F480401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 778 | 267 | 778 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10849234|Ga0070658_108492342 |
| Length | 107 |
| Sequence | MIGTAFAQSAGGSPAGMDMMSMLPIVIMFVILYFIMIRPQMRKAKEHKTMLDALAKGDEVVAVGILGRIEGISDNYLSVEIAPNTVIQVQKQAVTQLLPKGTIKSAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 215 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 216 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.24 |
| Rhizosphere | 95.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1003457 | 3300001976 | Bacteria | 2078 |
| 2 | JGI24743J22301_10008236 | 3300001991 | Bacteria | 1825 |
| 3 | JGI24035J26624_1004929 | 3300002126 | Bacteria | 1271 |
| 4 | JGI24033J26618_1008168 | 3300002155 | Bacteria | 1201 |
| 5 | JGI24751J29686_10060056 | 3300002459 | Bacteria | 783 |
| 6 | Ga0065714_10199405 | 3300005288 | Bacteria | 900 |
| 7 | Ga0065712_10097071 | 3300005290 | Bacteria | 2157 |
| 8 | Ga0065712_10422768 | 3300005290 | Bacteria | 710 |
| 9 | Ga0065715_10226336 | 3300005293 | Bacteria | 1251 |
| 10 | Ga0065715_11101890 | 3300005293 | Bacteria | 520 |
| 11 | Ga0065715_11108883 | 3300005293 | Bacteria | 518 |
| 12 | Ga0065707_10105687 | 3300005295 | Bacteria | 2601 |
| 13 | Ga0070658_10271339 | 3300005327 | Bacteria | 1443 |
| 14 | Ga0070658_10849234 | 3300005327 | Bacteria | 793 |
| 15 | Ga0070658_11398776 | 3300005327 | Bacteria | 607 |
| 16 | Ga0070676_10001503 | 3300005328 | Bacteria | 11811 |
| 17 | Ga0070676_10022086 | 3300005328 | Bacteria | 3567 |
| 18 | Ga0070676_10108116 | 3300005328 | Bacteria | 1728 |
| 19 | Ga0070676_10137267 | 3300005328 | Bacteria | 1553 |
| 20 | Ga0070676_10397613 | 3300005328 | Bacteria | 958 |
| 21 | Ga0070676_10696366 | 3300005328 | Bacteria | 741 |
| 22 | Ga0070683_100012394 | 3300005329 | Bacteria | 7408 |
| 23 | Ga0070683_100393919 | 3300005329 | Bacteria | 1321 |
| 24 | Ga0070690_100001622 | 3300005330 | Bacteria | 11824 |
| 25 | Ga0070690_100634905 | 3300005330 | Bacteria | 814 |
| 26 | Ga0070670_100016035 | 3300005331 | Bacteria | 6430 |
| 27 | Ga0070670_100072954 | 3300005331 | Bacteria | 2948 |
| 28 | Ga0070670_100093166 | 3300005331 | Bacteria | 2591 |
| 29 | Ga0070670_100230820 | 3300005331 | Bacteria | 1610 |
| 30 | Ga0070670_100628932 | 3300005331 | Bacteria | 962 |
| 31 | Ga0070670_101109651 | 3300005331 | Bacteria | 722 |
| 32 | Ga0070670_101501057 | 3300005331 | Bacteria | 619 |
| 33 | Ga0070677_10001330 | 3300005333 | Bacteria | 7890 |
| 34 | Ga0070677_10004494 | 3300005333 | Bacteria | 4557 |
| 35 | Ga0070677_10097094 | 3300005333 | Bacteria | 1292 |
| 36 | Ga0070677_10443595 | 3300005333 | Bacteria | 693 |
| 37 | Ga0068869_100020382 | 3300005334 | Bacteria | 4545 |
| 38 | Ga0068869_100147320 | 3300005334 | Bacteria | 1823 |
| 39 | Ga0068869_100579201 | 3300005334 | Bacteria | 946 |
| 40 | Ga0068869_100595003 | 3300005334 | Bacteria | 934 |
| 41 | Ga0070666_10022208 | 3300005335 | Bacteria | 4118 |
| 42 | Ga0070666_10060883 | 3300005335 | Bacteria | 2555 |
| 43 | Ga0070666_10600454 | 3300005335 | Bacteria | 803 |
| 44 | Ga0070666_10966195 | 3300005335 | Bacteria | 631 |
| 45 | Ga0070680_100155969 | 3300005336 | Bacteria | 1918 |
| 46 | Ga0070680_100306037 | 3300005336 | Bacteria | 1348 |
| 47 | Ga0068868_100007221 | 3300005338 | Bacteria | 7896 |
| 48 | Ga0068868_100073739 | 3300005338 | Bacteria | 2725 |
| 49 | Ga0068868_100168787 | 3300005338 | Bacteria | 1811 |
| 50 | Ga0068868_100609707 | 3300005338 | Bacteria | 968 |
| 51 | Ga0068868_100809299 | 3300005338 | Bacteria | 846 |
| 52 | Ga0068868_101106070 | 3300005338 | Bacteria | 729 |
| 53 | Ga0070660_100006963 | 3300005339 | Bacteria | 7845 |
| 54 | Ga0070660_100009658 | 3300005339 | Bacteria | 6795 |
| 55 | Ga0070660_100010635 | 3300005339 | Bacteria | 6505 |
| 56 | Ga0070660_100027115 | 3300005339 | Bacteria | 4274 |
| 57 | Ga0070689_100004833 | 3300005340 | Bacteria | 9148 |
| 58 | Ga0070689_100276146 | 3300005340 | Bacteria | 1393 |
| 59 | Ga0070689_100733193 | 3300005340 | Bacteria | 865 |
| 60 | Ga0070689_101182021 | 3300005340 | Unclassified | 686 |
| 61 | Ga0070689_101621971 | 3300005340 | Bacteria | 588 |
| 62 | Ga0070687_100056484 | 3300005343 | Bacteria | 2054 |
| 63 | Ga0070661_100002676 | 3300005344 | Bacteria | 12196 |
| 64 | Ga0070661_100012213 | 3300005344 | Bacteria | 6005 |
| 65 | Ga0070661_100013146 | 3300005344 | Bacteria | 5809 |
| 66 | Ga0070661_100925427 | 3300005344 | Bacteria | 721 |
| 67 | Ga0070692_10794126 | 3300005345 | Bacteria | 646 |
| 68 | Ga0070668_100012194 | 3300005347 | Bacteria | 6402 |
| 69 | Ga0070668_100016206 | 3300005347 | Bacteria | 5576 |
| 70 | Ga0070668_100023760 | 3300005347 | Bacteria | 4639 |
| 71 | Ga0070668_100122516 | 3300005347 | Bacteria | 2080 |
| 72 | Ga0070668_100238673 | 3300005347 | Bacteria | 1505 |
| 73 | Ga0070669_100030011 | 3300005353 | Bacteria | 3921 |
| 74 | Ga0070669_100070320 | 3300005353 | Bacteria | 2587 |
| 75 | Ga0070669_100126570 | 3300005353 | Bacteria | 1955 |
| 76 | Ga0070669_100348886 | 3300005353 | Bacteria | 1201 |
| 77 | Ga0070669_100757969 | 3300005353 | Bacteria | 823 |
| 78 | Ga0070669_101177328 | 3300005353 | Bacteria | 662 |
| 79 | Ga0070675_100002777 | 3300005354 | Bacteria | 13172 |
| 80 | Ga0070675_100004574 | 3300005354 | Bacteria | 10561 |
| 81 | Ga0070675_100014792 | 3300005354 | Bacteria | 6158 |
| 82 | Ga0070675_100055887 | 3300005354 | Bacteria | 3250 |
| 83 | Ga0070675_100113668 | 3300005354 | Bacteria | 2293 |
| 84 | Ga0070675_100785532 | 3300005354 | Bacteria | 870 |
| 85 | Ga0070675_101687151 | 3300005354 | Bacteria | 585 |
| 86 | Ga0070675_101992123 | 3300005354 | Bacteria | 535 |
| 87 | Ga0070671_100010529 | 3300005355 | Bacteria | 7425 |
| 88 | Ga0070671_100026435 | 3300005355 | Bacteria | 4769 |
| 89 | Ga0070671_100085895 | 3300005355 | Bacteria | 2632 |
| 90 | Ga0070671_100282724 | 3300005355 | Bacteria | 1411 |
| 91 | Ga0070674_100005067 | 3300005356 | Bacteria | 7572 |
| 92 | Ga0070674_100189417 | 3300005356 | Bacteria | 1581 |
| 93 | Ga0070674_100260584 | 3300005356 | Bacteria | 1366 |
| 94 | Ga0070674_100957238 | 3300005356 | Bacteria | 749 |
| 95 | Ga0070673_100001510 | 3300005364 | Bacteria | 13674 |
| 96 | Ga0070673_100030213 | 3300005364 | Bacteria | 4050 |
| 97 | Ga0070673_100051153 | 3300005364 | Bacteria | 3233 |
| 98 | Ga0070673_100111726 | 3300005364 | Bacteria | 2267 |
| 99 | Ga0070673_100115868 | 3300005364 | Bacteria | 2228 |
| 100 | Ga0070688_100001281 | 3300005365 | Bacteria | 12524 |
| 101 | Ga0070659_100000775 | 3300005366 | Bacteria | 23182 |
| 102 | Ga0070659_100011020 | 3300005366 | Bacteria | 6677 |
| 103 | Ga0070659_100053304 | 3300005366 | Bacteria | 3183 |
| 104 | Ga0070667_100010761 | 3300005367 | Bacteria | 7560 |
| 105 | Ga0070667_100050280 | 3300005367 | Bacteria | 3513 |
| 106 | Ga0070667_100185355 | 3300005367 | Bacteria | 1842 |
| 107 | Ga0070667_100218498 | 3300005367 | Bacteria | 1696 |
| 108 | Ga0070667_100222223 | 3300005367 | Bacteria | 1681 |
| 109 | Ga0070667_100796835 | 3300005367 | Bacteria | 877 |
| 110 | Ga0070667_100946092 | 3300005367 | Bacteria | 803 |
| 111 | Ga0070667_101162333 | 3300005367 | Bacteria | 722 |
| 112 | Ga0070714_100023434 | 3300005435 | Bacteria | 5071 |
| 113 | Ga0070713_100086547 | 3300005436 | Bacteria | 2687 |
| 114 | Ga0070701_10011312 | 3300005438 | Bacteria | 3985 |
| 115 | Ga0070701_11139293 | 3300005438 | Bacteria | 551 |
| 116 | Ga0070711_100490992 | 3300005439 | Bacteria | 1011 |
| 117 | Ga0070705_100101466 | 3300005440 | Bacteria | 1818 |
| 118 | Ga0070705_100124178 | 3300005440 | Bacteria | 1672 |
| 119 | Ga0070700_100012660 | 3300005441 | Bacteria | 4717 |
| 120 | Ga0070700_100107535 | 3300005441 | Bacteria | 1849 |
| 121 | Ga0070700_100217688 | 3300005441 | Bacteria | 1351 |
| 122 | Ga0070700_100347025 | 3300005441 | Bacteria | 1099 |
| 123 | Ga0070700_101032621 | 3300005441 | Bacteria | 678 |
| 124 | Ga0070694_100082265 | 3300005444 | Bacteria | 2242 |
| 125 | Ga0070694_100347937 | 3300005444 | Bacteria | 1147 |
| 126 | Ga0070663_100003531 | 3300005455 | Bacteria | 9026 |
| 127 | Ga0070663_100062756 | 3300005455 | Bacteria | 2680 |
| 128 | Ga0070663_100070060 | 3300005455 | Bacteria | 2549 |
| 129 | Ga0070663_100140407 | 3300005455 | Bacteria | 1844 |
| 130 | Ga0070678_100001864 | 3300005456 | Bacteria | 11368 |
| 131 | Ga0070678_100247261 | 3300005456 | Bacteria | 1494 |
| 132 | Ga0070678_100867969 | 3300005456 | Bacteria | 823 |
| 133 | Ga0070678_100935709 | 3300005456 | Bacteria | 794 |
| 134 | Ga0070678_101997501 | 3300005456 | Bacteria | 548 |
| 135 | Ga0070662_100006101 | 3300005457 | Bacteria | 7743 |
| 136 | Ga0070662_100728950 | 3300005457 | Bacteria | 840 |
| 137 | Ga0070681_10009268 | 3300005458 | Bacteria | 9678 |
| 138 | Ga0068867_100002941 | 3300005459 | Bacteria | 11995 |
| 139 | Ga0068867_100178981 | 3300005459 | Bacteria | 1685 |
| 140 | Ga0068867_100337860 | 3300005459 | Bacteria | 1253 |
| 141 | Ga0070685_10002100 | 3300005466 | Bacteria | 10285 |
| 142 | Ga0070685_10303707 | 3300005466 | Bacteria | 1076 |
| 143 | Ga0070685_10749548 | 3300005466 | Bacteria | 716 |
| 144 | Ga0070707_100522552 | 3300005468 | Bacteria | 1149 |
| 145 | Ga0070698_100010362 | 3300005471 | Bacteria | 9954 |
| 146 | Ga0070699_100009041 | 3300005518 | Bacteria | 8632 |
| 147 | Ga0070699_100071189 | 3300005518 | Bacteria | 3024 |
| 148 | Ga0070699_100865217 | 3300005518 | Bacteria | 828 |
| 149 | Ga0070699_101299167 | 3300005518 | Bacteria | 667 |
| 150 | Ga0070679_100021908 | 3300005530 | Bacteria | 6243 |
| 151 | Ga0070684_100008314 | 3300005535 | Bacteria | 8105 |
| 152 | Ga0070684_100024579 | 3300005535 | Bacteria | 5056 |
| 153 | Ga0070684_101743373 | 3300005535 | Bacteria | 588 |
| 154 | Ga0068853_100018218 | 3300005539 | Bacteria | 5809 |
| 155 | Ga0068853_100031794 | 3300005539 | Bacteria | 4466 |
| 156 | Ga0068853_100034090 | 3300005539 | Bacteria | 4320 |
| 157 | Ga0068853_100037786 | 3300005539 | Bacteria | 4110 |
| 158 | Ga0068853_100633677 | 3300005539 | Bacteria | 1017 |
| 159 | Ga0068853_100695828 | 3300005539 | Bacteria | 969 |
| 160 | Ga0068853_100706697 | 3300005539 | Bacteria | 962 |
| 161 | Ga0070672_100010643 | 3300005543 | Bacteria | 6387 |
| 162 | Ga0070672_100052948 | 3300005543 | Bacteria | 3171 |
| 163 | Ga0070672_100082201 | 3300005543 | Bacteria | 2584 |
| 164 | Ga0070672_100114468 | 3300005543 | Bacteria | 2202 |
| 165 | Ga0070672_100490790 | 3300005543 | Bacteria | 1061 |
| 166 | Ga0070672_100592574 | 3300005543 | Bacteria | 965 |
| 167 | Ga0070672_100774780 | 3300005543 | Bacteria | 843 |
| 168 | Ga0070672_100801083 | 3300005543 | Bacteria | 829 |
| 169 | Ga0070686_100007051 | 3300005544 | Bacteria | 6265 |
| 170 | Ga0070686_100109038 | 3300005544 | Bacteria | 1883 |
| 171 | Ga0070695_100313421 | 3300005545 | Bacteria | 1164 |
| 172 | Ga0070695_101495921 | 3300005545 | Bacteria | 562 |
| 173 | Ga0070696_101931150 | 3300005546 | Bacteria | 512 |
| 174 | Ga0070693_100022314 | 3300005547 | Bacteria | 3363 |
| 175 | Ga0070693_100845393 | 3300005547 | Bacteria | 682 |
| 176 | Ga0070693_100934346 | 3300005547 | Bacteria | 652 |
| 177 | Ga0070665_100016657 | 3300005548 | Bacteria | 7366 |
| 178 | Ga0070665_100020139 | 3300005548 | Bacteria | 6698 |
| 179 | Ga0070665_100032024 | 3300005548 | Bacteria | 5292 |
| 180 | Ga0070665_100351881 | 3300005548 | Bacteria | 1479 |
| 181 | Ga0070665_100395406 | 3300005548 | Bacteria | 1390 |
| 182 | Ga0070665_100470272 | 3300005548 | Bacteria | 1268 |
| 183 | Ga0070665_101827868 | 3300005548 | Bacteria | 614 |
| 184 | Ga0070704_100148893 | 3300005549 | Bacteria | 1838 |
| 185 | Ga0070704_100353309 | 3300005549 | Bacteria | 1241 |
| 186 | Ga0068855_100002431 | 3300005563 | Bacteria | 22996 |
| 187 | Ga0068855_100026060 | 3300005563 | Bacteria | 6994 |
| 188 | Ga0068855_100209040 | 3300005563 | Bacteria | 2194 |
| 189 | Ga0068855_101615315 | 3300005563 | Bacteria | 663 |
| 190 | Ga0070664_100000232 | 3300005564 | Bacteria | 39918 |
| 191 | Ga0070664_100002189 | 3300005564 | Bacteria | 15703 |
| 192 | Ga0070664_100006956 | 3300005564 | Bacteria | 9118 |
| 193 | Ga0070664_100042213 | 3300005564 | Bacteria | 3850 |
| 194 | Ga0070664_100093292 | 3300005564 | Bacteria | 2608 |
| 195 | Ga0070664_100212309 | 3300005564 | Bacteria | 1730 |
| 196 | Ga0070664_100290227 | 3300005564 | Bacteria | 1477 |
| 197 | Ga0070664_100635344 | 3300005564 | Bacteria | 991 |
| 198 | Ga0068857_100000150 | 3300005577 | Bacteria | 43268 |
| 199 | Ga0068857_100003300 | 3300005577 | Bacteria | 13405 |
| 200 | Ga0068857_100186323 | 3300005577 | Bacteria | 1889 |
| 201 | Ga0068854_100003871 | 3300005578 | Bacteria | 9380 |
| 202 | Ga0068854_100152640 | 3300005578 | Bacteria | 1782 |
| 203 | Ga0068854_100267591 | 3300005578 | Bacteria | 1371 |
| 204 | Ga0068856_100000121 | 3300005614 | Bacteria | 78250 |
| 205 | Ga0068856_100015939 | 3300005614 | Bacteria | 7266 |
| 206 | Ga0068856_100076208 | 3300005614 | Bacteria | 3323 |
| 207 | Ga0068856_102432301 | 3300005614 | Bacteria | 531 |
| 208 | Ga0070702_100004941 | 3300005615 | Bacteria | 6147 |
| 209 | Ga0070702_100770555 | 3300005615 | Bacteria | 741 |
| 210 | Ga0068852_100002603 | 3300005616 | Bacteria | 12468 |
| 211 | Ga0068852_100002736 | 3300005616 | Bacteria | 12195 |
| 212 | Ga0068852_100011689 | 3300005616 | Bacteria | 6622 |
| 213 | Ga0068852_100023842 | 3300005616 | Bacteria | 4934 |
| 214 | Ga0068852_101303544 | 3300005616 | Bacteria | 748 |
| 215 | Ga0068859_100018722 | 3300005617 | Bacteria | 6957 |
| 216 | Ga0068859_100019845 | 3300005617 | Bacteria | 6747 |
| 217 | Ga0068859_100157800 | 3300005617 | Bacteria | 2347 |
| 218 | Ga0068859_100265691 | 3300005617 | Bacteria | 1808 |
| 219 | Ga0068859_100301763 | 3300005617 | Bacteria | 1695 |
| 220 | Ga0068859_100355500 | 3300005617 | Bacteria | 1560 |
| 221 | Ga0068859_100413201 | 3300005617 | Bacteria | 1445 |
| 222 | Ga0068859_100942312 | 3300005617 | Bacteria | 947 |
| 223 | Ga0068859_101191547 | 3300005617 | Bacteria | 839 |
| 224 | Ga0068864_100002176 | 3300005618 | Bacteria | 16182 |
| 225 | Ga0068864_100002637 | 3300005618 | Bacteria | 14802 |
| 226 | Ga0068864_100004662 | 3300005618 | Bacteria | 11247 |
| 227 | Ga0068864_100255259 | 3300005618 | Bacteria | 1629 |
| 228 | Ga0068864_100628760 | 3300005618 | Bacteria | 1044 |
| 229 | Ga0068864_100719655 | 3300005618 | Bacteria | 976 |
| 230 | Ga0068864_101593077 | 3300005618 | Bacteria | 657 |
| 231 | Ga0068866_10001297 | 3300005718 | Bacteria | 10818 |
| 232 | Ga0068866_10093873 | 3300005718 | Bacteria | 1640 |
| 233 | Ga0068866_10286444 | 3300005718 | Bacteria | 1023 |
| 234 | Ga0068861_100048238 | 3300005719 | Bacteria | 3218 |
| 235 | Ga0068861_100506771 | 3300005719 | Bacteria | 1092 |
| 236 | Ga0068851_10005887 | 3300005834 | Bacteria | 5581 |
| 237 | Ga0068851_10006428 | 3300005834 | Bacteria | 5364 |
| 238 | Ga0068851_10024417 | 3300005834 | Bacteria | 2959 |
| 239 | Ga0068851_10043987 | 3300005834 | Bacteria | 2252 |
| 240 | Ga0068851_10324060 | 3300005834 | Bacteria | 891 |
| 241 | Ga0068870_10001159 | 3300005840 | Bacteria | 10552 |
| 242 | Ga0068870_10593473 | 3300005840 | Bacteria | 752 |
| 243 | Ga0068863_100007864 | 3300005841 | Bacteria | 10424 |
| 244 | Ga0068863_100024596 | 3300005841 | Bacteria | 5743 |
| 245 | Ga0068863_100031853 | 3300005841 | Bacteria | 5029 |
| 246 | Ga0068863_100237836 | 3300005841 | Bacteria | 1758 |
| 247 | Ga0068863_100313834 | 3300005841 | Bacteria | 1522 |
| 248 | Ga0068863_100436622 | 3300005841 | Bacteria | 1284 |
| 249 | Ga0068858_100009634 | 3300005842 | Bacteria | 9206 |
| 250 | Ga0068858_100011839 | 3300005842 | Bacteria | 8224 |
| 251 | Ga0068858_100183034 | 3300005842 | Bacteria | 1979 |
| 252 | Ga0068858_100465717 | 3300005842 | Bacteria | 1219 |
| 253 | Ga0068858_101339869 | 3300005842 | Bacteria | 705 |
| 254 | Ga0068860_100011798 | 3300005843 | Bacteria | 8612 |
| 255 | Ga0068860_100036564 | 3300005843 | Bacteria | 4704 |
| 256 | Ga0068860_100113567 | 3300005843 | Bacteria | 2590 |
| 257 | Ga0068860_100339101 | 3300005843 | Bacteria | 1478 |
| 258 | Ga0068860_100401698 | 3300005843 | Bacteria | 1356 |
| 259 | Ga0068860_101206294 | 3300005843 | Bacteria | 777 |
| 260 | Ga0068860_101386464 | 3300005843 | Bacteria | 724 |
| 261 | Ga0068860_102655485 | 3300005843 | Bacteria | 520 |
| 262 | Ga0068862_100022480 | 3300005844 | Bacteria | 5275 |
| 263 | Ga0068862_100175480 | 3300005844 | Bacteria | 1921 |
| 264 | Ga0068862_100212643 | 3300005844 | Bacteria | 1748 |
| 265 | Ga0068862_100756888 | 3300005844 | Bacteria | 945 |
| 266 | Ga0068862_101822845 | 3300005844 | Bacteria | 618 |
| 267 | Ga0081455_10148316 | 3300005937 | Bacteria | 1811 |
| 268 | Ga0097621_100069324 | 3300006237 | Bacteria | 2912 |
| 269 | Ga0097621_100459162 | 3300006237 | Bacteria | 1148 |
| 270 | Ga0097621_100477861 | 3300006237 | Bacteria | 1126 |
| 271 | Ga0097621_100542543 | 3300006237 | Bacteria | 1058 |
| 272 | Ga0097621_101359390 | 3300006237 | Bacteria | 672 |
| 273 | Ga0068871_100003356 | 3300006358 | Bacteria | 11001 |
| 274 | Ga0068871_100523554 | 3300006358 | Bacteria | 1071 |
| 275 | Ga0075428_100141496 | 3300006844 | Bacteria | 2616 |
| 276 | Ga0075428_100884931 | 3300006844 | Bacteria | 947 |
| 277 | Ga0075428_100961053 | 3300006844 | Bacteria | 905 |
| 278 | Ga0075428_101247171 | 3300006844 | Bacteria | 783 |
| 279 | Ga0075430_100804039 | 3300006846 | Bacteria | 775 |
| 280 | Ga0075431_100193952 | 3300006847 | Bacteria | 2080 |
| 281 | Ga0075431_100266062 | 3300006847 | Bacteria | 1739 |
| 282 | Ga0075431_100284833 | 3300006847 | Bacteria | 1673 |
| 283 | Ga0075433_10078268 | 3300006852 | Bacteria | 2913 |
| 284 | Ga0075433_10326687 | 3300006852 | Bacteria | 1357 |
| 285 | Ga0075433_10813455 | 3300006852 | Bacteria | 816 |
| 286 | Ga0075429_100001466 | 3300006880 | Bacteria | 19392 |
| 287 | Ga0068865_100041607 | 3300006881 | Bacteria | 3128 |
| 288 | Ga0068865_100086000 | 3300006881 | Bacteria | 2269 |
| 289 | Ga0068865_100207213 | 3300006881 | Bacteria | 1526 |
| 290 | Ga0068865_101058502 | 3300006881 | Bacteria | 713 |
| 291 | Ga0075436_100000090 | 3300006914 | Bacteria | 52278 |
| 292 | Ga0075436_100480933 | 3300006914 | Bacteria | 907 |
| 293 | Ga0097620_100018724 | 3300006931 | Bacteria | 6957 |
| 294 | Ga0097620_100019845 | 3300006931 | Bacteria | 6747 |
| 295 | Ga0097620_100157796 | 3300006931 | Bacteria | 2347 |
| 296 | Ga0097620_100265697 | 3300006931 | Bacteria | 1808 |
| 297 | Ga0097620_100301770 | 3300006931 | Bacteria | 1695 |
| 298 | Ga0097620_100355481 | 3300006931 | Bacteria | 1560 |
| 299 | Ga0097620_100413227 | 3300006931 | Bacteria | 1445 |
| 300 | Ga0097620_100942116 | 3300006931 | Bacteria | 947 |
| 301 | Ga0097620_101191387 | 3300006931 | Bacteria | 839 |
| 302 | Ga0075435_100394911 | 3300007076 | Bacteria | 1189 |
| 303 | Ga0075435_100547866 | 3300007076 | Bacteria | 1002 |
| 304 | Ga0075435_100960126 | 3300007076 | Bacteria | 746 |
| 305 | Ga0105240_10012137 | 3300009093 | Bacteria | 11926 |
| 306 | Ga0111539_10019136 | 3300009094 | Bacteria | 8460 |
| 307 | Ga0111539_10028889 | 3300009094 | Bacteria | 6762 |
| 308 | Ga0111539_10605075 | 3300009094 | Bacteria | 1276 |
| 309 | Ga0105245_10225435 | 3300009098 | Bacteria | 1810 |
| 310 | Ga0105245_10387341 | 3300009098 | Bacteria | 1393 |
| 311 | Ga0105245_10723645 | 3300009098 | Bacteria | 1030 |
| 312 | Ga0105245_10938102 | 3300009098 | Bacteria | 908 |
| 313 | Ga0105245_13040858 | 3300009098 | Bacteria | 520 |
| 314 | Ga0105247_10502975 | 3300009101 | Bacteria | 883 |
| 315 | Ga0105247_10549258 | 3300009101 | Bacteria | 849 |
| 316 | Ga0105247_11172083 | 3300009101 | Bacteria | 610 |
| 317 | Ga0114129_10024209 | 3300009147 | Bacteria | 8604 |
| 318 | Ga0105243_10037337 | 3300009148 | Bacteria | 3775 |
| 319 | Ga0105243_10226021 | 3300009148 | Bacteria | 1657 |
| 320 | Ga0105243_11422444 | 3300009148 | Bacteria | 715 |
| 321 | Ga0105241_10159687 | 3300009174 | Bacteria | 1852 |
| 322 | Ga0105241_10710165 | 3300009174 | Bacteria | 918 |
| 323 | Ga0105242_10018528 | 3300009176 | Bacteria | 5445 |
| 324 | Ga0105242_10477994 | 3300009176 | Bacteria | 1180 |
| 325 | Ga0105242_11139547 | 3300009176 | Bacteria | 796 |
| 326 | Ga0105248_10066758 | 3300009177 | Bacteria | 4039 |
| 327 | Ga0105248_10276502 | 3300009177 | Bacteria | 1890 |
| 328 | Ga0105237_10389017 | 3300009545 | Bacteria | 1399 |
| 329 | Ga0105238_10004955 | 3300009551 | Bacteria | 13167 |
| 330 | Ga0105238_11512243 | 3300009551 | Bacteria | 700 |
| 331 | Ga0105249_10042235 | 3300009553 | Bacteria | 4146 |
| 332 | Ga0105249_10080143 | 3300009553 | Bacteria | 3032 |
| 333 | Ga0105249_10633140 | 3300009553 | Bacteria | 1126 |
| 334 | Ga0105239_10368054 | 3300010375 | Bacteria | 1624 |
| 335 | Ga0105239_10457074 | 3300010375 | Bacteria | 1449 |
| 336 | Ga0105239_11112888 | 3300010375 | Bacteria | 909 |
| 337 | Ga0105246_10392365 | 3300011119 | Bacteria | 1150 |
| 338 | Ga0105246_10796343 | 3300011119 | Bacteria | 838 |
| 339 | Ga0157373_10000313 | 3300013100 | Bacteria | 39072 |
| 340 | Ga0157373_10034594 | 3300013100 | Bacteria | 3629 |
| 341 | Ga0157373_10597962 | 3300013100 | Bacteria | 803 |
| 342 | Ga0157371_10001031 | 3300013102 | Bacteria | 30547 |
| 343 | Ga0157371_10056458 | 3300013102 | Bacteria | 2785 |
| 344 | Ga0157370_10021258 | 3300013104 | Bacteria | 6469 |
| 345 | Ga0157370_10457949 | 3300013104 | Bacteria | 1172 |
| 346 | Ga0157369_10010469 | 3300013105 | Bacteria | 10564 |
| 347 | Ga0157369_10044535 | 3300013105 | Bacteria | 4828 |
| 348 | Ga0157374_10000271 | 3300013296 | Bacteria | 48054 |
| 349 | Ga0157374_10016090 | 3300013296 | Bacteria | 6572 |
| 350 | Ga0157374_11035949 | 3300013296 | Bacteria | 840 |
| 351 | Ga0157374_11193868 | 3300013296 | Bacteria | 782 |
| 352 | Ga0157374_11670958 | 3300013296 | Bacteria | 661 |
| 353 | Ga0157374_11877240 | 3300013296 | Bacteria | 625 |
| 354 | Ga0157378_10014211 | 3300013297 | Bacteria | 6967 |
| 355 | Ga0157378_10114479 | 3300013297 | Bacteria | 2477 |
| 356 | Ga0157378_10262576 | 3300013297 | Bacteria | 1657 |
| 357 | Ga0157378_10329130 | 3300013297 | Bacteria | 1486 |
| 358 | Ga0157378_10915896 | 3300013297 | Bacteria | 908 |
| 359 | Ga0157378_11164020 | 3300013297 | Bacteria | 810 |
| 360 | Ga0157378_11857659 | 3300013297 | Bacteria | 651 |
| 361 | Ga0163162_10102069 | 3300013306 | Bacteria | 2961 |
| 362 | Ga0163162_10549619 | 3300013306 | Bacteria | 1283 |
| 363 | Ga0163162_10858323 | 3300013306 | Bacteria | 1023 |
| 364 | Ga0163162_10907284 | 3300013306 | Bacteria | 994 |
| 365 | Ga0163162_11054898 | 3300013306 | Bacteria | 920 |
| 366 | Ga0163162_11598569 | 3300013306 | Bacteria | 744 |
| 367 | Ga0157372_10000985 | 3300013307 | Bacteria | 31124 |
| 368 | Ga0157372_10014220 | 3300013307 | Bacteria | 8506 |
| 369 | Ga0157375_10006967 | 3300013308 | Bacteria | 9870 |
| 370 | Ga0157375_10086744 | 3300013308 | Bacteria | 3181 |
| 371 | Ga0157375_10563236 | 3300013308 | Bacteria | 1300 |
| 372 | Ga0157375_10708975 | 3300013308 | Bacteria | 1160 |
| 373 | Ga0157375_11151346 | 3300013308 | Bacteria | 909 |
| 374 | Ga0157375_11321775 | 3300013308 | Bacteria | 848 |
| 375 | Ga0157375_11724389 | 3300013308 | Bacteria | 742 |
| 376 | Ga0163163_10004614 | 3300014325 | Bacteria | 11764 |
| 377 | Ga0163163_10055514 | 3300014325 | Bacteria | 3915 |
| 378 | Ga0163163_11469032 | 3300014325 | Bacteria | 743 |
| 379 | Ga0157380_10005087 | 3300014326 | Bacteria | 9182 |
| 380 | Ga0157380_10056113 | 3300014326 | Bacteria | 3131 |
| 381 | Ga0157380_10728088 | 3300014326 | Bacteria | 1000 |
| 382 | Ga0157380_11264387 | 3300014326 | Bacteria | 784 |
| 383 | Ga0182008_10118295 | 3300014497 | Bacteria | 1316 |
| 384 | Ga0157377_10004602 | 3300014745 | Bacteria | 6375 |
| 385 | Ga0157377_10281873 | 3300014745 | Bacteria | 1090 |
| 386 | Ga0157377_10956891 | 3300014745 | Bacteria | 645 |
| 387 | Ga0157379_10023535 | 3300014968 | Bacteria | 5467 |
| 388 | Ga0157379_10049691 | 3300014968 | Bacteria | 3745 |
| 389 | Ga0157379_10180925 | 3300014968 | Bacteria | 1905 |
| 390 | Ga0157379_10636543 | 3300014968 | Bacteria | 997 |
| 391 | Ga0157376_10216690 | 3300014969 | Bacteria | 1770 |
| 392 | Ga0157376_10502162 | 3300014969 | Bacteria | 1192 |
| 393 | Ga0163161_10050562 | 3300017792 | Bacteria | 3009 |
| 394 | Ga0163161_10332084 | 3300017792 | Bacteria | 1204 |
| 395 | Ga0163161_10607547 | 3300017792 | Unclassified | 902 |
| 396 | Ga0207666_1000621 | 3300025271 | Bacteria | 4246 |
| 397 | Ga0207673_1004119 | 3300025290 | Bacteria | 1727 |
| 398 | Ga0207697_10007413 | 3300025315 | Bacteria | 4895 |
| 399 | Ga0207697_10013718 | 3300025315 | Bacteria | 3376 |
| 400 | Ga0207697_10017641 | 3300025315 | Bacteria | 2932 |
| 401 | Ga0207656_10004803 | 3300025321 | Bacteria | 4743 |
| 402 | Ga0207656_10006766 | 3300025321 | Bacteria | 4143 |
| 403 | Ga0207656_10072875 | 3300025321 | Bacteria | 1530 |
| 404 | Ga0207656_10182260 | 3300025321 | Bacteria | 1008 |
| 405 | Ga0207656_10308176 | 3300025321 | Bacteria | 785 |
| 406 | Ga0207713_1238909 | 3300025735 | Bacteria | 540 |
| 407 | Ga0207653_10121641 | 3300025885 | Bacteria | 940 |
| 408 | Ga0207682_10000731 | 3300025893 | Bacteria | 15253 |
| 409 | Ga0207682_10001222 | 3300025893 | Bacteria | 11869 |
| 410 | Ga0207682_10164761 | 3300025893 | Bacteria | 1006 |
| 411 | Ga0207642_10034543 | 3300025899 | Bacteria | 2151 |
| 412 | Ga0207642_10070216 | 3300025899 | Bacteria | 1664 |
| 413 | Ga0207642_11028871 | 3300025899 | Bacteria | 531 |
| 414 | Ga0207710_10459065 | 3300025900 | Bacteria | 658 |
| 415 | Ga0207688_10005395 | 3300025901 | Bacteria | 6947 |
| 416 | Ga0207688_10134775 | 3300025901 | Bacteria | 1449 |
| 417 | Ga0207688_10292030 | 3300025901 | Bacteria | 995 |
| 418 | Ga0207688_10408283 | 3300025901 | Bacteria | 843 |
| 419 | Ga0207680_10026583 | 3300025903 | Bacteria | 3210 |
| 420 | Ga0207680_10196791 | 3300025903 | Bacteria | 1371 |
| 421 | Ga0207680_10265174 | 3300025903 | Bacteria | 1190 |
| 422 | Ga0207680_10632500 | 3300025903 | Bacteria | 766 |
| 423 | Ga0207645_10000077 | 3300025907 | Bacteria | 69960 |
| 424 | Ga0207645_10003858 | 3300025907 | Bacteria | 11218 |
| 425 | Ga0207645_10031496 | 3300025907 | Bacteria | 3411 |
| 426 | Ga0207645_10086857 | 3300025907 | Bacteria | 2010 |
| 427 | Ga0207645_10112486 | 3300025907 | Bacteria | 1763 |
| 428 | Ga0207643_10000267 | 3300025908 | Bacteria | 36372 |
| 429 | Ga0207643_10009075 | 3300025908 | Bacteria | 5341 |
| 430 | Ga0207643_10197608 | 3300025908 | Bacteria | 1223 |
| 431 | Ga0207643_10251539 | 3300025908 | Bacteria | 1089 |
| 432 | Ga0207705_10102076 | 3300025909 | Bacteria | 2111 |
| 433 | Ga0207705_10164440 | 3300025909 | Bacteria | 1668 |
| 434 | Ga0207705_11328132 | 3300025909 | Bacteria | 548 |
| 435 | Ga0207705_11345050 | 3300025909 | Bacteria | 544 |
| 436 | Ga0207684_10910169 | 3300025910 | Bacteria | 739 |
| 437 | Ga0207684_11293719 | 3300025910 | Unclassified | 601 |
| 438 | Ga0207654_10078915 | 3300025911 | Bacteria | 1976 |
| 439 | Ga0207695_10030233 | 3300025913 | Bacteria | 5966 |
| 440 | Ga0207671_10262845 | 3300025914 | Bacteria | 1358 |
| 441 | Ga0207663_10362553 | 3300025916 | Bacteria | 1100 |
| 442 | Ga0207660_10241528 | 3300025917 | Bacteria | 1423 |
| 443 | Ga0207662_10006514 | 3300025918 | Bacteria | 6308 |
| 444 | Ga0207662_10454652 | 3300025918 | Bacteria | 876 |
| 445 | Ga0207657_10000995 | 3300025919 | Bacteria | 30092 |
| 446 | Ga0207657_10012006 | 3300025919 | Bacteria | 8567 |
| 447 | Ga0207657_10023022 | 3300025919 | Bacteria | 5812 |
| 448 | Ga0207657_11216459 | 3300025919 | Bacteria | 572 |
| 449 | Ga0207649_10001599 | 3300025920 | Bacteria | 13166 |
| 450 | Ga0207649_10010084 | 3300025920 | Bacteria | 5183 |
| 451 | Ga0207649_10332081 | 3300025920 | Bacteria | 1120 |
| 452 | Ga0207649_10438155 | 3300025920 | Bacteria | 984 |
| 453 | Ga0207652_10096692 | 3300025921 | Bacteria | 2602 |
| 454 | Ga0207646_10739072 | 3300025922 | Bacteria | 878 |
| 455 | Ga0207681_10016081 | 3300025923 | Bacteria | 4674 |
| 456 | Ga0207681_10045524 | 3300025923 | Bacteria | 2946 |
| 457 | Ga0207681_10140279 | 3300025923 | Bacteria | 1799 |
| 458 | Ga0207681_10236080 | 3300025923 | Bacteria | 1421 |
| 459 | Ga0207681_10549388 | 3300025923 | Bacteria | 950 |
| 460 | Ga0207681_10880908 | 3300025923 | Bacteria | 749 |
| 461 | Ga0207694_10006116 | 3300025924 | Bacteria | 9202 |
| 462 | Ga0207650_10001468 | 3300025925 | Bacteria | 16928 |
| 463 | Ga0207650_10002076 | 3300025925 | Bacteria | 14007 |
| 464 | Ga0207650_10018406 | 3300025925 | Bacteria | 4903 |
| 465 | Ga0207650_10050188 | 3300025925 | Bacteria | 3084 |
| 466 | Ga0207650_10192049 | 3300025925 | Bacteria | 1632 |
| 467 | Ga0207650_10256187 | 3300025925 | Bacteria | 1418 |
| 468 | Ga0207650_10876201 | 3300025925 | Bacteria | 762 |
| 469 | Ga0207659_10015519 | 3300025926 | Bacteria | 4938 |
| 470 | Ga0207659_10019297 | 3300025926 | Bacteria | 4485 |
| 471 | Ga0207659_10024323 | 3300025926 | Bacteria | 4056 |
| 472 | Ga0207659_10116057 | 3300025926 | Bacteria | 2043 |
| 473 | Ga0207659_10228355 | 3300025926 | Bacteria | 1500 |
| 474 | Ga0207659_10447171 | 3300025926 | Bacteria | 1088 |
| 475 | Ga0207659_10668894 | 3300025926 | Bacteria | 888 |
| 476 | Ga0207659_10827963 | 3300025926 | Bacteria | 795 |
| 477 | Ga0207687_10241733 | 3300025927 | Bacteria | 1431 |
| 478 | Ga0207687_10264097 | 3300025927 | Bacteria | 1373 |
| 479 | Ga0207664_10004425 | 3300025929 | Bacteria | 9514 |
| 480 | Ga0207644_10003838 | 3300025931 | Bacteria | 9735 |
| 481 | Ga0207644_10045114 | 3300025931 | Bacteria | 3134 |
| 482 | Ga0207644_10051893 | 3300025931 | Bacteria | 2945 |
| 483 | Ga0207644_10196207 | 3300025931 | Bacteria | 1590 |
| 484 | Ga0207644_11369743 | 3300025931 | Bacteria | 594 |
| 485 | Ga0207690_10002015 | 3300025932 | Bacteria | 12446 |
| 486 | Ga0207690_10002295 | 3300025932 | Bacteria | 11669 |
| 487 | Ga0207690_10542396 | 3300025932 | Bacteria | 945 |
| 488 | Ga0207706_10000351 | 3300025933 | Bacteria | 49664 |
| 489 | Ga0207706_10000644 | 3300025933 | Bacteria | 37010 |
| 490 | Ga0207706_10195577 | 3300025933 | Bacteria | 1774 |
| 491 | Ga0207706_10580662 | 3300025933 | Bacteria | 964 |
| 492 | Ga0207686_10011883 | 3300025934 | Bacteria | 4778 |
| 493 | Ga0207686_10208009 | 3300025934 | Bacteria | 1405 |
| 494 | Ga0207686_10895893 | 3300025934 | Bacteria | 716 |
| 495 | Ga0207709_10197535 | 3300025935 | Bacteria | 1434 |
| 496 | Ga0207709_11038912 | 3300025935 | Bacteria | 671 |
| 497 | Ga0207670_10577658 | 3300025936 | Bacteria | 921 |
| 498 | Ga0207670_10816565 | 3300025936 | Bacteria | 777 |
| 499 | Ga0207669_10000673 | 3300025937 | Bacteria | 14737 |
| 500 | Ga0207669_10001618 | 3300025937 | Bacteria | 9580 |
| 501 | Ga0207669_10093030 | 3300025937 | Bacteria | 1969 |
| 502 | Ga0207669_10681769 | 3300025937 | Bacteria | 843 |
| 503 | Ga0207704_10079745 | 3300025938 | Bacteria | 2111 |
| 504 | Ga0207704_10258726 | 3300025938 | Bacteria | 1311 |
| 505 | Ga0207704_10331098 | 3300025938 | Bacteria | 1178 |
| 506 | Ga0207704_10626159 | 3300025938 | Bacteria | 884 |
| 507 | Ga0207691_10000499 | 3300025940 | Bacteria | 39022 |
| 508 | Ga0207691_10007167 | 3300025940 | Bacteria | 10755 |
| 509 | Ga0207691_10057572 | 3300025940 | Bacteria | 3536 |
| 510 | Ga0207691_10112859 | 3300025940 | Bacteria | 2415 |
| 511 | Ga0207691_10117738 | 3300025940 | Bacteria | 2357 |
| 512 | Ga0207691_10282445 | 3300025940 | Bacteria | 1428 |
| 513 | Ga0207691_10961484 | 3300025940 | Bacteria | 713 |
| 514 | Ga0207691_11071093 | 3300025940 | Bacteria | 671 |
| 515 | Ga0207691_11071907 | 3300025940 | Bacteria | 671 |
| 516 | Ga0207691_11330143 | 3300025940 | Bacteria | 593 |
| 517 | Ga0207711_10028179 | 3300025941 | Bacteria | 4725 |
| 518 | Ga0207711_10065246 | 3300025941 | Bacteria | 3147 |
| 519 | Ga0207689_10001154 | 3300025942 | Bacteria | 25407 |
| 520 | Ga0207689_10049737 | 3300025942 | Bacteria | 3458 |
| 521 | Ga0207689_10212191 | 3300025942 | Bacteria | 1600 |
| 522 | Ga0207689_10742948 | 3300025942 | Bacteria | 828 |
| 523 | Ga0207661_10020377 | 3300025944 | Bacteria | 4956 |
| 524 | Ga0207661_10474595 | 3300025944 | Bacteria | 1141 |
| 525 | Ga0207661_10635210 | 3300025944 | Bacteria | 981 |
| 526 | Ga0207679_10006231 | 3300025945 | Bacteria | 7528 |
| 527 | Ga0207679_10014817 | 3300025945 | Bacteria | 5136 |
| 528 | Ga0207679_10018627 | 3300025945 | Bacteria | 4655 |
| 529 | Ga0207679_10118655 | 3300025945 | Bacteria | 2102 |
| 530 | Ga0207679_10801880 | 3300025945 | Bacteria | 858 |
| 531 | Ga0207679_11569957 | 3300025945 | Bacteria | 603 |
| 532 | Ga0207667_10001918 | 3300025949 | Bacteria | 26099 |
| 533 | Ga0207667_10009543 | 3300025949 | Bacteria | 11419 |
| 534 | Ga0207667_10296162 | 3300025949 | Bacteria | 1653 |
| 535 | Ga0207667_11071085 | 3300025949 | Bacteria | 790 |
| 536 | Ga0207651_10020462 | 3300025960 | Bacteria | 3994 |
| 537 | Ga0207651_10033189 | 3300025960 | Bacteria | 3326 |
| 538 | Ga0207651_10062789 | 3300025960 | Bacteria | 2590 |
| 539 | Ga0207651_10346528 | 3300025960 | Bacteria | 1249 |
| 540 | Ga0207651_10478610 | 3300025960 | Bacteria | 1073 |
| 541 | Ga0207651_10582587 | 3300025960 | Bacteria | 976 |
| 542 | Ga0207712_10087166 | 3300025961 | Bacteria | 2289 |
| 543 | Ga0207668_10022978 | 3300025972 | Bacteria | 3999 |
| 544 | Ga0207668_10029010 | 3300025972 | Bacteria | 3623 |
| 545 | Ga0207668_10106152 | 3300025972 | Bacteria | 2097 |
| 546 | Ga0207668_10134880 | 3300025972 | Bacteria | 1890 |
| 547 | Ga0207668_10196695 | 3300025972 | Bacteria | 1602 |
| 548 | Ga0207668_10405630 | 3300025972 | Bacteria | 1153 |
| 549 | Ga0207668_10545310 | 3300025972 | Bacteria | 1004 |
| 550 | Ga0207640_10022374 | 3300025981 | Bacteria | 3782 |
| 551 | Ga0207640_10167130 | 3300025981 | Bacteria | 1635 |
| 552 | Ga0207658_10002918 | 3300025986 | Bacteria | 12240 |
| 553 | Ga0207658_10080416 | 3300025986 | Bacteria | 2496 |
| 554 | Ga0207658_10148288 | 3300025986 | Bacteria | 1908 |
| 555 | Ga0207658_10382099 | 3300025986 | Bacteria | 1234 |
| 556 | Ga0207658_10673874 | 3300025986 | Bacteria | 933 |
| 557 | Ga0207658_10914442 | 3300025986 | Bacteria | 799 |
| 558 | Ga0207677_10014097 | 3300026023 | Bacteria | 4655 |
| 559 | Ga0207677_10074342 | 3300026023 | Bacteria | 2411 |
| 560 | Ga0207677_10130185 | 3300026023 | Bacteria | 1909 |
| 561 | Ga0207677_10615527 | 3300026023 | Bacteria | 954 |
| 562 | Ga0207703_10006351 | 3300026035 | Bacteria | 9447 |
| 563 | Ga0207703_10029206 | 3300026035 | Bacteria | 4349 |
| 564 | Ga0207703_10227974 | 3300026035 | Bacteria | 1669 |
| 565 | Ga0207703_10294263 | 3300026035 | Bacteria | 1478 |
| 566 | Ga0207703_10432352 | 3300026035 | Bacteria | 1227 |
| 567 | Ga0207703_10947339 | 3300026035 | Bacteria | 825 |
| 568 | Ga0207639_10012950 | 3300026041 | Bacteria | 5820 |
| 569 | Ga0207639_10043737 | 3300026041 | Bacteria | 3364 |
| 570 | Ga0207639_10068759 | 3300026041 | Bacteria | 2761 |
| 571 | Ga0207639_10265685 | 3300026041 | Bacteria | 1503 |
| 572 | Ga0207639_11250933 | 3300026041 | Bacteria | 697 |
| 573 | Ga0207678_10002008 | 3300026067 | Bacteria | 18521 |
| 574 | Ga0207678_10008115 | 3300026067 | Bacteria | 9256 |
| 575 | Ga0207678_10131754 | 3300026067 | Bacteria | 2133 |
| 576 | Ga0207678_10211775 | 3300026067 | Bacteria | 1658 |
| 577 | Ga0207678_10557235 | 3300026067 | Bacteria | 1003 |
| 578 | Ga0207708_10013301 | 3300026075 | Bacteria | 6146 |
| 579 | Ga0207708_10496630 | 3300026075 | Bacteria | 1022 |
| 580 | Ga0207708_10677684 | 3300026075 | Bacteria | 880 |
| 581 | Ga0207708_11618776 | 3300026075 | Bacteria | 569 |
| 582 | Ga0207702_10001905 | 3300026078 | Bacteria | 20378 |
| 583 | Ga0207702_10002122 | 3300026078 | Bacteria | 19074 |
| 584 | Ga0207702_10127510 | 3300026078 | Bacteria | 2286 |
| 585 | Ga0207641_10009454 | 3300026088 | Bacteria | 8032 |
| 586 | Ga0207641_10143293 | 3300026088 | Bacteria | 2158 |
| 587 | Ga0207641_10505166 | 3300026088 | Bacteria | 1174 |
| 588 | Ga0207641_10806140 | 3300026088 | Bacteria | 929 |
| 589 | Ga0207648_10000589 | 3300026089 | Bacteria | 40773 |
| 590 | Ga0207648_10007227 | 3300026089 | Bacteria | 10946 |
| 591 | Ga0207648_10043114 | 3300026089 | Bacteria | 3962 |
| 592 | Ga0207648_10612301 | 3300026089 | Bacteria | 1004 |
| 593 | Ga0207648_10632523 | 3300026089 | Bacteria | 988 |
| 594 | Ga0207676_10011120 | 3300026095 | Bacteria | 6425 |
| 595 | Ga0207676_10022772 | 3300026095 | Bacteria | 4611 |
| 596 | Ga0207676_10032647 | 3300026095 | Bacteria | 3925 |
| 597 | Ga0207676_10044387 | 3300026095 | Bacteria | 3429 |
| 598 | Ga0207676_10612502 | 3300026095 | Bacteria | 1047 |
| 599 | Ga0207676_11539202 | 3300026095 | Bacteria | 662 |
| 600 | Ga0207674_10000369 | 3300026116 | Bacteria | 58569 |
| 601 | Ga0207674_10003357 | 3300026116 | Bacteria | 19642 |
| 602 | Ga0207674_10062151 | 3300026116 | Bacteria | 3772 |
| 603 | Ga0207675_100003777 | 3300026118 | Bacteria | 14745 |
| 604 | Ga0207675_100179829 | 3300026118 | Bacteria | 2025 |
| 605 | Ga0207675_100487653 | 3300026118 | Bacteria | 1226 |
| 606 | Ga0207675_100823092 | 3300026118 | Bacteria | 943 |
| 607 | Ga0207675_101976035 | 3300026118 | Bacteria | 601 |
| 608 | Ga0207683_10000280 | 3300026121 | Bacteria | 45558 |
| 609 | Ga0207683_10008777 | 3300026121 | Bacteria | 8631 |
| 610 | Ga0207683_10163908 | 3300026121 | Bacteria | 2011 |
| 611 | Ga0207683_10298674 | 3300026121 | Bacteria | 1473 |
| 612 | Ga0207683_10391339 | 3300026121 | Bacteria | 1278 |
| 613 | Ga0207683_12030082 | 3300026121 | Bacteria | 523 |
| 614 | Ga0207698_10002438 | 3300026142 | Bacteria | 11017 |
| 615 | Ga0207698_10007795 | 3300026142 | Bacteria | 6728 |
| 616 | Ga0207698_10012550 | 3300026142 | Bacteria | 5551 |
| 617 | Ga0207698_10483629 | 3300026142 | Bacteria | 1201 |
| 618 | Ga0207698_10499894 | 3300026142 | Bacteria | 1183 |
| 619 | Ga0207698_10695561 | 3300026142 | Bacteria | 1011 |
| 620 | Ga0207698_10767394 | 3300026142 | Bacteria | 964 |
| 621 | Ga0209969_1012137 | 3300027360 | Bacteria | 1240 |
| 622 | Ga0209981_1020177 | 3300027378 | Bacteria | 949 |
| 623 | Ga0209982_1023254 | 3300027552 | Bacteria | 959 |
| 624 | Ga0210002_1003266 | 3300027617 | Bacteria | 2381 |
| 625 | Ga0209983_1034032 | 3300027665 | Bacteria | 1091 |
| 626 | Ga0209974_10012607 | 3300027876 | Bacteria | 2824 |
| 627 | Ga0268266_10010702 | 3300028379 | Bacteria | 7993 |
| 628 | Ga0268266_10061589 | 3300028379 | Bacteria | 3236 |
| 629 | Ga0268266_10081640 | 3300028379 | Bacteria | 2819 |
| 630 | Ga0268266_10118388 | 3300028379 | Bacteria | 2355 |
| 631 | Ga0268266_10485486 | 3300028379 | Bacteria | 1178 |
| 632 | Ga0268266_10525897 | 3300028379 | Bacteria | 1131 |
| 633 | Ga0268265_10002348 | 3300028380 | Bacteria | 14344 |
| 634 | Ga0268265_10193807 | 3300028380 | Bacteria | 1757 |
| 635 | Ga0268265_10271622 | 3300028380 | Bacteria | 1512 |
| 636 | Ga0268265_10291964 | 3300028380 | Bacteria | 1464 |
| 637 | Ga0268265_11263326 | 3300028380 | Bacteria | 738 |
| 638 | Ga0268265_12235683 | 3300028380 | Bacteria | 554 |
| 639 | Ga0268264_10053919 | 3300028381 | Bacteria | 3356 |
| 640 | Ga0268264_10132723 | 3300028381 | Bacteria | 2210 |
| 641 | Ga0268264_10323419 | 3300028381 | Bacteria | 1459 |
| 642 | Ga0268264_10633718 | 3300028381 | Bacteria | 1056 |
| 643 | Ga0268264_10685940 | 3300028381 | Bacteria | 1016 |
| 644 | Ga0268264_11203575 | 3300028381 | Bacteria | 767 |
| 645 | Ga0307408_100004193 | 3300031548 | Bacteria | 9824 |
| 646 | Ga0307408_100025686 | 3300031548 | Bacteria | 4036 |
| 647 | Ga0307408_100214262 | 3300031548 | Bacteria | 1567 |
| 648 | Ga0307408_101558061 | 3300031548 | Bacteria | 626 |
| 649 | Ga0307408_101964382 | 3300031548 | Bacteria | 562 |
| 650 | Ga0307405_10009760 | 3300031731 | Bacteria | 4936 |
| 651 | Ga0307405_10017861 | 3300031731 | Bacteria | 3902 |
| 652 | Ga0307413_10003113 | 3300031824 | Bacteria | 6910 |
| 653 | Ga0307413_10426152 | 3300031824 | Bacteria | 1046 |
| 654 | Ga0307413_10934435 | 3300031824 | Bacteria | 739 |
| 655 | Ga0307410_10000921 | 3300031852 | Bacteria | 12567 |
| 656 | Ga0307410_10004177 | 3300031852 | Bacteria | 7413 |
| 657 | Ga0307410_10019754 | 3300031852 | Bacteria | 4106 |
| 658 | Ga0307406_10006332 | 3300031901 | Bacteria | 6531 |
| 659 | Ga0307406_10010231 | 3300031901 | Bacteria | 5286 |
| 660 | Ga0307406_10022446 | 3300031901 | Bacteria | 3745 |
| 661 | Ga0307407_10221143 | 3300031903 | Bacteria | 1280 |
| 662 | Ga0307407_10364164 | 3300031903 | Bacteria | 1027 |
| 663 | Ga0307412_10014385 | 3300031911 | Bacteria | 4665 |
| 664 | Ga0307412_10056819 | 3300031911 | Bacteria | 2610 |
| 665 | Ga0307412_10374120 | 3300031911 | Bacteria | 1151 |
| 666 | Ga0307409_100014278 | 3300031995 | Bacteria | 5157 |
| 667 | Ga0307409_100041375 | 3300031995 | Bacteria | 3441 |
| 668 | Ga0307409_100293166 | 3300031995 | Bacteria | 1509 |
| 669 | Ga0307409_100431529 | 3300031995 | Bacteria | 1267 |
| 670 | Ga0307409_100998311 | 3300031995 | Bacteria | 855 |
| 671 | Ga0307409_101370316 | 3300031995 | Bacteria | 733 |
| 672 | Ga0307416_100008070 | 3300032002 | Bacteria | 6750 |
| 673 | Ga0307416_100011450 | 3300032002 | Bacteria | 5917 |
| 674 | Ga0307416_100161589 | 3300032002 | Bacteria | 2071 |
| 675 | Ga0307416_100723920 | 3300032002 | Bacteria | 1086 |
| 676 | Ga0307414_10038539 | 3300032004 | Bacteria | 3211 |
| 677 | Ga0307411_10026945 | 3300032005 | Bacteria | 3468 |
| 678 | Ga0307411_10034405 | 3300032005 | Bacteria | 3153 |
| 679 | Ga0307411_10304856 | 3300032005 | Bacteria | 1279 |
| 680 | Ga0307411_10433224 | 3300032005 | Bacteria | 1095 |
| 681 | Ga0307415_100008244 | 3300032126 | Bacteria | 5766 |
| 682 | Ga0307415_100057098 | 3300032126 | Bacteria | 2680 |
| 683 | Ga0307415_100459567 | 3300032126 | Bacteria | 1103 |
| 684 | Ga0373928_0126764 | 3300035084 | Bacteria | 689 |
| 685 | Ga0373934_0262230 | 3300035086 | Bacteria | 715 |
| 686 | Ga0373939_0011443 | 3300035114 | Bacteria | 2239 |
| 687 | Ga0373939_0268991 | 3300035114 | Bacteria | 669 |
| 688 | Ga0373960_0092328 | 3300035121 | Bacteria | 970 |
| 689 | Ga0373943_0134767 | 3300035170 | Bacteria | 1325 |
| 690 | Ga0373943_0193549 | 3300035170 | Bacteria | 1123 |
| 691 | Ga0373931_0199995 | 3300035691 | Bacteria | 1193 |
| 692 | Ga0373931_0338925 | 3300035691 | Bacteria | 938 |
| 693 | Ga0373931_0417201 | 3300035691 | Bacteria | 853 |
| 694 | Ga0373931_0487697 | 3300035691 | Bacteria | 793 |
| 695 | Ga0373933_0226619 | 3300035724 | Bacteria | 1200 |
| 696 | Ga0373937_0130248 | 3300036401 | Bacteria | 2349 |
| 697 | Ga0373937_1404752 | 3300036401 | Bacteria | 646 |
| 698 | Ga0373925_1106113 | 3300037068 | Bacteria | 652 |
| 699 | Ga0436365_1105890 | 3300039437 | Bacteria | 815 |
| 700 | Ga0451793_0975526 | 3300041452 | Bacteria | 701 |
| 701 | Ga0451849_1474642 | 3300041505 | Bacteria | 557 |
| 702 | Ga0450889_046187 | 3300042144 | Bacteria | 531 |
| 703 | Ga0439435_0053313 | 3300042436 | Bacteria | 1163 |
| 704 | Ga0466963_0400401 | 3300044694 | Bacteria | 968 |
| 705 | Ga0453684_0751244 | 3300044712 | Bacteria | 1056 |
| 706 | Ga0451576_0189580 | 3300045051 | Bacteria | 2147 |
| 707 | Ga0451576_0282070 | 3300045051 | Bacteria | 1737 |
| 708 | Ga0495584_0460235 | 3300046491 | Bacteria | 647 |
| 709 | Ga0495620_0237679 | 3300046515 | Bacteria | 696 |
| 710 | Ga0495642_0036626 | 3300046528 | Bacteria | 1983 |
| 711 | Ga0495642_0200515 | 3300046528 | Bacteria | 870 |
| 712 | Ga0495598_0021341 | 3300046537 | Bacteria | 1722 |
| 713 | Ga0495621_0035684 | 3300046539 | Bacteria | 1723 |
| 714 | Ga0495621_0039462 | 3300046539 | Bacteria | 1651 |
| 715 | Ga0495669_0516472 | 3300046684 | Bacteria | 581 |
| 716 | Ga0496100_0046877 | 3300048903 | Bacteria | 2782 |
| 717 | Ga0496100_0256183 | 3300048903 | Bacteria | 1296 |
| 718 | Ga0496101_0009002 | 3300048904 | Bacteria | 6545 |
| 719 | Ga0496101_0020149 | 3300048904 | Bacteria | 4561 |
| 720 | Ga0496101_0758263 | 3300048904 | Bacteria | 766 |
| 721 | Ga0496102_0002745 | 3300048905 | Bacteria | 15008 |
| 722 | Ga0496104_0011927 | 3300048907 | Bacteria | 7796 |
| 723 | Ga0496105_0045848 | 3300048908 | Bacteria | 3607 |
| 724 | Ga0496105_0451466 | 3300048908 | Bacteria | 1015 |
| 725 | Ga0496106_0002746 | 3300048909 | Bacteria | 13028 |
| 726 | Ga0496106_0036069 | 3300048909 | Bacteria | 3699 |
| 727 | Ga0496106_0505509 | 3300048909 | Bacteria | 971 |
| 728 | Ga0496107_0014219 | 3300048910 | Bacteria | 5573 |
| 729 | Ga0496107_0015023 | 3300048910 | Bacteria | 5424 |
| 730 | Ga0496108_0047549 | 3300048911 | Bacteria | 3586 |
| 731 | Ga0496108_0709071 | 3300048911 | Bacteria | 872 |
| 732 | Ga0496108_1442396 | 3300048911 | Bacteria | 574 |
| 733 | Ga0496109_0003042 | 3300048912 | Bacteria | 13979 |
| 734 | Ga0496109_0156168 | 3300048912 | Bacteria | 2137 |
| 735 | Ga0496109_0662476 | 3300048912 | Bacteria | 981 |
| 736 | Ga0496110_0031041 | 3300048913 | Bacteria | 4609 |
| 737 | Ga0496110_0761389 | 3300048913 | Bacteria | 872 |
| 738 | Ga0496110_1312691 | 3300048913 | Bacteria | 633 |
| 739 | Ga0496110_1373744 | 3300048913 | Bacteria | 616 |
| 740 | Ga0496111_0293967 | 3300048914 | Bacteria | 1204 |
| 741 | Ga0496111_0967940 | 3300048914 | Bacteria | 611 |
| 742 | Ga0496112_0001624 | 3300048915 | Bacteria | 17413 |
| 743 | Ga0496112_1306990 | 3300048915 | Bacteria | 641 |
| 744 | Ga0496113_0184766 | 3300048916 | Bacteria | 1653 |
| 745 | Ga0496114_0013013 | 3300048917 | Bacteria | 6667 |
| 746 | Ga0496114_0311744 | 3300048917 | Bacteria | 1390 |
| 747 | Ga0496115_0336813 | 3300048918 | Bacteria | 1232 |
| 748 | Ga0501299_039631 | 3300049522 | Bacteria | 941 |
| 749 | Ga0501036_0159495 | 3300049572 | Bacteria | 1902 |
| 750 | Ga0501037_0516346 | 3300049573 | Bacteria | 809 |
| 751 | Ga0501038_0510783 | 3300049574 | Bacteria | 918 |
| 752 | Ga0501042_0103549 | 3300049578 | Bacteria | 2048 |
| 753 | Ga0501046_0276807 | 3300049580 | Bacteria | 1230 |
| 754 | Ga0501048_0507070 | 3300049582 | Bacteria | 865 |
| 755 | Ga0501068_0187553 | 3300049584 | Bacteria | 1309 |
| 756 | Ga0501069_0247972 | 3300049585 | Bacteria | 1038 |
| 757 | Ga0501071_0013804 | 3300049587 | Bacteria | 5512 |
| 758 | Ga0501072_0076776 | 3300049588 | Bacteria | 2643 |
| 759 | Ga0501074_0256221 | 3300049590 | Bacteria | 1244 |
| 760 | Ga0501075_0041836 | 3300049591 | Bacteria | 3434 |
| 761 | Ga0501076_0359855 | 3300049592 | Bacteria | 1195 |
| 762 | Ga0501199_070975 | 3300049650 | Bacteria | 500 |
| 763 | Ga0501079_0742699 | 3300049741 | Bacteria | 772 |
| 764 | Ga0501080_0006311 | 3300049742 | Bacteria | 10637 |
| 765 | nmdc:mga05p37_224_c1 | 3300050507 | Bacteria | 57339 |
| 766 | nmdc:mga09592_4452_c1 | 3300050508 | Bacteria | 11337 |
| 767 | nmdc:mga0qj67_885756_c1 | 3300050509 | Bacteria | 704 |
| 768 | nmdc:mga06r32_39490_c1 | 3300050510 | Bacteria | 4478 |
| 769 | nmdc:mga06r32_575548_c1 | 3300050510 | Bacteria | 1099 |
| 770 | nmdc:mga0n895_148965_c1 | 3300050512 | Bacteria | 2369 |
| 771 | nmdc:mga0rr50_381258_c1 | 3300050513 | Bacteria | 1189 |
| 772 | nmdc:mga0rr50_811685_c1 | 3300050513 | Bacteria | 798 |
| 773 | nmdc:mga08x19_281_c1 | 3300050514 | Bacteria | 38370 |
| 774 | nmdc:mga08x19_480139_c1 | 3300050514 | Bacteria | 876 |
| 775 | nmdc:mga0a205_137424_c1 | 3300050515 | Bacteria | 2344 |
| 776 | nmdc:mga0a205_832073_c1 | 3300050515 | Bacteria | 770 |
| 777 | Ga0501084_0239283 | 3300054114 | Bacteria | 1532 |
| 778 | Ga0501082_0174480 | 3300060353 | Bacteria | 1869 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100522552 | Ga0070707_1005225522 | 89 |
| 2 | 3300005518 | Ga0070699_100865217 | Ga0070699_1008652172 | 89 |
| 3 | 3300006844 | Ga0075428_100141496 | Ga0075428_1001414962 | 89 |
| 4 | 3300006847 | Ga0075431_100266062 | Ga0075431_1002660622 | 89 |
| 5 | 3300006880 | Ga0075429_100001466 | Ga0075429_1000014667 | 89 |
| 6 | 3300010375 | Ga0105239_11112888 | Ga0105239_111128881 | 90 |
| 7 | 3300013296 | Ga0157374_10000271 | Ga0157374_1000027145 | 90 |
| 8 | 3300013297 | Ga0157378_11857659 | Ga0157378_118576591 | 90 |
| 9 | 3300041505 | Ga0451849_1474642 | Ga0451849_1474642_158_466 | 102 |
| 10 | 3300035170 | Ga0373943_0134767 | Ga0373943_0134767_100_423 | 103 |
| 11 | 3300031548 | Ga0307408_100214262 | Ga0307408_1002142621 | 104 |
| 12 | 3300031824 | Ga0307413_10426152 | Ga0307413_104261522 | 104 |
| 13 | 3300031852 | Ga0307410_10019754 | Ga0307410_100197543 | 104 |
| 14 | 3300031901 | Ga0307406_10022446 | Ga0307406_100224462 | 104 |
| 15 | 3300031911 | Ga0307412_10374120 | Ga0307412_103741202 | 104 |
| 16 | 3300031995 | Ga0307409_100041375 | Ga0307409_1000413753 | 104 |
| 17 | 3300031995 | Ga0307409_100431529 | Ga0307409_1004315291 | 104 |
| 18 | 3300031995 | Ga0307409_101370316 | Ga0307409_1013703162 | 104 |
| 19 | 3300032002 | Ga0307416_100161589 | Ga0307416_1001615892 | 104 |
| 20 | 3300032005 | Ga0307411_10304856 | Ga0307411_103048562 | 104 |
| 21 | 3300032005 | Ga0307411_10433224 | Ga0307411_104332242 | 104 |
| 22 | 3300039437 | Ga0436365_1105890 | Ga0436365_1105890_106_429 | 104 |
| 23 | 3300049573 | Ga0501037_0516346 | Ga0501037_0516346_448_768 | 104 |
| 24 | 3300049574 | Ga0501038_0510783 | Ga0501038_0510783_272_592 | 104 |
| 25 | 3300049578 | Ga0501042_0103549 | Ga0501042_0103549_1356_1676 | 104 |
| 26 | 3300049580 | Ga0501046_0276807 | Ga0501046_0276807_345_665 | 104 |
| 27 | 3300049582 | Ga0501048_0507070 | Ga0501048_0507070_284_604 | 104 |
| 28 | 3300049584 | Ga0501068_0187553 | Ga0501068_0187553_196_516 | 104 |
| 29 | 3300049585 | Ga0501069_0247972 | Ga0501069_0247972_159_482 | 104 |
| 30 | 3300049587 | Ga0501071_0013804 | Ga0501071_0013804_3838_4158 | 104 |
| 31 | 3300049588 | Ga0501072_0076776 | Ga0501072_0076776_2130_2450 | 104 |
| 32 | 3300049590 | Ga0501074_0256221 | Ga0501074_0256221_239_559 | 104 |
| 33 | 3300049591 | Ga0501075_0041836 | Ga0501075_0041836_2104_2424 | 104 |
| 34 | 3300049592 | Ga0501076_0359855 | Ga0501076_0359855_583_903 | 104 |
| 35 | 3300049741 | Ga0501079_0742699 | Ga0501079_0742699_357_677 | 104 |
| 36 | 3300049742 | Ga0501080_0006311 | Ga0501080_0006311_2741_3061 | 104 |
| 37 | 3300054114 | Ga0501084_0239283 | Ga0501084_0239283_392_712 | 104 |
| 38 | 3300060353 | Ga0501082_0174480 | Ga0501082_0174480_633_953 | 104 |
| 39 | 3300005327 | Ga0070658_10849234 | Ga0070658_108492342 | 105 |
| 40 | 3300005444 | Ga0070694_100347937 | Ga0070694_1003479372 | 105 |
| 41 | 3300005518 | Ga0070699_100009041 | Ga0070699_1000090417 | 105 |
| 42 | 3300005518 | Ga0070699_100071189 | Ga0070699_1000711893 | 105 |
| 43 | 3300005539 | Ga0068853_100695828 | Ga0068853_1006958282 | 105 |
| 44 | 3300005548 | Ga0070665_101827868 | Ga0070665_1018278681 | 105 |
| 45 | 3300005549 | Ga0070704_100353309 | Ga0070704_1003533091 | 105 |
| 46 | 3300005843 | Ga0068860_102655485 | Ga0068860_1026554851 | 105 |
| 47 | 3300006914 | Ga0075436_100000090 | Ga0075436_10000009018 | 105 |
| 48 | 3300009098 | Ga0105245_13040858 | Ga0105245_130408582 | 105 |
| 49 | 3300025909 | Ga0207705_11328132 | Ga0207705_113281321 | 105 |
| 50 | 3300025910 | Ga0207684_11293719 | Ga0207684_112937192 | 105 |
| 51 | 3300025940 | Ga0207691_11330143 | Ga0207691_113301431 | 105 |
| 52 | 3300031548 | Ga0307408_100025686 | Ga0307408_1000256864 | 105 |
| 53 | 3300031731 | Ga0307405_10017861 | Ga0307405_100178612 | 105 |
| 54 | 3300031852 | Ga0307410_10004177 | Ga0307410_100041771 | 105 |
| 55 | 3300031901 | Ga0307406_10010231 | Ga0307406_100102315 | 105 |
| 56 | 3300031903 | Ga0307407_10364164 | Ga0307407_103641642 | 105 |
| 57 | 3300031911 | Ga0307412_10014385 | Ga0307412_100143852 | 105 |
| 58 | 3300031995 | Ga0307409_100293166 | Ga0307409_1002931662 | 105 |
| 59 | 3300032002 | Ga0307416_100011450 | Ga0307416_1000114505 | 105 |
| 60 | 3300032004 | Ga0307414_10038539 | Ga0307414_100385392 | 105 |
| 61 | 3300032005 | Ga0307411_10026945 | Ga0307411_100269452 | 105 |
| 62 | 3300032126 | Ga0307415_100057098 | Ga0307415_1000570982 | 105 |
| 63 | 3300046491 | Ga0495584_0460235 | Ga0495584_0460235_132_455 | 105 |
| 64 | 3300046528 | Ga0495642_0036626 | Ga0495642_0036626_422_745 | 105 |
| 65 | 3300046539 | Ga0495621_0039462 | Ga0495621_0039462_470_793 | 105 |
| 66 | 3300046684 | Ga0495669_0516472 | Ga0495669_0516472_189_512 | 105 |
| 67 | 3300049572 | Ga0501036_0159495 | Ga0501036_0159495_1539_1862 | 105 |
| 68 | 3300050514 | nmdc:mga08x19_281_c1 | nmdc:mga08x19_281_c1_22255_22578 | 105 |
| 69 | 3300005340 | Ga0070689_100276146 | Ga0070689_1002761462 | 106 |
| 70 | 3300005438 | Ga0070701_11139293 | Ga0070701_111392931 | 106 |
| 71 | 3300005441 | Ga0070700_100217688 | Ga0070700_1002176882 | 106 |
| 72 | 3300005456 | Ga0070678_100867969 | Ga0070678_1008679692 | 106 |
| 73 | 3300005535 | Ga0070684_101743373 | Ga0070684_1017433732 | 106 |
| 74 | 3300005539 | Ga0068853_100633677 | Ga0068853_1006336772 | 106 |
| 75 | 3300005545 | Ga0070695_101495921 | Ga0070695_1014959211 | 106 |
| 76 | 3300005615 | Ga0070702_100770555 | Ga0070702_1007705551 | 106 |
| 77 | 3300005616 | Ga0068852_101303544 | Ga0068852_1013035442 | 106 |
| 78 | 3300005617 | Ga0068859_100301763 | Ga0068859_1003017631 | 106 |
| 79 | 3300006237 | Ga0097621_100477861 | Ga0097621_1004778611 | 106 |
| 80 | 3300006844 | Ga0075428_101247171 | Ga0075428_1012471712 | 106 |
| 81 | 3300006881 | Ga0068865_101058502 | Ga0068865_1010585022 | 106 |
| 82 | 3300006914 | Ga0075436_100480933 | Ga0075436_1004809332 | 106 |
| 83 | 3300006931 | Ga0097620_100301770 | Ga0097620_1003017702 | 106 |
| 84 | 3300007076 | Ga0075435_100960126 | Ga0075435_1009601262 | 106 |
| 85 | 3300009098 | Ga0105245_10723645 | Ga0105245_107236452 | 106 |
| 86 | 3300009148 | Ga0105243_11422444 | Ga0105243_114224442 | 106 |
| 87 | 3300025735 | Ga0207713_1238909 | Ga0207713_12389091 | 106 |
| 88 | 3300025908 | Ga0207643_10251539 | Ga0207643_102515392 | 106 |
| 89 | 3300025927 | Ga0207687_10264097 | Ga0207687_102640972 | 106 |
| 90 | 3300025934 | Ga0207686_10011883 | Ga0207686_100118832 | 106 |
| 91 | 3300025935 | Ga0207709_11038912 | Ga0207709_110389122 | 106 |
| 92 | 3300025938 | Ga0207704_10626159 | Ga0207704_106261592 | 106 |
| 93 | 3300025942 | Ga0207689_10742948 | Ga0207689_107429482 | 106 |
| 94 | 3300026041 | Ga0207639_10265685 | Ga0207639_102656852 | 106 |
| 95 | 3300026142 | Ga0207698_10483629 | Ga0207698_104836292 | 106 |
| 96 | 3300031548 | Ga0307408_101558061 | Ga0307408_1015580612 | 106 |
| 97 | 3300032002 | Ga0307416_100723920 | Ga0307416_1007239202 | 106 |
| 98 | 3300035084 | Ga0373928_0126764 | Ga0373928_0126764_276_602 | 106 |
| 99 | 3300035086 | Ga0373934_0262230 | Ga0373934_0262230_182_508 | 106 |
| 100 | 3300035691 | Ga0373931_0338925 | Ga0373931_0338925_31_357 | 106 |
| 101 | 3300035691 | Ga0373931_0417201 | Ga0373931_0417201_298_618 | 106 |
| 102 | 3300035724 | Ga0373933_0226619 | Ga0373933_0226619_416_742 | 106 |
| 103 | 3300036401 | Ga0373937_0130248 | Ga0373937_0130248_1587_1913 | 106 |
| 104 | 3300036401 | Ga0373937_1404752 | Ga0373937_1404752_220_546 | 106 |
| 105 | 3300049522 | Ga0501299_039631 | Ga0501299_039631_21_347 | 106 |
| 106 | 3300049650 | Ga0501199_070975 | Ga0501199_070975_38_364 | 106 |
| 107 | 3300050513 | nmdc:mga0rr50_811685_c1 | nmdc:mga0rr50_811685_c1_311_637 | 106 |
| 108 | 3300050514 | nmdc:mga08x19_480139_c1 | nmdc:mga08x19_480139_c1_38_364 | 106 |
| 109 | 3300005295 | Ga0065707_10105687 | Ga0065707_101056872 | 107 |
| 110 | 3300005328 | Ga0070676_10397613 | Ga0070676_103976132 | 107 |
| 111 | 3300005331 | Ga0070670_100230820 | Ga0070670_1002308202 | 107 |
| 112 | 3300005333 | Ga0070677_10097094 | Ga0070677_100970942 | 107 |
| 113 | 3300005334 | Ga0068869_100595003 | Ga0068869_1005950032 | 107 |
| 114 | 3300005340 | Ga0070689_101182021 | Ga0070689_1011820211 | 107 |
| 115 | 3300005347 | Ga0070668_100238673 | Ga0070668_1002386732 | 107 |
| 116 | 3300005353 | Ga0070669_100126570 | Ga0070669_1001265702 | 107 |
| 117 | 3300005354 | Ga0070675_100014792 | Ga0070675_1000147924 | 107 |
| 118 | 3300005356 | Ga0070674_100260584 | Ga0070674_1002605842 | 107 |
| 119 | 3300005364 | Ga0070673_100051153 | Ga0070673_1000511533 | 107 |
| 120 | 3300005367 | Ga0070667_100050280 | Ga0070667_1000502802 | 107 |
| 121 | 3300005367 | Ga0070667_101162333 | Ga0070667_1011623332 | 107 |
| 122 | 3300005440 | Ga0070705_100101466 | Ga0070705_1001014662 | 107 |
| 123 | 3300005441 | Ga0070700_100107535 | Ga0070700_1001075352 | 107 |
| 124 | 3300005441 | Ga0070700_101032621 | Ga0070700_1010326212 | 107 |
| 125 | 3300005444 | Ga0070694_100082265 | Ga0070694_1000822652 | 107 |
| 126 | 3300005456 | Ga0070678_100247261 | Ga0070678_1002472612 | 107 |
| 127 | 3300005456 | Ga0070678_101997501 | Ga0070678_1019975012 | 107 |
| 128 | 3300005459 | Ga0068867_100337860 | Ga0068867_1003378602 | 107 |
| 129 | 3300005466 | Ga0070685_10303707 | Ga0070685_103037071 | 107 |
| 130 | 3300005471 | Ga0070698_100010362 | Ga0070698_1000103628 | 107 |
| 131 | 3300005544 | Ga0070686_100109038 | Ga0070686_1001090382 | 107 |
| 132 | 3300005545 | Ga0070695_100313421 | Ga0070695_1003134212 | 107 |
| 133 | 3300005548 | Ga0070665_100470272 | Ga0070665_1004702722 | 107 |
| 134 | 3300005549 | Ga0070704_100148893 | Ga0070704_1001488932 | 107 |
| 135 | 3300005617 | Ga0068859_100019845 | Ga0068859_1000198452 | 107 |
| 136 | 3300005617 | Ga0068859_100157800 | Ga0068859_1001578003 | 107 |
| 137 | 3300005617 | Ga0068859_100355500 | Ga0068859_1003555002 | 107 |
| 138 | 3300005617 | Ga0068859_100413201 | Ga0068859_1004132012 | 107 |
| 139 | 3300005617 | Ga0068859_101191547 | Ga0068859_1011915472 | 107 |
| 140 | 3300005618 | Ga0068864_100719655 | Ga0068864_1007196552 | 107 |
| 141 | 3300005842 | Ga0068858_100009634 | Ga0068858_1000096343 | 107 |
| 142 | 3300005843 | Ga0068860_100401698 | Ga0068860_1004016982 | 107 |
| 143 | 3300005844 | Ga0068862_100022480 | Ga0068862_1000224804 | 107 |
| 144 | 3300005844 | Ga0068862_100212643 | Ga0068862_1002126432 | 107 |
| 145 | 3300005844 | Ga0068862_101822845 | Ga0068862_1018228452 | 107 |
| 146 | 3300006844 | Ga0075428_100961053 | Ga0075428_1009610532 | 107 |
| 147 | 3300006847 | Ga0075431_100193952 | Ga0075431_1001939522 | 107 |
| 148 | 3300006847 | Ga0075431_100284833 | Ga0075431_1002848332 | 107 |
| 149 | 3300006852 | Ga0075433_10078268 | Ga0075433_100782682 | 107 |
| 150 | 3300006852 | Ga0075433_10326687 | Ga0075433_103266872 | 107 |
| 151 | 3300006931 | Ga0097620_100019845 | Ga0097620_1000198452 | 107 |
| 152 | 3300006931 | Ga0097620_100157796 | Ga0097620_1001577962 | 107 |
| 153 | 3300006931 | Ga0097620_100355481 | Ga0097620_1003554812 | 107 |
| 154 | 3300006931 | Ga0097620_100413227 | Ga0097620_1004132272 | 107 |
| 155 | 3300006931 | Ga0097620_101191387 | Ga0097620_1011913872 | 107 |
| 156 | 3300009094 | Ga0111539_10028889 | Ga0111539_100288896 | 107 |
| 157 | 3300009101 | Ga0105247_10502975 | Ga0105247_105029752 | 107 |
| 158 | 3300009147 | Ga0114129_10024209 | Ga0114129_100242098 | 107 |
| 159 | 3300009148 | Ga0105243_10226021 | Ga0105243_102260212 | 107 |
| 160 | 3300009176 | Ga0105242_10018528 | Ga0105242_100185285 | 107 |
| 161 | 3300009176 | Ga0105242_10477994 | Ga0105242_104779942 | 107 |
| 162 | 3300009177 | Ga0105248_10276502 | Ga0105248_102765022 | 107 |
| 163 | 3300009553 | Ga0105249_10080143 | Ga0105249_100801431 | 107 |
| 164 | 3300009553 | Ga0105249_10633140 | Ga0105249_106331402 | 107 |
| 165 | 3300013296 | Ga0157374_11670958 | Ga0157374_116709582 | 107 |
| 166 | 3300013297 | Ga0157378_10915896 | Ga0157378_109158961 | 107 |
| 167 | 3300013306 | Ga0163162_10907284 | Ga0163162_109072842 | 107 |
| 168 | 3300013306 | Ga0163162_11598569 | Ga0163162_115985692 | 107 |
| 169 | 3300013308 | Ga0157375_11151346 | Ga0157375_111513461 | 107 |
| 170 | 3300013308 | Ga0157375_11724389 | Ga0157375_117243891 | 107 |
| 171 | 3300014326 | Ga0157380_10056113 | Ga0157380_100561132 | 107 |
| 172 | 3300014745 | Ga0157377_10956891 | Ga0157377_109568911 | 107 |
| 173 | 3300014968 | Ga0157379_10023535 | Ga0157379_100235354 | 107 |
| 174 | 3300017792 | Ga0163161_10607547 | Ga0163161_106075472 | 107 |
| 175 | 3300025885 | Ga0207653_10121641 | Ga0207653_101216412 | 107 |
| 176 | 3300025910 | Ga0207684_10910169 | Ga0207684_109101692 | 107 |
| 177 | 3300025918 | Ga0207662_10454652 | Ga0207662_104546522 | 107 |
| 178 | 3300025923 | Ga0207681_10549388 | Ga0207681_105493882 | 107 |
| 179 | 3300025925 | Ga0207650_10256187 | Ga0207650_102561872 | 107 |
| 180 | 3300025926 | Ga0207659_10116057 | Ga0207659_101160572 | 107 |
| 181 | 3300025926 | Ga0207659_10827963 | Ga0207659_108279632 | 107 |
| 182 | 3300025934 | Ga0207686_10208009 | Ga0207686_102080092 | 107 |
| 183 | 3300025935 | Ga0207709_10197535 | Ga0207709_101975352 | 107 |
| 184 | 3300025936 | Ga0207670_10577658 | Ga0207670_105776581 | 107 |
| 185 | 3300025938 | Ga0207704_10258726 | Ga0207704_102587262 | 107 |
| 186 | 3300025940 | Ga0207691_10117738 | Ga0207691_101177382 | 107 |
| 187 | 3300025960 | Ga0207651_10033189 | Ga0207651_100331893 | 107 |
| 188 | 3300025972 | Ga0207668_10405630 | Ga0207668_104056302 | 107 |
| 189 | 3300025986 | Ga0207658_10080416 | Ga0207658_100804162 | 107 |
| 190 | 3300026035 | Ga0207703_10006351 | Ga0207703_100063517 | 107 |
| 191 | 3300026035 | Ga0207703_10294263 | Ga0207703_102942632 | 107 |
| 192 | 3300026075 | Ga0207708_10496630 | Ga0207708_104966302 | 107 |
| 193 | 3300026075 | Ga0207708_11618776 | Ga0207708_116187761 | 107 |
| 194 | 3300026116 | Ga0207674_10062151 | Ga0207674_100621513 | 107 |
| 195 | 3300026121 | Ga0207683_10391339 | Ga0207683_103913392 | 107 |
| 196 | 3300027360 | Ga0209969_1012137 | Ga0209969_10121372 | 107 |
| 197 | 3300027665 | Ga0209983_1034032 | Ga0209983_10340322 | 107 |
| 198 | 3300028379 | Ga0268266_10485486 | Ga0268266_104854862 | 107 |
| 199 | 3300028380 | Ga0268265_10002348 | Ga0268265_1000234813 | 107 |
| 200 | 3300028380 | Ga0268265_12235683 | Ga0268265_122356831 | 107 |
| 201 | 3300035114 | Ga0373939_0011443 | Ga0373939_0011443_122_451 | 107 |
| 202 | 3300035114 | Ga0373939_0268991 | Ga0373939_0268991_305_634 | 107 |
| 203 | 3300042436 | Ga0439435_0053313 | Ga0439435_0053313_555_884 | 107 |
| 204 | 3300044712 | Ga0453684_0751244 | Ga0453684_0751244_531_860 | 107 |
| 205 | 3300045051 | Ga0451576_0189580 | Ga0451576_0189580_669_998 | 107 |
| 206 | 3300045051 | Ga0451576_0282070 | Ga0451576_0282070_590_919 | 107 |
| 207 | 3300050510 | nmdc:mga06r32_39490_c1 | nmdc:mga06r32_39490_c1_1558_1887 | 107 |
| 208 | 3300050512 | nmdc:mga0n895_148965_c1 | nmdc:mga0n895_148965_c1_886_1215 | 107 |
| 209 | 3300050515 | nmdc:mga0a205_137424_c1 | nmdc:mga0a205_137424_c1_503_832 | 107 |
| 210 | 3300001976 | JGI24752J21851_1003457 | JGI24752J21851_10034572 | 108 |
| 211 | 3300001991 | JGI24743J22301_10008236 | JGI24743J22301_100082363 | 108 |
| 212 | 3300002126 | JGI24035J26624_1004929 | JGI24035J26624_10049292 | 108 |
| 213 | 3300002155 | JGI24033J26618_1008168 | JGI24033J26618_10081681 | 108 |
| 214 | 3300002459 | JGI24751J29686_10060056 | JGI24751J29686_100600561 | 108 |
| 215 | 3300005288 | Ga0065714_10199405 | Ga0065714_101994052 | 108 |
| 216 | 3300005290 | Ga0065712_10097071 | Ga0065712_100970712 | 108 |
| 217 | 3300005290 | Ga0065712_10422768 | Ga0065712_104227681 | 108 |
| 218 | 3300005293 | Ga0065715_10226336 | Ga0065715_102263361 | 108 |
| 219 | 3300005293 | Ga0065715_11101890 | Ga0065715_111018901 | 108 |
| 220 | 3300005293 | Ga0065715_11108883 | Ga0065715_111088831 | 108 |
| 221 | 3300005327 | Ga0070658_10271339 | Ga0070658_102713392 | 108 |
| 222 | 3300005327 | Ga0070658_11398776 | Ga0070658_113987761 | 108 |
| 223 | 3300005328 | Ga0070676_10001503 | Ga0070676_1000150312 | 108 |
| 224 | 3300005328 | Ga0070676_10022086 | Ga0070676_100220864 | 108 |
| 225 | 3300005328 | Ga0070676_10108116 | Ga0070676_101081162 | 108 |
| 226 | 3300005328 | Ga0070676_10137267 | Ga0070676_101372672 | 108 |
| 227 | 3300005328 | Ga0070676_10696366 | Ga0070676_106963661 | 108 |
| 228 | 3300005329 | Ga0070683_100012394 | Ga0070683_1000123944 | 108 |
| 229 | 3300005329 | Ga0070683_100393919 | Ga0070683_1003939191 | 108 |
| 230 | 3300005330 | Ga0070690_100001622 | Ga0070690_1000016223 | 108 |
| 231 | 3300005330 | Ga0070690_100634905 | Ga0070690_1006349052 | 108 |
| 232 | 3300005331 | Ga0070670_100016035 | Ga0070670_1000160357 | 108 |
| 233 | 3300005331 | Ga0070670_100072954 | Ga0070670_1000729542 | 108 |
| 234 | 3300005331 | Ga0070670_100093166 | Ga0070670_1000931663 | 108 |
| 235 | 3300005331 | Ga0070670_100628932 | Ga0070670_1006289322 | 108 |
| 236 | 3300005331 | Ga0070670_101109651 | Ga0070670_1011096511 | 108 |
| 237 | 3300005331 | Ga0070670_101501057 | Ga0070670_1015010571 | 108 |
| 238 | 3300005333 | Ga0070677_10001330 | Ga0070677_100013302 | 108 |
| 239 | 3300005333 | Ga0070677_10004494 | Ga0070677_100044944 | 108 |
| 240 | 3300005333 | Ga0070677_10443595 | Ga0070677_104435952 | 108 |
| 241 | 3300005334 | Ga0068869_100020382 | Ga0068869_1000203823 | 108 |
| 242 | 3300005334 | Ga0068869_100147320 | Ga0068869_1001473202 | 108 |
| 243 | 3300005334 | Ga0068869_100579201 | Ga0068869_1005792012 | 108 |
| 244 | 3300005335 | Ga0070666_10022208 | Ga0070666_100222083 | 108 |
| 245 | 3300005335 | Ga0070666_10060883 | Ga0070666_100608832 | 108 |
| 246 | 3300005335 | Ga0070666_10600454 | Ga0070666_106004542 | 108 |
| 247 | 3300005335 | Ga0070666_10966195 | Ga0070666_109661951 | 108 |
| 248 | 3300005336 | Ga0070680_100155969 | Ga0070680_1001559692 | 108 |
| 249 | 3300005336 | Ga0070680_100306037 | Ga0070680_1003060372 | 108 |
| 250 | 3300005338 | Ga0068868_100007221 | Ga0068868_1000072213 | 108 |
| 251 | 3300005338 | Ga0068868_100073739 | Ga0068868_1000737392 | 108 |
| 252 | 3300005338 | Ga0068868_100168787 | Ga0068868_1001687872 | 108 |
| 253 | 3300005338 | Ga0068868_100609707 | Ga0068868_1006097072 | 108 |
| 254 | 3300005338 | Ga0068868_100809299 | Ga0068868_1008092992 | 108 |
| 255 | 3300005338 | Ga0068868_101106070 | Ga0068868_1011060702 | 108 |
| 256 | 3300005339 | Ga0070660_100006963 | Ga0070660_1000069632 | 108 |
| 257 | 3300005339 | Ga0070660_100009658 | Ga0070660_1000096589 | 108 |
| 258 | 3300005339 | Ga0070660_100010635 | Ga0070660_1000106356 | 108 |
| 259 | 3300005339 | Ga0070660_100027115 | Ga0070660_1000271152 | 108 |
| 260 | 3300005340 | Ga0070689_100004833 | Ga0070689_1000048335 | 108 |
| 261 | 3300005340 | Ga0070689_100733193 | Ga0070689_1007331931 | 108 |
| 262 | 3300005340 | Ga0070689_101621971 | Ga0070689_1016219711 | 108 |
| 263 | 3300005343 | Ga0070687_100056484 | Ga0070687_1000564842 | 108 |
| 264 | 3300005344 | Ga0070661_100002676 | Ga0070661_1000026763 | 108 |
| 265 | 3300005344 | Ga0070661_100012213 | Ga0070661_1000122132 | 108 |
| 266 | 3300005344 | Ga0070661_100013146 | Ga0070661_1000131462 | 108 |
| 267 | 3300005344 | Ga0070661_100925427 | Ga0070661_1009254272 | 108 |
| 268 | 3300005345 | Ga0070692_10794126 | Ga0070692_107941262 | 108 |
| 269 | 3300005347 | Ga0070668_100012194 | Ga0070668_1000121944 | 108 |
| 270 | 3300005347 | Ga0070668_100016206 | Ga0070668_1000162064 | 108 |
| 271 | 3300005347 | Ga0070668_100023760 | Ga0070668_1000237603 | 108 |
| 272 | 3300005347 | Ga0070668_100122516 | Ga0070668_1001225162 | 108 |
| 273 | 3300005353 | Ga0070669_100030011 | Ga0070669_1000300114 | 108 |
| 274 | 3300005353 | Ga0070669_100070320 | Ga0070669_1000703202 | 108 |
| 275 | 3300005353 | Ga0070669_100348886 | Ga0070669_1003488862 | 108 |
| 276 | 3300005353 | Ga0070669_100757969 | Ga0070669_1007579691 | 108 |
| 277 | 3300005353 | Ga0070669_101177328 | Ga0070669_1011773282 | 108 |
| 278 | 3300005354 | Ga0070675_100002777 | Ga0070675_1000027773 | 108 |
| 279 | 3300005354 | Ga0070675_100004574 | Ga0070675_1000045742 | 108 |
| 280 | 3300005354 | Ga0070675_100055887 | Ga0070675_1000558872 | 108 |
| 281 | 3300005354 | Ga0070675_100113668 | Ga0070675_1001136682 | 108 |
| 282 | 3300005354 | Ga0070675_100785532 | Ga0070675_1007855322 | 108 |
| 283 | 3300005354 | Ga0070675_101687151 | Ga0070675_1016871512 | 108 |
| 284 | 3300005354 | Ga0070675_101992123 | Ga0070675_1019921231 | 108 |
| 285 | 3300005355 | Ga0070671_100010529 | Ga0070671_1000105294 | 108 |
| 286 | 3300005355 | Ga0070671_100026435 | Ga0070671_1000264352 | 108 |
| 287 | 3300005355 | Ga0070671_100085895 | Ga0070671_1000858953 | 108 |
| 288 | 3300005355 | Ga0070671_100282724 | Ga0070671_1002827241 | 108 |
| 289 | 3300005356 | Ga0070674_100005067 | Ga0070674_1000050677 | 108 |
| 290 | 3300005356 | Ga0070674_100189417 | Ga0070674_1001894172 | 108 |
| 291 | 3300005356 | Ga0070674_100957238 | Ga0070674_1009572382 | 108 |
| 292 | 3300005364 | Ga0070673_100001510 | Ga0070673_10000151012 | 108 |
| 293 | 3300005364 | Ga0070673_100030213 | Ga0070673_1000302132 | 108 |
| 294 | 3300005364 | Ga0070673_100111726 | Ga0070673_1001117262 | 108 |
| 295 | 3300005364 | Ga0070673_100115868 | Ga0070673_1001158682 | 108 |
| 296 | 3300005365 | Ga0070688_100001281 | Ga0070688_1000012814 | 108 |
| 297 | 3300005366 | Ga0070659_100000775 | Ga0070659_10000077510 | 108 |
| 298 | 3300005366 | Ga0070659_100011020 | Ga0070659_1000110202 | 108 |
| 299 | 3300005366 | Ga0070659_100053304 | Ga0070659_1000533042 | 108 |
| 300 | 3300005367 | Ga0070667_100010761 | Ga0070667_1000107614 | 108 |
| 301 | 3300005367 | Ga0070667_100185355 | Ga0070667_1001853552 | 108 |
| 302 | 3300005367 | Ga0070667_100218498 | Ga0070667_1002184982 | 108 |
| 303 | 3300005367 | Ga0070667_100222223 | Ga0070667_1002222232 | 108 |
| 304 | 3300005367 | Ga0070667_100796835 | Ga0070667_1007968352 | 108 |
| 305 | 3300005367 | Ga0070667_100946092 | Ga0070667_1009460921 | 108 |
| 306 | 3300005435 | Ga0070714_100023434 | Ga0070714_1000234344 | 108 |
| 307 | 3300005436 | Ga0070713_100086547 | Ga0070713_1000865472 | 108 |
| 308 | 3300005438 | Ga0070701_10011312 | Ga0070701_100113123 | 108 |
| 309 | 3300005439 | Ga0070711_100490992 | Ga0070711_1004909922 | 108 |
| 310 | 3300005440 | Ga0070705_100124178 | Ga0070705_1001241782 | 108 |
| 311 | 3300005441 | Ga0070700_100012660 | Ga0070700_1000126604 | 108 |
| 312 | 3300005441 | Ga0070700_100347025 | Ga0070700_1003470251 | 108 |
| 313 | 3300005455 | Ga0070663_100003531 | Ga0070663_1000035312 | 108 |
| 314 | 3300005455 | Ga0070663_100062756 | Ga0070663_1000627562 | 108 |
| 315 | 3300005455 | Ga0070663_100070060 | Ga0070663_1000700602 | 108 |
| 316 | 3300005455 | Ga0070663_100140407 | Ga0070663_1001404072 | 108 |
| 317 | 3300005456 | Ga0070678_100001864 | Ga0070678_1000018649 | 108 |
| 318 | 3300005456 | Ga0070678_100935709 | Ga0070678_1009357091 | 108 |
| 319 | 3300005457 | Ga0070662_100006101 | Ga0070662_1000061014 | 108 |
| 320 | 3300005457 | Ga0070662_100728950 | Ga0070662_1007289502 | 108 |
| 321 | 3300005458 | Ga0070681_10009268 | Ga0070681_100092684 | 108 |
| 322 | 3300005459 | Ga0068867_100002941 | Ga0068867_1000029413 | 108 |
| 323 | 3300005459 | Ga0068867_100178981 | Ga0068867_1001789812 | 108 |
| 324 | 3300005466 | Ga0070685_10002100 | Ga0070685_100021004 | 108 |
| 325 | 3300005466 | Ga0070685_10749548 | Ga0070685_107495482 | 108 |
| 326 | 3300005518 | Ga0070699_101299167 | Ga0070699_1012991671 | 108 |
| 327 | 3300005530 | Ga0070679_100021908 | Ga0070679_1000219082 | 108 |
| 328 | 3300005535 | Ga0070684_100008314 | Ga0070684_1000083142 | 108 |
| 329 | 3300005535 | Ga0070684_100024579 | Ga0070684_1000245793 | 108 |
| 330 | 3300005539 | Ga0068853_100018218 | Ga0068853_1000182187 | 108 |
| 331 | 3300005539 | Ga0068853_100031794 | Ga0068853_1000317944 | 108 |
| 332 | 3300005539 | Ga0068853_100034090 | Ga0068853_1000340904 | 108 |
| 333 | 3300005539 | Ga0068853_100037786 | Ga0068853_1000377862 | 108 |
| 334 | 3300005539 | Ga0068853_100706697 | Ga0068853_1007066972 | 108 |
| 335 | 3300005543 | Ga0070672_100010643 | Ga0070672_1000106434 | 108 |
| 336 | 3300005543 | Ga0070672_100052948 | Ga0070672_1000529482 | 108 |
| 337 | 3300005543 | Ga0070672_100082201 | Ga0070672_1000822012 | 108 |
| 338 | 3300005543 | Ga0070672_100114468 | Ga0070672_1001144682 | 108 |
| 339 | 3300005543 | Ga0070672_100490790 | Ga0070672_1004907902 | 108 |
| 340 | 3300005543 | Ga0070672_100592574 | Ga0070672_1005925742 | 108 |
| 341 | 3300005543 | Ga0070672_100774780 | Ga0070672_1007747801 | 108 |
| 342 | 3300005543 | Ga0070672_100801083 | Ga0070672_1008010832 | 108 |
| 343 | 3300005544 | Ga0070686_100007051 | Ga0070686_1000070514 | 108 |
| 344 | 3300005546 | Ga0070696_101931150 | Ga0070696_1019311501 | 108 |
| 345 | 3300005547 | Ga0070693_100022314 | Ga0070693_1000223143 | 108 |
| 346 | 3300005547 | Ga0070693_100845393 | Ga0070693_1008453931 | 108 |
| 347 | 3300005547 | Ga0070693_100934346 | Ga0070693_1009343462 | 108 |
| 348 | 3300005548 | Ga0070665_100016657 | Ga0070665_1000166574 | 108 |
| 349 | 3300005548 | Ga0070665_100020139 | Ga0070665_1000201394 | 108 |
| 350 | 3300005548 | Ga0070665_100032024 | Ga0070665_1000320244 | 108 |
| 351 | 3300005548 | Ga0070665_100351881 | Ga0070665_1003518812 | 108 |
| 352 | 3300005548 | Ga0070665_100395406 | Ga0070665_1003954062 | 108 |
| 353 | 3300005563 | Ga0068855_100002431 | Ga0068855_10000243121 | 108 |
| 354 | 3300005563 | Ga0068855_100026060 | Ga0068855_1000260603 | 108 |
| 355 | 3300005563 | Ga0068855_100209040 | Ga0068855_1002090402 | 108 |
| 356 | 3300005563 | Ga0068855_101615315 | Ga0068855_1016153151 | 108 |
| 357 | 3300005564 | Ga0070664_100000232 | Ga0070664_10000023218 | 108 |
| 358 | 3300005564 | Ga0070664_100002189 | Ga0070664_10000218911 | 108 |
| 359 | 3300005564 | Ga0070664_100006956 | Ga0070664_1000069568 | 108 |
| 360 | 3300005564 | Ga0070664_100042213 | Ga0070664_1000422132 | 108 |
| 361 | 3300005564 | Ga0070664_100093292 | Ga0070664_1000932922 | 108 |
| 362 | 3300005564 | Ga0070664_100212309 | Ga0070664_1002123091 | 108 |
| 363 | 3300005564 | Ga0070664_100290227 | Ga0070664_1002902272 | 108 |
| 364 | 3300005564 | Ga0070664_100635344 | Ga0070664_1006353441 | 108 |
| 365 | 3300005577 | Ga0068857_100000150 | Ga0068857_10000015019 | 108 |
| 366 | 3300005577 | Ga0068857_100003300 | Ga0068857_1000033002 | 108 |
| 367 | 3300005577 | Ga0068857_100186323 | Ga0068857_1001863232 | 108 |
| 368 | 3300005578 | Ga0068854_100003871 | Ga0068854_1000038716 | 108 |
| 369 | 3300005578 | Ga0068854_100152640 | Ga0068854_1001526402 | 108 |
| 370 | 3300005578 | Ga0068854_100267591 | Ga0068854_1002675912 | 108 |
| 371 | 3300005614 | Ga0068856_100000121 | Ga0068856_10000012156 | 108 |
| 372 | 3300005614 | Ga0068856_100015939 | Ga0068856_1000159392 | 108 |
| 373 | 3300005614 | Ga0068856_100076208 | Ga0068856_1000762082 | 108 |
| 374 | 3300005614 | Ga0068856_102432301 | Ga0068856_1024323012 | 108 |
| 375 | 3300005615 | Ga0070702_100004941 | Ga0070702_1000049414 | 108 |
| 376 | 3300005616 | Ga0068852_100002603 | Ga0068852_10000260311 | 108 |
| 377 | 3300005616 | Ga0068852_100002736 | Ga0068852_1000027365 | 108 |
| 378 | 3300005616 | Ga0068852_100011689 | Ga0068852_1000116898 | 108 |
| 379 | 3300005616 | Ga0068852_100023842 | Ga0068852_1000238423 | 108 |
| 380 | 3300005617 | Ga0068859_100018722 | Ga0068859_1000187222 | 108 |
| 381 | 3300005617 | Ga0068859_100265691 | Ga0068859_1002656912 | 108 |
| 382 | 3300005617 | Ga0068859_100942312 | Ga0068859_1009423122 | 108 |
| 383 | 3300005618 | Ga0068864_100002176 | Ga0068864_1000021763 | 108 |
| 384 | 3300005618 | Ga0068864_100002637 | Ga0068864_1000026372 | 108 |
| 385 | 3300005618 | Ga0068864_100004662 | Ga0068864_1000046623 | 108 |
| 386 | 3300005618 | Ga0068864_100255259 | Ga0068864_1002552592 | 108 |
| 387 | 3300005618 | Ga0068864_100628760 | Ga0068864_1006287601 | 108 |
| 388 | 3300005618 | Ga0068864_101593077 | Ga0068864_1015930771 | 108 |
| 389 | 3300005718 | Ga0068866_10001297 | Ga0068866_100012979 | 108 |
| 390 | 3300005718 | Ga0068866_10093873 | Ga0068866_100938732 | 108 |
| 391 | 3300005718 | Ga0068866_10286444 | Ga0068866_102864442 | 108 |
| 392 | 3300005719 | Ga0068861_100048238 | Ga0068861_1000482383 | 108 |
| 393 | 3300005719 | Ga0068861_100506771 | Ga0068861_1005067712 | 108 |
| 394 | 3300005834 | Ga0068851_10005887 | Ga0068851_100058873 | 108 |
| 395 | 3300005834 | Ga0068851_10006428 | Ga0068851_100064284 | 108 |
| 396 | 3300005834 | Ga0068851_10024417 | Ga0068851_100244172 | 108 |
| 397 | 3300005834 | Ga0068851_10043987 | Ga0068851_100439872 | 108 |
| 398 | 3300005834 | Ga0068851_10324060 | Ga0068851_103240602 | 108 |
| 399 | 3300005840 | Ga0068870_10001159 | Ga0068870_100011599 | 108 |
| 400 | 3300005840 | Ga0068870_10593473 | Ga0068870_105934731 | 108 |
| 401 | 3300005841 | Ga0068863_100007864 | Ga0068863_1000078648 | 108 |
| 402 | 3300005841 | Ga0068863_100024596 | Ga0068863_1000245962 | 108 |
| 403 | 3300005841 | Ga0068863_100031853 | Ga0068863_1000318534 | 108 |
| 404 | 3300005841 | Ga0068863_100237836 | Ga0068863_1002378362 | 108 |
| 405 | 3300005841 | Ga0068863_100313834 | Ga0068863_1003138342 | 108 |
| 406 | 3300005841 | Ga0068863_100436622 | Ga0068863_1004366222 | 108 |
| 407 | 3300005842 | Ga0068858_100011839 | Ga0068858_1000118394 | 108 |
| 408 | 3300005842 | Ga0068858_100183034 | Ga0068858_1001830342 | 108 |
| 409 | 3300005842 | Ga0068858_100465717 | Ga0068858_1004657172 | 108 |
| 410 | 3300005842 | Ga0068858_101339869 | Ga0068858_1013398691 | 108 |
| 411 | 3300005843 | Ga0068860_100011798 | Ga0068860_1000117987 | 108 |
| 412 | 3300005843 | Ga0068860_100036564 | Ga0068860_1000365642 | 108 |
| 413 | 3300005843 | Ga0068860_100113567 | Ga0068860_1001135672 | 108 |
| 414 | 3300005843 | Ga0068860_100339101 | Ga0068860_1003391012 | 108 |
| 415 | 3300005843 | Ga0068860_101206294 | Ga0068860_1012062942 | 108 |
| 416 | 3300005843 | Ga0068860_101386464 | Ga0068860_1013864642 | 108 |
| 417 | 3300005844 | Ga0068862_100175480 | Ga0068862_1001754802 | 108 |
| 418 | 3300005844 | Ga0068862_100756888 | Ga0068862_1007568881 | 108 |
| 419 | 3300005937 | Ga0081455_10148316 | Ga0081455_101483162 | 108 |
| 420 | 3300006237 | Ga0097621_100069324 | Ga0097621_1000693243 | 108 |
| 421 | 3300006237 | Ga0097621_100459162 | Ga0097621_1004591622 | 108 |
| 422 | 3300006237 | Ga0097621_100542543 | Ga0097621_1005425432 | 108 |
| 423 | 3300006237 | Ga0097621_101359390 | Ga0097621_1013593902 | 108 |
| 424 | 3300006358 | Ga0068871_100003356 | Ga0068871_1000033569 | 108 |
| 425 | 3300006358 | Ga0068871_100523554 | Ga0068871_1005235542 | 108 |
| 426 | 3300006844 | Ga0075428_100884931 | Ga0075428_1008849312 | 108 |
| 427 | 3300006846 | Ga0075430_100804039 | Ga0075430_1008040392 | 108 |
| 428 | 3300006852 | Ga0075433_10813455 | Ga0075433_108134552 | 108 |
| 429 | 3300006881 | Ga0068865_100041607 | Ga0068865_1000416073 | 108 |
| 430 | 3300006881 | Ga0068865_100086000 | Ga0068865_1000860001 | 108 |
| 431 | 3300006881 | Ga0068865_100207213 | Ga0068865_1002072132 | 108 |
| 432 | 3300006931 | Ga0097620_100018724 | Ga0097620_1000187242 | 108 |
| 433 | 3300006931 | Ga0097620_100265697 | Ga0097620_1002656972 | 108 |
| 434 | 3300006931 | Ga0097620_100942116 | Ga0097620_1009421162 | 108 |
| 435 | 3300007076 | Ga0075435_100394911 | Ga0075435_1003949112 | 108 |
| 436 | 3300007076 | Ga0075435_100547866 | Ga0075435_1005478662 | 108 |
| 437 | 3300009093 | Ga0105240_10012137 | Ga0105240_100121373 | 108 |
| 438 | 3300009094 | Ga0111539_10019136 | Ga0111539_100191364 | 108 |
| 439 | 3300009094 | Ga0111539_10605075 | Ga0111539_106050752 | 108 |
| 440 | 3300009098 | Ga0105245_10225435 | Ga0105245_102254352 | 108 |
| 441 | 3300009098 | Ga0105245_10387341 | Ga0105245_103873412 | 108 |
| 442 | 3300009098 | Ga0105245_10938102 | Ga0105245_109381022 | 108 |
| 443 | 3300009101 | Ga0105247_10549258 | Ga0105247_105492582 | 108 |
| 444 | 3300009101 | Ga0105247_11172083 | Ga0105247_111720831 | 108 |
| 445 | 3300009148 | Ga0105243_10037337 | Ga0105243_100373373 | 108 |
| 446 | 3300009174 | Ga0105241_10159687 | Ga0105241_101596872 | 108 |
| 447 | 3300009174 | Ga0105241_10710165 | Ga0105241_107101652 | 108 |
| 448 | 3300009176 | Ga0105242_11139547 | Ga0105242_111395472 | 108 |
| 449 | 3300009177 | Ga0105248_10066758 | Ga0105248_100667581 | 108 |
| 450 | 3300009545 | Ga0105237_10389017 | Ga0105237_103890172 | 108 |
| 451 | 3300009551 | Ga0105238_10004955 | Ga0105238_100049552 | 108 |
| 452 | 3300009551 | Ga0105238_11512243 | Ga0105238_115122431 | 108 |
| 453 | 3300009553 | Ga0105249_10042235 | Ga0105249_100422354 | 108 |
| 454 | 3300010375 | Ga0105239_10368054 | Ga0105239_103680541 | 108 |
| 455 | 3300010375 | Ga0105239_10457074 | Ga0105239_104570742 | 108 |
| 456 | 3300011119 | Ga0105246_10392365 | Ga0105246_103923652 | 108 |
| 457 | 3300011119 | Ga0105246_10796343 | Ga0105246_107963431 | 108 |
| 458 | 3300013100 | Ga0157373_10000313 | Ga0157373_1000031340 | 108 |
| 459 | 3300013100 | Ga0157373_10034594 | Ga0157373_100345942 | 108 |
| 460 | 3300013100 | Ga0157373_10597962 | Ga0157373_105979621 | 108 |
| 461 | 3300013102 | Ga0157371_10001031 | Ga0157371_1000103119 | 108 |
| 462 | 3300013102 | Ga0157371_10056458 | Ga0157371_100564583 | 108 |
| 463 | 3300013104 | Ga0157370_10021258 | Ga0157370_100212582 | 108 |
| 464 | 3300013104 | Ga0157370_10457949 | Ga0157370_104579492 | 108 |
| 465 | 3300013105 | Ga0157369_10010469 | Ga0157369_100104694 | 108 |
| 466 | 3300013105 | Ga0157369_10044535 | Ga0157369_100445352 | 108 |
| 467 | 3300013296 | Ga0157374_10016090 | Ga0157374_100160904 | 108 |
| 468 | 3300013296 | Ga0157374_11035949 | Ga0157374_110359492 | 108 |
| 469 | 3300013296 | Ga0157374_11193868 | Ga0157374_111938682 | 108 |
| 470 | 3300013296 | Ga0157374_11877240 | Ga0157374_118772401 | 108 |
| 471 | 3300013297 | Ga0157378_10014211 | Ga0157378_100142112 | 108 |
| 472 | 3300013297 | Ga0157378_10114479 | Ga0157378_101144793 | 108 |
| 473 | 3300013297 | Ga0157378_10262576 | Ga0157378_102625762 | 108 |
| 474 | 3300013297 | Ga0157378_10329130 | Ga0157378_103291302 | 108 |
| 475 | 3300013297 | Ga0157378_11164020 | Ga0157378_111640202 | 108 |
| 476 | 3300013306 | Ga0163162_10102069 | Ga0163162_101020692 | 108 |
| 477 | 3300013306 | Ga0163162_10549619 | Ga0163162_105496192 | 108 |
| 478 | 3300013306 | Ga0163162_10858323 | Ga0163162_108583232 | 108 |
| 479 | 3300013306 | Ga0163162_11054898 | Ga0163162_110548982 | 108 |
| 480 | 3300013307 | Ga0157372_10000985 | Ga0157372_1000098530 | 108 |
| 481 | 3300013307 | Ga0157372_10014220 | Ga0157372_100142209 | 108 |
| 482 | 3300013308 | Ga0157375_10006967 | Ga0157375_100069679 | 108 |
| 483 | 3300013308 | Ga0157375_10086744 | Ga0157375_100867443 | 108 |
| 484 | 3300013308 | Ga0157375_10563236 | Ga0157375_105632362 | 108 |
| 485 | 3300013308 | Ga0157375_10708975 | Ga0157375_107089752 | 108 |
| 486 | 3300013308 | Ga0157375_11321775 | Ga0157375_113217752 | 108 |
| 487 | 3300014325 | Ga0163163_10004614 | Ga0163163_100046144 | 108 |
| 488 | 3300014325 | Ga0163163_10055514 | Ga0163163_100555142 | 108 |
| 489 | 3300014325 | Ga0163163_11469032 | Ga0163163_114690322 | 108 |
| 490 | 3300014326 | Ga0157380_10005087 | Ga0157380_100050873 | 108 |
| 491 | 3300014326 | Ga0157380_10728088 | Ga0157380_107280882 | 108 |
| 492 | 3300014326 | Ga0157380_11264387 | Ga0157380_112643872 | 108 |
| 493 | 3300014497 | Ga0182008_10118295 | Ga0182008_101182952 | 108 |
| 494 | 3300014745 | Ga0157377_10004602 | Ga0157377_100046022 | 108 |
| 495 | 3300014745 | Ga0157377_10281873 | Ga0157377_102818732 | 108 |
| 496 | 3300014968 | Ga0157379_10049691 | Ga0157379_100496913 | 108 |
| 497 | 3300014968 | Ga0157379_10180925 | Ga0157379_101809252 | 108 |
| 498 | 3300014968 | Ga0157379_10636543 | Ga0157379_106365432 | 108 |
| 499 | 3300014969 | Ga0157376_10216690 | Ga0157376_102166902 | 108 |
| 500 | 3300014969 | Ga0157376_10502162 | Ga0157376_105021622 | 108 |
| 501 | 3300017792 | Ga0163161_10050562 | Ga0163161_100505622 | 108 |
| 502 | 3300017792 | Ga0163161_10332084 | Ga0163161_103320842 | 108 |
| 503 | 3300025271 | Ga0207666_1000621 | Ga0207666_10006212 | 108 |
| 504 | 3300025290 | Ga0207673_1004119 | Ga0207673_10041191 | 108 |
| 505 | 3300025315 | Ga0207697_10007413 | Ga0207697_100074132 | 108 |
| 506 | 3300025315 | Ga0207697_10013718 | Ga0207697_100137183 | 108 |
| 507 | 3300025315 | Ga0207697_10017641 | Ga0207697_100176413 | 108 |
| 508 | 3300025321 | Ga0207656_10004803 | Ga0207656_100048034 | 108 |
| 509 | 3300025321 | Ga0207656_10006766 | Ga0207656_100067664 | 108 |
| 510 | 3300025321 | Ga0207656_10072875 | Ga0207656_100728752 | 108 |
| 511 | 3300025321 | Ga0207656_10182260 | Ga0207656_101822602 | 108 |
| 512 | 3300025321 | Ga0207656_10308176 | Ga0207656_103081761 | 108 |
| 513 | 3300025893 | Ga0207682_10000731 | Ga0207682_100007318 | 108 |
| 514 | 3300025893 | Ga0207682_10001222 | Ga0207682_1000122210 | 108 |
| 515 | 3300025893 | Ga0207682_10164761 | Ga0207682_101647612 | 108 |
| 516 | 3300025899 | Ga0207642_10034543 | Ga0207642_100345432 | 108 |
| 517 | 3300025899 | Ga0207642_10070216 | Ga0207642_100702162 | 108 |
| 518 | 3300025899 | Ga0207642_11028871 | Ga0207642_110288711 | 108 |
| 519 | 3300025900 | Ga0207710_10459065 | Ga0207710_104590652 | 108 |
| 520 | 3300025901 | Ga0207688_10005395 | Ga0207688_100053952 | 108 |
| 521 | 3300025901 | Ga0207688_10134775 | Ga0207688_101347752 | 108 |
| 522 | 3300025901 | Ga0207688_10292030 | Ga0207688_102920302 | 108 |
| 523 | 3300025901 | Ga0207688_10408283 | Ga0207688_104082832 | 108 |
| 524 | 3300025903 | Ga0207680_10026583 | Ga0207680_100265833 | 108 |
| 525 | 3300025903 | Ga0207680_10196791 | Ga0207680_101967912 | 108 |
| 526 | 3300025903 | Ga0207680_10265174 | Ga0207680_102651742 | 108 |
| 527 | 3300025903 | Ga0207680_10632500 | Ga0207680_106325002 | 108 |
| 528 | 3300025907 | Ga0207645_10000077 | Ga0207645_1000007766 | 108 |
| 529 | 3300025907 | Ga0207645_10003858 | Ga0207645_100038589 | 108 |
| 530 | 3300025907 | Ga0207645_10031496 | Ga0207645_100314961 | 108 |
| 531 | 3300025907 | Ga0207645_10086857 | Ga0207645_100868572 | 108 |
| 532 | 3300025907 | Ga0207645_10112486 | Ga0207645_101124862 | 108 |
| 533 | 3300025908 | Ga0207643_10000267 | Ga0207643_1000026713 | 108 |
| 534 | 3300025908 | Ga0207643_10009075 | Ga0207643_100090755 | 108 |
| 535 | 3300025908 | Ga0207643_10197608 | Ga0207643_101976082 | 108 |
| 536 | 3300025909 | Ga0207705_10102076 | Ga0207705_101020762 | 108 |
| 537 | 3300025909 | Ga0207705_10164440 | Ga0207705_101644402 | 108 |
| 538 | 3300025909 | Ga0207705_11345050 | Ga0207705_113450501 | 108 |
| 539 | 3300025911 | Ga0207654_10078915 | Ga0207654_100789152 | 108 |
| 540 | 3300025913 | Ga0207695_10030233 | Ga0207695_100302335 | 108 |
| 541 | 3300025914 | Ga0207671_10262845 | Ga0207671_102628452 | 108 |
| 542 | 3300025916 | Ga0207663_10362553 | Ga0207663_103625531 | 108 |
| 543 | 3300025917 | Ga0207660_10241528 | Ga0207660_102415282 | 108 |
| 544 | 3300025918 | Ga0207662_10006514 | Ga0207662_100065143 | 108 |
| 545 | 3300025919 | Ga0207657_10000995 | Ga0207657_100009954 | 108 |
| 546 | 3300025919 | Ga0207657_10012006 | Ga0207657_100120062 | 108 |
| 547 | 3300025919 | Ga0207657_10023022 | Ga0207657_100230223 | 108 |
| 548 | 3300025919 | Ga0207657_11216459 | Ga0207657_112164591 | 108 |
| 549 | 3300025920 | Ga0207649_10001599 | Ga0207649_1000159911 | 108 |
| 550 | 3300025920 | Ga0207649_10010084 | Ga0207649_100100842 | 108 |
| 551 | 3300025920 | Ga0207649_10332081 | Ga0207649_103320812 | 108 |
| 552 | 3300025920 | Ga0207649_10438155 | Ga0207649_104381551 | 108 |
| 553 | 3300025921 | Ga0207652_10096692 | Ga0207652_100966922 | 108 |
| 554 | 3300025922 | Ga0207646_10739072 | Ga0207646_107390722 | 108 |
| 555 | 3300025923 | Ga0207681_10016081 | Ga0207681_100160813 | 108 |
| 556 | 3300025923 | Ga0207681_10045524 | Ga0207681_100455243 | 108 |
| 557 | 3300025923 | Ga0207681_10140279 | Ga0207681_101402792 | 108 |
| 558 | 3300025923 | Ga0207681_10236080 | Ga0207681_102360802 | 108 |
| 559 | 3300025923 | Ga0207681_10880908 | Ga0207681_108809081 | 108 |
| 560 | 3300025924 | Ga0207694_10006116 | Ga0207694_100061169 | 108 |
| 561 | 3300025925 | Ga0207650_10001468 | Ga0207650_100014682 | 108 |
| 562 | 3300025925 | Ga0207650_10002076 | Ga0207650_1000207612 | 108 |
| 563 | 3300025925 | Ga0207650_10018406 | Ga0207650_100184062 | 108 |
| 564 | 3300025925 | Ga0207650_10050188 | Ga0207650_100501883 | 108 |
| 565 | 3300025925 | Ga0207650_10192049 | Ga0207650_101920492 | 108 |
| 566 | 3300025925 | Ga0207650_10876201 | Ga0207650_108762011 | 108 |
| 567 | 3300025926 | Ga0207659_10015519 | Ga0207659_100155192 | 108 |
| 568 | 3300025926 | Ga0207659_10019297 | Ga0207659_100192973 | 108 |
| 569 | 3300025926 | Ga0207659_10024323 | Ga0207659_100243234 | 108 |
| 570 | 3300025926 | Ga0207659_10228355 | Ga0207659_102283551 | 108 |
| 571 | 3300025926 | Ga0207659_10447171 | Ga0207659_104471712 | 108 |
| 572 | 3300025926 | Ga0207659_10668894 | Ga0207659_106688942 | 108 |
| 573 | 3300025927 | Ga0207687_10241733 | Ga0207687_102417332 | 108 |
| 574 | 3300025929 | Ga0207664_10004425 | Ga0207664_100044259 | 108 |
| 575 | 3300025931 | Ga0207644_10003838 | Ga0207644_100038383 | 108 |
| 576 | 3300025931 | Ga0207644_10045114 | Ga0207644_100451142 | 108 |
| 577 | 3300025931 | Ga0207644_10051893 | Ga0207644_100518933 | 108 |
| 578 | 3300025931 | Ga0207644_10196207 | Ga0207644_101962072 | 108 |
| 579 | 3300025931 | Ga0207644_11369743 | Ga0207644_113697431 | 108 |
| 580 | 3300025932 | Ga0207690_10002015 | Ga0207690_100020154 | 108 |
| 581 | 3300025932 | Ga0207690_10002295 | Ga0207690_100022956 | 108 |
| 582 | 3300025932 | Ga0207690_10542396 | Ga0207690_105423962 | 108 |
| 583 | 3300025933 | Ga0207706_10000351 | Ga0207706_100003512 | 108 |
| 584 | 3300025933 | Ga0207706_10000644 | Ga0207706_1000064414 | 108 |
| 585 | 3300025933 | Ga0207706_10195577 | Ga0207706_101955772 | 108 |
| 586 | 3300025933 | Ga0207706_10580662 | Ga0207706_105806622 | 108 |
| 587 | 3300025934 | Ga0207686_10895893 | Ga0207686_108958932 | 108 |
| 588 | 3300025936 | Ga0207670_10816565 | Ga0207670_108165652 | 108 |
| 589 | 3300025937 | Ga0207669_10000673 | Ga0207669_100006732 | 108 |
| 590 | 3300025937 | Ga0207669_10001618 | Ga0207669_100016187 | 108 |
| 591 | 3300025937 | Ga0207669_10093030 | Ga0207669_100930302 | 108 |
| 592 | 3300025937 | Ga0207669_10681769 | Ga0207669_106817692 | 108 |
| 593 | 3300025938 | Ga0207704_10079745 | Ga0207704_100797452 | 108 |
| 594 | 3300025938 | Ga0207704_10331098 | Ga0207704_103310982 | 108 |
| 595 | 3300025940 | Ga0207691_10000499 | Ga0207691_100004992 | 108 |
| 596 | 3300025940 | Ga0207691_10007167 | Ga0207691_100071674 | 108 |
| 597 | 3300025940 | Ga0207691_10057572 | Ga0207691_100575722 | 108 |
| 598 | 3300025940 | Ga0207691_10112859 | Ga0207691_101128592 | 108 |
| 599 | 3300025940 | Ga0207691_10282445 | Ga0207691_102824452 | 108 |
| 600 | 3300025940 | Ga0207691_10961484 | Ga0207691_109614842 | 108 |
| 601 | 3300025940 | Ga0207691_11071093 | Ga0207691_110710932 | 108 |
| 602 | 3300025940 | Ga0207691_11071907 | Ga0207691_110719072 | 108 |
| 603 | 3300025941 | Ga0207711_10028179 | Ga0207711_100281795 | 108 |
| 604 | 3300025941 | Ga0207711_10065246 | Ga0207711_100652462 | 108 |
| 605 | 3300025942 | Ga0207689_10001154 | Ga0207689_1000115420 | 108 |
| 606 | 3300025942 | Ga0207689_10049737 | Ga0207689_100497374 | 108 |
| 607 | 3300025942 | Ga0207689_10212191 | Ga0207689_102121912 | 108 |
| 608 | 3300025944 | Ga0207661_10020377 | Ga0207661_100203772 | 108 |
| 609 | 3300025944 | Ga0207661_10474595 | Ga0207661_104745952 | 108 |
| 610 | 3300025944 | Ga0207661_10635210 | Ga0207661_106352102 | 108 |
| 611 | 3300025945 | Ga0207679_10006231 | Ga0207679_100062315 | 108 |
| 612 | 3300025945 | Ga0207679_10014817 | Ga0207679_100148172 | 108 |
| 613 | 3300025945 | Ga0207679_10018627 | Ga0207679_100186273 | 108 |
| 614 | 3300025945 | Ga0207679_10118655 | Ga0207679_101186552 | 108 |
| 615 | 3300025945 | Ga0207679_10801880 | Ga0207679_108018801 | 108 |
| 616 | 3300025945 | Ga0207679_11569957 | Ga0207679_115699571 | 108 |
| 617 | 3300025949 | Ga0207667_10001918 | Ga0207667_1000191816 | 108 |
| 618 | 3300025949 | Ga0207667_10009543 | Ga0207667_100095432 | 108 |
| 619 | 3300025949 | Ga0207667_10296162 | Ga0207667_102961622 | 108 |
| 620 | 3300025949 | Ga0207667_11071085 | Ga0207667_110710851 | 108 |
| 621 | 3300025960 | Ga0207651_10020462 | Ga0207651_100204623 | 108 |
| 622 | 3300025960 | Ga0207651_10062789 | Ga0207651_100627892 | 108 |
| 623 | 3300025960 | Ga0207651_10346528 | Ga0207651_103465282 | 108 |
| 624 | 3300025960 | Ga0207651_10478610 | Ga0207651_104786102 | 108 |
| 625 | 3300025960 | Ga0207651_10582587 | Ga0207651_105825871 | 108 |
| 626 | 3300025961 | Ga0207712_10087166 | Ga0207712_100871663 | 108 |
| 627 | 3300025972 | Ga0207668_10022978 | Ga0207668_100229782 | 108 |
| 628 | 3300025972 | Ga0207668_10029010 | Ga0207668_100290103 | 108 |
| 629 | 3300025972 | Ga0207668_10106152 | Ga0207668_101061522 | 108 |
| 630 | 3300025972 | Ga0207668_10134880 | Ga0207668_101348802 | 108 |
| 631 | 3300025972 | Ga0207668_10196695 | Ga0207668_101966952 | 108 |
| 632 | 3300025972 | Ga0207668_10545310 | Ga0207668_105453102 | 108 |
| 633 | 3300025981 | Ga0207640_10022374 | Ga0207640_100223743 | 108 |
| 634 | 3300025981 | Ga0207640_10167130 | Ga0207640_101671302 | 108 |
| 635 | 3300025986 | Ga0207658_10002918 | Ga0207658_1000291812 | 108 |
| 636 | 3300025986 | Ga0207658_10148288 | Ga0207658_101482882 | 108 |
| 637 | 3300025986 | Ga0207658_10382099 | Ga0207658_103820992 | 108 |
| 638 | 3300025986 | Ga0207658_10673874 | Ga0207658_106738742 | 108 |
| 639 | 3300025986 | Ga0207658_10914442 | Ga0207658_109144422 | 108 |
| 640 | 3300026023 | Ga0207677_10014097 | Ga0207677_100140972 | 108 |
| 641 | 3300026023 | Ga0207677_10074342 | Ga0207677_100743422 | 108 |
| 642 | 3300026023 | Ga0207677_10130185 | Ga0207677_101301852 | 108 |
| 643 | 3300026023 | Ga0207677_10615527 | Ga0207677_106155272 | 108 |
| 644 | 3300026035 | Ga0207703_10029206 | Ga0207703_100292064 | 108 |
| 645 | 3300026035 | Ga0207703_10227974 | Ga0207703_102279742 | 108 |
| 646 | 3300026035 | Ga0207703_10432352 | Ga0207703_104323522 | 108 |
| 647 | 3300026035 | Ga0207703_10947339 | Ga0207703_109473392 | 108 |
| 648 | 3300026041 | Ga0207639_10012950 | Ga0207639_100129502 | 108 |
| 649 | 3300026041 | Ga0207639_10043737 | Ga0207639_100437372 | 108 |
| 650 | 3300026041 | Ga0207639_10068759 | Ga0207639_100687592 | 108 |
| 651 | 3300026041 | Ga0207639_11250933 | Ga0207639_112509332 | 108 |
| 652 | 3300026067 | Ga0207678_10002008 | Ga0207678_1000200811 | 108 |
| 653 | 3300026067 | Ga0207678_10008115 | Ga0207678_100081152 | 108 |
| 654 | 3300026067 | Ga0207678_10131754 | Ga0207678_101317542 | 108 |
| 655 | 3300026067 | Ga0207678_10211775 | Ga0207678_102117752 | 108 |
| 656 | 3300026067 | Ga0207678_10557235 | Ga0207678_105572352 | 108 |
| 657 | 3300026075 | Ga0207708_10013301 | Ga0207708_100133012 | 108 |
| 658 | 3300026075 | Ga0207708_10677684 | Ga0207708_106776842 | 108 |
| 659 | 3300026078 | Ga0207702_10001905 | Ga0207702_1000190518 | 108 |
| 660 | 3300026078 | Ga0207702_10002122 | Ga0207702_1000212216 | 108 |
| 661 | 3300026078 | Ga0207702_10127510 | Ga0207702_101275102 | 108 |
| 662 | 3300026088 | Ga0207641_10009454 | Ga0207641_100094542 | 108 |
| 663 | 3300026088 | Ga0207641_10143293 | Ga0207641_101432932 | 108 |
| 664 | 3300026088 | Ga0207641_10505166 | Ga0207641_105051661 | 108 |
| 665 | 3300026088 | Ga0207641_10806140 | Ga0207641_108061402 | 108 |
| 666 | 3300026089 | Ga0207648_10000589 | Ga0207648_1000058938 | 108 |
| 667 | 3300026089 | Ga0207648_10007227 | Ga0207648_100072279 | 108 |
| 668 | 3300026089 | Ga0207648_10043114 | Ga0207648_100431142 | 108 |
| 669 | 3300026089 | Ga0207648_10612301 | Ga0207648_106123012 | 108 |
| 670 | 3300026089 | Ga0207648_10632523 | Ga0207648_106325231 | 108 |
| 671 | 3300026095 | Ga0207676_10011120 | Ga0207676_100111204 | 108 |
| 672 | 3300026095 | Ga0207676_10022772 | Ga0207676_100227723 | 108 |
| 673 | 3300026095 | Ga0207676_10032647 | Ga0207676_100326473 | 108 |
| 674 | 3300026095 | Ga0207676_10044387 | Ga0207676_100443872 | 108 |
| 675 | 3300026095 | Ga0207676_10612502 | Ga0207676_106125022 | 108 |
| 676 | 3300026095 | Ga0207676_11539202 | Ga0207676_115392022 | 108 |
| 677 | 3300026116 | Ga0207674_10000369 | Ga0207674_1000036919 | 108 |
| 678 | 3300026116 | Ga0207674_10003357 | Ga0207674_1000335717 | 108 |
| 679 | 3300026118 | Ga0207675_100003777 | Ga0207675_1000037778 | 108 |
| 680 | 3300026118 | Ga0207675_100179829 | Ga0207675_1001798292 | 108 |
| 681 | 3300026118 | Ga0207675_100487653 | Ga0207675_1004876532 | 108 |
| 682 | 3300026118 | Ga0207675_100823092 | Ga0207675_1008230922 | 108 |
| 683 | 3300026118 | Ga0207675_101976035 | Ga0207675_1019760351 | 108 |
| 684 | 3300026121 | Ga0207683_10000280 | Ga0207683_100002802 | 108 |
| 685 | 3300026121 | Ga0207683_10008777 | Ga0207683_100087777 | 108 |
| 686 | 3300026121 | Ga0207683_10163908 | Ga0207683_101639082 | 108 |
| 687 | 3300026121 | Ga0207683_10298674 | Ga0207683_102986742 | 108 |
| 688 | 3300026121 | Ga0207683_12030082 | Ga0207683_120300821 | 108 |
| 689 | 3300026142 | Ga0207698_10002438 | Ga0207698_100024385 | 108 |
| 690 | 3300026142 | Ga0207698_10007795 | Ga0207698_100077958 | 108 |
| 691 | 3300026142 | Ga0207698_10012550 | Ga0207698_100125503 | 108 |
| 692 | 3300026142 | Ga0207698_10499894 | Ga0207698_104998942 | 108 |
| 693 | 3300026142 | Ga0207698_10695561 | Ga0207698_106955611 | 108 |
| 694 | 3300026142 | Ga0207698_10767394 | Ga0207698_107673942 | 108 |
| 695 | 3300027378 | Ga0209981_1020177 | Ga0209981_10201771 | 108 |
| 696 | 3300027552 | Ga0209982_1023254 | Ga0209982_10232542 | 108 |
| 697 | 3300027617 | Ga0210002_1003266 | Ga0210002_10032661 | 108 |
| 698 | 3300027876 | Ga0209974_10012607 | Ga0209974_100126072 | 108 |
| 699 | 3300028379 | Ga0268266_10010702 | Ga0268266_100107023 | 108 |
| 700 | 3300028379 | Ga0268266_10061589 | Ga0268266_100615893 | 108 |
| 701 | 3300028379 | Ga0268266_10081640 | Ga0268266_100816402 | 108 |
| 702 | 3300028379 | Ga0268266_10118388 | Ga0268266_101183882 | 108 |
| 703 | 3300028379 | Ga0268266_10525897 | Ga0268266_105258971 | 108 |
| 704 | 3300028380 | Ga0268265_10193807 | Ga0268265_101938072 | 108 |
| 705 | 3300028380 | Ga0268265_10271622 | Ga0268265_102716222 | 108 |
| 706 | 3300028380 | Ga0268265_10291964 | Ga0268265_102919642 | 108 |
| 707 | 3300028380 | Ga0268265_11263326 | Ga0268265_112633262 | 108 |
| 708 | 3300028381 | Ga0268264_10053919 | Ga0268264_100539193 | 108 |
| 709 | 3300028381 | Ga0268264_10132723 | Ga0268264_101327232 | 108 |
| 710 | 3300028381 | Ga0268264_10323419 | Ga0268264_103234192 | 108 |
| 711 | 3300028381 | Ga0268264_10633718 | Ga0268264_106337182 | 108 |
| 712 | 3300028381 | Ga0268264_10685940 | Ga0268264_106859402 | 108 |
| 713 | 3300028381 | Ga0268264_11203575 | Ga0268264_112035752 | 108 |
| 714 | 3300031548 | Ga0307408_100004193 | Ga0307408_1000041932 | 108 |
| 715 | 3300031548 | Ga0307408_101964382 | Ga0307408_1019643821 | 108 |
| 716 | 3300031731 | Ga0307405_10009760 | Ga0307405_100097603 | 108 |
| 717 | 3300031824 | Ga0307413_10003113 | Ga0307413_100031135 | 108 |
| 718 | 3300031824 | Ga0307413_10934435 | Ga0307413_109344352 | 108 |
| 719 | 3300031852 | Ga0307410_10000921 | Ga0307410_100009215 | 108 |
| 720 | 3300031901 | Ga0307406_10006332 | Ga0307406_100063322 | 108 |
| 721 | 3300031903 | Ga0307407_10221143 | Ga0307407_102211432 | 108 |
| 722 | 3300031911 | Ga0307412_10056819 | Ga0307412_100568192 | 108 |
| 723 | 3300031995 | Ga0307409_100014278 | Ga0307409_1000142785 | 108 |
| 724 | 3300031995 | Ga0307409_100998311 | Ga0307409_1009983112 | 108 |
| 725 | 3300032002 | Ga0307416_100008070 | Ga0307416_1000080705 | 108 |
| 726 | 3300032005 | Ga0307411_10034405 | Ga0307411_100344054 | 108 |
| 727 | 3300032126 | Ga0307415_100008244 | Ga0307415_1000082442 | 108 |
| 728 | 3300032126 | Ga0307415_100459567 | Ga0307415_1004595672 | 108 |
| 729 | 3300035121 | Ga0373960_0092328 | Ga0373960_0092328_318_644 | 108 |
| 730 | 3300035170 | Ga0373943_0193549 | Ga0373943_0193549_134_460 | 108 |
| 731 | 3300035691 | Ga0373931_0199995 | Ga0373931_0199995_313_639 | 108 |
| 732 | 3300035691 | Ga0373931_0487697 | Ga0373931_0487697_218_556 | 108 |
| 733 | 3300037068 | Ga0373925_1106113 | Ga0373925_1106113_281_607 | 108 |
| 734 | 3300041452 | Ga0451793_0975526 | Ga0451793_0975526_149_475 | 108 |
| 735 | 3300042144 | Ga0450889_046187 | Ga0450889_046187_192_518 | 108 |
| 736 | 3300044694 | Ga0466963_0400401 | Ga0466963_0400401_498_824 | 108 |
| 737 | 3300046515 | Ga0495620_0237679 | Ga0495620_0237679_131_457 | 108 |
| 738 | 3300046528 | Ga0495642_0200515 | Ga0495642_0200515_286_612 | 108 |
| 739 | 3300046537 | Ga0495598_0021341 | Ga0495598_0021341_1287_1613 | 108 |
| 740 | 3300046539 | Ga0495621_0035684 | Ga0495621_0035684_917_1243 | 108 |
| 741 | 3300048903 | Ga0496100_0046877 | Ga0496100_0046877_312_638 | 108 |
| 742 | 3300048903 | Ga0496100_0256183 | Ga0496100_0256183_865_1191 | 108 |
| 743 | 3300048904 | Ga0496101_0009002 | Ga0496101_0009002_250_576 | 108 |
| 744 | 3300048904 | Ga0496101_0020149 | Ga0496101_0020149_1441_1767 | 108 |
| 745 | 3300048904 | Ga0496101_0758263 | Ga0496101_0758263_321_647 | 108 |
| 746 | 3300048905 | Ga0496102_0002745 | Ga0496102_0002745_6475_6801 | 108 |
| 747 | 3300048907 | Ga0496104_0011927 | Ga0496104_0011927_6876_7202 | 108 |
| 748 | 3300048908 | Ga0496105_0045848 | Ga0496105_0045848_236_562 | 108 |
| 749 | 3300048908 | Ga0496105_0451466 | Ga0496105_0451466_597_968 | 108 |
| 750 | 3300048909 | Ga0496106_0002746 | Ga0496106_0002746_2442_2768 | 108 |
| 751 | 3300048909 | Ga0496106_0036069 | Ga0496106_0036069_1418_1744 | 108 |
| 752 | 3300048909 | Ga0496106_0505509 | Ga0496106_0505509_535_861 | 108 |
| 753 | 3300048910 | Ga0496107_0014219 | Ga0496107_0014219_2362_2688 | 108 |
| 754 | 3300048910 | Ga0496107_0015023 | Ga0496107_0015023_5075_5401 | 108 |
| 755 | 3300048911 | Ga0496108_0047549 | Ga0496108_0047549_3208_3534 | 108 |
| 756 | 3300048911 | Ga0496108_0709071 | Ga0496108_0709071_338_685 | 108 |
| 757 | 3300048911 | Ga0496108_1442396 | Ga0496108_1442396_35_361 | 108 |
| 758 | 3300048912 | Ga0496109_0003042 | Ga0496109_0003042_10692_11018 | 108 |
| 759 | 3300048912 | Ga0496109_0156168 | Ga0496109_0156168_1553_1900 | 108 |
| 760 | 3300048912 | Ga0496109_0662476 | Ga0496109_0662476_206_532 | 108 |
| 761 | 3300048913 | Ga0496110_0031041 | Ga0496110_0031041_745_1071 | 108 |
| 762 | 3300048913 | Ga0496110_0761389 | Ga0496110_0761389_39_365 | 108 |
| 763 | 3300048913 | Ga0496110_1312691 | Ga0496110_1312691_178_555 | 108 |
| 764 | 3300048913 | Ga0496110_1373744 | Ga0496110_1373744_254_580 | 108 |
| 765 | 3300048914 | Ga0496111_0293967 | Ga0496111_0293967_530_856 | 108 |
| 766 | 3300048914 | Ga0496111_0967940 | Ga0496111_0967940_153_524 | 108 |
| 767 | 3300048915 | Ga0496112_0001624 | Ga0496112_0001624_5411_5737 | 108 |
| 768 | 3300048915 | Ga0496112_1306990 | Ga0496112_1306990_266_592 | 108 |
| 769 | 3300048916 | Ga0496113_0184766 | Ga0496113_0184766_485_811 | 108 |
| 770 | 3300048917 | Ga0496114_0013013 | Ga0496114_0013013_365_691 | 108 |
| 771 | 3300048917 | Ga0496114_0311744 | Ga0496114_0311744_374_700 | 108 |
| 772 | 3300048918 | Ga0496115_0336813 | Ga0496115_0336813_427_753 | 108 |
| 773 | 3300050507 | nmdc:mga05p37_224_c1 | nmdc:mga05p37_224_c1_49996_50328 | 108 |
| 774 | 3300050508 | nmdc:mga09592_4452_c1 | nmdc:mga09592_4452_c1_3602_3934 | 108 |
| 775 | 3300050509 | nmdc:mga0qj67_885756_c1 | nmdc:mga0qj67_885756_c1_90_416 | 108 |
| 776 | 3300050510 | nmdc:mga06r32_575548_c1 | nmdc:mga06r32_575548_c1_606_938 | 108 |
| 777 | 3300050513 | nmdc:mga0rr50_381258_c1 | nmdc:mga0rr50_381258_c1_552_878 | 108 |
| 778 | 3300050515 | nmdc:mga0a205_832073_c1 | nmdc:mga0a205_832073_c1_244_582 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rm3-assembly1.cif.gz_SE0 | evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome | 0.9022 | 55 | 96 |
| 6tjv-assembly1.cif.gz_S | structure of the ndh-1ms complex from thermosynechococcus elongatus | 0.875 | 55 | 96 |
| 3c4s-assembly2.cif.gz_B | crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42 | 0.8649 | 55 | 101 |
| 6wau-assembly1.cif.gz_A | complex structure of phf19 | 0.8623 | 55 | 97 |
| 2e5q-assembly1.cif.gz_A | solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens] | 0.8619 | 54 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I326_463_511_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9099 | 55 | 95 | 2.30.30.30 |
| af_A0A1D6JMV5_458_522_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8965 | 55 | 97 | 2.30.30.30 |
| af_P9WL75_5_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8855 | 22 | 98 | 2.40.50.140 |
| af_Q5ALX3_519_567_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8813 | 58 | 98 | 2.30.30.30 |
| af_Q2FXT7_4_82_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8762 | 22 | 98 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1VTE0-F1-model_v4 | Sec translocon accessory complex subunit YajC | 0.9994 | 44 | 108 |
GO:0005886
GO:0015031 |
| AF-A0A3G7TX04-F1-model_v4 | Sec translocon accessory complex subunit YajC | 0.9947 | 39 | 108 |
GO:0005886
GO:0015031 |
| AF-A0A7W0S0T5-F1-model_v4 | Preprotein translocase subunit YajC | 0.9779 | 34 | 101 |
GO:0005886
GO:0015031 |
| AF-A0A3C1VTE0-F1-model_v4 | Sec translocon accessory complex subunit YajC | 0.9696 | 44 | 108 |
GO:0005886
GO:0015031 |
| AF-A0A3A4U2I3-F1-model_v4 | Preprotein translocase subunit YajC | 0.9677 | 36 | 101 |
GO:0005886
GO:0015031 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar