F480446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 421 | 675 | 270 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2784746768|2785366704 |
| Length | 315 |
| Sequence | HAPPGSPEPDISEIDQNEASPSEAAHSEASPPEATDNGTGTAATPTSPVDLEPIVPASSRRTRIPRWLRRTTGPVLLLALWQLLSGTGVLTADVLASPGRIAQVAGDLIADGSLVSAMTTSLQRVAGGLLLGALVGTGLALVSGLFRIGEDIVDAPVQMLRTVPFVGLIPLFIIWFGIGEAPKIAIITLGVTFPLYLNIYAGIRGVDSQLIEAGESLGLSRWGLVRHVILPGALPGAMTGLRYSLGIAWLALVFAEQVNADSGIGFLMVQARDFLRTDVIVVCLIVYAFLGLLADFVVRSLERLLLQWRPTFTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 9 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 10 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 11 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 12 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 13 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 14 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 15 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 16 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 17 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 18 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 19 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 20 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 21 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 22 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 23 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 24 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 25 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 26 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 27 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 28 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 29 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 30 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 31 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 32 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 33 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 34 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 35 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 36 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 37 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 38 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 39 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 40 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 41 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 42 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 43 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 44 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 45 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 46 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 47 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 48 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 49 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 50 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 51 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 52 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 53 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 54 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 55 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 56 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 57 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 58 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 59 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 60 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 61 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 62 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 63 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 64 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 65 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 66 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 67 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 68 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 69 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 70 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 71 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 72 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 73 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 74 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 75 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 76 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 77 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 78 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 79 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 80 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 81 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 82 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 83 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 84 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 85 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 86 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 87 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 88 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 89 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 90 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 91 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 92 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 93 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 94 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 95 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 97 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 98 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 99 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 100 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 101 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 104 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 105 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 106 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 107 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 109 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 111 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 112 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 128 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 129 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 130 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 131 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 143 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 247 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 248 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 251 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 257 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 258 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 259 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 382 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 388 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 391 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 395 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 398 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 400 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 402 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 405 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 407 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 408 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 409 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 410 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 411 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 412 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 413 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 414 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 415 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 416 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 417 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 418 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 419 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 420 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 421 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.76 |
| Metatranscriptomes | 0 |
| Isolates | 13.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.4 |
| Nodule | 1.54 |
| Rhizoplane | 4.37 |
| Rhizosphere | 65.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3039297 | 2162886007 | Bacteria | 3638 |
| 2 | JGI24739J22299_10064354 | 3300001989 | Bacteria | 1153 |
| 3 | JGI25162J39368_1000054 | 3300002737 | Bacteria | 147779 |
| 4 | JGI25163J39215_1000106 | 3300002771 | Bacteria | 35005 |
| 5 | JGI25164J39214_1000029 | 3300002772 | Bacteria | 147779 |
| 6 | JGI25406J46586_10002057 | 3300003203 | Bacteria | 9500 |
| 7 | JGI25165J46597_1000111 | 3300003214 | Bacteria | 147779 |
| 8 | rootH2_10025695 | 3300003320 | Bacteria | 4019 |
| 9 | rootL2_10029067 | 3300003322 | Bacteria | 10650 |
| 10 | rootL2_10158374 | 3300003322 | Bacteria | 1357 |
| 11 | Ga0055526_1022180 | 3300003771 | Bacteria | 2172 |
| 12 | Ga0055537_1003505 | 3300003773 | Bacteria | 4806 |
| 13 | Ga0055524_1012948 | 3300003775 | Bacteria | 3174 |
| 14 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 15 | Ga0055536_1000734 | 3300003781 | Bacteria | 22052 |
| 16 | Ga0055536_1006940 | 3300003781 | Bacteria | 5160 |
| 17 | Ga0055536_1008111 | 3300003781 | Bacteria | 4576 |
| 18 | Ga0055534_1011018 | 3300003784 | Bacteria | 1858 |
| 19 | Ga0055528_1008429 | 3300003790 | Bacteria | 4418 |
| 20 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 21 | Ga0055530_10000066 | 3300003791 | Bacteria | 93405 |
| 22 | Ga0055530_10000165 | 3300003791 | Bacteria | 60120 |
| 23 | Ga0055530_10000222 | 3300003791 | Bacteria | 50412 |
| 24 | Ga0055530_10039056 | 3300003791 | Bacteria | 1175 |
| 25 | Ga0055540_1000186 | 3300003792 | Bacteria | 60120 |
| 26 | Ga0055540_1000258 | 3300003792 | Bacteria | 47854 |
| 27 | Ga0055531_10001339 | 3300003794 | Bacteria | 18391 |
| 28 | Ga0055531_10003634 | 3300003794 | Bacteria | 9731 |
| 29 | Ga0055531_10005696 | 3300003794 | Bacteria | 7228 |
| 30 | Ga0065165_1001271 | 3300005262 | Bacteria | 28528 |
| 31 | Ga0065714_10003126 | 3300005288 | Bacteria | 11417 |
| 32 | Ga0065714_10009959 | 3300005288 | Bacteria | 3772 |
| 33 | Ga0065714_10011828 | 3300005288 | Bacteria | 5184 |
| 34 | Ga0065714_10064839 | 3300005288 | Bacteria | 17232 |
| 35 | Ga0065704_10097097 | 3300005289 | Bacteria | 2409 |
| 36 | Ga0065704_10097927 | 3300005289 | Bacteria | 2370 |
| 37 | Ga0065712_10067982 | 3300005290 | Bacteria | 18146 |
| 38 | Ga0070658_10001281 | 3300005327 | Bacteria | 21475 |
| 39 | Ga0070666_10162510 | 3300005335 | Bacteria | 1561 |
| 40 | Ga0070680_100011064 | 3300005336 | Bacteria | 6973 |
| 41 | Ga0070682_100524627 | 3300005337 | Unclassified | 922 |
| 42 | Ga0070660_100019870 | 3300005339 | Bacteria | 4928 |
| 43 | Ga0070668_100002528 | 3300005347 | Bacteria | 13464 |
| 44 | Ga0070668_100017490 | 3300005347 | Bacteria | 5374 |
| 45 | Ga0070669_100001571 | 3300005353 | Bacteria | 16556 |
| 46 | Ga0070669_100001764 | 3300005353 | Bacteria | 15594 |
| 47 | Ga0070671_100003686 | 3300005355 | Bacteria | 12015 |
| 48 | Ga0070671_100003780 | 3300005355 | Bacteria | 11876 |
| 49 | Ga0070667_100020533 | 3300005367 | Bacteria | 5484 |
| 50 | Ga0070667_100028263 | 3300005367 | Bacteria | 4668 |
| 51 | Ga0070678_100039767 | 3300005456 | Bacteria | 3321 |
| 52 | Ga0070681_10003845 | 3300005458 | Bacteria | 14121 |
| 53 | Ga0070679_100007593 | 3300005530 | Bacteria | 10147 |
| 54 | Ga0070697_100077656 | 3300005536 | Bacteria | 2732 |
| 55 | Ga0070672_100374900 | 3300005543 | Bacteria | 1216 |
| 56 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 57 | Ga0070665_100008246 | 3300005548 | Bacteria | 10542 |
| 58 | Ga0070665_100033770 | 3300005548 | Bacteria | 5146 |
| 59 | Ga0068855_100005081 | 3300005563 | Bacteria | 16038 |
| 60 | Ga0068855_100276610 | 3300005563 | Bacteria | 1866 |
| 61 | Ga0068854_100072783 | 3300005578 | Bacteria | 2517 |
| 62 | Ga0068856_100411476 | 3300005614 | Bacteria | 1372 |
| 63 | Ga0068863_100018630 | 3300005841 | Bacteria | 6642 |
| 64 | Ga0068860_100015006 | 3300005843 | Bacteria | 7571 |
| 65 | Ga0068862_100000074 | 3300005844 | Bacteria | 118036 |
| 66 | Ga0068862_100016576 | 3300005844 | Bacteria | 6136 |
| 67 | Ga0081539_10000417 | 3300005985 | Bacteria | 90642 |
| 68 | Ga0075363_100070972 | 3300006048 | Bacteria | 1892 |
| 69 | Ga0075364_10005137 | 3300006051 | Bacteria | 7590 |
| 70 | Ga0075364_10005211 | 3300006051 | Bacteria | 7545 |
| 71 | Ga0075362_10019711 | 3300006177 | Bacteria | 2809 |
| 72 | Ga0075369_10006670 | 3300006186 | Bacteria | 4376 |
| 73 | Ga0075366_10143609 | 3300006195 | Bacteria | 1444 |
| 74 | Ga0075370_10177081 | 3300006353 | Bacteria | 1255 |
| 75 | Ga0068865_100244176 | 3300006881 | Bacteria | 1414 |
| 76 | Ga0097620_100210162 | 3300006931 | Bacteria | 2032 |
| 77 | Ga0079104_1000006 | 3300006946 | Bacteria | 396255 |
| 78 | Ga0099826_10000572 | 3300006948 | Bacteria | 18513 |
| 79 | Ga0105251_10000005 | 3300009011 | Bacteria | 259226 |
| 80 | Ga0105251_10005637 | 3300009011 | Bacteria | 8135 |
| 81 | Ga0105251_10030203 | 3300009011 | Bacteria | 2723 |
| 82 | Ga0105251_10030612 | 3300009011 | Bacteria | 2700 |
