0030146 3300046525 Bacteria 1606
411 Ga0495666_0012793 3300046526 Bacteria 4183
412 Ga0495642_0000187 3300046528 Bacteria 36703
413 Ga0495642_0092802 3300046528 Bacteria 1279
414 Ga0495654_0000012 3300046530 Bacteria 328997
415 Ga0495654_0000414 3300046530 Bacteria 36432
416 Ga0495654_0006197 3300046530 Bacteria 6822
417 Ga0495654_0021651 3300046530 Bacteria 3343
418 Ga0495654_0026580 3300046530 Bacteria 2974
419 Ga0495654_0028499 3300046530 Bacteria 2855
420 Ga0495654_0040591 3300046530 Bacteria 2318
421 Ga0495654_0076963 3300046530 Bacteria 1571
422 Ga0495654_0086774 3300046530 Bacteria 1458
423 Ga0495654_0087054 3300046530 Bacteria 1455
424 Ga0495586_0004586 3300046535 Bacteria 7385
425 Ga0495587_0019040 3300046536 Bacteria 4253
426 Ga0495609_0000147 3300046538 Bacteria 73010
427 Ga0495609_0000340 3300046538 Bacteria 41415
428 Ga0495609_0000477 3300046538 Bacteria 32285
429 Ga0495597_0000013 3300046542 Bacteria 203829
430 Ga0495597_0004857 3300046542 Bacteria 7245
431 Ga0495597_0012599 3300046542 Bacteria 4074
432 Ga0495597_0017766 3300046542 Bacteria 3342
433 Ga0495597_0030407 3300046542 Bacteria 2461
434 Ga0495597_0038360 3300046542 Bacteria 2147
435 Ga0495622_0017722 3300046557 Bacteria 3314
436 Ga0495633_0000316 3300046558 Bacteria 54818
437 Ga0495633_0000446 3300046558 Bacteria 42633
438 Ga0495633_0162372 3300046558 Bacteria 1031
439 Ga0495667_0179581 3300046559 Bacteria 1359
440 Ga0495668_0000087 3300046616 Bacteria 151819
441 Ga0495668_0000887 3300046616 Bacteria 33700
442 Ga0495668_0007406 3300046616 Bacteria 7017
443 Ga0495668_0022070 3300046616 Bacteria 3641
444 Ga0495668_0029381 3300046616 Bacteria 3106
445 Ga0495668_0032163 3300046616 Bacteria 2954
446 Ga0495668_0053332 3300046616 Bacteria 2235
447 Ga0495634_0031104 3300046642 Bacteria 3678
448 Ga0495611_0017900 3300046648 Bacteria 3036
449 Ga0495611_0155835 3300046648 Bacteria 1066
450 Ga0495625_0000081 3300046660 Bacteria 156254
451 Ga0495625_0000830 3300046660 Bacteria 42448
452 Ga0495625_0001558 3300046660 Bacteria 27293
453 Ga0495625_0012474 3300046660 Bacteria 6885
454 Ga0495625_0020841 3300046660 Bacteria 5054
455 Ga0495625_0022235 3300046660 Bacteria 4865
456 Ga0495625_0029266 3300046660 Bacteria 4122
457 Ga0495625_0072463 3300046660 Bacteria 2415
458 Ga0495625_0092267 3300046660 Bacteria 2092
459 Ga0495625_0113957 3300046660 Bacteria 1846
460 Ga0495625_0131976 3300046660 Bacteria 1691
461 Ga0495625_0137418 3300046660 Bacteria 1651
462 Ga0495625_0226307 3300046660 Bacteria 1223
463 Ga0495659_0008262 3300046664 Bacteria 3312
464 Ga0495661_0000078 3300046665 Bacteria 119097
465 Ga0495661_0000138 3300046665 Bacteria 85693
466 Ga0495661_0000513 3300046665 Bacteria 40214
467 Ga0495661_0002111 3300046665 Bacteria 15597
468 Ga0495661_0010828 3300046665 Bacteria 6203
469 Ga0495661_0177944 3300046665 Bacteria 1129
470 Ga0495588_0013345 3300046674 Bacteria 3913
471 Ga0495588_0033156 3300046674 Bacteria 2607
472 Ga0495588_0043085 3300046674 Bacteria 2308
473 Ga0495657_0000437 3300046675 Bacteria 38928
474 Ga0495599_0212034 3300046678 Bacteria 1187
475 Ga0495646_0000400 3300046680 Bacteria 22769
476 Ga0495613_0002753 3300046689 Bacteria 13204
477 Ga0495613_0085988 3300046689 Bacteria 2280
478 Ga0495671_0000052 3300046692 Bacteria 133684
479 Ga0495671_0014142 3300046692 Bacteria 4300
480 Ga0495671_0015686 3300046692 Bacteria 4054
481 Ga0495671_0026763 3300046692 Bacteria 2985
482 Ga0495671_0074428 3300046692 Bacteria 1666
483 Ga0495649_0000033 3300046694 Bacteria 136854
484 Ga0495649_0000106 3300046694 Bacteria 74615
485 Ga0495649_0000836 3300046694 Bacteria 24748
486 Ga0495649_0015712 3300046694 Bacteria 4304
487 Ga0495649_0023498 3300046694 Bacteria 3443
488 Ga0495649_0053335 3300046694 Bacteria 2189
489 Ga0495589_0000585 3300046794 Bacteria 24989
490 Ga0495589_0001063 3300046794 Bacteria 16487
491 Ga0495589_0002412 3300046794 Bacteria 10499
492 Ga0495589_0006602 3300046794 Bacteria 6113
493 Ga0495589_0010957 3300046794 Bacteria 4706
494 Ga0495660_0000873 3300046810 Bacteria 22251
495 Ga0495660_0001253 3300046810 Bacteria 17692
496 Ga0495660_0001366 3300046810 Bacteria 16808
497 Ga0495660_0002313 3300046810 Bacteria 12218
498 Ga0495660_0005067 3300046810 Bacteria 7916
499 Ga0495660_0017385 3300046810 Bacteria 4140
500 Ga0495660_0065403 3300046810 Bacteria 1941
501 Ga0495660_0078105 3300046810 Bacteria 1741
502 Ga0495604_0000673 3300047317 Bacteria 28933
503 Ga0495604_0009142 3300047317 Bacteria 7842
504 Ga0495636_0000221 3300047318 Bacteria 22484
505 Ga0495636_0020197 3300047318 Bacteria 2683
506 Ga0495636_0049029 3300047318 Bacteria 1766
507 Ga0495674_0170119 3300047319 Bacteria 1819
508 Ga0495672_0000032 3300047320 Bacteria 295356
509 Ga0495672_0001535 3300047320 Bacteria 22596
510 Ga0495672_0003990 3300047320 Bacteria 12347
511 Ga0495676_0002857 3300047321 Bacteria 15570
512 Ga0495676_0003781 3300047321 Bacteria 13756
513 Ga0495676_0004612 3300047321 Bacteria 12622
514 Ga0495676_0010737 3300047321 Bacteria 8289
515 Ga0495683_0000108 3300047323 Bacteria 84498
516 Ga0495683_0002624 3300047323 Bacteria 10750
517 Ga0495683_0002951 3300047323 Bacteria 10064
518 Ga0495683_0047214 3300047323 Bacteria 2161
519 Ga0495687_000572 3300047443 Bacteria 43367
520 Ga0495687_001130 3300047443 Bacteria 25900
521 Ga0495687_004181 3300047443 Bacteria 9913
522 Ga0495687_008146 3300047443 Bacteria 6044
523 Ga0495687_027803 3300047443 Bacteria 2641
524 Ga0495687_098775 3300047443 Bacteria 1100
525 Ga0495675_0000016 3300047444 Bacteria 129732
526 Ga0495679_000198 3300047446 Bacteria 53238
527 Ga0495679_001171 3300047446 Bacteria 15590
528 Ga0495679_003085 3300047446 Bacteria 8168
529 Ga0495679_013312 3300047446 Bacteria 3096
530 Ga0495685_041386 3300047447 Bacteria 1575
531 Ga0495673_0000190 3300047469 Bacteria 97539
532 Ga0495673_0000321 3300047469 Bacteria 61858
533 Ga0495673_0000997 3300047469 Bacteria 25163
534 Ga0495673_0003718 3300047469 Bacteria 9918
535 Ga0495673_0025675 3300047469 Bacteria 2824
536 Ga0495681_0000009 3300047470 Bacteria 205224
537 Ga0495681_0000257 3300047470 Bacteria 43264
538 Ga0495681_0000329 3300047470 Bacteria 37635
539 Ga0495681_0002219 3300047470 Bacteria 13986
540 Ga0495681_0003080 3300047470 Bacteria 11691
541 Ga0495681_0004335 3300047470 Bacteria 9705
542 Ga0495681_0004938 3300047470 Bacteria 9002
543 Ga0495681_0006935 3300047470 Bacteria 7341
544 Ga0495681_0008911 3300047470 Bacteria 6232
545 Ga0495681_0011173 3300047470 Bacteria 5372
546 Ga0495681_0013912 3300047470 Bacteria 4644
547 Ga0495681_0035562 3300047470 Bacteria 2472
548 Ga0495681_0159761 3300047470 Bacteria 939
549 Ga0495684_0023241 3300047471 Bacteria 4766
550 Ga0495686_0000633 3300047472 Bacteria 48475
551 Ga0495686_0025642 3300047472 Bacteria 3864
552 Ga0495686_0038730 3300047472 Bacteria 3048
553 Ga0495686_0071700 3300047472 Bacteria 2131
554 Ga0495686_0099087 3300047472 Bacteria 1760
555 Ga0495593_0002874 3300047673 Bacteria 10384
556 Ga0495602_0059408 3300048088 Bacteria 3338
557 Ga0495614_0007263 3300048089 Bacteria 4936
558 Ga0495626_0000015 3300048091 Bacteria 232238
559 Ga0495626_0000033 3300048091 Bacteria 184008
560 Ga0495626_0000720 3300048091 Bacteria 30946
561 Ga0495626_0009842 3300048091 Bacteria 5140
562 Ga0495626_0058064 3300048091 Bacteria 1769
563 Ga0496101_0323198 3300048904 Bacteria 1211
564 Ga0496102_0000613 3300048905 Bacteria 36995
565 Ga0496102_0043134 3300048905 Bacteria 4089
566 Ga0496103_0000163 3300048906 Bacteria 70387
567 Ga0496103_0009503 3300048906 Bacteria 5757
568 Ga0496104_0002224 3300048907 Bacteria 16745
569 Ga0496105_0003862 3300048908 Bacteria 11198
570 Ga0496106_0063172 3300048909 Bacteria 2813
571 Ga0496107_0000565 3300048910 Bacteria 20698
572 Ga0496111_0058777 3300048914 Bacteria 2784
573 Ga0496113_0000081 3300048916 Bacteria 42072
574 Ga0496115_0133558 3300048918 Bacteria 2046
575 Ga0496116_0000126 3300048919 Bacteria 160425
576 Ga0496116_0042961 3300048919 Bacteria 3083
577 Ga0496116_0080144 3300048919 Bacteria 2028
578 Ga0496116_0120560 3300048919 Bacteria 1519
579 Ga0496116_0182660 3300048919 Bacteria 1121
580 Ga0496117_0000623 3300048920 Bacteria 57364
581 Ga0496117_0027203 3300048920 Bacteria 4461
582 Ga0496118_0030117 3300048921 Bacteria 4537
583 Ga0496118_0037674 3300048921 Bacteria 3887
584 Ga0496118_0071815 3300048921 Bacteria 2489
585 Ga0496119_0004118 3300048922 Bacteria 14645
586 Ga0496119_0124169 3300048922 Bacteria 1415
587 Ga0496120_0004524 3300048923 Bacteria 11623
588 Ga0496120_0028051 3300048923 Bacteria 3456
589 Ga0496121_0000067 3300048924 Bacteria 261543
590 Ga0496121_0000142 3300048924 Bacteria 160072
591 Ga0496121_0001912 3300048924 Bacteria 33300
592 Ga0496121_0009885 3300048924 Bacteria 10872
593 Ga0496121_0019626 3300048924 Bacteria 6750
594 Ga0496121_0059414 3300048924 Bacteria 3152
595 Ga0496122_0001234 3300048925 Bacteria 43175
596 Ga0496122_0002287 3300048925 Bacteria 27682
597 Ga0496122_0005467 3300048925 Bacteria 15122
598 Ga0496122_0037935 3300048925 Bacteria 3869
599 Ga0496123_0000434 3300048926 Bacteria 75349
600 Ga0496123_0003785 3300048926 Bacteria 16568
601 Ga0496123_0009060 3300048926 Bacteria 9017
602 Ga0496123_0032276 3300048926 Bacteria 3795
603 Ga0496124_0000812 3300048927 Bacteria 50806
604 Ga0496124_0003614 3300048927 Bacteria 18779
605 Ga0496124_0068150 3300048927 Bacteria 2959
606 Ga0496125_0012848 3300048928 Bacteria 8274
607 Ga0496125_0185974 3300048928 Bacteria 1378
608 Ga0496125_0300067 3300048928 Bacteria 984
609 Ga0496125_0312175 3300048928 Bacteria 957
610 Ga0496126_0005438 3300048929 Bacteria 14523
611 Ga0496126_0107103 3300048929 Bacteria 2438
612 Ga0496126_0319170 3300048929 Bacteria 1277
613 Ga0495678_000081 3300049459 Bacteria 118700
614 Ga0495678_000583 3300049459 Bacteria 34467
615 Ga0495678_001014 3300049459 Bacteria 24007
616 Ga0495678_001228 3300049459 Bacteria 20891
617 Ga0495678_017299 3300049459 Bacteria 3271
618 Ga0495678_021074 3300049459 Bacteria 2875
619 Ga0495678_032827 3300049459 Bacteria 2148
620 Ga0495678_035943 3300049459 Bacteria 2027
621 Ga0495678_123412 3300049459 Bacteria 867
622 Ga0495682_0003421 3300049460 Bacteria 7058
623 Ga0495682_0013216 3300049460 Bacteria 3147
624 Ga0501032_0044735 3300049569 Bacteria 2996
625 Ga0501033_0066516 3300049570 Bacteria 2650
626 Ga0501043_0002520 3300049579 Bacteria 15482
627 Ga0501046_0055842 3300049580 Bacteria 3101
628 Ga0501047_0000342 3300049581 Bacteria 53140
629 Ga0501048_0355832 3300049582 Bacteria 1044
630 Ga0501070_0141038 3300049586 Bacteria 1990
631 Ga0501269_000034 3300049766 Bacteria 42532
632 Ga0501035_0029889 3300049822 Bacteria 4969
633 nmdc:mga03683_15022_c1 3300050489 Bacteria 2880
634 nmdc:mga03n38_109574_c1 3300050490 Bacteria 1343
635 nmdc:mga03n38_41862_c1 3300050490 Bacteria 1999
636 nmdc:mga00v17_51246_c1 3300050491 Bacteria 2510
637 nmdc:mga00v17_626_c1 3300050491 Bacteria 8462
638 nmdc:mga0k408_71943_c1 3300050493 Bacteria 2019
639 nmdc:mga07m45_62960_c1 3300050496 Bacteria 2103
640 nmdc:mga0sz30_6232_c1 3300050516 Bacteria 4422
641 Ga0500635_0000020 3300053080 Bacteria 110196
642 Ga0500578_0000234 3300053086 Bacteria 68455
643 Ga0500578_0215964 3300053086 Bacteria 1168
644 Ga0500643_048167 3300053087 Bacteria 1226
645 Ga0500644_0000189 3300053088 Bacteria 38264
646 Ga0500554_005865 3300053102 Bacteria 2715
647 Ga0500556_0001301 3300053104 Bacteria 11228
648 Ga0500556_0024836 3300053104 Bacteria 1973
649 Ga0500580_037832 3300053113 Bacteria 2047
650 Ga0500592_000148 3300053116 Bacteria 14211
651 Ga0500594_0000022 3300053118 Bacteria 54062
652 Ga0500607_000148 3300053121 Bacteria 59763
653 Ga0500607_048277 3300053121 Bacteria 2277
654 Ga0500618_000511 3300053125 Bacteria 24569
655 Ga0500642_0123100 3300053130 Bacteria 1214
656 Ga0500658_0050740 3300053134 Bacteria 1694
657 Ga0500559_0000005 3300053136 Bacteria 230231
658 Ga0500559_0001556 3300053136 Bacteria 12842
659 Ga0500564_000059 3300053138 Bacteria 29435
660 Ga0500568_0019338 3300053139 Bacteria 2962
661 Ga0500568_0019897 3300053139 Bacteria 2910
662 Ga0500600_0064882 3300053149 Bacteria 2022
663 Ga0500600_0172950 3300053149 Bacteria 1048
664 Ga0500616_0046069 3300053153 Bacteria 2319
665 Ga0500624_006724 3300053157 Bacteria 1563
666 Ga0500627_0000013 3300053158 Bacteria 136204
667 Ga0500634_0000350 3300053161 Bacteria 14729
668 Ga0500638_012935 3300053162 Bacteria 3757
669 Ga0500636_0000543 3300053177 Bacteria 20542
670 Ga0500611_015368 3300053727 Bacteria 1354
671 Ga0500645_004520 3300053730 Bacteria 5309
672 Ga0500645_008481 3300053730 Bacteria 3507
673 Ga0500645_016698 3300053730 Bacteria 2309
674 Ga0500609_000125 3300053731 Bacteria 10137
675 Ga0466962_0023165 3300061719 Bacteria 2985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1000734 Ga0055536_10007347 215
2 3300003781 Ga0055536_1008111 Ga0055536_10081113 215
3 3300003784 Ga0055534_1011018 Ga0055534_10110182 215
4 3300003791 Ga0055530_10000222 Ga0055530_1000022236 215
5 3300003794 Ga0055531_10005696 Ga0055531_100056963 215
6 3300025291 Ga0209675_1000097 Ga0209675_100009740 215
7 3300025292 Ga0209676_1000070 Ga0209676_1000070131 215
8 3300025292 Ga0209676_1000927 Ga0209676_100092710 215
9 3300025292 Ga0209676_1021711 Ga0209676_10217112 215
10 3300025292 Ga0209676_1047271 Ga0209676_10472712 215
11 3300025294 Ga0209025_1013670 Ga0209025_10136703 215
12 3300025298 Ga0209050_1000627 Ga0209050_100062740 215
13 3300025298 Ga0209050_1011541 Ga0209050_10115412 215
14 3300025304 Ga0209257_1009271 Ga0209257_10092712 215
15 3300025304 Ga0209257_1012736 Ga0209257_10127362 215
16 3300031911 Ga0307412_10038740 Ga0307412_100387401 215
17 3300032004 Ga0307414_10440785 Ga0307414_104407852 215
18 3300053139 Ga0500568_0019897 Ga0500568_0019897_1493_2338 215
19 3300003791 Ga0055530_10039056 Ga0055530_100390561 216
20 3300003794 Ga0055531_10003634 Ga0055531_1000363410 216
21 3300005347 Ga0070668_100017490 Ga0070668_1000174902 216
22 3300025298 Ga0209050_1002783 Ga0209050_10027833 216
23 3300025304 Ga0209257_1000328 Ga0209257_100032896 216
24 3300025972 Ga0207668_10001443 Ga0207668_100014438 216
25 3300046660 Ga0495625_0000830 Ga0495625_0000830_19571_20416 216
26 3300003781 Ga0055536_1006940 Ga0055536_10069404 217
27 3300025292 Ga0209676_1000673 Ga0209676_100067319 217
28 3300046616 Ga0495668_0000087 Ga0495668_0000087_98913_99758 220
29 3300053158 Ga0500627_0000013 Ga0500627_0000013_81440_82300 220
30 3300025250 Ga0209026_1002402 Ga0209026_10024029 221
31 3300053102 Ga0500554_005865 Ga0500554_005865_378_1100 223
32 iso_pu_bacteria 2791355048 2792462386 224
33 iso_pu_bacteria 2843744320 2843748738 224
34 iso_pu_bacteria 2849560528 2849565308 224
35 iso_pu_bacteria 2849573788 2849578894 224
36 iso_pu_bacteria 2851153111 2851156540 224
37 iso_pu_bacteria 2898329390 2898330210 224
38 3300006195 Ga0075366_10143609 Ga0075366_101436092 226
39 3300009093 Ga0105240_10014297 Ga0105240_100142976 226
40 3300039437 Ga0436365_0466215 Ga0436365_0466215_5892_6611 226
41 3300046460 Ga0495638_0035080 Ga0495638_0035080_647_1372 228
42 3300053727 Ga0500611_015368 Ga0500611_015368_188_913 228
43 3300046512 Ga0495610_0074419 Ga0495610_0074419_136_915 229
44 3300046530 Ga0495654_0086774 Ga0495654_0086774_68_847 229
45 3300003322 rootL2_10158374 rootL2_101583742 233
46 3300005456 Ga0070678_100039767 Ga0070678_1000397676 233
47 3300005543 Ga0070672_100374900 Ga0070672_1003749002 233
48 3300005548 Ga0070665_100008246 Ga0070665_1000082462 233
49 3300026121 Ga0207683_10217077 Ga0207683_102170772 233
50 3300028379 Ga0268266_10007811 Ga0268266_100078118 233
51 3300047469 Ga0495673_0003718 Ga0495673_0003718_5696_6448 233
52 3300005337 Ga0070682_100524627 Ga0070682_1005246271 235
53 3300009177 Ga0105248_10003233 Ga0105248_1000323310 235
54 3300025941 Ga0207711_10003235 Ga0207711_1000323510 235
55 3300028379 Ga0268266_10417546 Ga0268266_104175462 235
56 3300046455 Ga0495603_0297721 Ga0495603_0297721_70_894 235
57 3300046460 Ga0495638_0064881 Ga0495638_0064881_1138_1962 235
58 3300046474 Ga0495605_0004355 Ga0495605_0004355_1659_2483 235
59 3300046492 Ga0495585_0043610 Ga0495585_0043610_240_1064 235
60 3300046499 Ga0495594_0151081 Ga0495594_0151081_221_1045 235
61 3300046501 Ga0495607_0155298 Ga0495607_0155298_311_1135 235
62 3300046515 Ga0495620_0003917 Ga0495620_0003917_3818_4642 235
63 3300046523 Ga0495644_0055487 Ga0495644_0055487_339_1163 235
64 3300046525 Ga0495663_0030146 Ga0495663_0030146_758_1516 235
65 3300046526 Ga0495666_0012793 Ga0495666_0012793_1893_2717 235
66 3300046557 Ga0495622_0017722 Ga0495622_0017722_168_992 235
67 3300046616 Ga0495668_0053332 Ga0495668_0053332_229_1053 235
68 3300046648 Ga0495611_0155835 Ga0495611_0155835_221_1045 235
69 3300046660 Ga0495625_0131976 Ga0495625_0131976_627_1451 235
70 3300046665 Ga0495661_0177944 Ga0495661_0177944_234_1058 235
71 3300047321 Ga0495676_0002857 Ga0495676_0002857_13185_14009 235
72 3300047443 Ga0495687_098775 Ga0495687_098775_207_1031 235
73 3300047470 Ga0495681_0035562 Ga0495681_0035562_1351_2175 235
74 3300048091 Ga0495626_0058064 Ga0495626_0058064_579_1403 235
75 3300053121 Ga0500607_000148 Ga0500607_000148_21735_22517 235
76 3300053130 Ga0500642_0123100 Ga0500642_0123100_298_1107 235
77 3300053730 Ga0500645_008481 Ga0500645_008481_2392_3174 235
78 3300013104 Ga0157370_10002160 Ga0157370_1000216016 236
79 3300025297 Ga0209758_1001275 Ga0209758_100127525 236
80 3300046452 Ga0495617_061724 Ga0495617_061724_68_994 236
81 3300046524 Ga0495648_0000239 Ga0495648_0000239_21096_21848 236
82 3300046648 Ga0495611_0017900 Ga0495611_0017900_1658_2584 236
83 3300046674 Ga0495588_0033156 Ga0495588_0033156_1789_2562 236
84 3300047469 Ga0495673_0000321 Ga0495673_0000321_21125_21877 236
85 3300049459 Ga0495678_123412 Ga0495678_123412_50_799 236
86 3300049766 Ga0501269_000034 Ga0501269_000034_31059_31817 236
87 3300053088 Ga0500644_0000189 Ga0500644_0000189_20988_21740 236
88 3300053113 Ga0500580_037832 Ga0500580_037832_895_1764 236
89 3300053116 Ga0500592_000148 Ga0500592_000148_6264_7034 236
90 3300053138 Ga0500564_000059 Ga0500564_000059_5378_6130 236
91 3300009551 Ga0105238_10012868 Ga0105238_100128683 237
92 3300025304 Ga0209257_1001043 Ga0209257_100104329 237
93 3300025911 Ga0207654_10068346 Ga0207654_100683462 237
94 3300025924 Ga0207694_10007190 Ga0207694_100071907 237
95 3300046471 Ga0495650_0007765 Ga0495650_0007765_3632_4492 237
96 3300050490 nmdc:mga03n38_109574_c1 nmdc:mga03n38_109574_c1_364_1275 237
97 iso_pu_bacteria 2791355406 2793981546 237
98 iso_pu_bacteria 8047893842 8047900978 237
99 iso_pu_bacteria 8048127548 8048134285 237
100 iso_pu_bacteria 8048356638 8048357923 237
101 iso_pu_bacteria 8048369669 8048377920 237
102 iso_pu_bacteria 8048379754 8048387018 237
103 3300028786 Ga0307517_10074950 Ga0307517_100749502 238
104 3300046459 Ga0495629_0022313 Ga0495629_0022313_2865_3749 238
105 3300046474 Ga0495605_0069504 Ga0495605_0069504_436_1272 238
106 3300046474 Ga0495605_0090255 Ga0495605_0090255_63_989 238
107 3300046492 Ga0495585_0085816 Ga0495585_0085816_572_1456 238
108 3300046492 Ga0495585_0136201 Ga0495585_0136201_236_1162 238
109 3300046515 Ga0495620_0001291 Ga0495620_0001291_4976_5812 238
110 3300046522 Ga0495643_0011709 Ga0495643_0011709_1158_1994 238
111 3300046524 Ga0495648_0013500 Ga0495648_0013500_786_1622 238
112 3300046528 Ga0495642_0092802 Ga0495642_0092802_164_1000 238
113 3300046542 Ga0495597_0017766 Ga0495597_0017766_1619_2455 238
114 3300046674 Ga0495588_0013345 Ga0495588_0013345_90_974 238
115 3300047318 Ga0495636_0020197 Ga0495636_0020197_1509_2345 238
116 3300047318 Ga0495636_0049029 Ga0495636_0049029_303_1229 238
117 3300047321 Ga0495676_0003781 Ga0495676_0003781_12721_13623 238
118 3300047321 Ga0495676_0010737 Ga0495676_0010737_5698_6582 238
119 3300047443 Ga0495687_027803 Ga0495687_027803_1021_1857 238
120 3300047446 Ga0495679_013312 Ga0495679_013312_351_1115 238
121 3300049459 Ga0495678_032827 Ga0495678_032827_151_987 238
122 3300053125 Ga0500618_000511 Ga0500618_000511_565_1329 238
123 iso_pu_bacteria 2918501144 2918502211 238
124 iso_pu_bacteria 8054160619 8054163291 238
125 3300003791 Ga0055530_10000066 Ga0055530_1000006685 239
126 3300003794 Ga0055531_10001339 Ga0055531_1000133914 239
127 3300025298 Ga0209050_1000038 Ga0209050_1000038313 239
128 3300025304 Ga0209257_1001060 Ga0209257_100106022 239
129 3300046458 Ga0495591_010704 Ga0495591_010704_2711_3496 239
130 3300046558 Ga0495633_0162372 Ga0495633_0162372_199_984 239
131 3300053080 Ga0500635_0000020 Ga0500635_0000020_68096_68905 239
132 3300053121 Ga0500607_048277 Ga0500607_048277_1104_1913 239
133 3300053157 Ga0500624_006724 Ga0500624_006724_509_1318 239
134 3300053162 Ga0500638_012935 Ga0500638_012935_2144_2953 239
135 3300053177 Ga0500636_0000543 Ga0500636_0000543_5195_6004 239
136 3300001989 JGI24739J22299_10064354 JGI24739J22299_100643541 240
137 3300005563 Ga0068855_100276610 Ga0068855_1002766102 240
138 3300006048 Ga0075363_100070972 Ga0075363_1000709722 240
139 3300006353 Ga0075370_10177081 Ga0075370_101770811 240
140 3300011119 Ga0105246_10049033 Ga0105246_100490332 240
141 3300014497 Ga0182008_10001096 Ga0182008_1000109610 240
142 3300015262 Ga0182007_10001650 Ga0182007_100016505 240
143 3300015688 Ga0183367_1003 Ga0183367_1003266 240
144 3300030522 Ga0307512_10015575 Ga0307512_100155755 240
145 3300031456 Ga0307513_10103139 Ga0307513_101031391 240
146 3300031616 Ga0307508_10029395 Ga0307508_100293954 240
147 3300031838 Ga0307518_10178376 Ga0307518_101783761 240
148 3300033179 Ga0307507_10193809 Ga0307507_101938092 240
149 3300037466 Ga0395898_0002157 Ga0395898_0002157_14922_15827 240
150 3300038443 Ga0395901_0161915 Ga0395901_0161915_796_1701 240
151 3300042136 Ga0450900_006822 Ga0450900_006822_111_995 240
152 3300044656 Ga0466969_0015985 Ga0466969_0015985_180_1058 240
153 3300046474 Ga0495605_0043272 Ga0495605_0043272_1080_1940 240
154 3300046501 Ga0495607_0000032 Ga0495607_0000032_89151_90011 240
155 3300046689 Ga0495613_0085988 Ga0495613_0085988_1405_2250 240
156 3300047472 Ga0495686_0099087 Ga0495686_0099087_234_1136 240
157 3300048091 Ga0495626_0000015 Ga0495626_0000015_102026_102790 240
158 3300050490 nmdc:mga03n38_41862_c1 nmdc:mga03n38_41862_c1_223_1098 240
159 3300050496 nmdc:mga07m45_62960_c1 nmdc:mga07m45_62960_c1_838_1749 240
160 3300053086 Ga0500578_0215964 Ga0500578_0215964_80_982 240
161 iso_pu_bacteria 2862178590 2862181274 240
162 3300005844 Ga0068862_100000074 Ga0068862_100000074110 241
163 3300006931 Ga0097620_100210162 Ga0097620_1002101622 241
164 3300009101 Ga0105247_10119490 Ga0105247_101194902 241
165 3300025900 Ga0207710_10105809 Ga0207710_101058092 241
166 3300028380 Ga0268265_10000847 Ga0268265_1000084720 241
167 3300030522 Ga0307512_10040433 Ga0307512_100404333 241
168 3300031649 Ga0307514_10004958 Ga0307514_100049584 241
169 3300031730 Ga0307516_10006745 Ga0307516_100067453 241
170 3300033180 Ga0307510_10058361 Ga0307510_100583614 241
171 3300033180 Ga0307510_10219888 Ga0307510_102198881 241
172 3300041498 Ga0451841_0680686 Ga0451841_0680686_30_941 241
173 3300041512 Ga0451853_1601412 Ga0451853_1601412_875_1792 241
174 3300041512 Ga0451853_3602439 Ga0451853_3602439_3454_4383 241
175 3300042005 Ga0439448_0008535 Ga0439448_0008535_195_1106 241
176 3300042007 Ga0439449_0014725 Ga0439449_0014725_1513_2415 241
177 3300042012 Ga0439455_0037657 Ga0439455_0037657_295_1206 241
178 3300044658 Ga0466972_0004929 Ga0466972_0004929_180_1058 241
179 3300044693 Ga0466961_0012375 Ga0466961_0012375_4235_5113 241
180 3300046463 Ga0495653_0000002 Ga0495653_0000002_333415_334191 241
181 3300046660 Ga0495625_0137418 Ga0495625_0137418_455_1366 241
182 3300047443 Ga0495687_004181 Ga0495687_004181_5707_6594 241
183 3300048919 Ga0496116_0182660 Ga0496116_0182660_269_1045 241
184 3300048922 Ga0496119_0124169 Ga0496119_0124169_233_1009 241
185 3300048924 Ga0496121_0009885 Ga0496121_0009885_8308_9084 241
186 3300048925 Ga0496122_0037935 Ga0496122_0037935_603_1379 241
187 3300048926 Ga0496123_0009060 Ga0496123_0009060_7087_7863 241
188 3300048927 Ga0496124_0068150 Ga0496124_0068150_709_1485 241
189 3300049570 Ga0501033_0066516 Ga0501033_0066516_1411_2340 241
190 3300049822 Ga0501035_0029889 Ga0501035_0029889_2130_3059 241
191 3300053149 Ga0500600_0064882 Ga0500600_0064882_196_1083 241
192 3300053149 Ga0500600_0172950 Ga0500600_0172950_41_997 241
193 3300061719 Ga0466962_0023165 Ga0466962_0023165_633_1511 241
194 iso_pu_bacteria 2643221563 2643835400 241
195 iso_pu_bacteria 2643221608 2644056326 241
196 iso_pu_bacteria 2802429296 2804849247 241
197 iso_pu_bacteria 2928959182 2928961978 241
198 iso_pu_bacteria 2990088156 2990093814 241
199 iso_pu_bacteria 3002998708 3003002136 241
200 iso_pu_bacteria 8025413630 8025413824 241
201 3300009553 Ga0105249_10160716 Ga0105249_101607162 242
202 3300025961 Ga0207712_10146774 Ga0207712_101467742 242
203 3300031616 Ga0307508_10241856 Ga0307508_102418561 242
204 3300042157 Ga0439458_0004574 Ga0439458_0004574_910_1869 242
205 3300046507 Ga0495606_0000200 Ga0495606_0000200_28834_29625 242
206 3300046694 Ga0495649_0000033 Ga0495649_0000033_92634_93425 242
207 3300046810 Ga0495660_0078105 Ga0495660_0078105_76_885 242
208 3300048924 Ga0496121_0000067 Ga0496121_0000067_70782_71615 242
209 iso_pu_bacteria 2643221578 2643905053 242
210 iso_pu_bacteria 2643221673 2644403111 242
211 iso_pu_bacteria 2862574272 2862580336 242
212 iso_pu_bacteria 2946045630 2946052317 242
213 3300013104 Ga0157370_10032695 Ga0157370_100326954 243
214 3300028563 Ga0265319_1026094 Ga0265319_10260941 243
215 3300028577 Ga0265318_10000139 Ga0265318_1000013952 243
216 3300031235 Ga0265330_10003994 Ga0265330_100039943 243
217 3300031238 Ga0265332_10003516 Ga0265332_100035163 243
218 3300031239 Ga0265328_10002301 Ga0265328_100023016 243
219 3300031240 Ga0265320_10002481 Ga0265320_100024816 243
220 3300031242 Ga0265329_10000367 Ga0265329_1000036719 243
221 3300031249 Ga0265339_10077377 Ga0265339_100773772 243
222 3300031250 Ga0265331_10004641 Ga0265331_100046416 243
223 3300031344 Ga0265316_10008789 Ga0265316_100087896 243
224 3300031711 Ga0265314_10013933 Ga0265314_100139332 243
225 3300031712 Ga0265342_10001175 Ga0265342_100011755 243
226 3300046501 Ga0495607_0010063 Ga0495607_0010063_306_1094 243
227 3300046507 Ga0495606_0000545 Ga0495606_0000545_11980_12792 243
228 3300046694 Ga0495649_0053335 Ga0495649_0053335_1211_2023 243
229 3300048905 Ga0496102_0043134 Ga0496102_0043134_2634_3467 243
230 3300053730 Ga0500645_016698 Ga0500645_016698_1501_2286 243
231 iso_pu_bacteria 2643221692 2644514321 243
232 iso_pu_bacteria 2687453743 2689992791 243
233 iso_pu_bacteria 2917736166 2917736462 243
234 3300005289 Ga0065704_10097097 Ga0065704_100970972 244
235 3300005347 Ga0070668_100002528 Ga0070668_1000025287 244
236 3300005353 Ga0070669_100001764 Ga0070669_10000176412 244
237 3300005367 Ga0070667_100020533 Ga0070667_1000205332 244
238 3300009011 Ga0105251_10030612 Ga0105251_100306122 244
239 3300009177 Ga0105248_10037790 Ga0105248_100377902 244
240 3300021384 Ga0213876_10161140 Ga0213876_101611401 244
241 3300025711 Ga0207696_1003663 Ga0207696_10036636 244
242 3300025735 Ga0207713_1001885 Ga0207713_100188511 244
243 3300025923 Ga0207681_10001397 Ga0207681_100013972 244
244 3300025941 Ga0207711_10017238 Ga0207711_100172383 244
245 3300025941 Ga0207711_10382345 Ga0207711_103823452 244
246 3300025972 Ga0207668_10006938 Ga0207668_100069385 244
247 3300044901 Ga0466960_0003455 Ga0466960_0003455_2487_3314 244
248 3300048924 Ga0496121_0001912 Ga0496121_0001912_29124_29975 244
249 3300048929 Ga0496126_0107103 Ga0496126_0107103_1010_1861 244
250 3300048929 Ga0496126_0319170 Ga0496126_0319170_43_894 244
251 iso_pu_bacteria 2554235341 2555668355 244
252 iso_pu_bacteria 2599185160 2599355356 244
253 iso_pu_bacteria 2599185161 2599360825 244
254 iso_pu_bacteria 2599185162 2599367147 244
255 iso_pu_bacteria 2599185163 2599373937 244
256 iso_pu_bacteria 2599185164 2599380462 244
257 iso_pu_bacteria 2599185165 2599386909 244
258 iso_pu_bacteria 2599185166 2599392795 244
259 iso_pu_bacteria 2599185168 2599404562 244
260 iso_pu_bacteria 2599185181 2599462190 244
261 iso_pu_bacteria 2599185182 2599466768 244
262 iso_pu_bacteria 2599185186 2599490718 244
263 iso_pu_bacteria 2599185356 2600214812 244
264 iso_pu_bacteria 2600255313 2601774483 244
265 iso_pu_bacteria 2643221587 2643942515 244
266 iso_pu_bacteria 2643221677 2644429974 244
267 iso_pu_bacteria 2667528171 2671097957 244
268 iso_pu_bacteria 2818991464 2819703041 244
269 iso_pu_bacteria 2844665904 2844668867 244
270 iso_pu_bacteria 2917070673 2917072122 244
271 iso_pu_bacteria 2935353572 2935354294 244
272 iso_pu_bacteria 637000220 637318717 244
273 iso_pu_bacteria 8019769354 8019770911 244
274 iso_pu_bacteria 8057798959 8057803655 244
275 3300005335 Ga0070666_10162510 Ga0070666_101625102 245
276 3300005355 Ga0070671_100003686 Ga0070671_1000036863 245
277 3300005355 Ga0070671_100003780 Ga0070671_10000378011 245
278 3300005548 Ga0070665_100000107 Ga0070665_100000107103 245
279 3300005548 Ga0070665_100033770 Ga0070665_1000337704 245
280 3300005841 Ga0068863_100018630 Ga0068863_1000186306 245
281 3300005843 Ga0068860_100015006 Ga0068860_1000150069 245
282 3300005844 Ga0068862_100016576 Ga0068862_1000165765 245
283 3300009092 Ga0105250_10012357 Ga0105250_100123572 245
284 3300025711 Ga0207696_1041113 Ga0207696_10411132 245
285 3300025735 Ga0207713_1045466 Ga0207713_10454662 245
286 3300025903 Ga0207680_10137414 Ga0207680_101374142 245
287 3300025923 Ga0207681_10001221 Ga0207681_1000122111 245
288 3300025931 Ga0207644_10055190 Ga0207644_100551903 245
289 3300025986 Ga0207658_10001032 Ga0207658_1000103218 245
290 3300025986 Ga0207658_10092397 Ga0207658_100923972 245
291 3300026088 Ga0207641_10003617 Ga0207641_1000361713 245
292 3300028379 Ga0268266_10000354 Ga0268266_1000035418 245
293 3300028379 Ga0268266_10009243 Ga0268266_100092434 245
294 3300028380 Ga0268265_10005338 Ga0268265_100053386 245
295 3300028380 Ga0268265_10097822 Ga0268265_100978222 245
296 3300046512 Ga0495610_0019749 Ga0495610_0019749_1830_2651 245
297 3300046518 Ga0495631_0002052 Ga0495631_0002052_660_1481 245
298 3300046660 Ga0495625_0000081 Ga0495625_0000081_42426_43235 245
299 3300047446 Ga0495679_001171 Ga0495679_001171_11575_12396 245
300 3300048905 Ga0496102_0000613 Ga0496102_0000613_28782_29558 245
301 3300048906 Ga0496103_0000163 Ga0496103_0000163_47742_48518 245
302 3300048906 Ga0496103_0009503 Ga0496103_0009503_1297_2148 245
303 3300048907 Ga0496104_0002224 Ga0496104_0002224_3664_4440 245
304 3300048908 Ga0496105_0003862 Ga0496105_0003862_6869_7645 245
305 3300048914 Ga0496111_0058777 Ga0496111_0058777_1003_1779 245
306 3300048916 Ga0496113_0000081 Ga0496113_0000081_1489_2265 245
307 3300048918 Ga0496115_0133558 Ga0496115_0133558_1181_1957 245
308 3300048919 Ga0496116_0042961 Ga0496116_0042961_1515_2366 245
309 3300048919 Ga0496116_0080144 Ga0496116_0080144_1174_1950 245
310 3300048920 Ga0496117_0027203 Ga0496117_0027203_1874_2650 245
311 3300048921 Ga0496118_0030117 Ga0496118_0030117_2692_3468 245
312 3300048921 Ga0496118_0037674 Ga0496118_0037674_2837_3688 245
313 3300048922 Ga0496119_0004118 Ga0496119_0004118_10302_11078 245
314 3300048923 Ga0496120_0004524 Ga0496120_0004524_2931_3707 245
315 3300048923 Ga0496120_0028051 Ga0496120_0028051_2221_3072 245
316 3300048924 Ga0496121_0059414 Ga0496121_0059414_1541_2317 245
317 3300048925 Ga0496122_0001234 Ga0496122_0001234_1658_2434 245
318 3300048926 Ga0496123_0003785 Ga0496123_0003785_3338_4114 245
319 3300048926 Ga0496123_0032276 Ga0496123_0032276_165_1016 245
320 3300048927 Ga0496124_0003614 Ga0496124_0003614_12020_12796 245
321 3300048928 Ga0496125_0300067 Ga0496125_0300067_136_912 245
322 3300048928 Ga0496125_0312175 Ga0496125_0312175_136_912 245
323 3300048929 Ga0496126_0005438 Ga0496126_0005438_3551_4327 245
324 3300053136 Ga0500559_0001556 Ga0500559_0001556_5271_6080 245
325 iso_pu_bacteria 2582581313 2585306605 245
326 iso_pu_bacteria 2643221647 2644263470 245
327 iso_pu_bacteria 2784746768 2785366704 245
328 iso_pu_bacteria 2786546132 2786667764 245
329 iso_pu_bacteria 2862281513 2862290096 245
330 iso_pu_bacteria 2862290372 2862292990 245
331 iso_pu_bacteria 2946064051 2946065220 245
332 iso_pu_bacteria 2947224130 2947232225 245
333 iso_pu_bacteria 2954002825 2954008556 245
334 iso_pu_bacteria 2954380949 2954389138 245
335 iso_pu_bacteria 2954673503 2954673904 245
336 iso_pu_bacteria 2954682443 2954690087 245
337 iso_pu_bacteria 2954691527 2954699886 245
338 iso_pu_bacteria 2954701450 2954702312 245
339 iso_pu_bacteria 3006393351 3006394311 245
340 iso_pu_bacteria 8003314358 8003323451 245
341 3300006051 Ga0075364_10005211 Ga0075364_100052117 246
342 3300006177 Ga0075362_10019711 Ga0075362_100197112 246
343 3300006186 Ga0075369_10006670 Ga0075369_100066705 246
344 3300006881 Ga0068865_100244176 Ga0068865_1002441762 246
345 3300009011 Ga0105251_10000005 Ga0105251_10000005125 246
346 3300009036 Ga0105244_10001015 Ga0105244_1000101512 246
347 3300025735 Ga0207713_1000036 Ga0207713_100003677 246
348 3300025938 Ga0207704_10185123 Ga0207704_101851232 246
349 3300027312 Ga0209371_1000609 Ga0209371_10006095 246
350 3300030500 Ga0268256_1000527 Ga0268256_100052726 246
351 3300046453 Ga0495627_000008 Ga0495627_000008_111853_112677 246
352 3300046512 Ga0495610_0010854 Ga0495610_0010854_3218_4069 246
353 3300046516 Ga0495628_0229975 Ga0495628_0229975_473_1327 246
354 3300046523 Ga0495644_0001087 Ga0495644_0001087_4770_5594 246
355 3300046524 Ga0495648_0004517 Ga0495648_0004517_566_1387 246
356 3300046530 Ga0495654_0021651 Ga0495654_0021651_1487_2323 246
357 3300046538 Ga0495609_0000340 Ga0495609_0000340_19474_20298 246
358 3300046558 Ga0495633_0000446 Ga0495633_0000446_11802_12638 246
359 3300046665 Ga0495661_0002111 Ga0495661_0002111_3250_4071 246
360 3300046678 Ga0495599_0212034 Ga0495599_0212034_283_1137 246
361 3300046810 Ga0495660_0001366 Ga0495660_0001366_872_1696 246
362 3300047470 Ga0495681_0011173 Ga0495681_0011173_69_893 246
363 3300048919 Ga0496116_0120560 Ga0496116_0120560_268_1092 246
364 3300048928 Ga0496125_0012848 Ga0496125_0012848_369_1220 246
365 3300050489 nmdc:mga03683_15022_c1 nmdc:mga03683_15022_c1_826_1665 246
366 3300050491 nmdc:mga00v17_626_c1 nmdc:mga00v17_626_c1_4168_5007 246
367 3300050516 nmdc:mga0sz30_6232_c1 nmdc:mga0sz30_6232_c1_3382_4221 246
368 3300053161 Ga0500634_0000350 Ga0500634_0000350_2286_3107 246
369 iso_pu_bacteria 2643221560 2643819954 246
370 iso_pu_bacteria 2826581358 2826585861 246
371 iso_pu_bacteria 2842849001 2842850234 246
372 iso_pu_bacteria 2877676314 2877683834 246
373 3300005290 Ga0065712_10067982 Ga0065712_100679825 247
374 3300041507 Ga0451851_0122701 Ga0451851_0122701_88_912 247
375 3300046501 Ga0495607_0057620 Ga0495607_0057620_318_1142 247
376 3300046501 Ga0495607_0087450 Ga0495607_0087450_453_1307 247
377 3300046506 Ga0495583_0002118 Ga0495583_0002118_13710_14531 247
378 3300046523 Ga0495644_0059130 Ga0495644_0059130_94_918 247
379 3300046530 Ga0495654_0000414 Ga0495654_0000414_21881_22702 247
380 3300046660 Ga0495625_0012474 Ga0495625_0012474_4866_5723 247
381 3300047320 Ga0495672_0000032 Ga0495672_0000032_96319_97167 247
382 3300047446 Ga0495679_003085 Ga0495679_003085_3998_4819 247
383 3300053087 Ga0500643_048167 Ga0500643_048167_88_897 247
384 iso_pu_bacteria 2599185155 2599327076 247
385 3300002737 JGI25162J39368_1000054 JGI25162J39368_100005463 248
386 3300002771 JGI25163J39215_1000106 JGI25163J39215_100010621 248
387 3300002772 JGI25164J39214_1000029 JGI25164J39214_100002981 248
388 3300003214 JGI25165J46597_1000111 JGI25165J46597_100011163 248
389 3300003781 Ga0055536_1000005 Ga0055536_1000005308 248
390 3300003791 Ga0055530_10000001 Ga0055530_1000000123 248
391 3300003792 Ga0055540_1000258 Ga0055540_100025814 248
392 3300009011 Ga0105251_10005637 Ga0105251_100056374 248
393 3300009036 Ga0105244_10001477 Ga0105244_100014778 248
394 3300009148 Ga0105243_10000144 Ga0105243_100001442 248
395 3300009148 Ga0105243_10024932 Ga0105243_100249322 248
396 3300009553 Ga0105249_10027254 Ga0105249_100272543 248
397 3300011119 Ga0105246_10019373 Ga0105246_100193736 248
398 3300014497 Ga0182008_10000785 Ga0182008_1000078521 248
399 3300025207 Ga0209760_100015 Ga0209760_10001560 248
400 3300025231 Ga0207427_100001 Ga0207427_100001545 248
401 3300025233 Ga0209437_100003 Ga0209437_100003827 248
402 3300025261 Ga0209233_1000007 Ga0209233_1000007545 248
403 3300025292 Ga0209676_1000003 Ga0209676_1000003520 248
404 3300025298 Ga0209050_1000004 Ga0209050_1000004502 248
405 3300025303 Ga0209051_1000006 Ga0209051_1000006473 248
406 3300025728 Ga0207655_1003129 Ga0207655_10031297 248
407 3300025735 Ga0207713_1031618 Ga0207713_10316181 248
408 3300025935 Ga0207709_10001160 Ga0207709_100011602 248
409 3300025935 Ga0207709_10205008 Ga0207709_102050082 248
410 3300025961 Ga0207712_10032850 Ga0207712_100328504 248
411 3300028794 Ga0307515_10058201 Ga0307515_100582014 248
412 3300030521 Ga0307511_10100046 Ga0307511_101000462 248
413 3300030522 Ga0307512_10006750 Ga0307512_100067506 248
414 3300046453 Ga0495627_005481 Ga0495627_005481_74_934 248
415 3300046458 Ga0495591_000018 Ga0495591_000018_104556_105416 248
416 3300046471 Ga0495650_0010868 Ga0495650_0010868_1701_2561 248
417 3300046474 Ga0495605_0000088 Ga0495605_0000088_68566_69426 248
418 3300046474 Ga0495605_0000522 Ga0495605_0000522_1142_2002 248
419 3300046499 Ga0495594_0001521 Ga0495594_0001521_1838_2698 248
420 3300046506 Ga0495583_0000135 Ga0495583_0000135_73401_74261 248
421 3300046515 Ga0495620_0000034 Ga0495620_0000034_48594_49454 248
422 3300046520 Ga0495637_0012102 Ga0495637_0012102_1324_2184 248
423 3300046520 Ga0495637_0013550 Ga0495637_0013550_2205_3065 248
424 3300046524 Ga0495648_0001250 Ga0495648_0001250_5669_6529 248
425 3300046530 Ga0495654_0006197 Ga0495654_0006197_187_1047 248
426 3300046530 Ga0495654_0076963 Ga0495654_0076963_100_960 248
427 3300046538 Ga0495609_0000147 Ga0495609_0000147_49803_50663 248
428 3300046542 Ga0495597_0000013 Ga0495597_0000013_94525_95385 248
429 3300046542 Ga0495597_0004857 Ga0495597_0004857_5666_6526 248
430 3300046558 Ga0495633_0000316 Ga0495633_0000316_27089_27949 248
431 3300046665 Ga0495661_0000078 Ga0495661_0000078_68498_69358 248
432 3300046692 Ga0495671_0014142 Ga0495671_0014142_187_1047 248
433 3300046794 Ga0495589_0010957 Ga0495589_0010957_2325_3185 248
434 3300046810 Ga0495660_0000873 Ga0495660_0000873_15871_16731 248
435 3300046810 Ga0495660_0002313 Ga0495660_0002313_11285_12145 248
436 3300047323 Ga0495683_0000108 Ga0495683_0000108_49739_50599 248
437 3300047446 Ga0495679_000198 Ga0495679_000198_13795_14655 248
438 3300047469 Ga0495673_0025675 Ga0495673_0025675_472_1332 248
439 3300047470 Ga0495681_0013912 Ga0495681_0013912_1964_2824 248
440 3300048919 Ga0496116_0000126 Ga0496116_0000126_75479_76300 248
441 3300048920 Ga0496117_0000623 Ga0496117_0000623_782_1603 248
442 3300048921 Ga0496118_0071815 Ga0496118_0071815_654_1475 248
443 3300048924 Ga0496121_0000142 Ga0496121_0000142_75412_76233 248
444 3300048925 Ga0496122_0002287 Ga0496122_0002287_13614_14435 248
445 3300048925 Ga0496122_0005467 Ga0496122_0005467_12052_12912 248
446 3300048926 Ga0496123_0000434 Ga0496123_0000434_60576_61397 248
447 3300048928 Ga0496125_0185974 Ga0496125_0185974_253_1074 248
448 3300049459 Ga0495678_000081 Ga0495678_000081_68286_69146 248
449 3300003771 Ga0055526_1022180 Ga0055526_10221802 249
450 3300003773 Ga0055537_1003505 Ga0055537_10035053 249
451 3300003775 Ga0055524_1012948 Ga0055524_10129482 249
452 3300003790 Ga0055528_1008429 Ga0055528_10084293 249
453 3300005262 Ga0065165_1001271 Ga0065165_100127123 249
454 3300005327 Ga0070658_10001281 Ga0070658_1000128112 249
455 3300005336 Ga0070680_100011064 Ga0070680_1000110643 249
456 3300005339 Ga0070660_100019870 Ga0070660_1000198702 249
457 3300005458 Ga0070681_10003845 Ga0070681_1000384512 249
458 3300005530 Ga0070679_100007593 Ga0070679_1000075938 249
459 3300005563 Ga0068855_100005081 Ga0068855_10000508110 249
460 3300005578 Ga0068854_100072783 Ga0068854_1000727832 249
461 3300005614 Ga0068856_100411476 Ga0068856_1004114761 249
462 3300009092 Ga0105250_10004047 Ga0105250_100040476 249
463 3300025263 Ga0209565_1000281 Ga0209565_100028140 249
464 3300025273 Ga0209673_1001574 Ga0209673_10015748 249
465 3300025291 Ga0209675_1019109 Ga0209675_10191092 249
466 3300025295 Ga0209564_1000557 Ga0209564_100055734 249
467 3300025295 Ga0209564_1019939 Ga0209564_10199392 249
468 3300025297 Ga0209758_1000608 Ga0209758_100060812 249
469 3300025298 Ga0209050_1027233 Ga0209050_10272332 249
470 3300025299 Ga0209256_1013803 Ga0209256_10138032 249
471 3300025909 Ga0207705_10025961 Ga0207705_100259613 249
472 3300025912 Ga0207707_10003543 Ga0207707_100035438 249
473 3300025913 Ga0207695_10012701 Ga0207695_100127017 249
474 3300025917 Ga0207660_10167993 Ga0207660_101679932 249
475 3300025919 Ga0207657_10281967 Ga0207657_102819672 249
476 3300025921 Ga0207652_10011650 Ga0207652_100116501 249
477 3300025949 Ga0207667_10021876 Ga0207667_100218763 249
478 3300026078 Ga0207702_10042525 Ga0207702_100425253 249
479 3300028786 Ga0307517_10048414 Ga0307517_100484145 249
480 3300028794 Ga0307515_10000524 Ga0307515_1000052437 249
481 3300028794 Ga0307515_10027774 Ga0307515_100277746 249
482 3300030521 Ga0307511_10011009 Ga0307511_100110096 249
483 3300030521 Ga0307511_10037288 Ga0307511_100372883 249
484 3300031456 Ga0307513_10015813 Ga0307513_100158138 249
485 3300031507 Ga0307509_10002942 Ga0307509_1000294215 249
486 3300031507 Ga0307509_10003139 Ga0307509_1000313920 249
487 3300031616 Ga0307508_10049105 Ga0307508_100491053 249
488 3300031616 Ga0307508_10229675 Ga0307508_102296751 249
489 3300031838 Ga0307518_10186862 Ga0307518_101868622 249
490 3300033179 Ga0307507_10007410 Ga0307507_1000741011 249
491 3300033180 Ga0307510_10009355 Ga0307510_100093559 249
492 3300033180 Ga0307510_10024282 Ga0307510_100242822 249
493 3300033180 Ga0307510_10054411 Ga0307510_100544115 249
494 3300039447 Ga0436361_0989786 Ga0436361_0989786_71_895 249
495 3300046454 Ga0495592_0020586 Ga0495592_0020586_45_938 249
496 3300046462 Ga0495651_0021486 Ga0495651_0021486_4070_4963 249
497 3300046474 Ga0495605_0007282 Ga0495605_0007282_2296_3156 249
498 3300046476 Ga0495662_0000110 Ga0495662_0000110_21290_22183 249
499 3300046477 Ga0495664_0001686 Ga0495664_0001686_5901_6794 249
500 3300046499 Ga0495594_0043677 Ga0495594_0043677_1322_2215 249
501 3300046514 Ga0495618_0081775 Ga0495618_0081775_1151_2044 249
502 3300046516 Ga0495628_0009638 Ga0495628_0009638_4765_5658 249
503 3300046535 Ga0495586_0004586 Ga0495586_0004586_117_1010 249
504 3300046536 Ga0495587_0019040 Ga0495587_0019040_3278_4171 249
505 3300046542 Ga0495597_0038360 Ga0495597_0038360_475_1284 249
506 3300046559 Ga0495667_0179581 Ga0495667_0179581_316_1209 249
507 3300046616 Ga0495668_0007406 Ga0495668_0007406_1286_2095 249
508 3300046616 Ga0495668_0032163 Ga0495668_0032163_1857_2717 249
509 3300046642 Ga0495634_0031104 Ga0495634_0031104_1824_2717 249
510 3300046660 Ga0495625_0029266 Ga0495625_0029266_559_1455 249
511 3300046660 Ga0495625_0092267 Ga0495625_0092267_1079_1888 249
512 3300046674 Ga0495588_0043085 Ga0495588_0043085_1060_1956 249
513 3300046675 Ga0495657_0000437 Ga0495657_0000437_3278_4171 249
514 3300046680 Ga0495646_0000400 Ga0495646_0000400_13294_14187 249
515 3300046689 Ga0495613_0002753 Ga0495613_0002753_7031_7924 249
516 3300046810 Ga0495660_0001253 Ga0495660_0001253_3340_4200 249
517 3300047317 Ga0495604_0000673 Ga0495604_0000673_20239_21132 249
518 3300047319 Ga0495674_0170119 Ga0495674_0170119_531_1424 249
519 3300047321 Ga0495676_0004612 Ga0495676_0004612_8452_9345 249
520 3300047470 Ga0495681_0008911 Ga0495681_0008911_3068_3964 249
521 3300047472 Ga0495686_0038730 Ga0495686_0038730_1516_2412 249
522 3300047673 Ga0495593_0002874 Ga0495593_0002874_5363_6256 249
523 3300048088 Ga0495602_0059408 Ga0495602_0059408_1104_1997 249
524 3300048089 Ga0495614_0007263 Ga0495614_0007263_2220_3113 249
525 3300053104 Ga0500556_0024836 Ga0500556_0024836_79_888 249
526 iso_pu_bacteria 2582581279 2585149455 249
527 iso_pu_bacteria 2945961074 2945963004 249
528 3300003203 JGI25406J46586_10002057 JGI25406J46586_100020579 250
529 3300003320 rootH2_10025695 rootH2_100256952 250
530 3300003322 rootL2_10029067 rootL2_100290677 250
531 3300005536 Ga0070697_100077656 Ga0070697_1000776562 250
532 3300005985 Ga0081539_10000417 Ga0081539_1000041722 250
533 3300006946 Ga0079104_1000006 Ga0079104_1000006304 250
534 3300006948 Ga0099826_10000572 Ga0099826_1000057213 250
535 3300013102 Ga0157371_10000063 Ga0157371_1000006334 250
536 3300015261 Ga0182006_1006128 Ga0182006_10061282 250
537 3300021361 Ga0213872_10159707 Ga0213872_101597071 250
538 3300025299 Ga0209256_1003017 Ga0209256_10030175 250
539 3300027111 Ga0209281_1000011 Ga0209281_1000011491 250
540 3300046460 Ga0495638_0004745 Ga0495638_0004745_71_880 250
541 3300046460 Ga0495638_0092995 Ga0495638_0092995_401_1210 250
542 3300046512 Ga0495610_0000058 Ga0495610_0000058_49658_50467 250
543 3300046513 Ga0495616_0000031 Ga0495616_0000031_23117_23926 250
544 3300046519 Ga0495632_0000607 Ga0495632_0000607_28101_28910 250
545 3300046530 Ga0495654_0000012 Ga0495654_0000012_108458_109267 250
546 3300046616 Ga0495668_0022070 Ga0495668_0022070_498_1307 250
547 3300046660 Ga0495625_0020841 Ga0495625_0020841_2504_3313 250
548 3300046692 Ga0495671_0074428 Ga0495671_0074428_279_1088 250
549 3300047320 Ga0495672_0003990 Ga0495672_0003990_9056_9865 250
550 3300053104 Ga0500556_0001301 Ga0500556_0001301_2054_2863 250
551 3300053134 Ga0500658_0050740 Ga0500658_0050740_133_942 250
552 3300053153 Ga0500616_0046069 Ga0500616_0046069_940_1749 250
553 3300053730 Ga0500645_004520 Ga0500645_004520_4054_4863 250
554 3300053731 Ga0500609_000125 Ga0500609_000125_6115_6924 250
555 iso_pu_bacteria 2616644814 2616693185 250
556 iso_pu_bacteria 2643221598 2643999094 250
557 3300046453 Ga0495627_002624 Ga0495627_002624_3105_3968 251
558 3300046458 Ga0495591_000300 Ga0495591_000300_6247_7110 251
559 3300046471 Ga0495650_0000017 Ga0495650_0000017_424403_425212 251
560 3300046501 Ga0495607_0006881 Ga0495607_0006881_1990_2853 251
561 3300046507 Ga0495606_0000729 Ga0495606_0000729_37741_38604 251
562 3300046512 Ga0495610_0009917 Ga0495610_0009917_3623_4486 251
563 3300046512 Ga0495610_0012925 Ga0495610_0012925_1000_1809 251
564 3300046515 Ga0495620_0000207 Ga0495620_0000207_10328_11191 251
565 3300046519 Ga0495632_0003572 Ga0495632_0003572_6468_7331 251
566 3300046660 Ga0495625_0072463 Ga0495625_0072463_1536_2345 251
567 3300046660 Ga0495625_0226307 Ga0495625_0226307_34_843 251
568 3300046665 Ga0495661_0000138 Ga0495661_0000138_46609_47472 251
569 3300046794 Ga0495589_0000585 Ga0495589_0000585_1518_2381 251
570 3300047323 Ga0495683_0002624 Ga0495683_0002624_849_1733 251
571 3300047443 Ga0495687_008146 Ga0495687_008146_1620_2504 251
572 3300047470 Ga0495681_0003080 Ga0495681_0003080_249_1112 251
573 3300047470 Ga0495681_0004938 Ga0495681_0004938_4999_5862 251
574 3300047470 Ga0495681_0159761 Ga0495681_0159761_27_890 251
575 3300049459 Ga0495678_021074 Ga0495678_021074_262_1071 251
576 3300053086 Ga0500578_0000234 Ga0500578_0000234_48597_49406 251
577 3300053118 Ga0500594_0000022 Ga0500594_0000022_24752_25561 251
578 iso_pu_bacteria 2506783011 2506864804 251
579 3300031251 Ga0265327_10000175 Ga0265327_1000017548 252
580 3300039447 Ga0436361_0804027 Ga0436361_0804027_410_1234 252
581 3300050493 nmdc:mga0k408_71943_c1 nmdc:mga0k408_71943_c1_678_1499 252
582 3300053136 Ga0500559_0000005 Ga0500559_0000005_131905_132726 252
583 iso_pu_bacteria 2651869719 2652544212 252
584 3300015261 Ga0182006_1003571 Ga0182006_10035717 253
585 3300025297 Ga0209758_1001477 Ga0209758_10014772 253
586 3300025299 Ga0209256_1001941 Ga0209256_10019413 253
587 3300041410 Ga0439461_0009575 Ga0439461_0009575_913_1722 253
588 3300042156 Ga0439446_0004310 Ga0439446_0004310_898_1707 253
589 3300042436 Ga0439435_0002850 Ga0439435_0002850_1754_2563 253
590 3300046474 Ga0495605_0000067 Ga0495605_0000067_119565_120425 253
591 3300046501 Ga0495607_0175258 Ga0495607_0175258_104_964 253
592 3300046506 Ga0495583_0000457 Ga0495583_0000457_17223_18083 253
593 3300046519 Ga0495632_0000748 Ga0495632_0000748_6956_7816 253
594 3300046520 Ga0495637_0012438 Ga0495637_0012438_1660_2520 253
595 3300046616 Ga0495668_0029381 Ga0495668_0029381_896_1705 253
596 3300046665 Ga0495661_0000513 Ga0495661_0000513_17671_18531 253
597 3300047470 Ga0495681_0000009 Ga0495681_0000009_147221_148105 253
598 3300047472 Ga0495686_0025642 Ga0495686_0025642_2516_3325 253
599 iso_pu_bacteria 2511231004 2511253361 253
600 iso_pu_bacteria 2511231007 2511269607 253
601 iso_pu_bacteria 2511231008 2511278028 253
602 iso_pu_bacteria 2511231014 2511311612 253
603 iso_pu_bacteria 2511231016 2511324212 253
604 iso_pu_bacteria 2511231021 2511359913 253
605 iso_pu_bacteria 2512047018 2512326225 253
606 iso_pu_bacteria 2582580891 2583792554 253
607 iso_pu_bacteria 2599185316 2600021798 253
608 iso_pu_bacteria 2599185317 2600030832 253
609 iso_pu_bacteria 2599185325 2600075071 253
610 iso_pu_bacteria 2600254930 2600360637 253
611 iso_pu_bacteria 2623620446 2624491734 253
612 iso_pu_bacteria 2667528176 2671126882 253
613 iso_pu_bacteria 2740892503 2743737691 253
614 iso_pu_bacteria 2923153595 2923156736 253
615 iso_pu_bacteria 2923586266 2923588027 253
616 iso_pu_bacteria 2931369376 2931374720 253
617 iso_pu_bacteria 2931396565 2931401304 253
618 iso_pu_bacteria 3007395558 3007396547 253
619 iso_pu_bacteria 8015687852 8015690956 253
620 iso_pu_bacteria 8055770955 8055774096 253
621 iso_pu_bacteria 8056177738 8056178997 253
622 3300003791 Ga0055530_10000165 Ga0055530_1000016517 254
623 3300003792 Ga0055540_1000186 Ga0055540_100018617 254
624 3300005288 Ga0065714_10003126 Ga0065714_100031265 254
625 3300005288 Ga0065714_10009959 Ga0065714_100099594 254
626 3300005288 Ga0065714_10011828 Ga0065714_100118286 254
627 3300005289 Ga0065704_10097927 Ga0065704_100979271 254
628 3300006051 Ga0075364_10005137 Ga0075364_100051375 254
629 3300017792 Ga0163161_10003171 Ga0163161_100031713 254
630 3300025292 Ga0209676_1004357 Ga0209676_10043575 254
631 3300025298 Ga0209050_1000037 Ga0209050_1000037221 254
632 3300025303 Ga0209051_1000040 Ga0209051_1000040222 254
633 3300025304 Ga0209257_1002314 Ga0209257_10023143 254
634 3300030731 Ga0316177_1222324 Ga0316177_12223242 254
635 3300039450 Ga0436363_1493638 Ga0436363_1493638_1397_2239 254
636 3300046452 Ga0495617_000044 Ga0495617_000044_21635_22519 254
637 3300046452 Ga0495617_013499 Ga0495617_013499_1504_2388 254
638 3300046460 Ga0495638_0000589 Ga0495638_0000589_26684_27568 254
639 3300046460 Ga0495638_0010099 Ga0495638_0010099_3208_4092 254
640 3300046491 Ga0495584_0015439 Ga0495584_0015439_266_1150 254
641 3300046492 Ga0495585_0000142 Ga0495585_0000142_34565_35449 254
642 3300046512 Ga0495610_0004442 Ga0495610_0004442_6088_6972 254
643 3300046515 Ga0495620_0008610 Ga0495620_0008610_2815_3699 254
644 3300046520 Ga0495637_0033500 Ga0495637_0033500_1254_2138 254
645 3300046524 Ga0495648_0021510 Ga0495648_0021510_740_1624 254
646 3300046530 Ga0495654_0040591 Ga0495654_0040591_170_1054 254
647 3300046530 Ga0495654_0087054 Ga0495654_0087054_536_1420 254
648 3300046542 Ga0495597_0012599 Ga0495597_0012599_282_1166 254
649 3300046660 Ga0495625_0022235 Ga0495625_0022235_2264_3148 254
650 3300046660 Ga0495625_0113957 Ga0495625_0113957_721_1542 254
651 3300046694 Ga0495649_0015712 Ga0495649_0015712_2130_3014 254
652 3300046810 Ga0495660_0065403 Ga0495660_0065403_212_1096 254
653 3300047317 Ga0495604_0009142 Ga0495604_0009142_5487_6371 254
654 3300047444 Ga0495675_0000016 Ga0495675_0000016_103845_104729 254
655 3300047470 Ga0495681_0002219 Ga0495681_0002219_7511_8395 254
656 3300047470 Ga0495681_0004335 Ga0495681_0004335_6774_7658 254
657 3300047471 Ga0495684_0023241 Ga0495684_0023241_1290_2174 254
658 3300047472 Ga0495686_0000633 Ga0495686_0000633_34697_35581 254
659 3300049459 Ga0495678_001228 Ga0495678_001228_16820_17704 254
660 3300050491 nmdc:mga00v17_51246_c1 nmdc:mga00v17_51246_c1_1331_2170 254
661 3300053139 Ga0500568_0019338 Ga0500568_0019338_1378_2262 254
662 3300005288 Ga0065714_10064839 Ga0065714_1006483912 255
663 3300009011 Ga0105251_10030203 Ga0105251_100302032 255
664 3300013102 Ga0157371_10000925 Ga0157371_100009257 255
665 3300013105 Ga0157369_10227871 Ga0157369_102278712 255
666 3300013306 Ga0163162_10000551 Ga0163162_1000055128 255
667 3300041405 Ga0439438_000450 Ga0439438_000450_8389_9324 255
668 3300041405 Ga0439438_000666 Ga0439438_000666_13490_14374 255
669 3300041407 Ga0439447_006761 Ga0439447_006761_786_1670 255
670 3300041411 Ga0439466_0013030 Ga0439466_0013030_1479_2414 255
671 3300042010 Ga0439452_000115 Ga0439452_000115_1424_2308 255
672 3300042010 Ga0439452_000826 Ga0439452_000826_2743_3678 255
673 3300046452 Ga0495617_015757 Ga0495617_015757_1288_2172 255
674 3300046453 Ga0495627_012240 Ga0495627_012240_496_1380 255
675 3300046455 Ga0495603_0000009 Ga0495603_0000009_57012_57884 255
676 3300046457 Ga0495590_0000698 Ga0495590_0000698_5772_6644 255
677 3300046457 Ga0495590_0002258 Ga0495590_0002258_2485_3369 255
678 3300046474 Ga0495605_0000806 Ga0495605_0000806_10095_10967 255
679 3300046474 Ga0495605_0023420 Ga0495605_0023420_1945_2829 255
680 3300046491 Ga0495584_0000083 Ga0495584_0000083_63501_64385 255
681 3300046491 Ga0495584_0003188 Ga0495584_0003188_7241_8125 255
682 3300046491 Ga0495584_0017141 Ga0495584_0017141_2676_3548 255
683 3300046500 Ga0495596_0000089 Ga0495596_0000089_11531_12415 255
684 3300046501 Ga0495607_0013334 Ga0495607_0013334_2234_3106 255
685 3300046501 Ga0495607_0021527 Ga0495607_0021527_1067_1951 255
686 3300046507 Ga0495606_0025101 Ga0495606_0025101_1945_2829 255
687 3300046512 Ga0495610_0005995 Ga0495610_0005995_2076_2960 255
688 3300046513 Ga0495616_0000429 Ga0495616_0000429_24138_25010 255
689 3300046515 Ga0495620_0009072 Ga0495620_0009072_515_1399 255
690 3300046518 Ga0495631_0007823 Ga0495631_0007823_1929_2813 255
691 3300046519 Ga0495632_0000495 Ga0495632_0000495_12476_13348 255
692 3300046519 Ga0495632_0015353 Ga0495632_0015353_1945_2829 255
693 3300046520 Ga0495637_0009342 Ga0495637_0009342_2093_2977 255
694 3300046522 Ga0495643_0005942 Ga0495643_0005942_777_1661 255
695 3300046522 Ga0495643_0007143 Ga0495643_0007143_3612_4484 255
696 3300046523 Ga0495644_0004478 Ga0495644_0004478_1518_2402 255
697 3300046524 Ga0495648_0015275 Ga0495648_0015275_2796_3668 255
698 3300046528 Ga0495642_0000187 Ga0495642_0000187_12032_12904 255
699 3300046530 Ga0495654_0026580 Ga0495654_0026580_1361_2233 255
700 3300046530 Ga0495654_0028499 Ga0495654_0028499_905_1789 255
701 3300046538 Ga0495609_0000477 Ga0495609_0000477_21219_22091 255
702 3300046542 Ga0495597_0030407 Ga0495597_0030407_1448_2332 255
703 3300046616 Ga0495668_0000887 Ga0495668_0000887_2151_3035 255
704 3300046660 Ga0495625_0001558 Ga0495625_0001558_11891_12775 255
705 3300046664 Ga0495659_0008262 Ga0495659_0008262_1753_2625 255
706 3300046665 Ga0495661_0010828 Ga0495661_0010828_3780_4664 255
707 3300046692 Ga0495671_0000052 Ga0495671_0000052_13868_14740 255
708 3300046694 Ga0495649_0000106 Ga0495649_0000106_59091_59963 255
709 3300046694 Ga0495649_0023498 Ga0495649_0023498_615_1499 255
710 3300046794 Ga0495589_0001063 Ga0495589_0001063_3608_4480 255
711 3300046794 Ga0495589_0006602 Ga0495589_0006602_2502_3386 255
712 3300046810 Ga0495660_0005067 Ga0495660_0005067_1926_2810 255
713 3300046810 Ga0495660_0017385 Ga0495660_0017385_1448_2332 255
714 3300047318 Ga0495636_0000221 Ga0495636_0000221_11418_12290 255
715 3300047320 Ga0495672_0001535 Ga0495672_0001535_3781_4653 255
716 3300047323 Ga0495683_0002951 Ga0495683_0002951_8530_9414 255
717 3300047443 Ga0495687_001130 Ga0495687_001130_12897_13769 255
718 3300047447 Ga0495685_041386 Ga0495685_041386_317_1189 255
719 3300047469 Ga0495673_0000190 Ga0495673_0000190_94365_95249 255
720 3300047469 Ga0495673_0000997 Ga0495673_0000997_3158_4042 255
721 3300047470 Ga0495681_0000257 Ga0495681_0000257_12870_13754 255
722 3300047472 Ga0495686_0071700 Ga0495686_0071700_453_1337 255
723 3300048091 Ga0495626_0000033 Ga0495626_0000033_48496_49380 255
724 3300048091 Ga0495626_0009842 Ga0495626_0009842_3714_4586 255
725 3300049459 Ga0495678_001014 Ga0495678_001014_10810_11682 255
726 3300049459 Ga0495678_017299 Ga0495678_017299_1632_2516 255
727 3300049459 Ga0495678_035943 Ga0495678_035943_1010_1882 255
728 3300049460 Ga0495682_0003421 Ga0495682_0003421_2278_3162 255
729 3300049460 Ga0495682_0013216 Ga0495682_0013216_475_1347 255
730 3300049569 Ga0501032_0044735 Ga0501032_0044735_1229_2047 255
731 3300049579 Ga0501043_0002520 Ga0501043_0002520_12690_13508 255
732 3300049580 Ga0501046_0055842 Ga0501046_0055842_737_1555 255
733 3300049581 Ga0501047_0000342 Ga0501047_0000342_8959_9777 255
734 3300049582 Ga0501048_0355832 Ga0501048_0355832_37_855 255
735 3300049586 Ga0501070_0141038 Ga0501070_0141038_943_1761 255
736 3300048904 Ga0496101_0323198 Ga0496101_0323198_242_1063 256
737 3300048909 Ga0496106_0063172 Ga0496106_0063172_1371_2192 256
738 3300048910 Ga0496107_0000565 Ga0496107_0000565_17656_18477 256
739 3300048924 Ga0496121_0019626 Ga0496121_0019626_4193_5014 256
740 3300046460 Ga0495638_0000160 Ga0495638_0000160_57059_57943 257
741 3300046794 Ga0495589_0002412 Ga0495589_0002412_5122_6006 257
742 3300010375 Ga0105239_10132598 Ga0105239_101325983 258
743 3300010375 Ga0105239_10811772 Ga0105239_108117721 258
744 3300013104 Ga0157370_10030558 Ga0157370_100305581 258
745 3300015261 Ga0182006_1007784 Ga0182006_10077846 258
746 3300015262 Ga0182007_10000682 Ga0182007_100006824 258
747 3300015265 Ga0182005_1015072 Ga0182005_10150722 258
748 3300041405 Ga0439438_000200 Ga0439438_000200_17098_18042 258
749 3300042013 Ga0439456_000816 Ga0439456_000816_354_1298 258
750 3300042016 Ga0439463_000202 Ga0439463_000202_11660_12604 258
751 3300042016 Ga0439463_026153 Ga0439463_026153_431_1375 258
752 3300046455 Ga0495603_0009296 Ga0495603_0009296_1629_2552 258
753 3300046460 Ga0495638_0020681 Ga0495638_0020681_1991_2932 258
754 3300046474 Ga0495605_0012723 Ga0495605_0012723_14_943 258
755 3300046474 Ga0495605_0017337 Ga0495605_0017337_1348_2292 258
756 3300046491 Ga0495584_0001678 Ga0495584_0001678_4824_5750 258
757 3300046491 Ga0495584_0002197 Ga0495584_0002197_1676_2599 258
758 3300046512 Ga0495610_0033846 Ga0495610_0033846_1319_2242 258
759 3300046515 Ga0495620_0048421 Ga0495620_0048421_407_1261 258
760 3300046520 Ga0495637_0007004 Ga0495637_0007004_3044_3967 258
761 3300046692 Ga0495671_0015686 Ga0495671_0015686_1335_2258 258
762 3300047470 Ga0495681_0000329 Ga0495681_0000329_26858_27787 258
763 3300047470 Ga0495681_0006935 Ga0495681_0006935_5202_6125 258
764 3300049459 Ga0495678_000583 Ga0495678_000583_22346_23275 258
765 3300046458 Ga0495591_000088 Ga0495591_000088_21684_22613 259
766 3300046460 Ga0495638_0007339 Ga0495638_0007339_5679_6623 259
767 3300046460 Ga0495638_0095347 Ga0495638_0095347_760_1704 259
768 3300046474 Ga0495605_0000158 Ga0495605_0000158_23056_24000 259
769 3300046692 Ga0495671_0026763 Ga0495671_0026763_1787_2716 259
770 3300047323 Ga0495683_0047214 Ga0495683_0047214_808_1752 259
771 3300047443 Ga0495687_000572 Ga0495687_000572_20744_21688 259
772 3300048091 Ga0495626_0000720 Ga0495626_0000720_20700_21644 259
773 3300048927 Ga0496124_0000812 Ga0496124_0000812_10552_11496 259
774 2162886007 SwRhRL2b_contig_3039297 SwRhRL2b_0215.00008070 261
775 3300005353 Ga0070669_100001571 Ga0070669_1000015715 261
776 3300005367 Ga0070667_100028263 Ga0070667_1000282632 261
777 3300013306 Ga0163162_10031044 Ga0163162_100310445 261
778 3300046694 Ga0495649_0000836 Ga0495649_0000836_367_1311 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.6563 84 253
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.5348 15 247
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.5289 15 248
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.5242 84 239
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.5171 61 241
ID Description Score Start End Superfamily
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8761 124 251 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.783 133 246 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7821 87 255 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7452 84 247 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7395 133 246 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7J5DT53-F1-model_v4 ABC transporter permease subunit 0.9404 125 257 GO:0005886
GO:0055085
AF-A0A519YA77-F1-model_v4 deleted 0.9294 116 261
AF-A0A6N8QHZ2-F1-model_v4 deleted 0.9179 110 257
AF-A0A519YA77-F1-model_v4 deleted 0.9172 116 261
AF-A0A1H9AHU3-F1-model_v4 Sulfonate transport system permease protein 0.9141 107 255 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.87 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map