| 83 | Ga0105244_10001015 | 3300009036 | Bacteria | 23506 |
| 84 | Ga0105244_10001477 | 3300009036 | Bacteria | 18965 |
| 85 | Ga0105250_10004047 | 3300009092 | Bacteria | 6822 |
| 86 | Ga0105250_10012357 | 3300009092 | Bacteria | 3526 |
| 87 | Ga0105240_10014297 | 3300009093 | Bacteria | 10839 |
| 88 | Ga0105247_10119490 | 3300009101 | Bacteria | 1706 |
| 89 | Ga0105243_10000144 | 3300009148 | Bacteria | 81484 |
| 90 | Ga0105243_10024932 | 3300009148 | Bacteria | 4566 |
| 91 | Ga0105248_10003233 | 3300009177 | Bacteria | 18069 |
| 92 | Ga0105248_10037790 | 3300009177 | Bacteria | 5403 |
| 93 | Ga0105238_10012868 | 3300009551 | Bacteria | 8444 |
| 94 | Ga0105249_10027254 | 3300009553 | Bacteria | 5156 |
| 95 | Ga0105249_10160716 | 3300009553 | Bacteria | 2171 |
| 96 | Ga0105239_10132598 | 3300010375 | Bacteria | 2772 |
| 97 | Ga0105239_10811772 | 3300010375 | Bacteria | 1072 |
| 98 | Ga0105246_10019373 | 3300011119 | Bacteria | 4347 |
| 99 | Ga0105246_10049033 | 3300011119 | Bacteria | 2890 |
| 100 | Ga0157371_10000063 | 3300013102 | Bacteria | 169490 |
| 101 | Ga0157371_10000925 | 3300013102 | Bacteria | 32949 |
| 102 | Ga0157370_10002160 | 3300013104 | Bacteria | 24009 |
| 103 | Ga0157370_10030558 | 3300013104 | Bacteria | 5278 |
| 104 | Ga0157370_10032695 | 3300013104 | Bacteria | 5078 |
| 105 | Ga0157369_10227871 | 3300013105 | Bacteria | 1949 |
| 106 | Ga0163162_10000551 | 3300013306 | Bacteria | 34607 |
| 107 | Ga0163162_10031044 | 3300013306 | Bacteria | 5298 |
| 108 | Ga0182008_10000785 | 3300014497 | Bacteria | 22221 |
| 109 | Ga0182008_10001096 | 3300014497 | Bacteria | 18678 |
| 110 | Ga0182006_1003571 | 3300015261 | Bacteria | 7926 |
| 111 | Ga0182006_1006128 | 3300015261 | Bacteria | 5622 |
| 112 | Ga0182006_1007784 | 3300015261 | Bacteria | 4885 |
| 113 | Ga0182007_10000682 | 3300015262 | Bacteria | 19509 |
| 114 | Ga0182007_10001650 | 3300015262 | Bacteria | 11813 |
| 115 | Ga0182005_1015072 | 3300015265 | Bacteria | 2157 |
| 116 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 117 | Ga0163161_10003171 | 3300017792 | Bacteria | 11599 |
| 118 | Ga0213872_10159707 | 3300021361 | Bacteria | 981 |
| 119 | Ga0213876_10161140 | 3300021384 | Unclassified | 1193 |
| 120 | Ga0209760_100015 | 3300025207 | Bacteria | 176281 |
| 121 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 122 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 123 | Ga0209026_1002402 | 3300025250 | Bacteria | 7062 |
| 124 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 125 | Ga0209565_1000281 | 3300025263 | Bacteria | 50202 |
| 126 | Ga0209673_1001574 | 3300025273 | Bacteria | 20330 |
| 127 | Ga0209675_1000097 | 3300025291 | Bacteria | 131546 |
| 128 | Ga0209675_1019109 | 3300025291 | Bacteria | 1896 |
| 129 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 130 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 131 | Ga0209676_1000673 | 3300025292 | Bacteria | 48566 |
| 132 | Ga0209676_1000927 | 3300025292 | Bacteria | 36244 |
| 133 | Ga0209676_1004357 | 3300025292 | Bacteria | 7923 |
| 134 | Ga0209676_1021711 | 3300025292 | Bacteria | 2147 |
| 135 | Ga0209676_1047271 | 3300025292 | Bacteria | 1158 |
| 136 | Ga0209025_1013670 | 3300025294 | Bacteria | 5075 |
| 137 | Ga0209564_1000557 | 3300025295 | Bacteria | 59834 |
| 138 | Ga0209564_1019939 | 3300025295 | Bacteria | 2481 |
| 139 | Ga0209758_1000608 | 3300025297 | Bacteria | 55483 |
| 140 | Ga0209758_1001275 | 3300025297 | Bacteria | 31177 |
| 141 | Ga0209758_1001477 | 3300025297 | Bacteria | 27508 |
| 142 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 143 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 144 | Ga0209050_1000038 | 3300025298 | Bacteria | 412635 |
| 145 | Ga0209050_1000627 | 3300025298 | Bacteria | 55036 |
| 146 | Ga0209050_1002783 | 3300025298 | Bacteria | 14009 |
| 147 | Ga0209050_1011541 | 3300025298 | Bacteria | 4169 |
| 148 | Ga0209050_1027233 | 3300025298 | Bacteria | 1889 |
| 149 | Ga0209256_1001941 | 3300025299 | Bacteria | 18811 |
| 150 | Ga0209256_1003017 | 3300025299 | Bacteria | 12452 |
| 151 | Ga0209256_1013803 | 3300025299 | Bacteria | 2969 |
| 152 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 153 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 154 | Ga0209257_1000328 | 3300025304 | Bacteria | 99542 |
| 155 | Ga0209257_1001043 | 3300025304 | Bacteria | 36902 |
| 156 | Ga0209257_1001060 | 3300025304 | Bacteria | 36360 |
| 157 | Ga0209257_1002314 | 3300025304 | Bacteria | 19259 |
| 158 | Ga0209257_1009271 | 3300025304 | Bacteria | 5322 |
| 159 | Ga0209257_1012736 | 3300025304 | Bacteria | 3842 |
| 160 | Ga0207696_1003663 | 3300025711 | Bacteria | 6900 |
| 161 | Ga0207696_1041113 | 3300025711 | Bacteria | 1352 |
| 162 | Ga0207655_1003129 | 3300025728 | Bacteria | 12523 |
| 163 | Ga0207713_1000036 | 3300025735 | Bacteria | 259717 |
| 164 | Ga0207713_1001885 | 3300025735 | Bacteria | 15929 |
| 165 | Ga0207713_1031618 | 3300025735 | Bacteria | 2336 |
| 166 | Ga0207713_1045466 | 3300025735 | Bacteria | 1793 |
| 167 | Ga0207710_10105809 | 3300025900 | Bacteria | 1331 |
| 168 | Ga0207680_10137414 | 3300025903 | Bacteria | 1617 |
| 169 | Ga0207705_10025961 | 3300025909 | Bacteria | 4180 |
| 170 | Ga0207654_10068346 | 3300025911 | Bacteria | 2101 |
| 171 | Ga0207707_10003543 | 3300025912 | Bacteria | 13814 |
| 172 | Ga0207695_10012701 | 3300025913 | Bacteria | 10085 |
| 173 | Ga0207660_10167993 | 3300025917 | Bacteria | 1696 |
| 174 | Ga0207657_10281967 | 3300025919 | Unclassified | 1319 |
| 175 | Ga0207652_10011650 | 3300025921 | Bacteria | 7094 |
| 176 | Ga0207681_10001221 | 3300025923 | Bacteria | 16554 |
| 177 | Ga0207681_10001397 | 3300025923 | Bacteria | 15603 |
| 178 | Ga0207694_10007190 | 3300025924 | Bacteria | 8454 |
| 179 | Ga0207644_10055190 | 3300025931 | Bacteria | 2863 |
| 180 | Ga0207709_10001160 | 3300025935 | Bacteria | 19160 |
| 181 | Ga0207709_10205008 | 3300025935 | Bacteria | 1411 |
| 182 | Ga0207704_10185123 | 3300025938 | Bacteria | 1509 |
| 183 | Ga0207711_10003235 | 3300025941 | Bacteria | 14198 |
| 184 | Ga0207711_10017238 | 3300025941 | Bacteria | 6003 |
| 185 | Ga0207711_10382345 | 3300025941 | Bacteria | 1306 |
| 186 | Ga0207667_10021876 | 3300025949 | Bacteria | 7077 |
| 187 | Ga0207712_10032850 | 3300025961 | Bacteria | 3504 |
| 188 | Ga0207712_10146774 | 3300025961 | Bacteria | 1817 |
| 189 | Ga0207668_10001443 | 3300025972 | Bacteria | 13995 |
| 190 | Ga0207668_10006938 | 3300025972 | Bacteria | 6722 |
| 191 | Ga0207658_10001032 | 3300025986 | Bacteria | 22661 |
| 192 | Ga0207658_10092397 | 3300025986 | Bacteria | 2350 |
| 193 | Ga0207702_10042525 | 3300026078 | Bacteria | 3812 |
| 194 | Ga0207641_10003617 | 3300026088 | Bacteria | 13640 |
| 195 | Ga0207683_10217077 | 3300026121 | Bacteria | 1742 |
| 196 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 197 | Ga0209371_1000609 | 3300027312 | Bacteria | 31984 |
| 198 | Ga0268266_10000354 | 3300028379 | Bacteria | 70983 |
| 199 | Ga0268266_10007811 | 3300028379 | Bacteria | 9588 |
| 200 | Ga0268266_10009243 | 3300028379 | Bacteria | 8694 |
| 201 | Ga0268266_10417546 | 3300028379 | Bacteria | 1271 |
| 202 | Ga0268265_10000847 | 3300028380 | Bacteria | 28741 |
| 203 | Ga0268265_10005338 | 3300028380 | Bacteria | 8804 |
| 204 | Ga0268265_10097822 | 3300028380 | Bacteria | 2362 |
| 205 | Ga0265319_1026094 | 3300028563 | Bacteria | 2085 |
| 206 | Ga0265318_10000139 | 3300028577 | Bacteria | 66471 |
| 207 | Ga0307517_10048414 | 3300028786 | Bacteria | 4374 |
| 208 | Ga0307517_10074950 | 3300028786 | Bacteria | 2975 |
| 209 | Ga0307515_10000524 | 3300028794 | Bacteria | 91311 |
| 210 | Ga0307515_10027774 | 3300028794 | Bacteria | 9653 |
| 211 | Ga0307515_10058201 | 3300028794 | Bacteria | 5571 |
| 212 | Ga0268256_1000527 | 3300030500 | Bacteria | 31984 |
| 213 | Ga0307511_10011009 | 3300030521 | Bacteria | 8931 |
| 214 | Ga0307511_10037288 | 3300030521 | Bacteria | 4202 |
| 215 | Ga0307511_10100046 | 3300030521 | Bacteria | 1909 |
| 216 | Ga0307512_10006750 | 3300030522 | Bacteria | 11541 |
| 217 | Ga0307512_10015575 | 3300030522 | Bacteria | 7039 |
| 218 | Ga0307512_10040433 | 3300030522 | Bacteria | 3892 |
| 219 | Ga0316177_1222324 | 3300030731 | Bacteria | 2013 |
| 220 | Ga0265330_10003994 | 3300031235 | Bacteria | 7570 |
| 221 | Ga0265332_10003516 | 3300031238 | Bacteria | 7534 |
| 222 | Ga0265328_10002301 | 3300031239 | Bacteria | 8605 |
| 223 | Ga0265320_10002481 | 3300031240 | Bacteria | 12829 |
| 224 | Ga0265329_10000367 | 3300031242 | Bacteria | 23949 |
| 225 | Ga0265339_10077377 | 3300031249 | Bacteria | 1763 |
| 226 | Ga0265331_10004641 | 3300031250 | Bacteria | 8517 |
| 227 | Ga0265327_10000175 | 3300031251 | Bacteria | 137193 |
| 228 | Ga0265316_10008789 | 3300031344 | Bacteria | 9334 |
| 229 | Ga0307513_10015813 | 3300031456 | Bacteria | 9134 |
| 230 | Ga0307513_10103139 | 3300031456 | Bacteria | 2869 |
| 231 | Ga0307509_10002942 | 3300031507 | Bacteria | 26804 |
| 232 | Ga0307509_10003139 | 3300031507 | Bacteria | 25603 |
| 233 | Ga0307508_10029395 | 3300031616 | Bacteria | 4968 |
| 234 | Ga0307508_10049105 | 3300031616 | Bacteria | 3758 |
| 235 | Ga0307508_10229675 | 3300031616 | Bacteria | 1454 |
| 236 | Ga0307508_10241856 | 3300031616 | Bacteria | 1402 |
| 237 | Ga0307514_10004958 | 3300031649 | Bacteria | 12072 |
| 238 | Ga0265314_10013933 | 3300031711 | Bacteria | 6466 |
| 239 | Ga0265342_10001175 | 3300031712 | Bacteria | 24900 |
| 240 | Ga0307516_10006745 | 3300031730 | Bacteria | 13416 |
| 241 | Ga0307518_10178376 | 3300031838 | Bacteria | 1439 |
| 242 | Ga0307518_10186862 | 3300031838 | Bacteria | 1393 |
| 243 | Ga0307412_10038740 | 3300031911 | Bacteria | 3072 |
| 244 | Ga0307414_10440785 | 3300032004 | Bacteria | 1140 |
| 245 | Ga0307507_10007410 | 3300033179 | Bacteria | 15995 |
| 246 | Ga0307507_10193809 | 3300033179 | Bacteria | 1422 |
| 247 | Ga0307510_10009355 | 3300033180 | Bacteria | 11671 |
| 248 | Ga0307510_10024282 | 3300033180 | Bacteria | 7007 |
| 249 | Ga0307510_10054411 | 3300033180 | Bacteria | 4192 |
| 250 | Ga0307510_10058361 | 3300033180 | Bacteria | 3996 |
| 251 | Ga0307510_10219888 | 3300033180 | Bacteria | 1412 |
| 252 | Ga0395898_0002157 | 3300037466 | Bacteria | 24154 |
| 253 | Ga0395901_0161915 | 3300038443 | Bacteria | 2350 |
| 254 | Ga0436365_0466215 | 3300039437 | Bacteria | 7739 |
| 255 | Ga0436361_0804027 | 3300039447 | Bacteria | 6492 |
| 256 | Ga0436361_0989786 | 3300039447 | Bacteria | 1846 |
| 257 | Ga0436363_1493638 | 3300039450 | Bacteria | 2636 |
| 258 | Ga0439438_000200 | 3300041405 | Bacteria | 27336 |
| 259 | Ga0439438_000450 | 3300041405 | Bacteria | 18562 |
| 260 | Ga0439438_000666 | 3300041405 | Bacteria | 15441 |
| 261 | Ga0439447_006761 | 3300041407 | Bacteria | 3688 |
| 262 | Ga0439461_0009575 | 3300041410 | Bacteria | 1760 |
| 263 | Ga0439466_0013030 | 3300041411 | Bacteria | 3050 |
| 264 | Ga0451841_0680686 | 3300041498 | Bacteria | 1075 |
| 265 | Ga0451851_0122701 | 3300041507 | Bacteria | 1141 |
| 266 | Ga0451853_1601412 | 3300041512 | Bacteria | 2011 |
| 267 | Ga0451853_3602439 | 3300041512 | Bacteria | 5479 |
| 268 | Ga0439448_0008535 | 3300042005 | Bacteria | 3003 |
| 269 | Ga0439449_0014725 | 3300042007 | Bacteria | 2939 |
| 270 | Ga0439452_000115 | 3300042010 | Bacteria | 63101 |
| 271 | Ga0439452_000826 | 3300042010 | Bacteria | 14386 |
| 272 | Ga0439455_0037657 | 3300042012 | Bacteria | 1227 |
| 273 | Ga0439456_000816 | 3300042013 | Bacteria | 6313 |
| 274 | Ga0439463_000202 | 3300042016 | Bacteria | 16002 |
| 275 | Ga0439463_026153 | 3300042016 | Bacteria | 1465 |
| 276 | Ga0450900_006822 | 3300042136 | Bacteria | 1392 |
| 277 | Ga0439446_0004310 | 3300042156 | Bacteria | 3601 |
| 278 | Ga0439458_0004574 | 3300042157 | Bacteria | 3166 |
| 279 | Ga0439435_0002850 | 3300042436 | Bacteria | 3505 |
| 280 | Ga0466969_0015985 | 3300044656 | Bacteria | 3933 |
| 281 | Ga0466972_0004929 | 3300044658 | Bacteria | 6699 |
| 282 | Ga0466961_0012375 | 3300044693 | Bacteria | 5455 |
| 283 | Ga0466960_0003455 | 3300044901 | Bacteria | 6079 |
| 284 | Ga0495617_000044 | 3300046452 | Bacteria | 119709 |
| 285 | Ga0495617_013499 | 3300046452 | Bacteria | 2781 |
| 286 | Ga0495617_015757 | 3300046452 | Bacteria | 2558 |
| 287 | Ga0495617_061724 | 3300046452 | Bacteria | 1239 |
| 288 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 289 | Ga0495627_002624 | 3300046453 | Bacteria | 8462 |
| 290 | Ga0495627_005481 | 3300046453 | Bacteria | 5111 |
| 291 | Ga0495627_012240 | 3300046453 | Bacteria | 3052 |
| 292 | Ga0495592_0020586 | 3300046454 | Bacteria | 5020 |
| 293 | Ga0495603_0000009 | 3300046455 | Bacteria | 72869 |
| 294 | Ga0495603_0009296 | 3300046455 | Bacteria | 5944 |
| 295 | Ga0495603_0297721 | 3300046455 | Bacteria | 926 |
| 296 | Ga0495590_0000698 | 3300046457 | Bacteria | 15366 |
| 297 | Ga0495590_0002258 | 3300046457 | Bacteria | 8044 |
| 298 | Ga0495591_000018 | 3300046458 | Bacteria | 232216 |
| 299 | Ga0495591_000088 | 3300046458 | Bacteria | 102486 |
| 300 | Ga0495591_000300 | 3300046458 | Bacteria | 45180 |
| 301 | Ga0495591_010704 | 3300046458 | Bacteria | 3531 |
| 302 | Ga0495629_0022313 | 3300046459 | Bacteria | 4513 |
| 303 | Ga0495638_0000160 | 3300046460 | Bacteria | 105110 |
| 304 | Ga0495638_0000589 | 3300046460 | Bacteria | 41015 |
| 305 | Ga0495638_0004745 | 3300046460 | Bacteria | 10253 |
| 306 | Ga0495638_0007339 | 3300046460 | Bacteria | 7916 |
| 307 | Ga0495638_0010099 | 3300046460 | Bacteria | 6577 |
| 308 | Ga0495638_0020681 | 3300046460 | Bacteria | 4345 |
| 309 | Ga0495638_0035080 | 3300046460 | Bacteria | 3198 |
| 310 | Ga0495638_0064881 | 3300046460 | Bacteria | 2249 |
| 311 | Ga0495638_0092995 | 3300046460 | Bacteria | 1814 |
| 312 | Ga0495638_0095347 | 3300046460 | Bacteria | 1787 |
| 313 | Ga0495651_0021486 | 3300046462 | Bacteria | 5016 |
| 314 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 315 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 316 | Ga0495650_0007765 | 3300046471 | Bacteria | 6382 |
| 317 | Ga0495650_0010868 | 3300046471 | Bacteria | 5045 |
| 318 | Ga0495605_0000067 | 3300046474 | Bacteria | 138871 |
| 319 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 320 | Ga0495605_0000158 | 3300046474 | Bacteria | 86829 |
| 321 | Ga0495605_0000522 | 3300046474 | Bacteria | 32534 |
| 322 | Ga0495605_0000806 | 3300046474 | Bacteria | 22409 |
| 323 | Ga0495605_0004355 | 3300046474 | Bacteria | 8326 |
| 324 | Ga0495605_0007282 | 3300046474 | Bacteria | 6285 |
| 325 | Ga0495605_0012723 | 3300046474 | Bacteria | 4660 |
| 326 | Ga0495605_0017337 | 3300046474 | Bacteria | 3880 |
| 327 | Ga0495605_0023420 | 3300046474 | Bacteria | 3247 |
| 328 | Ga0495605_0043272 | 3300046474 | Bacteria | 2233 |
| 329 | Ga0495605_0069504 | 3300046474 | Bacteria | 1667 |
| 330 | Ga0495605_0090255 | 3300046474 | Bacteria | 1421 |
| 331 | Ga0495662_0000110 | 3300046476 | Bacteria | 30405 |
| 332 | Ga0495664_0001686 | 3300046477 | Bacteria | 11750 |
| 333 | Ga0495584_0000083 | 3300046491 | Bacteria | 66118 |
| 334 | Ga0495584_0001678 | 3300046491 | Bacteria | 12983 |
| 335 | Ga0495584_0002197 | 3300046491 | Bacteria | 11125 |
| 336 | Ga0495584_0003188 | 3300046491 | Bacteria | 9116 |
| 337 | Ga0495584_0015439 | 3300046491 | Bacteria | 3892 |
| 338 | Ga0495584_0017141 | 3300046491 | Bacteria | 3691 |
| 339 | Ga0495585_0000142 | 3300046492 | Bacteria | 79060 |
| 340 | Ga0495585_0043610 | 3300046492 | Bacteria | 2507 |
| 341 | Ga0495585_0085816 | 3300046492 | Bacteria | 1701 |
| 342 | Ga0495585_0136201 | 3300046492 | Bacteria | 1289 |
| 343 | Ga0495594_0001521 | 3300046499 | Bacteria | 12044 |
| 344 | Ga0495594_0043677 | 3300046499 | Bacteria | 2457 |
| 345 | Ga0495594_0151081 | 3300046499 | Bacteria | 1318 |
| 346 | Ga0495596_0000089 | 3300046500 | Bacteria | 63864 |
| 347 | Ga0495607_0000032 | 3300046501 | Bacteria | 153288 |
| 348 | Ga0495607_0006881 | 3300046501 | Bacteria | 7930 |
| 349 | Ga0495607_0010063 | 3300046501 | Bacteria | 6370 |
| 350 | Ga0495607_0013334 | 3300046501 | Bacteria | 5389 |
| 351 | Ga0495607_0021527 | 3300046501 | Bacteria | 4055 |
| 352 | Ga0495607_0057620 | 3300046501 | Bacteria | 2225 |
| 353 | Ga0495607_0087450 | 3300046501 | Bacteria | 1696 |
| 354 | Ga0495607_0155298 | 3300046501 | Bacteria | 1167 |
| 355 | Ga0495607_0175258 | 3300046501 | Bacteria | 1079 |
| 356 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 357 | Ga0495583_0000457 | 3300046506 | Bacteria | 60714 |
| 358 | Ga0495583_0002118 | 3300046506 | Bacteria | 17775 |
| 359 | Ga0495606_0000200 | 3300046507 | Bacteria | 104194 |
| 360 | Ga0495606_0000545 | 3300046507 | Bacteria | 60465 |
| 361 | Ga0495606_0000729 | 3300046507 | Bacteria | 50871 |
| 362 | Ga0495606_0025101 | 3300046507 | Bacteria | 4276 |
| 363 | Ga0495610_0000058 | 3300046512 | Bacteria | 137991 |
| 364 | Ga0495610_0004442 | 3300046512 | Bacteria | 10365 |
| 365 | Ga0495610_0005995 | 3300046512 | Bacteria | 8496 |
| 366 | Ga0495610_0009917 | 3300046512 | Bacteria | 5959 |
| 367 | Ga0495610_0010854 | 3300046512 | Bacteria | 5625 |
| 368 | Ga0495610_0012925 | 3300046512 | Bacteria | 4989 |
| 369 | Ga0495610_0019749 | 3300046512 | Bacteria | 3758 |
| 370 | Ga0495610_0033846 | 3300046512 | Bacteria | 2637 |
| 371 | Ga0495610_0074419 | 3300046512 | Bacteria | 1576 |
| 372 | Ga0495616_0000031 | 3300046513 | Bacteria | 130957 |
| 373 | Ga0495616_0000429 | 3300046513 | Bacteria | 32137 |
| 374 | Ga0495618_0081775 | 3300046514 | Bacteria | 2063 |
| 375 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 376 | Ga0495620_0000207 | 3300046515 | Bacteria | 44260 |
| 377 | Ga0495620_0001291 | 3300046515 | Bacteria | 15265 |
| 378 | Ga0495620_0003917 | 3300046515 | Bacteria | 8483 |
| 379 | Ga0495620_0008610 | 3300046515 | Bacteria | 5471 |
| 380 | Ga0495620_0009072 | 3300046515 | Bacteria | 5308 |
| 381 | Ga0495620_0048421 | 3300046515 | Bacteria | 1824 |
| 382 | Ga0495628_0009638 | 3300046516 | Bacteria | 8239 |
| 383 | Ga0495628_0229975 | 3300046516 | Bacteria | 1390 |
| 384 | Ga0495631_0002052 | 3300046518 | Bacteria | 11733 |
| 385 | Ga0495631_0007823 | 3300046518 | Bacteria | 5419 |
| 386 | Ga0495632_0000495 | 3300046519 | Bacteria | 37144 |
| 387 | Ga0495632_0000607 | 3300046519 | Bacteria | 33188 |
| 388 | Ga0495632_0000748 | 3300046519 | Bacteria | 29283 |
| 389 | Ga0495632_0003572 | 3300046519 | Bacteria | 10964 |
| 390 | Ga0495632_0015353 | 3300046519 | Bacteria | 4299 |
| 391 | Ga0495637_0007004 | 3300046520 | Bacteria | 5616 |
| 392 | Ga0495637_0009342 | 3300046520 | Bacteria | 4785 |
| 393 | Ga0495637_0012102 | 3300046520 | Bacteria | 4133 |
| 394 | Ga0495637_0012438 | 3300046520 | Bacteria | 4069 |
| 395 | Ga0495637_0013550 | 3300046520 | Bacteria | 3866 |
| 396 | Ga0495637_0033500 | 3300046520 | Bacteria | 2255 |
| 397 | Ga0495643_0005942 | 3300046522 | Bacteria | 8142 |
| 398 | Ga0495643_0007143 | 3300046522 | Bacteria | 7244 |
| 399 | Ga0495643_0011709 | 3300046522 | Bacteria | 5325 |
| 400 | Ga0495644_0001087 | 3300046523 | Bacteria | 11262 |
| 401 | Ga0495644_0004478 | 3300046523 | Bacteria | 5489 |
| 402 | Ga0495644_0055487 | 3300046523 | Bacteria | 1489 |
| 403 | Ga0495644_0059130 | 3300046523 | Bacteria | 1441 |
| 404 | Ga0495648_0000239 | 3300046524 | Bacteria | 62900 |
| 405 | Ga0495648_0001250 | 3300046524 | Bacteria | 25409 |
| 406 | Ga0495648_0004517 | 3300046524 | Bacteria | 11863 |
| 407 | Ga0495648_0013500 | 3300046524 | Bacteria | 6031 |
| 408 | Ga0495648_0015275 | 3300046524 | Bacteria | 5584 |
| 409 | Ga0495648_0021510 | 3300046524 | Bacteria | 4463 |
| 410 | Ga0495663_0030146 | 3300046525 | Bacteria | 1606 |
| 411 | Ga0495666_0012793 | 3300046526 | Bacteria | 4183 |
| 412 | Ga0495642_0000187 | 3300046528 | Bacteria | 36703 |
| 413 | Ga0495642_0092802 | 3300046528 | Bacteria | 1279 |
| 414 | Ga0495654_0000012 | 3300046530 | Bacteria | 328997 |
| 415 | Ga0495654_0000414 | 3300046530 | Bacteria | 36432 |
| 416 | Ga0495654_0006197 | 3300046530 | Bacteria | 6822 |
| 417 | Ga0495654_0021651 | 3300046530 | Bacteria | 3343 |
| 418 | Ga0495654_0026580 | 3300046530 | Bacteria | 2974 |
| 419 | Ga0495654_0028499 | 3300046530 | Bacteria | 2855 |
| 420 | Ga0495654_0040591 | 3300046530 | Bacteria | 2318 |
| 421 | Ga0495654_0076963 | 3300046530 | Bacteria | 1571 |
| 422 | Ga0495654_0086774 | 3300046530 | Bacteria | 1458 |
| 423 | Ga0495654_0087054 | 3300046530 | Bacteria | 1455 |
| 424 | Ga0495586_0004586 | 3300046535 | Bacteria | 7385 |
| 425 | Ga0495587_0019040 | 3300046536 | Bacteria | 4253 |
| 426 | Ga0495609_0000147 | 3300046538 | Bacteria | 73010 |
| 427 | Ga0495609_0000340 | 3300046538 | Bacteria | 41415 |
| 428 | Ga0495609_0000477 | 3300046538 | Bacteria | 32285 |
| 429 | Ga0495597_0000013 | 3300046542 | Bacteria | 203829 |
| 430 | Ga0495597_0004857 | 3300046542 | Bacteria | 7245 |
| 431 | Ga0495597_0012599 | 3300046542 | Bacteria | 4074 |
| 432 | Ga0495597_0017766 | 3300046542 | Bacteria | 3342 |
| 433 | Ga0495597_0030407 | 3300046542 | Bacteria | 2461 |
| 434 | Ga0495597_0038360 | 3300046542 | Bacteria | 2147 |
| 435 | Ga0495622_0017722 | 3300046557 | Bacteria | 3314 |
| 436 | Ga0495633_0000316 | 3300046558 | Bacteria | 54818 |
| 437 | Ga0495633_0000446 | 3300046558 | Bacteria | 42633 |
| 438 | Ga0495633_0162372 | 3300046558 | Bacteria | 1031 |
| 439 | Ga0495667_0179581 | 3300046559 | Bacteria | 1359 |
| 440 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 441 | Ga0495668_0000887 | 3300046616 | Bacteria | 33700 |
| 442 | Ga0495668_0007406 | 3300046616 | Bacteria | 7017 |
| 443 | Ga0495668_0022070 | 3300046616 | Bacteria | 3641 |
| 444 | Ga0495668_0029381 | 3300046616 | Bacteria | 3106 |
| 445 | Ga0495668_0032163 | 3300046616 | Bacteria | 2954 |
| 446 | Ga0495668_0053332 | 3300046616 | Bacteria | 2235 |
| 447 | Ga0495634_0031104 | 3300046642 | Bacteria | 3678 |
| 448 | Ga0495611_0017900 | 3300046648 | Bacteria | 3036 |
| 449 | Ga0495611_0155835 | 3300046648 | Bacteria | 1066 |
| 450 | Ga0495625_0000081 | 3300046660 | Bacteria | 156254 |
| 451 | Ga0495625_0000830 | 3300046660 | Bacteria | 42448 |
| 452 | Ga0495625_0001558 | 3300046660 | Bacteria | 27293 |
| 453 | Ga0495625_0012474 | 3300046660 | Bacteria | 6885 |
| 454 | Ga0495625_0020841 | 3300046660 | Bacteria | 5054 |
| 455 | Ga0495625_0022235 | 3300046660 | Bacteria | 4865 |
| 456 | Ga0495625_0029266 | 3300046660 | Bacteria | 4122 |
| 457 | Ga0495625_0072463 | 3300046660 | Bacteria | 2415 |
| 458 | Ga0495625_0092267 | 3300046660 | Bacteria | 2092 |
| 459 | Ga0495625_0113957 | 3300046660 | Bacteria | 1846 |
| 460 | Ga0495625_0131976 | 3300046660 | Bacteria | 1691 |
| 461 | Ga0495625_0137418 | 3300046660 | Bacteria | 1651 |
| 462 | Ga0495625_0226307 | 3300046660 | Bacteria | 1223 |
| 463 | Ga0495659_0008262 | 3300046664 | Bacteria | 3312 |
| 464 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 465 | Ga0495661_0000138 | 3300046665 | Bacteria | 85693 |
| 466 | Ga0495661_0000513 | 3300046665 | Bacteria | 40214 |
| 467 | Ga0495661_0002111 | 3300046665 | Bacteria | 15597 |
| 468 | Ga0495661_0010828 | 3300046665 | Bacteria | 6203 |
| 469 | Ga0495661_0177944 | 3300046665 | Bacteria | 1129 |
| 470 | Ga0495588_0013345 | 3300046674 | Bacteria | 3913 |
| 471 | Ga0495588_0033156 | 3300046674 | Bacteria | 2607 |
| 472 | Ga0495588_0043085 | 3300046674 | Bacteria | 2308 |
| 473 | Ga0495657_0000437 | 3300046675 | Bacteria | 38928 |
| 474 | Ga0495599_0212034 | 3300046678 | Bacteria | 1187 |
| 475 | Ga0495646_0000400 | 3300046680 | Bacteria | 22769 |
| 476 | Ga0495613_0002753 | 3300046689 | Bacteria | 13204 |
| 477 | Ga0495613_0085988 | 3300046689 | Bacteria | 2280 |
| 478 | Ga0495671_0000052 | 3300046692 | Bacteria | 133684 |
| 479 | Ga0495671_0014142 | 3300046692 | Bacteria | 4300 |
| 480 | Ga0495671_0015686 | 3300046692 | Bacteria | 4054 |
| 481 | Ga0495671_0026763 | 3300046692 | Bacteria | 2985 |
| 482 | Ga0495671_0074428 | 3300046692 | Bacteria | 1666 |
| 483 | Ga0495649_0000033 | 3300046694 | Bacteria | 136854 |
| 484 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 485 | Ga0495649_0000836 | 3300046694 | Bacteria | 24748 |
| 486 | Ga0495649_0015712 | 3300046694 | Bacteria | 4304 |
| 487 | Ga0495649_0023498 | 3300046694 | Bacteria | 3443 |
| 488 | Ga0495649_0053335 | 3300046694 | Bacteria | 2189 |
| 489 | Ga0495589_0000585 | 3300046794 | Bacteria | 24989 |
| 490 | Ga0495589_0001063 | 3300046794 | Bacteria | 16487 |
| 491 | Ga0495589_0002412 | 3300046794 | Bacteria | 10499 |
| 492 | Ga0495589_0006602 | 3300046794 | Bacteria | 6113 |
| 493 | Ga0495589_0010957 | 3300046794 | Bacteria | 4706 |
| 494 | Ga0495660_0000873 | 3300046810 | Bacteria | 22251 |
| 495 | Ga0495660_0001253 | 3300046810 | Bacteria | 17692 |
| 496 | Ga0495660_0001366 | 3300046810 | Bacteria | 16808 |
| 497 | Ga0495660_0002313 | 3300046810 | Bacteria | 12218 |
| 498 | Ga0495660_0005067 | 3300046810 | Bacteria | 7916 |
| 499 | Ga0495660_0017385 | 3300046810 | Bacteria | 4140 |
| 500 | Ga0495660_0065403 | 3300046810 | Bacteria | 1941 |
| 501 | Ga0495660_0078105 | 3300046810 | Bacteria | 1741 |
| 502 | Ga0495604_0000673 | 3300047317 | Bacteria | 28933 |
| 503 | Ga0495604_0009142 | 3300047317 | Bacteria | 7842 |
| 504 | Ga0495636_0000221 | 3300047318 | Bacteria | 22484 |
| 505 | Ga0495636_0020197 | 3300047318 | Bacteria | 2683 |
| 506 | Ga0495636_0049029 | 3300047318 | Bacteria | 1766 |
| 507 | Ga0495674_0170119 | 3300047319 | Bacteria | 1819 |
| 508 | Ga0495672_0000032 | 3300047320 | Bacteria | 295356 |
| 509 | Ga0495672_0001535 | 3300047320 | Bacteria | 22596 |
| 510 | Ga0495672_0003990 | 3300047320 | Bacteria | 12347 |
| 511 | Ga0495676_0002857 | 3300047321 | Bacteria | 15570 |
| 512 | Ga0495676_0003781 | 3300047321 | Bacteria | 13756 |
| 513 | Ga0495676_0004612 | 3300047321 | Bacteria | 12622 |
| 514 | Ga0495676_0010737 | 3300047321 | Bacteria | 8289 |
| 515 | Ga0495683_0000108 | 3300047323 | Bacteria | 84498 |
| 516 | Ga0495683_0002624 | 3300047323 | Bacteria | 10750 |
| 517 | Ga0495683_0002951 | 3300047323 | Bacteria | 10064 |
| 518 | Ga0495683_0047214 | 3300047323 | Bacteria | 2161 |
| 519 | Ga0495687_000572 | 3300047443 | Bacteria | 43367 |
| 520 | Ga0495687_001130 | 3300047443 | Bacteria | 25900 |
| 521 | Ga0495687_004181 | 3300047443 | Bacteria | 9913 |
| 522 | Ga0495687_008146 | 3300047443 | Bacteria | 6044 |
| 523 | Ga0495687_027803 | 3300047443 | Bacteria | 2641 |
| 524 | Ga0495687_098775 | 3300047443 | Bacteria | 1100 |
| 525 | Ga0495675_0000016 | 3300047444 | Bacteria | 129732 |
| 526 | Ga0495679_000198 | 3300047446 | Bacteria | 53238 |
| 527 | Ga0495679_001171 | 3300047446 | Bacteria | 15590 |
| 528 | Ga0495679_003085 | 3300047446 | Bacteria | 8168 |
| 529 | Ga0495679_013312 | 3300047446 | Bacteria | 3096 |
| 530 | Ga0495685_041386 | 3300047447 | Bacteria | 1575 |
| 531 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 532 | Ga0495673_0000321 | 3300047469 | Bacteria | 61858 |
| 533 | Ga0495673_0000997 | 3300047469 | Bacteria | 25163 |
| 534 | Ga0495673_0003718 | 3300047469 | Bacteria | 9918 |
| 535 | Ga0495673_0025675 | 3300047469 | Bacteria | 2824 |
| 536 | Ga0495681_0000009 | 3300047470 | Bacteria | 205224 |
| 537 | Ga0495681_0000257 | 3300047470 | Bacteria | 43264 |
| 538 | Ga0495681_0000329 | 3300047470 | Bacteria | 37635 |
| 539 | Ga0495681_0002219 | 3300047470 | Bacteria | 13986 |
| 540 | Ga0495681_0003080 | 3300047470 | Bacteria | 11691 |
| 541 | Ga0495681_0004335 | 3300047470 | Bacteria | 9705 |
| 542 | Ga0495681_0004938 | 3300047470 | Bacteria | 9002 |
| 543 | Ga0495681_0006935 | 3300047470 | Bacteria | 7341 |
| 544 | Ga0495681_0008911 | 3300047470 | Bacteria | 6232 |
| 545 | Ga0495681_0011173 | 3300047470 | Bacteria | 5372 |
| 546 | Ga0495681_0013912 | 3300047470 | Bacteria | 4644 |
| 547 | Ga0495681_0035562 | 3300047470 | Bacteria | 2472 |
| 548 | Ga0495681_0159761 | 3300047470 | Bacteria | 939 |
| 549 | Ga0495684_0023241 | 3300047471 | Bacteria | 4766 |
| 550 | Ga0495686_0000633 | 3300047472 | Bacteria | 48475 |
| 551 | Ga0495686_0025642 | 3300047472 | Bacteria | 3864 |
| 552 | Ga0495686_0038730 | 3300047472 | Bacteria | 3048 |
| 553 | Ga0495686_0071700 | 3300047472 | Bacteria | 2131 |
| 554 | Ga0495686_0099087 | 3300047472 | Bacteria | 1760 |
| 555 | Ga0495593_0002874 | 3300047673 | Bacteria | 10384 |
| 556 | Ga0495602_0059408 | 3300048088 | Bacteria | 3338 |
| 557 | Ga0495614_0007263 | 3300048089 | Bacteria | 4936 |
| 558 | Ga0495626_0000015 | 3300048091 | Bacteria | 232238 |
| 559 | Ga0495626_0000033 | 3300048091 | Bacteria | 184008 |
| 560 | Ga0495626_0000720 | 3300048091 | Bacteria | 30946 |
| 561 | Ga0495626_0009842 | 3300048091 | Bacteria | 5140 |
| 562 | Ga0495626_0058064 | 3300048091 | Bacteria | 1769 |
| 563 | Ga0496101_0323198 | 3300048904 | Bacteria | 1211 |
| 564 | Ga0496102_0000613 | 3300048905 | Bacteria | 36995 |
| 565 | Ga0496102_0043134 | 3300048905 | Bacteria | 4089 |
| 566 | Ga0496103_0000163 | 3300048906 | Bacteria | 70387 |
| 567 | Ga0496103_0009503 | 3300048906 | Bacteria | 5757 |
| 568 | Ga0496104_0002224 | 3300048907 | Bacteria | 16745 |
| 569 | Ga0496105_0003862 | 3300048908 | Bacteria | 11198 |
| 570 | Ga0496106_0063172 | 3300048909 | Bacteria | 2813 |
| 571 | Ga0496107_0000565 | 3300048910 | Bacteria | 20698 |
| 572 | Ga0496111_0058777 | 3300048914 | Bacteria | 2784 |
| 573 | Ga0496113_0000081 | 3300048916 | Bacteria | 42072 |
| 574 | Ga0496115_0133558 | 3300048918 | Bacteria | 2046 |
| 575 | Ga0496116_0000126 | 3300048919 | Bacteria | 160425 |
| 576 | Ga0496116_0042961 | 3300048919 | Bacteria | 3083 |
| 577 | Ga0496116_0080144 | 3300048919 | Bacteria | 2028 |
| 578 | Ga0496116_0120560 | 3300048919 | Bacteria | 1519 |
| 579 | Ga0496116_0182660 | 3300048919 | Bacteria | 1121 |
| 580 | Ga0496117_0000623 | 3300048920 | Bacteria | 57364 |
| 581 | Ga0496117_0027203 | 3300048920 | Bacteria | 4461 |
| 582 | Ga0496118_0030117 | 3300048921 | Bacteria | 4537 |
| 583 | Ga0496118_0037674 | 3300048921 | Bacteria | 3887 |
| 584 | Ga0496118_0071815 | 3300048921 | Bacteria | 2489 |
| 585 | Ga0496119_0004118 | 3300048922 | Bacteria | 14645 |
| 586 | Ga0496119_0124169 | 3300048922 | Bacteria | 1415 |
| 587 | Ga0496120_0004524 | 3300048923 | Bacteria | 11623 |
| 588 | Ga0496120_0028051 | 3300048923 | Bacteria | 3456 |
| 589 | Ga0496121_0000067 | 3300048924 | Bacteria | 261543 |
| 590 | Ga0496121_0000142 | 3300048924 | Bacteria | 160072 |
| 591 | Ga0496121_0001912 | 3300048924 | Bacteria | 33300 |
| 592 | Ga0496121_0009885 | 3300048924 | Bacteria | 10872 |
| 593 | Ga0496121_0019626 | 3300048924 | Bacteria | 6750 |
| 594 | Ga0496121_0059414 | 3300048924 | Bacteria | 3152 |
| 595 | Ga0496122_0001234 | 3300048925 | Bacteria | 43175 |
| 596 | Ga0496122_0002287 | 3300048925 | Bacteria | 27682 |
| 597 | Ga0496122_0005467 | 3300048925 | Bacteria | 15122 |
| 598 | Ga0496122_0037935 | 3300048925 | Bacteria | 3869 |
| 599 | Ga0496123_0000434 | 3300048926 | Bacteria | 75349 |
| 600 | Ga0496123_0003785 | 3300048926 | Bacteria | 16568 |
| 601 | Ga0496123_0009060 | 3300048926 | Bacteria | 9017 |
| 602 | Ga0496123_0032276 | 3300048926 | Bacteria | 3795 |
| 603 | Ga0496124_0000812 | 3300048927 | Bacteria | 50806 |
| 604 | Ga0496124_0003614 | 3300048927 | Bacteria | 18779 |
| 605 | Ga0496124_0068150 | 3300048927 | Bacteria | 2959 |
| 606 | Ga0496125_0012848 | 3300048928 | Bacteria | 8274 |
| 607 | Ga0496125_0185974 | 3300048928 | Bacteria | 1378 |
| 608 | Ga0496125_0300067 | 3300048928 | Bacteria | 984 |
| 609 | Ga0496125_0312175 | 3300048928 | Bacteria | 957 |
| 610 | Ga0496126_0005438 | 3300048929 | Bacteria | 14523 |
| 611 | Ga0496126_0107103 | 3300048929 | Bacteria | 2438 |
| 612 | Ga0496126_0319170 | 3300048929 | Bacteria | 1277 |
| 613 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 614 | Ga0495678_000583 | 3300049459 | Bacteria | 34467 |
| 615 | Ga0495678_001014 | 3300049459 | Bacteria | 24007 |
| 616 | Ga0495678_001228 | 3300049459 | Bacteria | 20891 |
| 617 | Ga0495678_017299 | 3300049459 | Bacteria | 3271 |
| 618 | Ga0495678_021074 | 3300049459 | Bacteria | 2875 |
| 619 | Ga0495678_032827 | 3300049459 | Bacteria | 2148 |
| 620 | Ga0495678_035943 | 3300049459 | Bacteria | 2027 |
| 621 | Ga0495678_123412 | 3300049459 | Bacteria | 867 |
| 622 | Ga0495682_0003421 | 3300049460 | Bacteria | 7058 |
| 623 | Ga0495682_0013216 | 3300049460 | Bacteria | 3147 |
| 624 | Ga0501032_0044735 | 3300049569 | Bacteria | 2996 |
| 625 | Ga0501033_0066516 | 3300049570 | Bacteria | 2650 |
| 626 | Ga0501043_0002520 | 3300049579 | Bacteria | 15482 |
| 627 | Ga0501046_0055842 | 3300049580 | Bacteria | 3101 |
| 628 | Ga0501047_0000342 | 3300049581 | Bacteria | 53140 |
| 629 | Ga0501048_0355832 | 3300049582 | Bacteria | 1044 |
| 630 | Ga0501070_0141038 | 3300049586 | Bacteria | 1990 |
| 631 | Ga0501269_000034 | 3300049766 | Bacteria | 42532 |
| 632 | Ga0501035_0029889 | 3300049822 | Bacteria | 4969 |
| 633 | nmdc:mga03683_15022_c1 | 3300050489 | Bacteria | 2880 |
| 634 | nmdc:mga03n38_109574_c1 | 3300050490 | Bacteria | 1343 |
| 635 | nmdc:mga03n38_41862_c1 | 3300050490 | Bacteria | 1999 |
| 636 | nmdc:mga00v17_51246_c1 | 3300050491 | Bacteria | 2510 |
| 637 | nmdc:mga00v17_626_c1 | 3300050491 | Bacteria | 8462 |
| 638 | nmdc:mga0k408_71943_c1 | 3300050493 | Bacteria | 2019 |
| 639 | nmdc:mga07m45_62960_c1 | 3300050496 | Bacteria | 2103 |
| 640 | nmdc:mga0sz30_6232_c1 | 3300050516 | Bacteria | 4422 |
| 641 | Ga0500635_0000020 | 3300053080 | Bacteria | 110196 |
| 642 | Ga0500578_0000234 | 3300053086 | Bacteria | 68455 |
| 643 | Ga0500578_0215964 | 3300053086 | Bacteria | 1168 |
| 644 | Ga0500643_048167 | 3300053087 | Bacteria | 1226 |
| 645 | Ga0500644_0000189 | 3300053088 | Bacteria | 38264 |
| 646 | Ga0500554_005865 | 3300053102 | Bacteria | 2715 |
| 647 | Ga0500556_0001301 | 3300053104 | Bacteria | 11228 |
| 648 | Ga0500556_0024836 | 3300053104 | Bacteria | 1973 |
| 649 | Ga0500580_037832 | 3300053113 | Bacteria | 2047 |
| 650 | Ga0500592_000148 | 3300053116 | Bacteria | 14211 |
| 651 | Ga0500594_0000022 | 3300053118 | Bacteria | 54062 |
| 652 | Ga0500607_000148 | 3300053121 | Bacteria | 59763 |
| 653 | Ga0500607_048277 | 3300053121 | Bacteria | 2277 |
| 654 | Ga0500618_000511 | 3300053125 | Bacteria | 24569 |
| 655 | Ga0500642_0123100 | 3300053130 | Bacteria | 1214 |
| 656 | Ga0500658_0050740 | 3300053134 | Bacteria | 1694 |
| 657 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 658 | Ga0500559_0001556 | 3300053136 | Bacteria | 12842 |
| 659 | Ga0500564_000059 | 3300053138 | Bacteria | 29435 |
| 660 | Ga0500568_0019338 | 3300053139 | Bacteria | 2962 |
| 661 | Ga0500568_0019897 | 3300053139 | Bacteria | 2910 |
| 662 | Ga0500600_0064882 | 3300053149 | Bacteria | 2022 |
| 663 | Ga0500600_0172950 | 3300053149 | Bacteria | 1048 |
| 664 | Ga0500616_0046069 | 3300053153 | Bacteria | 2319 |
| 665 | Ga0500624_006724 | 3300053157 | Bacteria | 1563 |
| 666 | Ga0500627_0000013 | 3300053158 | Bacteria | 136204 |
| 667 | Ga0500634_0000350 | 3300053161 | Bacteria | 14729 |
| 668 | Ga0500638_012935 | 3300053162 | Bacteria | 3757 |
| 669 | Ga0500636_0000543 | 3300053177 | Bacteria | 20542 |
| 670 | Ga0500611_015368 | 3300053727 | Bacteria | 1354 |
| 671 | Ga0500645_004520 | 3300053730 | Bacteria | 5309 |
| 672 | Ga0500645_008481 | 3300053730 | Bacteria | 3507 |
| 673 | Ga0500645_016698 | 3300053730 | Bacteria | 2309 |
| 674 | Ga0500609_000125 | 3300053731 | Bacteria | 10137 |
| 675 | Ga0466962_0023165 | 3300061719 | Bacteria | 2985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003781 | Ga0055536_1000734 | Ga0055536_10007347 | 215 |
| 2 | 3300003781 | Ga0055536_1008111 | Ga0055536_10081113 | 215 |
| 3 | 3300003784 | Ga0055534_1011018 | Ga0055534_10110182 | 215 |
| 4 | 3300003791 | Ga0055530_10000222 | Ga0055530_1000022236 | 215 |
| 5 | 3300003794 | Ga0055531_10005696 | Ga0055531_100056963 | 215 |
| 6 | 3300025291 | Ga0209675_1000097 | Ga0209675_100009740 | 215 |
| 7 | 3300025292 | Ga0209676_1000070 | Ga0209676_1000070131 | 215 |
| 8 | 3300025292 | Ga0209676_1000927 | Ga0209676_100092710 | 215 |
| 9 | 3300025292 | Ga0209676_1021711 | Ga0209676_10217112 | 215 |
| 10 | 3300025292 | Ga0209676_1047271 | Ga0209676_10472712 | 215 |
| 11 | 3300025294 | Ga0209025_1013670 | Ga0209025_10136703 | 215 |
| 12 | 3300025298 | Ga0209050_1000627 | Ga0209050_100062740 | 215 |
| 13 | 3300025298 | Ga0209050_1011541 | Ga0209050_10115412 | 215 |
| 14 | 3300025304 | Ga0209257_1009271 | Ga0209257_10092712 | 215 |
| 15 | 3300025304 | Ga0209257_1012736 | Ga0209257_10127362 | 215 |
| 16 | 3300031911 | Ga0307412_10038740 | Ga0307412_100387401 | 215 |
| 17 | 3300032004 | Ga0307414_10440785 | Ga0307414_104407852 | 215 |
| 18 | 3300053139 | Ga0500568_0019897 | Ga0500568_0019897_1493_2338 | 215 |
| 19 | 3300003791 | Ga0055530_10039056 | Ga0055530_100390561 | 216 |
| 20 | 3300003794 | Ga0055531_10003634 | Ga0055531_1000363410 | 216 |
| 21 | 3300005347 | Ga0070668_100017490 | Ga0070668_1000174902 | 216 |
| 22 | 3300025298 | Ga0209050_1002783 | Ga0209050_10027833 | 216 |
| 23 | 3300025304 | Ga0209257_1000328 | Ga0209257_100032896 | 216 |
| 24 | 3300025972 | Ga0207668_10001443 | Ga0207668_100014438 | 216 |
| 25 | 3300046660 | Ga0495625_0000830 | Ga0495625_0000830_19571_20416 | 216 |
| 26 | 3300003781 | Ga0055536_1006940 | Ga0055536_10069404 | 217 |
| 27 | 3300025292 | Ga0209676_1000673 | Ga0209676_100067319 | 217 |
| 28 | 3300046616 | Ga0495668_0000087 | Ga0495668_0000087_98913_99758 | 220 |
| 29 | 3300053158 | Ga0500627_0000013 | Ga0500627_0000013_81440_82300 | 220 |
| 30 | 3300025250 | Ga0209026_1002402 | Ga0209026_10024029 | 221 |
| 31 | 3300053102 | Ga0500554_005865 | Ga0500554_005865_378_1100 | 223 |
| 32 | iso_pu_bacteria | 2791355048 | 2792462386 | 224 |
| 33 | iso_pu_bacteria | 2843744320 | 2843748738 | 224 |
| 34 | iso_pu_bacteria | 2849560528 | 2849565308 | 224 |
| 35 | iso_pu_bacteria | 2849573788 | 2849578894 | 224 |
| 36 | iso_pu_bacteria | 2851153111 | 2851156540 | 224 |
| 37 | iso_pu_bacteria | 2898329390 | 2898330210 | 224 |
| 38 | 3300006195 | Ga0075366_10143609 | Ga0075366_101436092 | 226 |
| 39 | 3300009093 | Ga0105240_10014297 | Ga0105240_100142976 | 226 |
| 40 | 3300039437 | Ga0436365_0466215 | Ga0436365_0466215_5892_6611 | 226 |
| 41 | 3300046460 | Ga0495638_0035080 | Ga0495638_0035080_647_1372 | 228 |
| 42 | 3300053727 | Ga0500611_015368 | Ga0500611_015368_188_913 | 228 |
| 43 | 3300046512 | Ga0495610_0074419 | Ga0495610_0074419_136_915 | 229 |
| 44 | 3300046530 | Ga0495654_0086774 | Ga0495654_0086774_68_847 | 229 |
| 45 | 3300003322 | rootL2_10158374 | rootL2_101583742 | 233 |
| 46 | 3300005456 | Ga0070678_100039767 | Ga0070678_1000397676 | 233 |
| 47 | 3300005543 | Ga0070672_100374900 | Ga0070672_1003749002 | 233 |
| 48 | 3300005548 | Ga0070665_100008246 | Ga0070665_1000082462 | 233 |
| 49 | 3300026121 | Ga0207683_10217077 | Ga0207683_102170772 | 233 |
| 50 | 3300028379 | Ga0268266_10007811 | Ga0268266_100078118 | 233 |
| 51 | 3300047469 | Ga0495673_0003718 | Ga0495673_0003718_5696_6448 | 233 |
| 52 | 3300005337 | Ga0070682_100524627 | Ga0070682_1005246271 | 235 |
| 53 | 3300009177 | Ga0105248_10003233 | Ga0105248_1000323310 | 235 |
| 54 | 3300025941 | Ga0207711_10003235 | Ga0207711_1000323510 | 235 |
| 55 | 3300028379 | Ga0268266_10417546 | Ga0268266_104175462 | 235 |
| 56 | 3300046455 | Ga0495603_0297721 | Ga0495603_0297721_70_894 | 235 |
| 57 | 3300046460 | Ga0495638_0064881 | Ga0495638_0064881_1138_1962 | 235 |
| 58 | 3300046474 | Ga0495605_0004355 | Ga0495605_0004355_1659_2483 | 235 |
| 59 | 3300046492 | Ga0495585_0043610 | Ga0495585_0043610_240_1064 | 235 |
| 60 | 3300046499 | Ga0495594_0151081 | Ga0495594_0151081_221_1045 | 235 |
| 61 | 3300046501 | Ga0495607_0155298 | Ga0495607_0155298_311_1135 | 235 |
| 62 | 3300046515 | Ga0495620_0003917 | Ga0495620_0003917_3818_4642 | 235 |
| 63 | 3300046523 | Ga0495644_0055487 | Ga0495644_0055487_339_1163 | 235 |
| 64 | 3300046525 | Ga0495663_0030146 | Ga0495663_0030146_758_1516 | 235 |
| 65 | 3300046526 | Ga0495666_0012793 | Ga0495666_0012793_1893_2717 | 235 |
| 66 | 3300046557 | Ga0495622_0017722 | Ga0495622_0017722_168_992 | 235 |
| 67 | 3300046616 | Ga0495668_0053332 | Ga0495668_0053332_229_1053 | 235 |
| 68 | 3300046648 | Ga0495611_0155835 | Ga0495611_0155835_221_1045 | 235 |
| 69 | 3300046660 | Ga0495625_0131976 | Ga0495625_0131976_627_1451 | 235 |
| 70 | 3300046665 | Ga0495661_0177944 | Ga0495661_0177944_234_1058 | 235 |
| 71 | 3300047321 | Ga0495676_0002857 | Ga0495676_0002857_13185_14009 | 235 |
| 72 | 3300047443 | Ga0495687_098775 | Ga0495687_098775_207_1031 | 235 |
| 73 | 3300047470 | Ga0495681_0035562 | Ga0495681_0035562_1351_2175 | 235 |
| 74 | 3300048091 | Ga0495626_0058064 | Ga0495626_0058064_579_1403 | 235 |
| 75 | 3300053121 | Ga0500607_000148 | Ga0500607_000148_21735_22517 | 235 |
| 76 | 3300053130 | Ga0500642_0123100 | Ga0500642_0123100_298_1107 | 235 |
| 77 | 3300053730 | Ga0500645_008481 | Ga0500645_008481_2392_3174 | 235 |
| 78 | 3300013104 | Ga0157370_10002160 | Ga0157370_1000216016 | 236 |
| 79 | 3300025297 | Ga0209758_1001275 | Ga0209758_100127525 | 236 |
| 80 | 3300046452 | Ga0495617_061724 | Ga0495617_061724_68_994 | 236 |
| 81 | 3300046524 | Ga0495648_0000239 | Ga0495648_0000239_21096_21848 | 236 |
| 82 | 3300046648 | Ga0495611_0017900 | Ga0495611_0017900_1658_2584 | 236 |
| 83 | 3300046674 | Ga0495588_0033156 | Ga0495588_0033156_1789_2562 | 236 |
| 84 | 3300047469 | Ga0495673_0000321 | Ga0495673_0000321_21125_21877 | 236 |
| 85 | 3300049459 | Ga0495678_123412 | Ga0495678_123412_50_799 | 236 |
| 86 | 3300049766 | Ga0501269_000034 | Ga0501269_000034_31059_31817 | 236 |
| 87 | 3300053088 | Ga0500644_0000189 | Ga0500644_0000189_20988_21740 | 236 |
| 88 | 3300053113 | Ga0500580_037832 | Ga0500580_037832_895_1764 | 236 |
| 89 | 3300053116 | Ga0500592_000148 | Ga0500592_000148_6264_7034 | 236 |
| 90 | 3300053138 | Ga0500564_000059 | Ga0500564_000059_5378_6130 | 236 |
| 91 | 3300009551 | Ga0105238_10012868 | Ga0105238_100128683 | 237 |
| 92 | 3300025304 | Ga0209257_1001043 | Ga0209257_100104329 | 237 |
| 93 | 3300025911 | Ga0207654_10068346 | Ga0207654_100683462 | 237 |
| 94 | 3300025924 | Ga0207694_10007190 | Ga0207694_100071907 | 237 |
| 95 | 3300046471 | Ga0495650_0007765 | Ga0495650_0007765_3632_4492 | 237 |
| 96 | 3300050490 | nmdc:mga03n38_109574_c1 | nmdc:mga03n38_109574_c1_364_1275 | 237 |
| 97 | iso_pu_bacteria | 2791355406 | 2793981546 | 237 |
| 98 | iso_pu_bacteria | 8047893842 | 8047900978 | 237 |
| 99 | iso_pu_bacteria | 8048127548 | 8048134285 | 237 |
| 100 | iso_pu_bacteria | 8048356638 | 8048357923 | 237 |
| 101 | iso_pu_bacteria | 8048369669 | 8048377920 | 237 |
| 102 | iso_pu_bacteria | 8048379754 | 8048387018 | 237 |
| 103 | 3300028786 | Ga0307517_10074950 | Ga0307517_100749502 | 238 |
| 104 | 3300046459 | Ga0495629_0022313 | Ga0495629_0022313_2865_3749 | 238 |
| 105 | 3300046474 | Ga0495605_0069504 | Ga0495605_0069504_436_1272 | 238 |
| 106 | 3300046474 | Ga0495605_0090255 | Ga0495605_0090255_63_989 | 238 |
| 107 | 3300046492 | Ga0495585_0085816 | Ga0495585_0085816_572_1456 | 238 |
| 108 | 3300046492 | Ga0495585_0136201 | Ga0495585_0136201_236_1162 | 238 |
| 109 | 3300046515 | Ga0495620_0001291 | Ga0495620_0001291_4976_5812 | 238 |
| 110 | 3300046522 | Ga0495643_0011709 | Ga0495643_0011709_1158_1994 | 238 |
| 111 | 3300046524 | Ga0495648_0013500 | Ga0495648_0013500_786_1622 | 238 |
| 112 | 3300046528 | Ga0495642_0092802 | Ga0495642_0092802_164_1000 | 238 |
| 113 | 3300046542 | Ga0495597_0017766 | Ga0495597_0017766_1619_2455 | 238 |
| 114 | 3300046674 | Ga0495588_0013345 | Ga0495588_0013345_90_974 | 238 |
| 115 | 3300047318 | Ga0495636_0020197 | Ga0495636_0020197_1509_2345 | 238 |
| 116 | 3300047318 | Ga0495636_0049029 | Ga0495636_0049029_303_1229 | 238 |
| 117 | 3300047321 | Ga0495676_0003781 | Ga0495676_0003781_12721_13623 | 238 |
| 118 | 3300047321 | Ga0495676_0010737 | Ga0495676_0010737_5698_6582 | 238 |
| 119 | 3300047443 | Ga0495687_027803 | Ga0495687_027803_1021_1857 | 238 |
| 120 | 3300047446 | Ga0495679_013312 | Ga0495679_013312_351_1115 | 238 |
| 121 | 3300049459 | Ga0495678_032827 | Ga0495678_032827_151_987 | 238 |
| 122 | 3300053125 | Ga0500618_000511 | Ga0500618_000511_565_1329 | 238 |
| 123 | iso_pu_bacteria | 2918501144 | 2918502211 | 238 |
| 124 | iso_pu_bacteria | 8054160619 | 8054163291 | 238 |
| 125 | 3300003791 | Ga0055530_10000066 | Ga0055530_1000006685 | 239 |
| 126 | 3300003794 | Ga0055531_10001339 | Ga0055531_1000133914 | 239 |
| 127 | 3300025298 | Ga0209050_1000038 | Ga0209050_1000038313 | 239 |
| 128 | 3300025304 | Ga0209257_1001060 | Ga0209257_100106022 | 239 |
| 129 | 3300046458 | Ga0495591_010704 | Ga0495591_010704_2711_3496 | 239 |
| 130 | 3300046558 | Ga0495633_0162372 | Ga0495633_0162372_199_984 | 239 |
| 131 | 3300053080 | Ga0500635_0000020 | Ga0500635_0000020_68096_68905 | 239 |
| 132 | 3300053121 | Ga0500607_048277 | Ga0500607_048277_1104_1913 | 239 |
| 133 | 3300053157 | Ga0500624_006724 | Ga0500624_006724_509_1318 | 239 |
| 134 | 3300053162 | Ga0500638_012935 | Ga0500638_012935_2144_2953 | 239 |
| 135 | 3300053177 | Ga0500636_0000543 | Ga0500636_0000543_5195_6004 | 239 |
| 136 | 3300001989 | JGI24739J22299_10064354 | JGI24739J22299_100643541 | 240 |
| 137 | 3300005563 | Ga0068855_100276610 | Ga0068855_1002766102 | 240 |
| 138 | 3300006048 | Ga0075363_100070972 | Ga0075363_1000709722 | 240 |
| 139 | 3300006353 | Ga0075370_10177081 | Ga0075370_101770811 | 240 |
| 140 | 3300011119 | Ga0105246_10049033 | Ga0105246_100490332 | 240 |
| 141 | 3300014497 | Ga0182008_10001096 | Ga0182008_1000109610 | 240 |
| 142 | 3300015262 | Ga0182007_10001650 | Ga0182007_100016505 | 240 |
| 143 | 3300015688 | Ga0183367_1003 | Ga0183367_1003266 | 240 |
| 144 | 3300030522 | Ga0307512_10015575 | Ga0307512_100155755 | 240 |
| 145 | 3300031456 | Ga0307513_10103139 | Ga0307513_101031391 | 240 |
| 146 | 3300031616 | Ga0307508_10029395 | Ga0307508_100293954 | 240 |
| 147 | 3300031838 | Ga0307518_10178376 | Ga0307518_101783761 | 240 |
| 148 | 3300033179 | Ga0307507_10193809 | Ga0307507_101938092 | 240 |
| 149 | 3300037466 | Ga0395898_0002157 | Ga0395898_0002157_14922_15827 | 240 |
| 150 | 3300038443 | Ga0395901_0161915 | Ga0395901_0161915_796_1701 | 240 |
| 151 | 3300042136 | Ga0450900_006822 | Ga0450900_006822_111_995 | 240 |
| 152 | 3300044656 | Ga0466969_0015985 | Ga0466969_0015985_180_1058 | 240 |
| 153 | 3300046474 | Ga0495605_0043272 | Ga0495605_0043272_1080_1940 | 240 |
| 154 | 3300046501 | Ga0495607_0000032 | Ga0495607_0000032_89151_90011 | 240 |
| 155 | 3300046689 | Ga0495613_0085988 | Ga0495613_0085988_1405_2250 | 240 |
| 156 | 3300047472 | Ga0495686_0099087 | Ga0495686_0099087_234_1136 | 240 |
| 157 | 3300048091 | Ga0495626_0000015 | Ga0495626_0000015_102026_102790 | 240 |
| 158 | 3300050490 | nmdc:mga03n38_41862_c1 | nmdc:mga03n38_41862_c1_223_1098 | 240 |
| 159 | 3300050496 | nmdc:mga07m45_62960_c1 | nmdc:mga07m45_62960_c1_838_1749 | 240 |
| 160 | 3300053086 | Ga0500578_0215964 | Ga0500578_0215964_80_982 | 240 |
| 161 | iso_pu_bacteria | 2862178590 | 2862181274 | 240 |
| 162 | 3300005844 | Ga0068862_100000074 | Ga0068862_100000074110 | 241 |
| 163 | 3300006931 | Ga0097620_100210162 | Ga0097620_1002101622 | 241 |
| 164 | 3300009101 | Ga0105247_10119490 | Ga0105247_101194902 | 241 |
| 165 | 3300025900 | Ga0207710_10105809 | Ga0207710_101058092 | 241 |
| 166 | 3300028380 | Ga0268265_10000847 | Ga0268265_1000084720 | 241 |
| 167 | 3300030522 | Ga0307512_10040433 | Ga0307512_100404333 | 241 |
| 168 | 3300031649 | Ga0307514_10004958 | Ga0307514_100049584 | 241 |
| 169 | 3300031730 | Ga0307516_10006745 | Ga0307516_100067453 | 241 |
| 170 | 3300033180 | Ga0307510_10058361 | Ga0307510_100583614 | 241 |
| 171 | 3300033180 | Ga0307510_10219888 | Ga0307510_102198881 | 241 |
| 172 | 3300041498 | Ga0451841_0680686 | Ga0451841_0680686_30_941 | 241 |
| 173 | 3300041512 | Ga0451853_1601412 | Ga0451853_1601412_875_1792 | 241 |
| 174 | 3300041512 | Ga0451853_3602439 | Ga0451853_3602439_3454_4383 | 241 |
| 175 | 3300042005 | Ga0439448_0008535 | Ga0439448_0008535_195_1106 | 241 |
| 176 | 3300042007 | Ga0439449_0014725 | Ga0439449_0014725_1513_2415 | 241 |
| 177 | 3300042012 | Ga0439455_0037657 | Ga0439455_0037657_295_1206 | 241 |
| 178 | 3300044658 | Ga0466972_0004929 | Ga0466972_0004929_180_1058 | 241 |
| 179 | 3300044693 | Ga0466961_0012375 | Ga0466961_0012375_4235_5113 | 241 |
| 180 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_333415_334191 | 241 |
| 181 | 3300046660 | Ga0495625_0137418 | Ga0495625_0137418_455_1366 | 241 |
| 182 | 3300047443 | Ga0495687_004181 | Ga0495687_004181_5707_6594 | 241 |
| 183 | 3300048919 | Ga0496116_0182660 | Ga0496116_0182660_269_1045 | 241 |
| 184 | 3300048922 | Ga0496119_0124169 | Ga0496119_0124169_233_1009 | 241 |
| 185 | 3300048924 | Ga0496121_0009885 | Ga0496121_0009885_8308_9084 | 241 |
| 186 | 3300048925 | Ga0496122_0037935 | Ga0496122_0037935_603_1379 | 241 |
| 187 | 3300048926 | Ga0496123_0009060 | Ga0496123_0009060_7087_7863 | 241 |
| 188 | 3300048927 | Ga0496124_0068150 | Ga0496124_0068150_709_1485 | 241 |
| 189 | 3300049570 | Ga0501033_0066516 | Ga0501033_0066516_1411_2340 | 241 |
| 190 | 3300049822 | Ga0501035_0029889 | Ga0501035_0029889_2130_3059 | 241 |
| 191 | 3300053149 | Ga0500600_0064882 | Ga0500600_0064882_196_1083 | 241 |
| 192 | 3300053149 | Ga0500600_0172950 | Ga0500600_0172950_41_997 | 241 |
| 193 | 3300061719 | Ga0466962_0023165 | Ga0466962_0023165_633_1511 | 241 |
| 194 | iso_pu_bacteria | 2643221563 | 2643835400 | 241 |
| 195 | iso_pu_bacteria | 2643221608 | 2644056326 | 241 |
| 196 | iso_pu_bacteria | 2802429296 | 2804849247 | 241 |
| 197 | iso_pu_bacteria | 2928959182 | 2928961978 | 241 |
| 198 | iso_pu_bacteria | 2990088156 | 2990093814 | 241 |
| 199 | iso_pu_bacteria | 3002998708 | 3003002136 | 241 |
| 200 | iso_pu_bacteria | 8025413630 | 8025413824 | 241 |
| 201 | 3300009553 | Ga0105249_10160716 | Ga0105249_101607162 | 242 |
| 202 | 3300025961 | Ga0207712_10146774 | Ga0207712_101467742 | 242 |
| 203 | 3300031616 | Ga0307508_10241856 | Ga0307508_102418561 | 242 |
| 204 | 3300042157 | Ga0439458_0004574 | Ga0439458_0004574_910_1869 | 242 |
| 205 | 3300046507 | Ga0495606_0000200 | Ga0495606_0000200_28834_29625 | 242 |
| 206 | 3300046694 | Ga0495649_0000033 | Ga0495649_0000033_92634_93425 | 242 |
| 207 | 3300046810 | Ga0495660_0078105 | Ga0495660_0078105_76_885 | 242 |
| 208 | 3300048924 | Ga0496121_0000067 | Ga0496121_0000067_70782_71615 | 242 |
| 209 | iso_pu_bacteria | 2643221578 | 2643905053 | 242 |
| 210 | iso_pu_bacteria | 2643221673 | 2644403111 | 242 |
| 211 | iso_pu_bacteria | 2862574272 | 2862580336 | 242 |
| 212 | iso_pu_bacteria | 2946045630 | 2946052317 | 242 |
| 213 | 3300013104 | Ga0157370_10032695 | Ga0157370_100326954 | 243 |
| 214 | 3300028563 | Ga0265319_1026094 | Ga0265319_10260941 | 243 |
| 215 | 3300028577 | Ga0265318_10000139 | Ga0265318_1000013952 | 243 |
| 216 | 3300031235 | Ga0265330_10003994 | Ga0265330_100039943 | 243 |
| 217 | 3300031238 | Ga0265332_10003516 | Ga0265332_100035163 | 243 |
| 218 | 3300031239 | Ga0265328_10002301 | Ga0265328_100023016 | 243 |
| 219 | 3300031240 | Ga0265320_10002481 | Ga0265320_100024816 | 243 |
| 220 | 3300031242 | Ga0265329_10000367 | Ga0265329_1000036719 | 243 |
| 221 | 3300031249 | Ga0265339_10077377 | Ga0265339_100773772 | 243 |
| 222 | 3300031250 | Ga0265331_10004641 | Ga0265331_100046416 | 243 |
| 223 | 3300031344 | Ga0265316_10008789 | Ga0265316_100087896 | 243 |
| 224 | 3300031711 | Ga0265314_10013933 | Ga0265314_100139332 | 243 |
| 225 | 3300031712 | Ga0265342_10001175 | Ga0265342_100011755 | 243 |
| 226 | 3300046501 | Ga0495607_0010063 | Ga0495607_0010063_306_1094 | 243 |
| 227 | 3300046507 | Ga0495606_0000545 | Ga0495606_0000545_11980_12792 | 243 |
| 228 | 3300046694 | Ga0495649_0053335 | Ga0495649_0053335_1211_2023 | 243 |
| 229 | 3300048905 | Ga0496102_0043134 | Ga0496102_0043134_2634_3467 | 243 |
| 230 | 3300053730 | Ga0500645_016698 | Ga0500645_016698_1501_2286 | 243 |
| 231 | iso_pu_bacteria | 2643221692 | 2644514321 | 243 |
| 232 | iso_pu_bacteria | 2687453743 | 2689992791 | 243 |
| 233 | iso_pu_bacteria | 2917736166 | 2917736462 | 243 |
| 234 | 3300005289 | Ga0065704_10097097 | Ga0065704_100970972 | 244 |
| 235 | 3300005347 | Ga0070668_100002528 | Ga0070668_1000025287 | 244 |
| 236 | 3300005353 | Ga0070669_100001764 | Ga0070669_10000176412 | 244 |
| 237 | 3300005367 | Ga0070667_100020533 | Ga0070667_1000205332 | 244 |
| 238 | 3300009011 | Ga0105251_10030612 | Ga0105251_100306122 | 244 |
| 239 | 3300009177 | Ga0105248_10037790 | Ga0105248_100377902 | 244 |
| 240 | 3300021384 | Ga0213876_10161140 | Ga0213876_101611401 | 244 |
| 241 | 3300025711 | Ga0207696_1003663 | Ga0207696_10036636 | 244 |
| 242 | 3300025735 | Ga0207713_1001885 | Ga0207713_100188511 | 244 |
| 243 | 3300025923 | Ga0207681_10001397 | Ga0207681_100013972 | 244 |
| 244 | 3300025941 | Ga0207711_10017238 | Ga0207711_100172383 | 244 |
| 245 | 3300025941 | Ga0207711_10382345 | Ga0207711_103823452 | 244 |
| 246 | 3300025972 | Ga0207668_10006938 | Ga0207668_100069385 | 244 |
| 247 | 3300044901 | Ga0466960_0003455 | Ga0466960_0003455_2487_3314 | 244 |
| 248 | 3300048924 | Ga0496121_0001912 | Ga0496121_0001912_29124_29975 | 244 |
| 249 | 3300048929 | Ga0496126_0107103 | Ga0496126_0107103_1010_1861 | 244 |
| 250 | 3300048929 | Ga0496126_0319170 | Ga0496126_0319170_43_894 | 244 |
| 251 | iso_pu_bacteria | 2554235341 | 2555668355 | 244 |
| 252 | iso_pu_bacteria | 2599185160 | 2599355356 | 244 |
| 253 | iso_pu_bacteria | 2599185161 | 2599360825 | 244 |
| 254 | iso_pu_bacteria | 2599185162 | 2599367147 | 244 |
| 255 | iso_pu_bacteria | 2599185163 | 2599373937 | 244 |
| 256 | iso_pu_bacteria | 2599185164 | 2599380462 | 244 |
| 257 | iso_pu_bacteria | 2599185165 | 2599386909 | 244 |
| 258 | iso_pu_bacteria | 2599185166 | 2599392795 | 244 |
| 259 | iso_pu_bacteria | 2599185168 | 2599404562 | 244 |
| 260 | iso_pu_bacteria | 2599185181 | 2599462190 | 244 |
| 261 | iso_pu_bacteria | 2599185182 | 2599466768 | 244 |
| 262 | iso_pu_bacteria | 2599185186 | 2599490718 | 244 |
| 263 | iso_pu_bacteria | 2599185356 | 2600214812 | 244 |
| 264 | iso_pu_bacteria | 2600255313 | 2601774483 | 244 |
| 265 | iso_pu_bacteria | 2643221587 | 2643942515 | 244 |
| 266 | iso_pu_bacteria | 2643221677 | 2644429974 | 244 |
| 267 | iso_pu_bacteria | 2667528171 | 2671097957 | 244 |
| 268 | iso_pu_bacteria | 2818991464 | 2819703041 | 244 |
| 269 | iso_pu_bacteria | 2844665904 | 2844668867 | 244 |
| 270 | iso_pu_bacteria | 2917070673 | 2917072122 | 244 |
| 271 | iso_pu_bacteria | 2935353572 | 2935354294 | 244 |
| 272 | iso_pu_bacteria | 637000220 | 637318717 | 244 |
| 273 | iso_pu_bacteria | 8019769354 | 8019770911 | 244 |
| 274 | iso_pu_bacteria | 8057798959 | 8057803655 | 244 |
| 275 | 3300005335 | Ga0070666_10162510 | Ga0070666_101625102 | 245 |
| 276 | 3300005355 | Ga0070671_100003686 | Ga0070671_1000036863 | 245 |
| 277 | 3300005355 | Ga0070671_100003780 | Ga0070671_10000378011 | 245 |
| 278 | 3300005548 | Ga0070665_100000107 | Ga0070665_100000107103 | 245 |
| 279 | 3300005548 | Ga0070665_100033770 | Ga0070665_1000337704 | 245 |
| 280 | 3300005841 | Ga0068863_100018630 | Ga0068863_1000186306 | 245 |
| 281 | 3300005843 | Ga0068860_100015006 | Ga0068860_1000150069 | 245 |
| 282 | 3300005844 | Ga0068862_100016576 | Ga0068862_1000165765 | 245 |
| 283 | 3300009092 | Ga0105250_10012357 | Ga0105250_100123572 | 245 |
| 284 | 3300025711 | Ga0207696_1041113 | Ga0207696_10411132 | 245 |
| 285 | 3300025735 | Ga0207713_1045466 | Ga0207713_10454662 | 245 |
| 286 | 3300025903 | Ga0207680_10137414 | Ga0207680_101374142 | 245 |
| 287 | 3300025923 | Ga0207681_10001221 | Ga0207681_1000122111 | 245 |
| 288 | 3300025931 | Ga0207644_10055190 | Ga0207644_100551903 | 245 |
| 289 | 3300025986 | Ga0207658_10001032 | Ga0207658_1000103218 | 245 |
| 290 | 3300025986 | Ga0207658_10092397 | Ga0207658_100923972 | 245 |
| 291 | 3300026088 | Ga0207641_10003617 | Ga0207641_1000361713 | 245 |
| 292 | 3300028379 | Ga0268266_10000354 | Ga0268266_1000035418 | 245 |
| 293 | 3300028379 | Ga0268266_10009243 | Ga0268266_100092434 | 245 |
| 294 | 3300028380 | Ga0268265_10005338 | Ga0268265_100053386 | 245 |
| 295 | 3300028380 | Ga0268265_10097822 | Ga0268265_100978222 | 245 |
| 296 | 3300046512 | Ga0495610_0019749 | Ga0495610_0019749_1830_2651 | 245 |
| 297 | 3300046518 | Ga0495631_0002052 | Ga0495631_0002052_660_1481 | 245 |
| 298 | 3300046660 | Ga0495625_0000081 | Ga0495625_0000081_42426_43235 | 245 |
| 299 | 3300047446 | Ga0495679_001171 | Ga0495679_001171_11575_12396 | 245 |
| 300 | 3300048905 | Ga0496102_0000613 | Ga0496102_0000613_28782_29558 | 245 |
| 301 | 3300048906 | Ga0496103_0000163 | Ga0496103_0000163_47742_48518 | 245 |
| 302 | 3300048906 | Ga0496103_0009503 | Ga0496103_0009503_1297_2148 | 245 |
| 303 | 3300048907 | Ga0496104_0002224 | Ga0496104_0002224_3664_4440 | 245 |
| 304 | 3300048908 | Ga0496105_0003862 | Ga0496105_0003862_6869_7645 | 245 |
| 305 | 3300048914 | Ga0496111_0058777 | Ga0496111_0058777_1003_1779 | 245 |
| 306 | 3300048916 | Ga0496113_0000081 | Ga0496113_0000081_1489_2265 | 245 |
| 307 | 3300048918 | Ga0496115_0133558 | Ga0496115_0133558_1181_1957 | 245 |
| 308 | 3300048919 | Ga0496116_0042961 | Ga0496116_0042961_1515_2366 | 245 |
| 309 | 3300048919 | Ga0496116_0080144 | Ga0496116_0080144_1174_1950 | 245 |
| 310 | 3300048920 | Ga0496117_0027203 | Ga0496117_0027203_1874_2650 | 245 |
| 311 | 3300048921 | Ga0496118_0030117 | Ga0496118_0030117_2692_3468 | 245 |
| 312 | 3300048921 | Ga0496118_0037674 | Ga0496118_0037674_2837_3688 | 245 |
| 313 | 3300048922 | Ga0496119_0004118 | Ga0496119_0004118_10302_11078 | 245 |
| 314 | 3300048923 | Ga0496120_0004524 | Ga0496120_0004524_2931_3707 | 245 |
| 315 | 3300048923 | Ga0496120_0028051 | Ga0496120_0028051_2221_3072 | 245 |
| 316 | 3300048924 | Ga0496121_0059414 | Ga0496121_0059414_1541_2317 | 245 |
| 317 | 3300048925 | Ga0496122_0001234 | Ga0496122_0001234_1658_2434 | 245 |
| 318 | 3300048926 | Ga0496123_0003785 | Ga0496123_0003785_3338_4114 | 245 |
| 319 | 3300048926 | Ga0496123_0032276 | Ga0496123_0032276_165_1016 | 245 |
| 320 | 3300048927 | Ga0496124_0003614 | Ga0496124_0003614_12020_12796 | 245 |
| 321 | 3300048928 | Ga0496125_0300067 | Ga0496125_0300067_136_912 | 245 |
| 322 | 3300048928 | Ga0496125_0312175 | Ga0496125_0312175_136_912 | 245 |
| 323 | 3300048929 | Ga0496126_0005438 | Ga0496126_0005438_3551_4327 | 245 |
| 324 | 3300053136 | Ga0500559_0001556 | Ga0500559_0001556_5271_6080 | 245 |
| 325 | iso_pu_bacteria | 2582581313 | 2585306605 | 245 |
| 326 | iso_pu_bacteria | 2643221647 | 2644263470 | 245 |
| 327 | iso_pu_bacteria | 2784746768 | 2785366704 | 245 |
| 328 | iso_pu_bacteria | 2786546132 | 2786667764 | 245 |
| 329 | iso_pu_bacteria | 2862281513 | 2862290096 | 245 |
| 330 | iso_pu_bacteria | 2862290372 | 2862292990 | 245 |
| 331 | iso_pu_bacteria | 2946064051 | 2946065220 | 245 |
| 332 | iso_pu_bacteria | 2947224130 | 2947232225 | 245 |
| 333 | iso_pu_bacteria | 2954002825 | 2954008556 | 245 |
| 334 | iso_pu_bacteria | 2954380949 | 2954389138 | 245 |
| 335 | iso_pu_bacteria | 2954673503 | 2954673904 | 245 |
| 336 | iso_pu_bacteria | 2954682443 | 2954690087 | 245 |
| 337 | iso_pu_bacteria | 2954691527 | 2954699886 | 245 |
| 338 | iso_pu_bacteria | 2954701450 | 2954702312 | 245 |
| 339 | iso_pu_bacteria | 3006393351 | 3006394311 | 245 |
| 340 | iso_pu_bacteria | 8003314358 | 8003323451 | 245 |
| 341 | 3300006051 | Ga0075364_10005211 | Ga0075364_100052117 | 246 |
| 342 | 3300006177 | Ga0075362_10019711 | Ga0075362_100197112 | 246 |
| 343 | 3300006186 | Ga0075369_10006670 | Ga0075369_100066705 | 246 |
| 344 | 3300006881 | Ga0068865_100244176 | Ga0068865_1002441762 | 246 |
| 345 | 3300009011 | Ga0105251_10000005 | Ga0105251_10000005125 | 246 |
| 346 | 3300009036 | Ga0105244_10001015 | Ga0105244_1000101512 | 246 |
| 347 | 3300025735 | Ga0207713_1000036 | Ga0207713_100003677 | 246 |
| 348 | 3300025938 | Ga0207704_10185123 | Ga0207704_101851232 | 246 |
| 349 | 3300027312 | Ga0209371_1000609 | Ga0209371_10006095 | 246 |
| 350 | 3300030500 | Ga0268256_1000527 | Ga0268256_100052726 | 246 |
| 351 | 3300046453 | Ga0495627_000008 | Ga0495627_000008_111853_112677 | 246 |
| 352 | 3300046512 | Ga0495610_0010854 | Ga0495610_0010854_3218_4069 | 246 |
| 353 | 3300046516 | Ga0495628_0229975 | Ga0495628_0229975_473_1327 | 246 |
| 354 | 3300046523 | Ga0495644_0001087 | Ga0495644_0001087_4770_5594 | 246 |
| 355 | 3300046524 | Ga0495648_0004517 | Ga0495648_0004517_566_1387 | 246 |
| 356 | 3300046530 | Ga0495654_0021651 | Ga0495654_0021651_1487_2323 | 246 |
| 357 | 3300046538 | Ga0495609_0000340 | Ga0495609_0000340_19474_20298 | 246 |
| 358 | 3300046558 | Ga0495633_0000446 | Ga0495633_0000446_11802_12638 | 246 |
| 359 | 3300046665 | Ga0495661_0002111 | Ga0495661_0002111_3250_4071 | 246 |
| 360 | 3300046678 | Ga0495599_0212034 | Ga0495599_0212034_283_1137 | 246 |
| 361 | 3300046810 | Ga0495660_0001366 | Ga0495660_0001366_872_1696 | 246 |
| 362 | 3300047470 | Ga0495681_0011173 | Ga0495681_0011173_69_893 | 246 |
| 363 | 3300048919 | Ga0496116_0120560 | Ga0496116_0120560_268_1092 | 246 |
| 364 | 3300048928 | Ga0496125_0012848 | Ga0496125_0012848_369_1220 | 246 |
| 365 | 3300050489 | nmdc:mga03683_15022_c1 | nmdc:mga03683_15022_c1_826_1665 | 246 |
| 366 | 3300050491 | nmdc:mga00v17_626_c1 | nmdc:mga00v17_626_c1_4168_5007 | 246 |
| 367 | 3300050516 | nmdc:mga0sz30_6232_c1 | nmdc:mga0sz30_6232_c1_3382_4221 | 246 |
| 368 | 3300053161 | Ga0500634_0000350 | Ga0500634_0000350_2286_3107 | 246 |
| 369 | iso_pu_bacteria | 2643221560 | 2643819954 | 246 |
| 370 | iso_pu_bacteria | 2826581358 | 2826585861 | 246 |
| 371 | iso_pu_bacteria | 2842849001 | 2842850234 | 246 |
| 372 | iso_pu_bacteria | 2877676314 | 2877683834 | 246 |
| 373 | 3300005290 | Ga0065712_10067982 | Ga0065712_100679825 | 247 |
| 374 | 3300041507 | Ga0451851_0122701 | Ga0451851_0122701_88_912 | 247 |
| 375 | 3300046501 | Ga0495607_0057620 | Ga0495607_0057620_318_1142 | 247 |
| 376 | 3300046501 | Ga0495607_0087450 | Ga0495607_0087450_453_1307 | 247 |
| 377 | 3300046506 | Ga0495583_0002118 | Ga0495583_0002118_13710_14531 | 247 |
| 378 | 3300046523 | Ga0495644_0059130 | Ga0495644_0059130_94_918 | 247 |
| 379 | 3300046530 | Ga0495654_0000414 | Ga0495654_0000414_21881_22702 | 247 |
| 380 | 3300046660 | Ga0495625_0012474 | Ga0495625_0012474_4866_5723 | 247 |
| 381 | 3300047320 | Ga0495672_0000032 | Ga0495672_0000032_96319_97167 | 247 |
| 382 | 3300047446 | Ga0495679_003085 | Ga0495679_003085_3998_4819 | 247 |
| 383 | 3300053087 | Ga0500643_048167 | Ga0500643_048167_88_897 | 247 |
| 384 | iso_pu_bacteria | 2599185155 | 2599327076 | 247 |
| 385 | 3300002737 | JGI25162J39368_1000054 | JGI25162J39368_100005463 | 248 |
| 386 | 3300002771 | JGI25163J39215_1000106 | JGI25163J39215_100010621 | 248 |
| 387 | 3300002772 | JGI25164J39214_1000029 | JGI25164J39214_100002981 | 248 |
| 388 | 3300003214 | JGI25165J46597_1000111 | JGI25165J46597_100011163 | 248 |
| 389 | 3300003781 | Ga0055536_1000005 | Ga0055536_1000005308 | 248 |
| 390 | 3300003791 | Ga0055530_10000001 | Ga0055530_1000000123 | 248 |
| 391 | 3300003792 | Ga0055540_1000258 | Ga0055540_100025814 | 248 |
| 392 | 3300009011 | Ga0105251_10005637 | Ga0105251_100056374 | 248 |
| 393 | 3300009036 | Ga0105244_10001477 | Ga0105244_100014778 | 248 |
| 394 | 3300009148 | Ga0105243_10000144 | Ga0105243_100001442 | 248 |
| 395 | 3300009148 | Ga0105243_10024932 | Ga0105243_100249322 | 248 |
| 396 | 3300009553 | Ga0105249_10027254 | Ga0105249_100272543 | 248 |
| 397 | 3300011119 | Ga0105246_10019373 | Ga0105246_100193736 | 248 |
| 398 | 3300014497 | Ga0182008_10000785 | Ga0182008_1000078521 | 248 |
| 399 | 3300025207 | Ga0209760_100015 | Ga0209760_10001560 | 248 |
| 400 | 3300025231 | Ga0207427_100001 | Ga0207427_100001545 | 248 |
| 401 | 3300025233 | Ga0209437_100003 | Ga0209437_100003827 | 248 |
| 402 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007545 | 248 |
| 403 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003520 | 248 |
| 404 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004502 | 248 |
| 405 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006473 | 248 |
| 406 | 3300025728 | Ga0207655_1003129 | Ga0207655_10031297 | 248 |
| 407 | 3300025735 | Ga0207713_1031618 | Ga0207713_10316181 | 248 |
| 408 | 3300025935 | Ga0207709_10001160 | Ga0207709_100011602 | 248 |
| 409 | 3300025935 | Ga0207709_10205008 | Ga0207709_102050082 | 248 |
| 410 | 3300025961 | Ga0207712_10032850 | Ga0207712_100328504 | 248 |
| 411 | 3300028794 | Ga0307515_10058201 | Ga0307515_100582014 | 248 |
| 412 | 3300030521 | Ga0307511_10100046 | Ga0307511_101000462 | 248 |
| 413 | 3300030522 | Ga0307512_10006750 | Ga0307512_100067506 | 248 |
| 414 | 3300046453 | Ga0495627_005481 | Ga0495627_005481_74_934 | 248 |
| 415 | 3300046458 | Ga0495591_000018 | Ga0495591_000018_104556_105416 | 248 |
| 416 | 3300046471 | Ga0495650_0010868 | Ga0495650_0010868_1701_2561 | 248 |
| 417 | 3300046474 | Ga0495605_0000088 | Ga0495605_0000088_68566_69426 | 248 |
| 418 | 3300046474 | Ga0495605_0000522 | Ga0495605_0000522_1142_2002 | 248 |
| 419 | 3300046499 | Ga0495594_0001521 | Ga0495594_0001521_1838_2698 | 248 |
| 420 | 3300046506 | Ga0495583_0000135 | Ga0495583_0000135_73401_74261 | 248 |
| 421 | 3300046515 | Ga0495620_0000034 | Ga0495620_0000034_48594_49454 | 248 |
| 422 | 3300046520 | Ga0495637_0012102 | Ga0495637_0012102_1324_2184 | 248 |
| 423 | 3300046520 | Ga0495637_0013550 | Ga0495637_0013550_2205_3065 | 248 |
| 424 | 3300046524 | Ga0495648_0001250 | Ga0495648_0001250_5669_6529 | 248 |
| 425 | 3300046530 | Ga0495654_0006197 | Ga0495654_0006197_187_1047 | 248 |
| 426 | 3300046530 | Ga0495654_0076963 | Ga0495654_0076963_100_960 | 248 |
| 427 | 3300046538 | Ga0495609_0000147 | Ga0495609_0000147_49803_50663 | 248 |
| 428 | 3300046542 | Ga0495597_0000013 | Ga0495597_0000013_94525_95385 | 248 |
| 429 | 3300046542 | Ga0495597_0004857 | Ga0495597_0004857_5666_6526 | 248 |
| 430 | 3300046558 | Ga0495633_0000316 | Ga0495633_0000316_27089_27949 | 248 |
| 431 | 3300046665 | Ga0495661_0000078 | Ga0495661_0000078_68498_69358 | 248 |
| 432 | 3300046692 | Ga0495671_0014142 | Ga0495671_0014142_187_1047 | 248 |
| 433 | 3300046794 | Ga0495589_0010957 | Ga0495589_0010957_2325_3185 | 248 |
| 434 | 3300046810 | Ga0495660_0000873 | Ga0495660_0000873_15871_16731 | 248 |
| 435 | 3300046810 | Ga0495660_0002313 | Ga0495660_0002313_11285_12145 | 248 |
| 436 | 3300047323 | Ga0495683_0000108 | Ga0495683_0000108_49739_50599 | 248 |
| 437 | 3300047446 | Ga0495679_000198 | Ga0495679_000198_13795_14655 | 248 |
| 438 | 3300047469 | Ga0495673_0025675 | Ga0495673_0025675_472_1332 | 248 |
| 439 | 3300047470 | Ga0495681_0013912 | Ga0495681_0013912_1964_2824 | 248 |
| 440 | 3300048919 | Ga0496116_0000126 | Ga0496116_0000126_75479_76300 | 248 |
| 441 | 3300048920 | Ga0496117_0000623 | Ga0496117_0000623_782_1603 | 248 |
| 442 | 3300048921 | Ga0496118_0071815 | Ga0496118_0071815_654_1475 | 248 |
| 443 | 3300048924 | Ga0496121_0000142 | Ga0496121_0000142_75412_76233 | 248 |
| 444 | 3300048925 | Ga0496122_0002287 | Ga0496122_0002287_13614_14435 | 248 |
| 445 | 3300048925 | Ga0496122_0005467 | Ga0496122_0005467_12052_12912 | 248 |
| 446 | 3300048926 | Ga0496123_0000434 | Ga0496123_0000434_60576_61397 | 248 |
| 447 | 3300048928 | Ga0496125_0185974 | Ga0496125_0185974_253_1074 | 248 |
| 448 | 3300049459 | Ga0495678_000081 | Ga0495678_000081_68286_69146 | 248 |
| 449 | 3300003771 | Ga0055526_1022180 | Ga0055526_10221802 | 249 |
| 450 | 3300003773 | Ga0055537_1003505 | Ga0055537_10035053 | 249 |
| 451 | 3300003775 | Ga0055524_1012948 | Ga0055524_10129482 | 249 |
| 452 | 3300003790 | Ga0055528_1008429 | Ga0055528_10084293 | 249 |
| 453 | 3300005262 | Ga0065165_1001271 | Ga0065165_100127123 | 249 |
| 454 | 3300005327 | Ga0070658_10001281 | Ga0070658_1000128112 | 249 |
| 455 | 3300005336 | Ga0070680_100011064 | Ga0070680_1000110643 | 249 |
| 456 | 3300005339 | Ga0070660_100019870 | Ga0070660_1000198702 | 249 |
| 457 | 3300005458 | Ga0070681_10003845 | Ga0070681_1000384512 | 249 |
| 458 | 3300005530 | Ga0070679_100007593 | Ga0070679_1000075938 | 249 |
| 459 | 3300005563 | Ga0068855_100005081 | Ga0068855_10000508110 | 249 |
| 460 | 3300005578 | Ga0068854_100072783 | Ga0068854_1000727832 | 249 |
| 461 | 3300005614 | Ga0068856_100411476 | Ga0068856_1004114761 | 249 |
| 462 | 3300009092 | Ga0105250_10004047 | Ga0105250_100040476 | 249 |
| 463 | 3300025263 | Ga0209565_1000281 | Ga0209565_100028140 | 249 |
| 464 | 3300025273 | Ga0209673_1001574 | Ga0209673_10015748 | 249 |
| 465 | 3300025291 | Ga0209675_1019109 | Ga0209675_10191092 | 249 |
| 466 | 3300025295 | Ga0209564_1000557 | Ga0209564_100055734 | 249 |
| 467 | 3300025295 | Ga0209564_1019939 | Ga0209564_10199392 | 249 |
| 468 | 3300025297 | Ga0209758_1000608 | Ga0209758_100060812 | 249 |
| 469 | 3300025298 | Ga0209050_1027233 | Ga0209050_10272332 | 249 |
| 470 | 3300025299 | Ga0209256_1013803 | Ga0209256_10138032 | 249 |
| 471 | 3300025909 | Ga0207705_10025961 | Ga0207705_100259613 | 249 |
| 472 | 3300025912 | Ga0207707_10003543 | Ga0207707_100035438 | 249 |
| 473 | 3300025913 | Ga0207695_10012701 | Ga0207695_100127017 | 249 |
| 474 | 3300025917 | Ga0207660_10167993 | Ga0207660_101679932 | 249 |
| 475 | 3300025919 | Ga0207657_10281967 | Ga0207657_102819672 | 249 |
| 476 | 3300025921 | Ga0207652_10011650 | Ga0207652_100116501 | 249 |
| 477 | 3300025949 | Ga0207667_10021876 | Ga0207667_100218763 | 249 |
| 478 | 3300026078 | Ga0207702_10042525 | Ga0207702_100425253 | 249 |
| 479 | 3300028786 | Ga0307517_10048414 | Ga0307517_100484145 | 249 |
| 480 | 3300028794 | Ga0307515_10000524 | Ga0307515_1000052437 | 249 |
| 481 | 3300028794 | Ga0307515_10027774 | Ga0307515_100277746 | 249 |
| 482 | 3300030521 | Ga0307511_10011009 | Ga0307511_100110096 | 249 |
| 483 | 3300030521 | Ga0307511_10037288 | Ga0307511_100372883 | 249 |
| 484 | 3300031456 | Ga0307513_10015813 | Ga0307513_100158138 | 249 |
| 485 | 3300031507 | Ga0307509_10002942 | Ga0307509_1000294215 | 249 |
| 486 | 3300031507 | Ga0307509_10003139 | Ga0307509_1000313920 | 249 |
| 487 | 3300031616 | Ga0307508_10049105 | Ga0307508_100491053 | 249 |
| 488 | 3300031616 | Ga0307508_10229675 | Ga0307508_102296751 | 249 |
| 489 | 3300031838 | Ga0307518_10186862 | Ga0307518_101868622 | 249 |
| 490 | 3300033179 | Ga0307507_10007410 | Ga0307507_1000741011 | 249 |
| 491 | 3300033180 | Ga0307510_10009355 | Ga0307510_100093559 | 249 |
| 492 | 3300033180 | Ga0307510_10024282 | Ga0307510_100242822 | 249 |
| 493 | 3300033180 | Ga0307510_10054411 | Ga0307510_100544115 | 249 |
| 494 | 3300039447 | Ga0436361_0989786 | Ga0436361_0989786_71_895 | 249 |
| 495 | 3300046454 | Ga0495592_0020586 | Ga0495592_0020586_45_938 | 249 |
| 496 | 3300046462 | Ga0495651_0021486 | Ga0495651_0021486_4070_4963 | 249 |
| 497 | 3300046474 | Ga0495605_0007282 | Ga0495605_0007282_2296_3156 | 249 |
| 498 | 3300046476 | Ga0495662_0000110 | Ga0495662_0000110_21290_22183 | 249 |
| 499 | 3300046477 | Ga0495664_0001686 | Ga0495664_0001686_5901_6794 | 249 |
| 500 | 3300046499 | Ga0495594_0043677 | Ga0495594_0043677_1322_2215 | 249 |
| 501 | 3300046514 | Ga0495618_0081775 | Ga0495618_0081775_1151_2044 | 249 |
| 502 | 3300046516 | Ga0495628_0009638 | Ga0495628_0009638_4765_5658 | 249 |
| 503 | 3300046535 | Ga0495586_0004586 | Ga0495586_0004586_117_1010 | 249 |
| 504 | 3300046536 | Ga0495587_0019040 | Ga0495587_0019040_3278_4171 | 249 |
| 505 | 3300046542 | Ga0495597_0038360 | Ga0495597_0038360_475_1284 | 249 |
| 506 | 3300046559 | Ga0495667_0179581 | Ga0495667_0179581_316_1209 | 249 |
| 507 | 3300046616 | Ga0495668_0007406 | Ga0495668_0007406_1286_2095 | 249 |
| 508 | 3300046616 | Ga0495668_0032163 | Ga0495668_0032163_1857_2717 | 249 |
| 509 | 3300046642 | Ga0495634_0031104 | Ga0495634_0031104_1824_2717 | 249 |
| 510 | 3300046660 | Ga0495625_0029266 | Ga0495625_0029266_559_1455 | 249 |
| 511 | 3300046660 | Ga0495625_0092267 | Ga0495625_0092267_1079_1888 | 249 |
| 512 | 3300046674 | Ga0495588_0043085 | Ga0495588_0043085_1060_1956 | 249 |
| 513 | 3300046675 | Ga0495657_0000437 | Ga0495657_0000437_3278_4171 | 249 |
| 514 | 3300046680 | Ga0495646_0000400 | Ga0495646_0000400_13294_14187 | 249 |
| 515 | 3300046689 | Ga0495613_0002753 | Ga0495613_0002753_7031_7924 | 249 |
| 516 | 3300046810 | Ga0495660_0001253 | Ga0495660_0001253_3340_4200 | 249 |
| 517 | 3300047317 | Ga0495604_0000673 | Ga0495604_0000673_20239_21132 | 249 |
| 518 | 3300047319 | Ga0495674_0170119 | Ga0495674_0170119_531_1424 | 249 |
| 519 | 3300047321 | Ga0495676_0004612 | Ga0495676_0004612_8452_9345 | 249 |
| 520 | 3300047470 | Ga0495681_0008911 | Ga0495681_0008911_3068_3964 | 249 |
| 521 | 3300047472 | Ga0495686_0038730 | Ga0495686_0038730_1516_2412 | 249 |
| 522 | 3300047673 | Ga0495593_0002874 | Ga0495593_0002874_5363_6256 | 249 |
| 523 | 3300048088 | Ga0495602_0059408 | Ga0495602_0059408_1104_1997 | 249 |
| 524 | 3300048089 | Ga0495614_0007263 | Ga0495614_0007263_2220_3113 | 249 |
| 525 | 3300053104 | Ga0500556_0024836 | Ga0500556_0024836_79_888 | 249 |
| 526 | iso_pu_bacteria | 2582581279 | 2585149455 | 249 |
| 527 | iso_pu_bacteria | 2945961074 | 2945963004 | 249 |
| 528 | 3300003203 | JGI25406J46586_10002057 | JGI25406J46586_100020579 | 250 |
| 529 | 3300003320 | rootH2_10025695 | rootH2_100256952 | 250 |
| 530 | 3300003322 | rootL2_10029067 | rootL2_100290677 | 250 |
| 531 | 3300005536 | Ga0070697_100077656 | Ga0070697_1000776562 | 250 |
| 532 | 3300005985 | Ga0081539_10000417 | Ga0081539_1000041722 | 250 |
| 533 | 3300006946 | Ga0079104_1000006 | Ga0079104_1000006304 | 250 |
| 534 | 3300006948 | Ga0099826_10000572 | Ga0099826_1000057213 | 250 |
| 535 | 3300013102 | Ga0157371_10000063 | Ga0157371_1000006334 | 250 |
| 536 | 3300015261 | Ga0182006_1006128 | Ga0182006_10061282 | 250 |
| 537 | 3300021361 | Ga0213872_10159707 | Ga0213872_101597071 | 250 |
| 538 | 3300025299 | Ga0209256_1003017 | Ga0209256_10030175 | 250 |
| 539 | 3300027111 | Ga0209281_1000011 | Ga0209281_1000011491 | 250 |
| 540 | 3300046460 | Ga0495638_0004745 | Ga0495638_0004745_71_880 | 250 |
| 541 | 3300046460 | Ga0495638_0092995 | Ga0495638_0092995_401_1210 | 250 |
| 542 | 3300046512 | Ga0495610_0000058 | Ga0495610_0000058_49658_50467 | 250 |
| 543 | 3300046513 | Ga0495616_0000031 | Ga0495616_0000031_23117_23926 | 250 |
| 544 | 3300046519 | Ga0495632_0000607 | Ga0495632_0000607_28101_28910 | 250 |
| 545 | 3300046530 | Ga0495654_0000012 | Ga0495654_0000012_108458_109267 | 250 |
| 546 | 3300046616 | Ga0495668_0022070 | Ga0495668_0022070_498_1307 | 250 |
| 547 | 3300046660 | Ga0495625_0020841 | Ga0495625_0020841_2504_3313 | 250 |
| 548 | 3300046692 | Ga0495671_0074428 | Ga0495671_0074428_279_1088 | 250 |
| 549 | 3300047320 | Ga0495672_0003990 | Ga0495672_0003990_9056_9865 | 250 |
| 550 | 3300053104 | Ga0500556_0001301 | Ga0500556_0001301_2054_2863 | 250 |
| 551 | 3300053134 | Ga0500658_0050740 | Ga0500658_0050740_133_942 | 250 |
| 552 | 3300053153 | Ga0500616_0046069 | Ga0500616_0046069_940_1749 | 250 |
| 553 | 3300053730 | Ga0500645_004520 | Ga0500645_004520_4054_4863 | 250 |
| 554 | 3300053731 | Ga0500609_000125 | Ga0500609_000125_6115_6924 | 250 |
| 555 | iso_pu_bacteria | 2616644814 | 2616693185 | 250 |
| 556 | iso_pu_bacteria | 2643221598 | 2643999094 | 250 |
| 557 | 3300046453 | Ga0495627_002624 | Ga0495627_002624_3105_3968 | 251 |
| 558 | 3300046458 | Ga0495591_000300 | Ga0495591_000300_6247_7110 | 251 |
| 559 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_424403_425212 | 251 |
| 560 | 3300046501 | Ga0495607_0006881 | Ga0495607_0006881_1990_2853 | 251 |
| 561 | 3300046507 | Ga0495606_0000729 | Ga0495606_0000729_37741_38604 | 251 |
| 562 | 3300046512 | Ga0495610_0009917 | Ga0495610_0009917_3623_4486 | 251 |
| 563 | 3300046512 | Ga0495610_0012925 | Ga0495610_0012925_1000_1809 | 251 |
| 564 | 3300046515 | Ga0495620_0000207 | Ga0495620_0000207_10328_11191 | 251 |
| 565 | 3300046519 | Ga0495632_0003572 | Ga0495632_0003572_6468_7331 | 251 |
| 566 | 3300046660 | Ga0495625_0072463 | Ga0495625_0072463_1536_2345 | 251 |
| 567 | 3300046660 | Ga0495625_0226307 | Ga0495625_0226307_34_843 | 251 |
| 568 | 3300046665 | Ga0495661_0000138 | Ga0495661_0000138_46609_47472 | 251 |
| 569 | 3300046794 | Ga0495589_0000585 | Ga0495589_0000585_1518_2381 | 251 |
| 570 | 3300047323 | Ga0495683_0002624 | Ga0495683_0002624_849_1733 | 251 |
| 571 | 3300047443 | Ga0495687_008146 | Ga0495687_008146_1620_2504 | 251 |
| 572 | 3300047470 | Ga0495681_0003080 | Ga0495681_0003080_249_1112 | 251 |
| 573 | 3300047470 | Ga0495681_0004938 | Ga0495681_0004938_4999_5862 | 251 |
| 574 | 3300047470 | Ga0495681_0159761 | Ga0495681_0159761_27_890 | 251 |
| 575 | 3300049459 | Ga0495678_021074 | Ga0495678_021074_262_1071 | 251 |
| 576 | 3300053086 | Ga0500578_0000234 | Ga0500578_0000234_48597_49406 | 251 |
| 577 | 3300053118 | Ga0500594_0000022 | Ga0500594_0000022_24752_25561 | 251 |
| 578 | iso_pu_bacteria | 2506783011 | 2506864804 | 251 |
| 579 | 3300031251 | Ga0265327_10000175 | Ga0265327_1000017548 | 252 |
| 580 | 3300039447 | Ga0436361_0804027 | Ga0436361_0804027_410_1234 | 252 |
| 581 | 3300050493 | nmdc:mga0k408_71943_c1 | nmdc:mga0k408_71943_c1_678_1499 | 252 |
| 582 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_131905_132726 | 252 |
| 583 | iso_pu_bacteria | 2651869719 | 2652544212 | 252 |
| 584 | 3300015261 | Ga0182006_1003571 | Ga0182006_10035717 | 253 |
| 585 | 3300025297 | Ga0209758_1001477 | Ga0209758_10014772 | 253 |
| 586 | 3300025299 | Ga0209256_1001941 | Ga0209256_10019413 | 253 |
| 587 | 3300041410 | Ga0439461_0009575 | Ga0439461_0009575_913_1722 | 253 |
| 588 | 3300042156 | Ga0439446_0004310 | Ga0439446_0004310_898_1707 | 253 |
| 589 | 3300042436 | Ga0439435_0002850 | Ga0439435_0002850_1754_2563 | 253 |
| 590 | 3300046474 | Ga0495605_0000067 | Ga0495605_0000067_119565_120425 | 253 |
| 591 | 3300046501 | Ga0495607_0175258 | Ga0495607_0175258_104_964 | 253 |
| 592 | 3300046506 | Ga0495583_0000457 | Ga0495583_0000457_17223_18083 | 253 |
| 593 | 3300046519 | Ga0495632_0000748 | Ga0495632_0000748_6956_7816 | 253 |
| 594 | 3300046520 | Ga0495637_0012438 | Ga0495637_0012438_1660_2520 | 253 |
| 595 | 3300046616 | Ga0495668_0029381 | Ga0495668_0029381_896_1705 | 253 |
| 596 | 3300046665 | Ga0495661_0000513 | Ga0495661_0000513_17671_18531 | 253 |
| 597 | 3300047470 | Ga0495681_0000009 | Ga0495681_0000009_147221_148105 | 253 |
| 598 | 3300047472 | Ga0495686_0025642 | Ga0495686_0025642_2516_3325 | 253 |
| 599 | iso_pu_bacteria | 2511231004 | 2511253361 | 253 |
| 600 | iso_pu_bacteria | 2511231007 | 2511269607 | 253 |
| 601 | iso_pu_bacteria | 2511231008 | 2511278028 | 253 |
| 602 | iso_pu_bacteria | 2511231014 | 2511311612 | 253 |
| 603 | iso_pu_bacteria | 2511231016 | 2511324212 | 253 |
| 604 | iso_pu_bacteria | 2511231021 | 2511359913 | 253 |
| 605 | iso_pu_bacteria | 2512047018 | 2512326225 | 253 |
| 606 | iso_pu_bacteria | 2582580891 | 2583792554 | 253 |
| 607 | iso_pu_bacteria | 2599185316 | 2600021798 | 253 |
| 608 | iso_pu_bacteria | 2599185317 | 2600030832 | 253 |
| 609 | iso_pu_bacteria | 2599185325 | 2600075071 | 253 |
| 610 | iso_pu_bacteria | 2600254930 | 2600360637 | 253 |
| 611 | iso_pu_bacteria | 2623620446 | 2624491734 | 253 |
| 612 | iso_pu_bacteria | 2667528176 | 2671126882 | 253 |
| 613 | iso_pu_bacteria | 2740892503 | 2743737691 | 253 |
| 614 | iso_pu_bacteria | 2923153595 | 2923156736 | 253 |
| 615 | iso_pu_bacteria | 2923586266 | 2923588027 | 253 |
| 616 | iso_pu_bacteria | 2931369376 | 2931374720 | 253 |
| 617 | iso_pu_bacteria | 2931396565 | 2931401304 | 253 |
| 618 | iso_pu_bacteria | 3007395558 | 3007396547 | 253 |
| 619 | iso_pu_bacteria | 8015687852 | 8015690956 | 253 |
| 620 | iso_pu_bacteria | 8055770955 | 8055774096 | 253 |
| 621 | iso_pu_bacteria | 8056177738 | 8056178997 | 253 |
| 622 | 3300003791 | Ga0055530_10000165 | Ga0055530_1000016517 | 254 |
| 623 | 3300003792 | Ga0055540_1000186 | Ga0055540_100018617 | 254 |
| 624 | 3300005288 | Ga0065714_10003126 | Ga0065714_100031265 | 254 |
| 625 | 3300005288 | Ga0065714_10009959 | Ga0065714_100099594 | 254 |
| 626 | 3300005288 | Ga0065714_10011828 | Ga0065714_100118286 | 254 |
| 627 | 3300005289 | Ga0065704_10097927 | Ga0065704_100979271 | 254 |
| 628 | 3300006051 | Ga0075364_10005137 | Ga0075364_100051375 | 254 |
| 629 | 3300017792 | Ga0163161_10003171 | Ga0163161_100031713 | 254 |
| 630 | 3300025292 | Ga0209676_1004357 | Ga0209676_10043575 | 254 |
| 631 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037221 | 254 |
| 632 | 3300025303 | Ga0209051_1000040 | Ga0209051_1000040222 | 254 |
| 633 | 3300025304 | Ga0209257_1002314 | Ga0209257_10023143 | 254 |
| 634 | 3300030731 | Ga0316177_1222324 | Ga0316177_12223242 | 254 |
| 635 | 3300039450 | Ga0436363_1493638 | Ga0436363_1493638_1397_2239 | 254 |
| 636 | 3300046452 | Ga0495617_000044 | Ga0495617_000044_21635_22519 | 254 |
| 637 | 3300046452 | Ga0495617_013499 | Ga0495617_013499_1504_2388 | 254 |
| 638 | 3300046460 | Ga0495638_0000589 | Ga0495638_0000589_26684_27568 | 254 |
| 639 | 3300046460 | Ga0495638_0010099 | Ga0495638_0010099_3208_4092 | 254 |
| 640 | 3300046491 | Ga0495584_0015439 | Ga0495584_0015439_266_1150 | 254 |
| 641 | 3300046492 | Ga0495585_0000142 | Ga0495585_0000142_34565_35449 | 254 |
| 642 | 3300046512 | Ga0495610_0004442 | Ga0495610_0004442_6088_6972 | 254 |
| 643 | 3300046515 | Ga0495620_0008610 | Ga0495620_0008610_2815_3699 | 254 |
| 644 | 3300046520 | Ga0495637_0033500 | Ga0495637_0033500_1254_2138 | 254 |
| 645 | 3300046524 | Ga0495648_0021510 | Ga0495648_0021510_740_1624 | 254 |
| 646 | 3300046530 | Ga0495654_0040591 | Ga0495654_0040591_170_1054 | 254 |
| 647 | 3300046530 | Ga0495654_0087054 | Ga0495654_0087054_536_1420 | 254 |
| 648 | 3300046542 | Ga0495597_0012599 | Ga0495597_0012599_282_1166 | 254 |
| 649 | 3300046660 | Ga0495625_0022235 | Ga0495625_0022235_2264_3148 | 254 |
| 650 | 3300046660 | Ga0495625_0113957 | Ga0495625_0113957_721_1542 | 254 |
| 651 | 3300046694 | Ga0495649_0015712 | Ga0495649_0015712_2130_3014 | 254 |
| 652 | 3300046810 | Ga0495660_0065403 | Ga0495660_0065403_212_1096 | 254 |
| 653 | 3300047317 | Ga0495604_0009142 | Ga0495604_0009142_5487_6371 | 254 |
| 654 | 3300047444 | Ga0495675_0000016 | Ga0495675_0000016_103845_104729 | 254 |
| 655 | 3300047470 | Ga0495681_0002219 | Ga0495681_0002219_7511_8395 | 254 |
| 656 | 3300047470 | Ga0495681_0004335 | Ga0495681_0004335_6774_7658 | 254 |
| 657 | 3300047471 | Ga0495684_0023241 | Ga0495684_0023241_1290_2174 | 254 |
| 658 | 3300047472 | Ga0495686_0000633 | Ga0495686_0000633_34697_35581 | 254 |
| 659 | 3300049459 | Ga0495678_001228 | Ga0495678_001228_16820_17704 | 254 |
| 660 | 3300050491 | nmdc:mga00v17_51246_c1 | nmdc:mga00v17_51246_c1_1331_2170 | 254 |
| 661 | 3300053139 | Ga0500568_0019338 | Ga0500568_0019338_1378_2262 | 254 |
| 662 | 3300005288 | Ga0065714_10064839 | Ga0065714_1006483912 | 255 |
| 663 | 3300009011 | Ga0105251_10030203 | Ga0105251_100302032 | 255 |
| 664 | 3300013102 | Ga0157371_10000925 | Ga0157371_100009257 | 255 |
| 665 | 3300013105 | Ga0157369_10227871 | Ga0157369_102278712 | 255 |
| 666 | 3300013306 | Ga0163162_10000551 | Ga0163162_1000055128 | 255 |
| 667 | 3300041405 | Ga0439438_000450 | Ga0439438_000450_8389_9324 | 255 |
| 668 | 3300041405 | Ga0439438_000666 | Ga0439438_000666_13490_14374 | 255 |
| 669 | 3300041407 | Ga0439447_006761 | Ga0439447_006761_786_1670 | 255 |
| 670 | 3300041411 | Ga0439466_0013030 | Ga0439466_0013030_1479_2414 | 255 |
| 671 | 3300042010 | Ga0439452_000115 | Ga0439452_000115_1424_2308 | 255 |
| 672 | 3300042010 | Ga0439452_000826 | Ga0439452_000826_2743_3678 | 255 |
| 673 | 3300046452 | Ga0495617_015757 | Ga0495617_015757_1288_2172 | 255 |
| 674 | 3300046453 | Ga0495627_012240 | Ga0495627_012240_496_1380 | 255 |
| 675 | 3300046455 | Ga0495603_0000009 | Ga0495603_0000009_57012_57884 | 255 |
| 676 | 3300046457 | Ga0495590_0000698 | Ga0495590_0000698_5772_6644 | 255 |
| 677 | 3300046457 | Ga0495590_0002258 | Ga0495590_0002258_2485_3369 | 255 |
| 678 | 3300046474 | Ga0495605_0000806 | Ga0495605_0000806_10095_10967 | 255 |
| 679 | 3300046474 | Ga0495605_0023420 | Ga0495605_0023420_1945_2829 | 255 |
| 680 | 3300046491 | Ga0495584_0000083 | Ga0495584_0000083_63501_64385 | 255 |
| 681 | 3300046491 | Ga0495584_0003188 | Ga0495584_0003188_7241_8125 | 255 |
| 682 | 3300046491 | Ga0495584_0017141 | Ga0495584_0017141_2676_3548 | 255 |
| 683 | 3300046500 | Ga0495596_0000089 | Ga0495596_0000089_11531_12415 | 255 |
| 684 | 3300046501 | Ga0495607_0013334 | Ga0495607_0013334_2234_3106 | 255 |
| 685 | 3300046501 | Ga0495607_0021527 | Ga0495607_0021527_1067_1951 | 255 |
| 686 | 3300046507 | Ga0495606_0025101 | Ga0495606_0025101_1945_2829 | 255 |
| 687 | 3300046512 | Ga0495610_0005995 | Ga0495610_0005995_2076_2960 | 255 |
| 688 | 3300046513 | Ga0495616_0000429 | Ga0495616_0000429_24138_25010 | 255 |
| 689 | 3300046515 | Ga0495620_0009072 | Ga0495620_0009072_515_1399 | 255 |
| 690 | 3300046518 | Ga0495631_0007823 | Ga0495631_0007823_1929_2813 | 255 |
| 691 | 3300046519 | Ga0495632_0000495 | Ga0495632_0000495_12476_13348 | 255 |
| 692 | 3300046519 | Ga0495632_0015353 | Ga0495632_0015353_1945_2829 | 255 |
| 693 | 3300046520 | Ga0495637_0009342 | Ga0495637_0009342_2093_2977 | 255 |
| 694 | 3300046522 | Ga0495643_0005942 | Ga0495643_0005942_777_1661 | 255 |
| 695 | 3300046522 | Ga0495643_0007143 | Ga0495643_0007143_3612_4484 | 255 |
| 696 | 3300046523 | Ga0495644_0004478 | Ga0495644_0004478_1518_2402 | 255 |
| 697 | 3300046524 | Ga0495648_0015275 | Ga0495648_0015275_2796_3668 | 255 |
| 698 | 3300046528 | Ga0495642_0000187 | Ga0495642_0000187_12032_12904 | 255 |
| 699 | 3300046530 | Ga0495654_0026580 | Ga0495654_0026580_1361_2233 | 255 |
| 700 | 3300046530 | Ga0495654_0028499 | Ga0495654_0028499_905_1789 | 255 |
| 701 | 3300046538 | Ga0495609_0000477 | Ga0495609_0000477_21219_22091 | 255 |
| 702 | 3300046542 | Ga0495597_0030407 | Ga0495597_0030407_1448_2332 | 255 |
| 703 | 3300046616 | Ga0495668_0000887 | Ga0495668_0000887_2151_3035 | 255 |
| 704 | 3300046660 | Ga0495625_0001558 | Ga0495625_0001558_11891_12775 | 255 |
| 705 | 3300046664 | Ga0495659_0008262 | Ga0495659_0008262_1753_2625 | 255 |
| 706 | 3300046665 | Ga0495661_0010828 | Ga0495661_0010828_3780_4664 | 255 |
| 707 | 3300046692 | Ga0495671_0000052 | Ga0495671_0000052_13868_14740 | 255 |
| 708 | 3300046694 | Ga0495649_0000106 | Ga0495649_0000106_59091_59963 | 255 |
| 709 | 3300046694 | Ga0495649_0023498 | Ga0495649_0023498_615_1499 | 255 |
| 710 | 3300046794 | Ga0495589_0001063 | Ga0495589_0001063_3608_4480 | 255 |
| 711 | 3300046794 | Ga0495589_0006602 | Ga0495589_0006602_2502_3386 | 255 |
| 712 | 3300046810 | Ga0495660_0005067 | Ga0495660_0005067_1926_2810 | 255 |
| 713 | 3300046810 | Ga0495660_0017385 | Ga0495660_0017385_1448_2332 | 255 |
| 714 | 3300047318 | Ga0495636_0000221 | Ga0495636_0000221_11418_12290 | 255 |
| 715 | 3300047320 | Ga0495672_0001535 | Ga0495672_0001535_3781_4653 | 255 |
| 716 | 3300047323 | Ga0495683_0002951 | Ga0495683_0002951_8530_9414 | 255 |
| 717 | 3300047443 | Ga0495687_001130 | Ga0495687_001130_12897_13769 | 255 |
| 718 | 3300047447 | Ga0495685_041386 | Ga0495685_041386_317_1189 | 255 |
| 719 | 3300047469 | Ga0495673_0000190 | Ga0495673_0000190_94365_95249 | 255 |
| 720 | 3300047469 | Ga0495673_0000997 | Ga0495673_0000997_3158_4042 | 255 |
| 721 | 3300047470 | Ga0495681_0000257 | Ga0495681_0000257_12870_13754 | 255 |
| 722 | 3300047472 | Ga0495686_0071700 | Ga0495686_0071700_453_1337 | 255 |
| 723 | 3300048091 | Ga0495626_0000033 | Ga0495626_0000033_48496_49380 | 255 |
| 724 | 3300048091 | Ga0495626_0009842 | Ga0495626_0009842_3714_4586 | 255 |
| 725 | 3300049459 | Ga0495678_001014 | Ga0495678_001014_10810_11682 | 255 |
| 726 | 3300049459 | Ga0495678_017299 | Ga0495678_017299_1632_2516 | 255 |
| 727 | 3300049459 | Ga0495678_035943 | Ga0495678_035943_1010_1882 | 255 |
| 728 | 3300049460 | Ga0495682_0003421 | Ga0495682_0003421_2278_3162 | 255 |
| 729 | 3300049460 | Ga0495682_0013216 | Ga0495682_0013216_475_1347 | 255 |
| 730 | 3300049569 | Ga0501032_0044735 | Ga0501032_0044735_1229_2047 | 255 |
| 731 | 3300049579 | Ga0501043_0002520 | Ga0501043_0002520_12690_13508 | 255 |
| 732 | 3300049580 | Ga0501046_0055842 | Ga0501046_0055842_737_1555 | 255 |
| 733 | 3300049581 | Ga0501047_0000342 | Ga0501047_0000342_8959_9777 | 255 |
| 734 | 3300049582 | Ga0501048_0355832 | Ga0501048_0355832_37_855 | 255 |
| 735 | 3300049586 | Ga0501070_0141038 | Ga0501070_0141038_943_1761 | 255 |
| 736 | 3300048904 | Ga0496101_0323198 | Ga0496101_0323198_242_1063 | 256 |
| 737 | 3300048909 | Ga0496106_0063172 | Ga0496106_0063172_1371_2192 | 256 |
| 738 | 3300048910 | Ga0496107_0000565 | Ga0496107_0000565_17656_18477 | 256 |
| 739 | 3300048924 | Ga0496121_0019626 | Ga0496121_0019626_4193_5014 | 256 |
| 740 | 3300046460 | Ga0495638_0000160 | Ga0495638_0000160_57059_57943 | 257 |
| 741 | 3300046794 | Ga0495589_0002412 | Ga0495589_0002412_5122_6006 | 257 |
| 742 | 3300010375 | Ga0105239_10132598 | Ga0105239_101325983 | 258 |
| 743 | 3300010375 | Ga0105239_10811772 | Ga0105239_108117721 | 258 |
| 744 | 3300013104 | Ga0157370_10030558 | Ga0157370_100305581 | 258 |
| 745 | 3300015261 | Ga0182006_1007784 | Ga0182006_10077846 | 258 |
| 746 | 3300015262 | Ga0182007_10000682 | Ga0182007_100006824 | 258 |
| 747 | 3300015265 | Ga0182005_1015072 | Ga0182005_10150722 | 258 |
| 748 | 3300041405 | Ga0439438_000200 | Ga0439438_000200_17098_18042 | 258 |
| 749 | 3300042013 | Ga0439456_000816 | Ga0439456_000816_354_1298 | 258 |
| 750 | 3300042016 | Ga0439463_000202 | Ga0439463_000202_11660_12604 | 258 |
| 751 | 3300042016 | Ga0439463_026153 | Ga0439463_026153_431_1375 | 258 |
| 752 | 3300046455 | Ga0495603_0009296 | Ga0495603_0009296_1629_2552 | 258 |
| 753 | 3300046460 | Ga0495638_0020681 | Ga0495638_0020681_1991_2932 | 258 |
| 754 | 3300046474 | Ga0495605_0012723 | Ga0495605_0012723_14_943 | 258 |
| 755 | 3300046474 | Ga0495605_0017337 | Ga0495605_0017337_1348_2292 | 258 |
| 756 | 3300046491 | Ga0495584_0001678 | Ga0495584_0001678_4824_5750 | 258 |
| 757 | 3300046491 | Ga0495584_0002197 | Ga0495584_0002197_1676_2599 | 258 |
| 758 | 3300046512 | Ga0495610_0033846 | Ga0495610_0033846_1319_2242 | 258 |
| 759 | 3300046515 | Ga0495620_0048421 | Ga0495620_0048421_407_1261 | 258 |
| 760 | 3300046520 | Ga0495637_0007004 | Ga0495637_0007004_3044_3967 | 258 |
| 761 | 3300046692 | Ga0495671_0015686 | Ga0495671_0015686_1335_2258 | 258 |
| 762 | 3300047470 | Ga0495681_0000329 | Ga0495681_0000329_26858_27787 | 258 |
| 763 | 3300047470 | Ga0495681_0006935 | Ga0495681_0006935_5202_6125 | 258 |
| 764 | 3300049459 | Ga0495678_000583 | Ga0495678_000583_22346_23275 | 258 |
| 765 | 3300046458 | Ga0495591_000088 | Ga0495591_000088_21684_22613 | 259 |
| 766 | 3300046460 | Ga0495638_0007339 | Ga0495638_0007339_5679_6623 | 259 |
| 767 | 3300046460 | Ga0495638_0095347 | Ga0495638_0095347_760_1704 | 259 |
| 768 | 3300046474 | Ga0495605_0000158 | Ga0495605_0000158_23056_24000 | 259 |
| 769 | 3300046692 | Ga0495671_0026763 | Ga0495671_0026763_1787_2716 | 259 |
| 770 | 3300047323 | Ga0495683_0047214 | Ga0495683_0047214_808_1752 | 259 |
| 771 | 3300047443 | Ga0495687_000572 | Ga0495687_000572_20744_21688 | 259 |
| 772 | 3300048091 | Ga0495626_0000720 | Ga0495626_0000720_20700_21644 | 259 |
| 773 | 3300048927 | Ga0496124_0000812 | Ga0496124_0000812_10552_11496 | 259 |
| 774 | 2162886007 | SwRhRL2b_contig_3039297 | SwRhRL2b_0215.00008070 | 261 |
| 775 | 3300005353 | Ga0070669_100001571 | Ga0070669_1000015715 | 261 |
| 776 | 3300005367 | Ga0070667_100028263 | Ga0070667_1000282632 | 261 |
| 777 | 3300013306 | Ga0163162_10031044 | Ga0163162_100310445 | 261 |
| 778 | 3300046694 | Ga0495649_0000836 | Ga0495649_0000836_367_1311 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
115
307
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.6563 | 84 | 253 |
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.5348 | 15 | 247 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.5289 | 15 | 248 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.5242 | 84 | 239 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.5171 | 61 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45767_178_390_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8761 | 124 | 251 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.783 | 133 | 246 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7821 | 87 | 255 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7452 | 84 | 247 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7395 | 133 | 246 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5DT53-F1-model_v4 | ABC transporter permease subunit | 0.9404 | 125 | 257 |
GO:0005886
GO:0055085 |
| AF-A0A519YA77-F1-model_v4 | deleted | 0.9294 | 116 | 261 |
|
| AF-A0A6N8QHZ2-F1-model_v4 | deleted | 0.9179 | 110 | 257 |
|
| AF-A0A519YA77-F1-model_v4 | deleted | 0.9172 | 116 | 261 |
|
| AF-A0A1H9AHU3-F1-model_v4 | Sulfonate transport system permease protein | 0.9141 | 107 | 255 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar