F480383

General Info

Members Datasets Scaffolds Average Seq Length
777 419 760 251

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0077136|Ga0495645_0077136_548_1399
Length 283
Sequence MMQAMADAPTFATGSAAGSERAAPAASAARLDTASVLSVRGLVKRYGGLVVTQDVDLDLRRGEVHALVGPNGAGKTTLLGQLTGDVRSDAGRIYFGSRDITTLPVHRRARLGIGRSFQITSVFRDLTVIENALLAVQAHAGHSFRFWQRALDDTRHVAAAEGLLAQVGLADQAGRVASEMSHGEHRQLEIAIALAGQPQVLLLDEPMAGMGIEDSASLTRMLLAMKGTVSMLLVEHDMNAVFALADRISVLVYGQRIATGTPAEIRADLEVRRAYLGDDETAQ

Samples

Sample ID Description Type Environment
1 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
2 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
3 2643221736 Bosea sp. Root483D1 Isolate Unclassified
4 2841760612 Bosea sp. Tri-49 Isolate Nodule
5 2844104063 Bosea sp. Tri-39 Isolate Nodule
6 2851182111 Bosea sp. Tri-44 Isolate Nodule
7 2851246043 Bosea sp. Tri-54 Isolate Nodule
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
10 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
11 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
12 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
13 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
14 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
15 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
261 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
262 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
378 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
387 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
388 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
389 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
390 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
391 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
392 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
393 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
394 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
400 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
403 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
412 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
418 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
419 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.58
Nodule 0.77
Rhizoplane 5.28
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000807 3300001991 Bacteria 3948
2 JGI24738J21930_10004627 3300002075 Bacteria 3356
3 JGI24744J21845_10005767 3300002077 Bacteria 2565
4 JGI24034J26672_10006804 3300002239 Bacteria 1654
5 JGI24742J22300_10000495 3300002244 Bacteria 5860
6 JGI24751J29686_10010577 3300002459 Bacteria 1901
7 JGI25159J45721_1003052 3300002987 Bacteria 6057
8 JGI25151J46595_10063427 3300003187 Bacteria 1162
9 Ga0055526_1000208 3300003771 Bacteria 50614
10 Ga0055524_1012184 3300003775 Bacteria 3316
11 Ga0055540_1014170 3300003792 Bacteria 2391
12 Ga0055531_10001259 3300003794 Bacteria 19156
13 Ga0065165_1000545 3300005262 Bacteria 56973
14 Ga0070658_10234020 3300005327 Bacteria 1556
15 Ga0070676_10077808 3300005328 Bacteria 2006
16 Ga0070683_100090387 3300005329 Bacteria 2875
17 Ga0070690_100004018 3300005330 Bacteria 8138
18 Ga0070670_100017039 3300005331 Bacteria 6236
19 Ga0070670_100091318 3300005331 Bacteria 2618
20 Ga0070670_100343942 3300005331 Bacteria 1310
21 Ga0068869_100010076 3300005334 Bacteria 6148
22 Ga0070680_100169819 3300005336 Bacteria 1835
23 Ga0068868_100005853 3300005338 Bacteria 8669
24 Ga0068868_100239100 3300005338 Bacteria 1525
25 Ga0070660_100190286 3300005339 Bacteria 1662
26 Ga0070691_10050916 3300005341 Bacteria 1977
27 Ga0070687_100025293 3300005343 Bacteria 2847
28 Ga0070687_100068228 3300005343 Bacteria 1901
29 Ga0070668_100420044 3300005347 Bacteria 1145
30 Ga0070669_100099484 3300005353 Bacteria 2192
31 Ga0070669_100395094 3300005353 Bacteria 1130
32 Ga0070675_100059013 3300005354 Bacteria 3165
33 Ga0070671_100007665 3300005355 Bacteria 8630
34 Ga0070674_100032599 3300005356 Bacteria 3460
35 Ga0070673_100168008 3300005364 Bacteria 1871
36 Ga0070688_100179932 3300005365 Bacteria 1466
37 Ga0070659_100036341 3300005366 Bacteria 3840
38 Ga0070667_100055487 3300005367 Bacteria 3346
39 Ga0070667_100291235 3300005367 Bacteria 1468
40 Ga0070667_100693523 3300005367 Bacteria 942
41 Ga0070714_100146740 3300005435 Bacteria 2123
42 Ga0070713_100227564 3300005436 Bacteria 1694
43 Ga0070713_100399033 3300005436 Bacteria 1284
44 Ga0070710_10029448 3300005437 Bacteria 2946
45 Ga0070710_10031956 3300005437 Bacteria 2847
46 Ga0070711_100027700 3300005439 Bacteria 3723
47 Ga0070711_100031443 3300005439 Bacteria 3524
48 Ga0070700_100007292 3300005441 Bacteria 5958
49 Ga0070694_100038643 3300005444 Bacteria 3173
50 Ga0070694_100628932 3300005444 Bacteria 867
51 Ga0070708_100395891 3300005445 Bacteria 1302
52 Ga0070663_100350868 3300005455 Bacteria 1194
53 Ga0070662_100016800 3300005457 Bacteria 4919
54 Ga0070681_10066203 3300005458 Bacteria 3581
55 Ga0068867_100025736 3300005459 Bacteria 4223
56 Ga0070685_10005128 3300005466 Bacteria 6639
57 Ga0070706_100000143 3300005467 Bacteria 90046
58 Ga0070706_100099921 3300005467 Bacteria 2695
59 Ga0070707_100010752 3300005468 Bacteria 8525
60 Ga0070707_100771993 3300005468 Bacteria 925
61 Ga0070698_100008480 3300005471 Bacteria 11101
62 Ga0070698_100099339 3300005471 Bacteria 2884
63 Ga0070698_100339756 3300005471 Bacteria 1433
64 Ga0070699_100013891 3300005518 Bacteria 6926
65 Ga0070699_100067780 3300005518 Bacteria 3099
66 Ga0070699_100369682 3300005518 Bacteria 1293
67 Ga0070679_100010169 3300005530 Bacteria 8918
68 Ga0070679_100227559 3300005530 Bacteria 1825
69 Ga0070684_100299396 3300005535 Bacteria 1476
70 Ga0070697_100008684 3300005536 Bacteria 7936
71 Ga0070672_100014112 3300005543 Bacteria 5654
72 Ga0070686_100004245 3300005544 Bacteria 7895
73 Ga0070695_100149731 3300005545 Bacteria 1627
74 Ga0070696_100351399 3300005546 Bacteria 1142
75 Ga0070693_100415968 3300005547 Bacteria 936
76 Ga0070665_100030435 3300005548 Bacteria 5430
77 Ga0070665_100147957 3300005548 Bacteria 2351
78 Ga0070704_100404240 3300005549 Bacteria 1166
79 Ga0068855_100709067 3300005563 Bacteria 1076
80 Ga0070664_100087000 3300005564 Bacteria 2701
81 Ga0070664_100253423 3300005564 Bacteria 1583
82 Ga0068857_100071485 3300005577 Bacteria 3091
83 Ga0068854_100034610 3300005578 Bacteria 3530
84 Ga0068856_100143218 3300005614 Bacteria 2398
85 Ga0070702_100044518 3300005615 Bacteria 2506
86 Ga0068852_100066314 3300005616 Bacteria 3152
87 Ga0068852_100454413 3300005616 Bacteria 1269
88 Ga0068859_100047957 3300005617 Bacteria 4292
89 Ga0068859_100139513 3300005617 Bacteria 2498
90 Ga0068864_100007948 3300005618 Bacteria 8742
91 Ga0068864_100190831 3300005618 Bacteria 1878
92 Ga0068866_10120908 3300005718 Bacteria 1475
93 Ga0068851_10027848 3300005834 Bacteria 2788
94 Ga0068851_10040710 3300005834 Bacteria 2336
95 Ga0068870_10006927 3300005840 Bacteria 5027
96 Ga0068863_100049255 3300005841 Bacteria 3995
97 Ga0068858_100019529 3300005842 Bacteria 6337
98 Ga0068860_100014017 3300005843 Bacteria 7863
99 Ga0068860_100340376 3300005843 Bacteria 1475
100 Ga0068862_100229086 3300005844 Bacteria 1685
101 Ga0068862_100722287 3300005844 Bacteria 967
102 Ga0081455_10000029 3300005937 Bacteria 155672
103 Ga0081455_10007685 3300005937 Bacteria 11317
104 Ga0081455_10010700 3300005937 Bacteria 9278
105 Ga0081455_10024977 3300005937 Bacteria 5522
106 Ga0081455_10032195 3300005937 Bacteria 4729
107 Ga0081455_10032729 3300005937 Bacteria 4683
108 Ga0081538_10041774 3300005981 Bacteria 2904
109 Ga0081540_1046425 3300005983 Bacteria 2193
110 Ga0081539_10001002 3300005985 Bacteria 52454
111 Ga0081539_10059743 3300005985 Bacteria 2096
112 Ga0081539_10121412 3300005985 Bacteria 1297
113 Ga0070717_10091564 3300006028 Bacteria 2568
114 Ga0075365_10000251 3300006038 Bacteria 18353
115 Ga0075365_10011418 3300006038 Bacteria 5222
116 Ga0075365_10038565 3300006038 Bacteria 3106
117 Ga0075365_10048602 3300006038 Bacteria 2793
118 Ga0075365_10317384 3300006038 Bacteria 1097
119 Ga0075368_10003183 3300006042 Bacteria 5458
120 Ga0075363_100000009 3300006048 Bacteria 45960
121 Ga0075364_10000004 3300006051 Bacteria 110554
122 Ga0075364_10051200 3300006051 Bacteria 2696
123 Ga0075364_10063037 3300006051 Bacteria 2433
124 Ga0075364_10250832 3300006051 Bacteria 1203
125 Ga0070716_100255794 3300006173 Bacteria 1196
126 Ga0070712_100008801 3300006175 Bacteria 6357
127 Ga0070712_100046697 3300006175 Bacteria 2995
128 Ga0075362_10000009 3300006177 Bacteria 111748
129 Ga0075362_10187229 3300006177 Bacteria 1004
130 Ga0075367_10000178 3300006178 Bacteria 20621
131 Ga0075367_10109957 3300006178 Bacteria 1691
132 Ga0075367_10158396 3300006178 Bacteria 1407
133 Ga0075369_10000375 3300006186 Bacteria 13369
134 Ga0075369_10009946 3300006186 Bacteria 3711
135 Ga0075369_10203851 3300006186 Bacteria 913
136 Ga0075366_10001471 3300006195 Bacteria 11742
137 Ga0097621_100132627 3300006237 Bacteria 2122
138 Ga0097621_100501293 3300006237 Bacteria 1100
139 Ga0068871_100030574 3300006358 Bacteria 4241
140 Ga0075428_100031660 3300006844 Bacteria 5844
141 Ga0075428_100171759 3300006844 Bacteria 2349
142 Ga0075428_100237381 3300006844 Bacteria 1967
143 Ga0075428_100371521 3300006844 Bacteria 1533
144 Ga0075430_100070826 3300006846 Bacteria 2925
145 Ga0075430_100091977 3300006846 Bacteria 2536
146 Ga0075431_100060020 3300006847 Bacteria 3925
147 Ga0075431_100061230 3300006847 Bacteria 3884
148 Ga0075431_100117017 3300006847 Bacteria 2750
149 Ga0075431_100208611 3300006847 Bacteria 1996
150 Ga0075431_100227293 3300006847 Bacteria 1902
151 Ga0075433_10004204 3300006852 Bacteria 11174
152 Ga0075433_10005407 3300006852 Bacteria 10032
153 Ga0075433_10097265 3300006852 Bacteria 2605
154 Ga0075434_100000566 3300006871 Bacteria 28488
155 Ga0075434_100064742 3300006871 Bacteria 3640
156 Ga0075434_100137293 3300006871 Bacteria 2465
157 Ga0075434_100272472 3300006871 Bacteria 1712
158 Ga0075434_100377849 3300006871 Bacteria 1438
159 Ga0075434_100437829 3300006871 Bacteria 1328
160 Ga0075429_100036481 3300006880 Bacteria 4275
161 Ga0075429_100080870 3300006880 Bacteria 2833
162 Ga0075429_100212882 3300006880 Bacteria 1693
163 Ga0075429_100252969 3300006880 Bacteria 1543
164 Ga0068865_100103789 3300006881 Bacteria 2085
165 Ga0075436_100001004 3300006914 Bacteria 18958
166 Ga0075436_100001732 3300006914 Bacteria 14948
167 Ga0075436_100004495 3300006914 Bacteria 9571
168 Ga0075436_100024858 3300006914 Bacteria 4119
169 Ga0075436_100087608 3300006914 Bacteria 2163
170 Ga0075436_100097669 3300006914 Bacteria 2043
171 Ga0075436_100157948 3300006914 Bacteria 1598
172 Ga0097620_100047957 3300006931 Bacteria 4292
173 Ga0097620_100139505 3300006931 Bacteria 2498
174 Ga0075435_100000249 3300007076 Bacteria 33358
175 Ga0075435_100039504 3300007076 Bacteria 3766
176 Ga0075435_100040140 3300007076 Bacteria 3737
177 Ga0075435_100140249 3300007076 Bacteria 2028
178 Ga0075435_100215984 3300007076 Bacteria 1627
179 Ga0111539_10005703 3300009094 Bacteria 16116
180 Ga0111539_10025147 3300009094 Bacteria 7299
181 Ga0111539_10036658 3300009094 Bacteria 5926
182 Ga0111539_10266676 3300009094 Bacteria 1993
183 Ga0111539_10470781 3300009094 Bacteria 1463
184 Ga0105245_10015927 3300009098 Bacteria 6552
185 Ga0105247_10007157 3300009101 Bacteria 6848
186 Ga0105247_10106101 3300009101 Bacteria 1802
187 Ga0114129_10065588 3300009147 Bacteria 5067
188 Ga0105243_10515412 3300009148 Bacteria 1136
189 Ga0105242_10093120 3300009176 Bacteria 2540
190 Ga0105248_10019483 3300009177 Bacteria 7508
191 Ga0105248_10274923 3300009177 Bacteria 1896
192 Ga0105237_10021363 3300009545 Bacteria 6655
193 Ga0105238_10105147 3300009551 Bacteria 2804
194 Ga0105249_10046267 3300009553 Bacteria 3960
195 Ga0105249_10639158 3300009553 Bacteria 1121
196 Ga0105239_10057469 3300010375 Bacteria 4267
197 Ga0105239_10161158 3300010375 Bacteria 2506
198 Ga0157369_10515717 3300013105 Bacteria 1237
199 Ga0157374_10112267 3300013296 Bacteria 2622
200 Ga0157378_10016981 3300013297 Bacteria 6381
201 Ga0157378_10067520 3300013297 Bacteria 3205
202 Ga0163162_10020933 3300013306 Bacteria 6433
203 Ga0163162_10345511 3300013306 Bacteria 1620
204 Ga0163162_10366265 3300013306 Bacteria 1574
205 Ga0157375_10051481 3300013308 Bacteria 4044
206 Ga0157375_10059199 3300013308 Bacteria 3794
207 Ga0163163_10051301 3300014325 Bacteria 4067
208 Ga0163163_10065850 3300014325 Bacteria 3598
209 Ga0163163_10606211 3300014325 Bacteria 1158
210 Ga0157380_10041185 3300014326 Bacteria 3603
211 Ga0157377_10078775 3300014745 Bacteria 1921
212 Ga0157379_10093834 3300014968 Bacteria 2692
213 Ga0157376_10301818 3300014969 Bacteria 1516
214 Ga0183362_10002 3300015683 Bacteria 1432711
215 Ga0213872_10002719 3300021361 Bacteria 10181
216 Ga0213874_10018493 3300021377 Bacteria 1884
217 Ga0213874_10102910 3300021377 Bacteria 952
218 Ga0213876_10026642 3300021384 Bacteria 3049
219 Ga0213876_10074291 3300021384 Bacteria 1795
220 Ga0213875_10000012 3300021388 Bacteria 312017
221 Ga0209130_1000279 3300025284 Bacteria 63145
222 Ga0209025_1002770 3300025294 Bacteria 17696
223 Ga0209025_1004300 3300025294 Bacteria 12487
224 Ga0209025_1026885 3300025294 Bacteria 2872
225 Ga0209564_1000031 3300025295 Bacteria 494703
226 Ga0209758_1010140 3300025297 Bacteria 5699
227 Ga0209758_1028125 3300025297 Bacteria 2386
228 Ga0209256_1000435 3300025299 Bacteria 64366
229 Ga0209051_1000254 3300025303 Bacteria 90411
230 Ga0209051_1015332 3300025303 Bacteria 3530
231 Ga0209257_1000012 3300025304 Bacteria 1111138
232 Ga0209257_1000045 3300025304 Bacteria 484429
233 Ga0209257_1000137 3300025304 Bacteria 204210
234 Ga0207697_10037576 3300025315 Bacteria 1984
235 Ga0207656_10008444 3300025321 Bacteria 3793
236 Ga0207692_10020204 3300025898 Bacteria 3025
237 Ga0207710_10006578 3300025900 Bacteria 4956
238 Ga0207688_10001955 3300025901 Bacteria 11043
239 Ga0207680_10128499 3300025903 Bacteria 1667
240 Ga0207647_10014950 3300025904 Bacteria 5334
241 Ga0207645_10085814 3300025907 Bacteria 2021
242 Ga0207643_10002306 3300025908 Bacteria 10379
243 Ga0207684_10000210 3300025910 Bacteria 90345
244 Ga0207684_10086724 3300025910 Bacteria 2666
245 Ga0207684_10169937 3300025910 Bacteria 1879
246 Ga0207707_10039607 3300025912 Bacteria 4118
247 Ga0207707_10164725 3300025912 Bacteria 1938
248 Ga0207693_10002628 3300025915 Bacteria 15602
249 Ga0207693_10018726 3300025915 Bacteria 5511
250 Ga0207693_10460585 3300025915 Bacteria 993
251 Ga0207660_10016178 3300025917 Bacteria 4934
252 Ga0207662_10005153 3300025918 Bacteria 6933
253 Ga0207662_10519112 3300025918 Bacteria 822
254 Ga0207657_10031712 3300025919 Bacteria 4782
255 Ga0207649_10031949 3300025920 Bacteria 3133
256 Ga0207652_10010471 3300025921 Bacteria 7463
257 Ga0207652_10083212 3300025921 Bacteria 2802
258 Ga0207681_10070311 3300025923 Bacteria 2437
259 Ga0207650_10022493 3300025925 Bacteria 4463
260 Ga0207650_10073835 3300025925 Bacteria 2570
261 Ga0207650_10163679 3300025925 Bacteria 1764
262 Ga0207687_10008703 3300025927 Bacteria 6630
263 Ga0207700_10066003 3300025928 Bacteria 2764
264 Ga0207700_10240305 3300025928 Bacteria 1543
265 Ga0207644_10005434 3300025931 Bacteria 8308
266 Ga0207644_10112746 3300025931 Bacteria 2058
267 Ga0207690_10050226 3300025932 Bacteria 2783
268 Ga0207706_10010420 3300025933 Bacteria 8491
269 Ga0207706_10012014 3300025933 Bacteria 7889
270 Ga0207686_10137275 3300025934 Bacteria 1685
271 Ga0207686_10182471 3300025934 Bacteria 1489
272 Ga0207709_10010119 3300025935 Bacteria 5195
273 Ga0207670_10019125 3300025936 Bacteria 4176
274 Ga0207669_10008071 3300025937 Bacteria 4924
275 Ga0207704_10015967 3300025938 Bacteria 3844
276 Ga0207691_10014822 3300025940 Bacteria 7428
277 Ga0207711_10026744 3300025941 Bacteria 4843
278 Ga0207711_10113916 3300025941 Bacteria 2408
279 Ga0207689_10007381 3300025942 Bacteria 9639
280 Ga0207661_10026048 3300025944 Bacteria 4452
281 Ga0207679_10163410 3300025945 Bacteria 1825
282 Ga0207667_10383808 3300025949 Bacteria 1431
283 Ga0207651_10067955 3300025960 Bacteria 2510
284 Ga0207712_10006588 3300025961 Bacteria 7327
285 Ga0207712_10266697 3300025961 Bacteria 1391
286 Ga0207668_10261025 3300025972 Bacteria 1411
287 Ga0207668_10306377 3300025972 Bacteria 1313
288 Ga0207640_10026341 3300025981 Bacteria 3529
289 Ga0207658_10049277 3300025986 Bacteria 3094
290 Ga0207658_10096498 3300025986 Bacteria 2306
291 Ga0207677_10021718 3300026023 Bacteria 3928
292 Ga0207677_10136369 3300026023 Bacteria 1872
293 Ga0207703_10011944 3300026035 Bacteria 6765
294 Ga0207639_10201169 3300026041 Bacteria 1708
295 Ga0207678_10020954 3300026067 Bacteria 5729
296 Ga0207708_10017847 3300026075 Bacteria 5341
297 Ga0207708_10102872 3300026075 Bacteria 2212
298 Ga0207702_10180153 3300026078 Bacteria 1945
299 Ga0207641_10021597 3300026088 Bacteria 5289
300 Ga0207648_10024517 3300026089 Bacteria 5383
301 Ga0207648_10163187 3300026089 Bacteria 1968
302 Ga0207676_10064959 3300026095 Bacteria 2904
303 Ga0207676_10172798 3300026095 Bacteria 1884
304 Ga0207674_10011240 3300026116 Bacteria 10061
305 Ga0207674_10057274 3300026116 Bacteria 3951
306 Ga0207675_100008557 3300026118 Bacteria 9626
307 Ga0207683_10011574 3300026121 Bacteria 7532
308 Ga0207698_10001343 3300026142 Bacteria 14326
309 Ga0207698_10023423 3300026142 Bacteria 4313
310 Ga0209981_1005392 3300027378 Bacteria 1698
311 Ga0209966_1010126 3300027695 Bacteria 1695
312 Ga0209813_10003641 3300027866 Bacteria 3622
313 Ga0207428_10037508 3300027907 Bacteria 3943
314 Ga0207428_10180757 3300027907 Bacteria 1594
315 Ga0207428_10221271 3300027907 Bacteria 1419
316 Ga0268266_10036179 3300028379 Bacteria 4201
317 Ga0268266_10334415 3300028379 Bacteria 1420
318 Ga0268266_10724790 3300028379 Bacteria 959
319 Ga0268265_10188811 3300028380 Bacteria 1777
320 Ga0268264_10083710 3300028381 Bacteria 2733
321 Ga0268264_10286279 3300028381 Bacteria 1546
322 Ga0265318_10057032 3300028577 Bacteria 1460
323 Ga0307515_10006150 3300028794 Bacteria 24126
324 Ga0265338_10170600 3300028800 Bacteria 1669
325 Ga0265340_10045456 3300031247 Bacteria 2145
326 Ga0307513_10129155 3300031456 Bacteria 2476
327 Ga0307408_100162106 3300031548 Bacteria 1777
328 Ga0307514_10000530 3300031649 Bacteria 74660
329 Ga0307514_10012378 3300031649 Bacteria 7096
330 Ga0316576_10020926 3300031727 Bacteria 4514
331 Ga0307405_10297351 3300031731 Bacteria 1223
332 Ga0307406_10069755 3300031901 Bacteria 2299
333 Ga0307414_10522204 3300032004 Bacteria 1054
334 Ga0307411_10132017 3300032005 Bacteria 1827
335 Ga0307411_10223391 3300032005 Bacteria 1463
336 Ga0373929_0075460 3300035085 Bacteria 813
337 Ga0373934_0092238 3300035086 Bacteria 1221
338 Ga0373940_0041607 3300035088 Bacteria 1264
339 Ga0373952_0007421 3300035092 Bacteria 2055
340 Ga0373923_0026736 3300035111 Bacteria 2297
341 Ga0373932_0005547 3300035112 Bacteria 2967
342 Ga0373932_0019748 3300035112 Bacteria 1760
343 Ga0373932_0078500 3300035112 Bacteria 1038
344 Ga0373936_0011666 3300035113 Bacteria 3333
345 Ga0373936_0070284 3300035113 Bacteria 1442
346 Ga0373941_0030720 3300035115 Bacteria 1595
347 Ga0373953_0004090 3300035117 Bacteria 4619
348 Ga0373954_0013311 3300035118 Bacteria 3665
349 Ga0373954_0035235 3300035118 Bacteria 2320
350 Ga0373957_0015583 3300035120 Bacteria 2618
351 Ga0373957_0073157 3300035120 Bacteria 1343
352 Ga0373960_0003099 3300035121 Bacteria 3756
353 Ga0373960_0099562 3300035121 Bacteria 940
354 Ga0373943_0012623 3300035170 Bacteria 3807
355 Ga0373943_0182483 3300035170 Bacteria 1154
356 Ga0373943_0369929 3300035170 Bacteria 824
357 Ga0373946_0043534 3300035171 Bacteria 1850
358 Ga0373946_0051263 3300035171 Bacteria 1727
359 Ga0373942_0009381 3300035207 Bacteria 2291
360 Ga0373961_0021330 3300035241 Bacteria 1722
361 Ga0373961_0113029 3300035241 Bacteria 892
362 Ga0316574_0023966 3300035398 Bacteria 3648
363 Ga0373924_0001607 3300035410 Bacteria 7409
364 Ga0373931_0000143 3300035691 Bacteria 31467
365 Ga0373931_0002552 3300035691 Bacteria 8100
366 Ga0373935_0040267 3300035692 Bacteria 2932
367 Ga0373927_0018040 3300035695 Bacteria 4641
368 Ga0373927_0022658 3300035695 Bacteria 4113
369 Ga0373927_0454926 3300035695 Bacteria 845
370 Ga0373933_0040793 3300035724 Bacteria 2736
371 Ga0373933_0108005 3300035724 Bacteria 1733
372 Ga0373947_0034180 3300035725 Bacteria 3006
373 Ga0373937_0289984 3300036401 Bacteria 1546
374 Ga0373937_0309366 3300036401 Bacteria 1494
375 Ga0373937_0945995 3300036401 Bacteria 810
376 Ga0316582_0360834 3300036647 Bacteria 1000
377 Ga0316582_0401533 3300036647 Bacteria 944
378 Ga0373925_0048818 3300037068 Bacteria 3155
379 Ga0373925_0075572 3300037068 Bacteria 2553
380 Ga0373925_0096751 3300037068 Bacteria 2263
381 Ga0373925_0249292 3300037068 Bacteria 1424
382 Ga0373925_0337141 3300037068 Bacteria 1222
383 Ga0373925_0566391 3300037068 Bacteria 935
384 Ga0395899_0137724 3300037312 Bacteria 1739
385 Ga0395900_0181350 3300037418 Bacteria 2139
386 Ga0395898_0034742 3300037466 Bacteria 5018
387 Ga0395898_0082771 3300037466 Bacteria 3093
388 Ga0395898_0273449 3300037466 Bacteria 1611
389 Ga0395905_0110891 3300037471 Bacteria 2576
390 Ga0436364_0202668 3300037853 Bacteria 35432
391 Ga0436364_0477672 3300037853 Bacteria 3476
392 Ga0237819_03268 3300038705 Bacteria 2929
393 Ga0400483_154484 3300039062 Bacteria 2001
394 Ga0400489_92491 3300039093 Bacteria 4417
395 Ga0436365_0939829 3300039437 Bacteria 16436
396 Ga0436365_0995234 3300039437 Bacteria 2908
397 Ga0436361_1164300 3300039447 Bacteria 33594
398 Ga0436363_0947161 3300039450 Bacteria 3262
399 Ga0436363_1612610 3300039450 Bacteria 1411
400 Ga0439441_000026 3300042001 Bacteria 11272
401 Ga0439435_0000435 3300042436 Bacteria 6548
402 Ga0439435_0028107 3300042436 Bacteria 1509
403 Ga0439444_0001983 3300042437 Bacteria 2737
404 Ga0439460_0000313 3300042461 Bacteria 10209
405 Ga0439460_0012358 3300042461 Bacteria 2214
406 Ga0451577_0120146 3300042876 Bacteria 2354
407 Ga0451577_0432952 3300042876 Bacteria 1194
408 Ga0453683_0013232 3300044673 Bacteria 5393
409 Ga0451576_0016029 3300045051 Bacteria 8281
410 Ga0451576_0075928 3300045051 Bacteria 3497
411 Ga0451576_0173969 3300045051 Bacteria 2248
412 Ga0451576_0174857 3300045051 Bacteria 2242
413 Ga0451576_0309918 3300045051 Bacteria 1651
414 Ga0451576_0388737 3300045051 Bacteria 1462
415 Ga0495627_069015 3300046453 Bacteria 1035
416 Ga0495592_0000293 3300046454 Bacteria 42689
417 Ga0495592_0022152 3300046454 Bacteria 4834
418 Ga0495592_0077559 3300046454 Bacteria 2408
419 Ga0495592_0080106 3300046454 Bacteria 2363
420 Ga0495603_0004084 3300046455 Bacteria 8695
421 Ga0495603_0184236 3300046455 Bacteria 1208
422 Ga0495629_0194236 3300046459 Bacteria 1404
423 Ga0495638_0004606 3300046460 Bacteria 10435
424 Ga0495638_0203305 3300046460 Bacteria 1117
425 Ga0495641_0031174 3300046461 Bacteria 2549
426 Ga0495641_0088767 3300046461 Bacteria 1382
427 Ga0495641_0096769 3300046461 Bacteria 1317
428 Ga0495651_0017401 3300046462 Bacteria 5566
429 Ga0495653_0120125 3300046463 Bacteria 1874
430 Ga0495580_0078393 3300046472 Bacteria 2304
431 Ga0495580_0169580 3300046472 Bacteria 1509
432 Ga0495582_0005948 3300046473 Bacteria 6804
433 Ga0495582_0009300 3300046473 Bacteria 5421
434 Ga0495582_0092534 3300046473 Bacteria 1687
435 Ga0495605_0129333 3300046474 Bacteria 1140
436 Ga0495639_0038379 3300046475 Bacteria 2151
437 Ga0495662_0017151 3300046476 Bacteria 3506
438 Ga0495662_0017552 3300046476 Bacteria 3464
439 Ga0495662_0094328 3300046476 Bacteria 1461
440 Ga0495594_0029549 3300046499 Bacteria 2963
441 Ga0495596_0059724 3300046500 Bacteria 1486
442 Ga0495608_0001761 3300046511 Bacteria 15451
443 Ga0495610_0095563 3300046512 Bacteria 1339
444 Ga0495616_0061122 3300046513 Bacteria 1848
445 Ga0495618_0239457 3300046514 Bacteria 1141
446 Ga0495618_0307171 3300046514 Bacteria 984
447 Ga0495628_0000746 3300046516 Bacteria 30179
448 Ga0495628_0043841 3300046516 Bacteria 3561
449 Ga0495628_0092428 3300046516 Bacteria 2340
450 Ga0495628_0093551 3300046516 Bacteria 2325
451 Ga0495628_0327079 3300046516 Bacteria 1130
452 Ga0495631_0209137 3300046518 Bacteria 834
453 Ga0495643_0062396 3300046522 Bacteria 1973
454 Ga0495644_0007801 3300046523 Bacteria 4125
455 Ga0495663_0126267 3300046525 Bacteria 860
456 Ga0495666_0036188 3300046526 Bacteria 2404
457 Ga0495652_0039920 3300046529 Bacteria 4057
458 Ga0495652_0076784 3300046529 Bacteria 2770
459 Ga0495654_0000826 3300046530 Bacteria 23505
460 Ga0495665_0043165 3300046531 Bacteria 2398
461 Ga0495640_0025411 3300046533 Bacteria 4296
462 Ga0495640_0180418 3300046533 Bacteria 1346
463 Ga0495640_0249640 3300046533 Bacteria 1111
464 Ga0495586_0022883 3300046535 Bacteria 3335
465 Ga0495587_0029676 3300046536 Bacteria 3319
466 Ga0495587_0112243 3300046536 Bacteria 1565
467 Ga0495598_0000685 3300046537 Bacteria 6437
468 Ga0495598_0021304 3300046537 Bacteria 1723
469 Ga0495645_0000344 3300046543 Bacteria 32939
470 Ga0495645_0077136 3300046543 Bacteria 2396
471 Ga0495633_0003399 3300046558 Bacteria 10639
472 Ga0495633_0003906 3300046558 Bacteria 9723
473 Ga0495656_0071753 3300046615 Bacteria 1540
474 Ga0495634_0009572 3300046642 Bacteria 7141
475 Ga0495634_0152544 3300046642 Bacteria 1460
476 Ga0495625_0035167 3300046660 Bacteria 3694
477 Ga0495661_0149861 3300046665 Bacteria 1261
478 Ga0495588_0015365 3300046674 Bacteria 3683
479 Ga0495588_0038856 3300046674 Bacteria 2422
480 Ga0495657_0011823 3300046675 Bacteria 6508
481 Ga0495657_0121780 3300046675 Bacteria 1642
482 Ga0495599_0000231 3300046678 Bacteria 35177
483 Ga0495599_0017582 3300046678 Bacteria 4445
484 Ga0495599_0053162 3300046678 Bacteria 2537
485 Ga0495599_0068111 3300046678 Bacteria 2222
486 Ga0495647_0032041 3300046681 Bacteria 1957
487 Ga0495647_0045349 3300046681 Bacteria 1688
488 Ga0495647_0128274 3300046681 Bacteria 1072
489 Ga0495658_0053331 3300046683 Bacteria 2296
490 Ga0495658_0088218 3300046683 Bacteria 1833
491 Ga0495658_0172353 3300046683 Bacteria 1340
492 Ga0495669_0237680 3300046684 Bacteria 874
493 Ga0495613_0009212 3300046689 Bacteria 7319
494 Ga0495613_0027382 3300046689 Bacteria 4242
495 Ga0495613_0143616 3300046689 Bacteria 1704
496 Ga0495624_0118955 3300046690 Bacteria 1623
497 Ga0495624_0220077 3300046690 Bacteria 1151
498 Ga0495600_0006373 3300046809 Bacteria 7180
499 Ga0495604_0011098 3300047317 Bacteria 7151
500 Ga0495604_0041532 3300047317 Bacteria 3607
501 Ga0495636_0037611 3300047318 Bacteria 1999
502 Ga0495674_0036262 3300047319 Bacteria 4440
503 Ga0495674_0439379 3300047319 Bacteria 1049
504 Ga0495676_0002963 3300047321 Bacteria 15344
505 Ga0495676_0125672 3300047321 Bacteria 1859
506 Ga0495680_0066161 3300047322 Bacteria 2766
507 Ga0495680_0121848 3300047322 Bacteria 1924
508 Ga0495675_0068400 3300047444 Bacteria 2243
509 Ga0495681_0017707 3300047470 Bacteria 3946
510 Ga0495684_0041912 3300047471 Bacteria 3507
511 Ga0495684_0244441 3300047471 Bacteria 1308
512 Ga0495593_0011139 3300047673 Bacteria 5173
513 Ga0495614_0051299 3300048089 Bacteria 1768
514 Ga0495615_0005622 3300048090 Bacteria 2267
515 Ga0496100_0013107 3300048903 Bacteria 4772
516 Ga0496100_0114021 3300048903 Bacteria 1882
517 Ga0496100_0196857 3300048903 Bacteria 1466
518 Ga0496101_0022282 3300048904 Bacteria 4359
519 Ga0496101_0026227 3300048904 Bacteria 4051
520 Ga0496103_0026099 3300048906 Bacteria 3535
521 Ga0496104_0000463 3300048907 Bacteria 34981
522 Ga0496104_0048325 3300048907 Bacteria 4011
523 Ga0496104_0064199 3300048907 Bacteria 3483
524 Ga0496105_0002198 3300048908 Bacteria 14134
525 Ga0496105_0005212 3300048908 Bacteria 9848
526 Ga0496105_0012414 3300048908 Bacteria 6744
527 Ga0496105_0026741 3300048908 Bacteria 4710
528 Ga0496105_0042957 3300048908 Bacteria 3727
529 Ga0496106_0041073 3300048909 Bacteria 3465
530 Ga0496107_0039933 3300048910 Bacteria 3367
531 Ga0496107_0175831 3300048910 Bacteria 1589
532 Ga0496108_0001525 3300048911 Bacteria 18325
533 Ga0496108_0016595 3300048911 Bacteria 6012
534 Ga0496108_0061059 3300048911 Bacteria 3172
535 Ga0496109_0009507 3300048912 Bacteria 8287
536 Ga0496109_0315887 3300048912 Bacteria 1474
537 Ga0496109_0330721 3300048912 Bacteria 1438
538 Ga0496109_0537256 3300048912 Bacteria 1103
539 Ga0496110_0103767 3300048913 Bacteria 2550
540 Ga0496110_0251926 3300048913 Bacteria 1607
541 Ga0496111_0014852 3300048914 Bacteria 5329
542 Ga0496111_0147680 3300048914 Bacteria 1743
543 Ga0496111_0374877 3300048914 Bacteria 1053
544 Ga0496112_0003444 3300048915 Bacteria 13068
545 Ga0496112_0114032 3300048915 Bacteria 2673
546 Ga0496113_0023841 3300048916 Bacteria 4343
547 Ga0496114_0061573 3300048917 Bacteria 3139
548 Ga0496114_0071119 3300048917 Bacteria 2923
549 Ga0496114_0075530 3300048917 Bacteria 2839
550 Ga0496114_0159005 3300048917 Bacteria 1963
551 Ga0496115_0014189 3300048918 Bacteria 6029
552 Ga0496115_0051466 3300048918 Bacteria 3302
553 Ga0496115_0079123 3300048918 Bacteria 2676
554 Ga0496115_0092307 3300048918 Bacteria 2475
555 Ga0496115_0246831 3300048918 Bacteria 1470
556 Ga0496117_0313825 3300048920 Bacteria 824
557 Ga0496122_0007517 3300048925 Bacteria 12086
558 Ga0496122_0022553 3300048925 Bacteria 5590
559 Ga0496123_0023614 3300048926 Bacteria 4702
560 Ga0496123_0100138 3300048926 Bacteria 1689
561 Ga0496124_0043405 3300048927 Bacteria 3866
562 Ga0496125_0033052 3300048928 Bacteria 4585
563 Ga0496125_0080329 3300048928 Bacteria 2496
564 Ga0496126_0222345 3300048929 Bacteria 1585
565 Ga0501031_0000294 3300049568 Bacteria 28430
566 Ga0501032_0000049 3300049569 Bacteria 105967
567 Ga0501032_0000076 3300049569 Bacteria 83609
568 Ga0501033_0000093 3300049570 Bacteria 85243
569 Ga0501033_0000368 3300049570 Bacteria 43219
570 Ga0501033_0146346 3300049570 Bacteria 1706
571 Ga0501033_0191533 3300049570 Bacteria 1463
572 Ga0501034_0000826 3300049571 Bacteria 46024
573 Ga0501034_0000915 3300049571 Bacteria 43082
574 Ga0501034_0001640 3300049571 Bacteria 28905
575 Ga0501034_0348420 3300049571 Bacteria 1410
576 Ga0501036_0000014 3300049572 Bacteria 148705
577 Ga0501036_0000035 3300049572 Bacteria 88062
578 Ga0501036_0292759 3300049572 Bacteria 1362
579 Ga0501037_0000026 3300049573 Bacteria 142936
580 Ga0501037_0000042 3300049573 Bacteria 118407
581 Ga0501037_0067378 3300049573 Bacteria 2607
582 Ga0501038_0000024 3300049574 Bacteria 148705
583 Ga0501038_0000037 3300049574 Bacteria 124444
584 Ga0501038_0017697 3300049574 Bacteria 6441
585 Ga0501038_0117546 3300049574 Bacteria 2196
586 Ga0501038_0306974 3300049574 Bacteria 1244
587 Ga0501039_0000052 3300049575 Bacteria 95038
588 Ga0501039_0000263 3300049575 Bacteria 38312
589 Ga0501039_0008828 3300049575 Bacteria 7677
590 Ga0501039_0426464 3300049575 Bacteria 1042
591 Ga0501039_0550781 3300049575 Bacteria 905
592 Ga0501040_0000634 3300049576 Bacteria 21504
593 Ga0501040_0002520 3300049576 Bacteria 11807
594 Ga0501040_0023339 3300049576 Bacteria 4148
595 Ga0501040_0213076 3300049576 Bacteria 1373
596 Ga0501041_0029704 3300049577 Bacteria 3298
597 Ga0501042_0032822 3300049578 Bacteria 3678
598 Ga0501042_0039603 3300049578 Bacteria 3350
599 Ga0501042_0076035 3300049578 Bacteria 2403
600 Ga0501042_0096818 3300049578 Bacteria 2121
601 Ga0501042_0440510 3300049578 Bacteria 945
602 Ga0501042_0553933 3300049578 Bacteria 836
603 Ga0501043_0000115 3300049579 Bacteria 75659
604 Ga0501043_0000506 3300049579 Bacteria 35040
605 Ga0501043_0200986 3300049579 Bacteria 1547
606 Ga0501046_0000210 3300049580 Bacteria 60801
607 Ga0501046_0130813 3300049580 Bacteria 1904
608 Ga0501046_0135259 3300049580 Bacteria 1867
609 Ga0501047_0000094 3300049581 Bacteria 109928
610 Ga0501047_0000542 3300049581 Bacteria 40727
611 Ga0501047_0200556 3300049581 Bacteria 1856
612 Ga0501047_0268050 3300049581 Bacteria 1554
613 Ga0501047_0354342 3300049581 Bacteria 1304
614 Ga0501048_0048274 3300049582 Bacteria 3037
615 Ga0501048_0056259 3300049582 Bacteria 2791
616 Ga0501048_0262683 3300049582 Bacteria 1226
617 Ga0501067_0009643 3300049583 Bacteria 5345
618 Ga0501068_0001202 3300049584 Bacteria 13764
619 Ga0501070_0000134 3300049586 Bacteria 66993
620 Ga0501070_0023866 3300049586 Bacteria 5126
621 Ga0501070_0030970 3300049586 Bacteria 4481
622 Ga0501070_0115410 3300049586 Bacteria 2218
623 Ga0501070_0123682 3300049586 Bacteria 2138
624 Ga0501070_0184020 3300049586 Bacteria 1719
625 Ga0501071_0022936 3300049587 Bacteria 4355
626 Ga0501071_0493907 3300049587 Bacteria 938
627 Ga0501072_0018126 3300049588 Bacteria 5414
628 Ga0501072_0034935 3300049588 Bacteria 3940
629 Ga0501072_0062604 3300049588 Bacteria 2935
630 Ga0501072_0093062 3300049588 Bacteria 2394
631 Ga0501072_0165536 3300049588 Bacteria 1764
632 Ga0501073_0001636 3300049589 Bacteria 16614
633 Ga0501073_0263640 3300049589 Bacteria 1189
634 Ga0501074_0005960 3300049590 Bacteria 8792
635 Ga0501075_0003215 3300049591 Bacteria 10931
636 Ga0501075_0016426 3300049591 Bacteria 5333
637 Ga0501075_0070253 3300049591 Bacteria 2646
638 Ga0501075_0324186 3300049591 Bacteria 1174
639 Ga0501076_0003634 3300049592 Bacteria 10833
640 Ga0501077_0024862 3300049593 Bacteria 3803
641 Ga0501079_0004535 3300049741 Bacteria 10303
642 Ga0501079_0036212 3300049741 Bacteria 3801
643 Ga0501079_0045544 3300049741 Bacteria 3385
644 Ga0501079_0266550 3300049741 Bacteria 1339
645 Ga0501080_0000076 3300049742 Bacteria 66341
646 Ga0501080_0009888 3300049742 Bacteria 8713
647 Ga0501080_0018127 3300049742 Bacteria 6517
648 Ga0501080_0073773 3300049742 Bacteria 3174
649 Ga0501081_0012551 3300049743 Bacteria 5571
650 Ga0501081_0108093 3300049743 Bacteria 1973
651 Ga0501035_0000045 3300049822 Bacteria 148705
652 Ga0501035_0000533 3300049822 Bacteria 42510
653 Ga0501035_0104813 3300049822 Bacteria 2480
654 Ga0501035_0291976 3300049822 Bacteria 1376
655 Ga0501035_0310050 3300049822 Bacteria 1328
656 Ga0501044_0000044 3300049823 Bacteria 148705
657 Ga0501044_0000507 3300049823 Bacteria 47418
658 Ga0501044_0005311 3300049823 Bacteria 14327
659 Ga0501044_0217078 3300049823 Bacteria 1864
660 Ga0501044_0473931 3300049823 Bacteria 1156
661 Ga0501045_0028758 3300049824 Bacteria 4011
662 Ga0501045_0209211 3300049824 Bacteria 1453
663 Ga0501045_0246490 3300049824 Bacteria 1330
664 Ga0501045_0328515 3300049824 Bacteria 1138
665 nmdc:mga03683_104131_c1 3300050489 Bacteria 1249
666 nmdc:mga03683_11_c1 3300050489 Bacteria 120565
667 nmdc:mga03683_53179_c1 3300050489 Bacteria 1694
668 nmdc:mga03n38_1_c1 3300050490 Bacteria 91975
669 nmdc:mga03n38_67202_c1 3300050490 Bacteria 1649
670 nmdc:mga00v17_1_c1 3300050491 Bacteria 292294
671 nmdc:mga00v17_332103_c1 3300050491 Bacteria 988
672 nmdc:mga00v17_345416_c1 3300050491 Bacteria 967
673 nmdc:mga0yw44_15969_c1 3300050492 Bacteria 4041
674 nmdc:mga0yw44_2741_c1 3300050492 Bacteria 7619
675 nmdc:mga0yw44_59_c1 3300050492 Bacteria 39505
676 nmdc:mga0yw44_69602_c1 3300050492 Bacteria 2180
677 nmdc:mga0yw44_84551_c1 3300050492 Bacteria 1995
678 nmdc:mga0k408_1437_c1 3300050493 Bacteria 12900
679 nmdc:mga0k408_62655_c1 3300050493 Bacteria 2163
680 nmdc:mga06z11_124219_c1 3300050494 Bacteria 1443
681 nmdc:mga06z11_312379_c1 3300050494 Bacteria 936
682 nmdc:mga06z11_4192_c1 3300050494 Bacteria 5646
683 nmdc:mga04h51_22015_c1 3300050495 Bacteria 1924
684 nmdc:mga07m45_17843_c1 3300050496 Bacteria 3819
685 nmdc:mga07m45_234592_c1 3300050496 Bacteria 1067
686 nmdc:mga05p37_151446_c1 3300050507 Bacteria 2836
687 nmdc:mga05p37_211951_c1 3300050507 Bacteria 2341
688 nmdc:mga05p37_254119_c1 3300050507 Bacteria 2107
689 nmdc:mga09592_244315_c1 3300050508 Bacteria 1556
690 nmdc:mga09592_28428_c1 3300050508 Bacteria 4644
691 nmdc:mga09592_71497_c1 3300050508 Bacteria 2945
692 nmdc:mga0qj67_53906_c1 3300050509 Bacteria 3184
693 nmdc:mga0qj67_55712_c1 3300050509 Bacteria 3133
694 nmdc:mga0qj67_60783_c1 3300050509 Bacteria 2999
695 nmdc:mga06r32_106357_c1 3300050510 Bacteria 2757
696 nmdc:mga06r32_106903_c1 3300050510 Bacteria 2749
697 nmdc:mga06r32_154133_c1 3300050510 Bacteria 2277
698 nmdc:mga06r32_441013_c1 3300050510 Bacteria 1282
699 nmdc:mga06r32_75944_c1 3300050510 Bacteria 3262
700 nmdc:mga08y16_153159_c1 3300050511 Bacteria 2396
701 nmdc:mga08y16_228040_c1 3300050511 Bacteria 1927
702 nmdc:mga08y16_271970_c1 3300050511 Bacteria 1749
703 nmdc:mga08y16_315748_c1 3300050511 Bacteria 1609
704 nmdc:mga08y16_67535_c1 3300050511 Bacteria 3729
705 nmdc:mga08y16_85029_c1 3300050511 Bacteria 3297
706 nmdc:mga0n895_303025_c1 3300050512 Bacteria 1620
707 nmdc:mga0n895_511_c1 3300050512 Bacteria 26369
708 nmdc:mga0n895_79017_c1 3300050512 Bacteria 3275
709 nmdc:mga0n895_79816_c1 3300050512 Bacteria 3259
710 nmdc:mga0n895_9838_c1 3300050512 Bacteria 8407
711 nmdc:mga0rr50_106176_c1 3300050513 Bacteria 2215
712 nmdc:mga0rr50_1254_c1 3300050513 Bacteria 13821
713 nmdc:mga0rr50_35085_c1 3300050513 Bacteria 3599
714 nmdc:mga08x19_15633_c1 3300050514 Bacteria 4618
715 nmdc:mga08x19_1634_c1 3300050514 Bacteria 13867
716 nmdc:mga08x19_4635_c1 3300050514 Bacteria 8157
717 nmdc:mga08x19_892_c1 3300050514 Bacteria 18990
718 nmdc:mga0a205_106_c1 3300050515 Bacteria 48183
719 nmdc:mga0a205_5548_c1 3300050515 Bacteria 11365
720 nmdc:mga0sz30_135785_c1 3300050516 Bacteria 1085
721 nmdc:mga0sz30_393_c1 3300050516 Bacteria 5163
722 nmdc:mga0sz30_5_c1 3300050516 Bacteria 189060
723 Ga0495655_0018811 3300053083 Bacteria 1524
724 Ga0495595_0006358 3300053084 Bacteria 4813
725 Ga0495619_0002736 3300053085 Bacteria 11516
726 Ga0495619_0033847 3300053085 Bacteria 3319
727 Ga0495619_0042447 3300053085 Bacteria 2979
728 Ga0500643_002537 3300053087 Bacteria 9334
729 Ga0500644_0112787 3300053088 Bacteria 1049
730 Ga0500560_054459 3300053107 Bacteria 1291
731 Ga0500562_013980 3300053108 Bacteria 2053
732 Ga0500569_042677 3300053109 Bacteria 1336
733 Ga0500572_001159 3300053111 Bacteria 7619
734 Ga0500572_002416 3300053111 Bacteria 4499
735 Ga0500572_045189 3300053111 Bacteria 1294
736 Ga0500607_008580 3300053121 Bacteria 6204
737 Ga0500607_031346 3300053121 Bacteria 2924
738 Ga0500618_000788 3300053125 Bacteria 17747
739 Ga0500642_0197505 3300053130 Bacteria 937
740 Ga0500561_0000120 3300053137 Bacteria 15160
741 Ga0500577_0032391 3300053142 Bacteria 1838
742 Ga0500604_0103237 3300053151 Bacteria 941
743 Ga0500616_0000981 3300053153 Bacteria 30834
744 Ga0500616_0001578 3300053153 Bacteria 21281
745 Ga0500616_0003402 3300053153 Bacteria 12208
746 Ga0500616_0047785 3300053153 Bacteria 2271
747 Ga0500624_000594 3300053157 Bacteria 9896
748 Ga0500634_0006374 3300053161 Bacteria 5702
749 Ga0500634_0028476 3300053161 Bacteria 3043
750 Ga0500634_0049897 3300053161 Bacteria 2256
751 Ga0500636_0000029 3300053177 Bacteria 78079
752 Ga0500596_003621 3300053735 Bacteria 2911
753 Ga0501084_0050222 3300054114 Bacteria 3491
754 Ga0501084_0053585 3300054114 Bacteria 3374
755 Ga0501082_0116447 3300060353 Bacteria 2314
756 Ga0501082_0388275 3300060353 Bacteria 1218
757 Ga0501082_0747011 3300060353 Bacteria 856
758 Ga0530510_0001937 3300061734 Bacteria 14163
759 Ga0530510_0015068 3300061734 Bacteria 5460
760 Ga0530510_0291677 3300061734 Bacteria 1220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0005960 Ga0501074_0005960_20_625 201
2 3300037418 Ga0395900_0181350 Ga0395900_0181350_364_1119 202
3 3300037466 Ga0395898_0034742 Ga0395898_0034742_1261_2016 202
4 3300005937 Ga0081455_10000029 Ga0081455_10000029133 204
5 3300049589 Ga0501073_0263640 Ga0501073_0263640_17_640 207
6 3300005467 Ga0070706_100099921 Ga0070706_1000999212 222
7 3300035121 Ga0373960_0003099 Ga0373960_0003099_10_744 223
8 3300005338 Ga0068868_100239100 Ga0068868_1002391002 226
9 3300013306 Ga0163162_10345511 Ga0163162_103455113 226
10 3300026023 Ga0207677_10136369 Ga0207677_101363692 226
11 3300053130 Ga0500642_0197505 Ga0500642_0197505_45_806 226
12 3300005355 Ga0070671_100007665 Ga0070671_1000076657 227
13 3300013297 Ga0157378_10016981 Ga0157378_100169816 227
14 3300014325 Ga0163163_10606211 Ga0163163_106062112 227
15 3300025903 Ga0207680_10128499 Ga0207680_101284992 227
16 3300025931 Ga0207644_10005434 Ga0207644_100054342 227
17 3300025986 Ga0207658_10096498 Ga0207658_100964983 227
18 3300026089 Ga0207648_10163187 Ga0207648_101631872 227
19 3300035092 Ga0373952_0007421 Ga0373952_0007421_137_913 227
20 3300035112 Ga0373932_0019748 Ga0373932_0019748_625_1401 227
21 3300035241 Ga0373961_0021330 Ga0373961_0021330_838_1614 227
22 3300035691 Ga0373931_0000143 Ga0373931_0000143_25868_26644 227
23 3300049570 Ga0501033_0146346 Ga0501033_0146346_1010_1693 227
24 3300060353 Ga0501082_0388275 Ga0501082_0388275_521_1207 228
25 3300005518 Ga0070699_100013891 Ga0070699_1000138914 229
26 3300048928 Ga0496125_0080329 Ga0496125_0080329_1718_2416 231
27 3300006186 Ga0075369_10203851 Ga0075369_102038512 232
28 3300028800 Ga0265338_10170600 Ga0265338_101706002 233
29 3300025303 Ga0209051_1015332 Ga0209051_10153323 234
30 3300047318 Ga0495636_0037611 Ga0495636_0037611_332_1075 234
31 3300053142 Ga0500577_0032391 Ga0500577_0032391_1042_1746 234
32 3300048928 Ga0496125_0033052 Ga0496125_0033052_1298_2077 235
33 3300021377 Ga0213874_10102910 Ga0213874_101029101 236
34 3300037853 Ga0436364_0477672 Ga0436364_0477672_498_1223 236
35 3300046525 Ga0495663_0126267 Ga0495663_0126267_38_814 236
36 3300006847 Ga0075431_100117017 Ga0075431_1001170172 237
37 3300050510 nmdc:mga06r32_106903_c1 nmdc:mga06r32_106903_c1_816_1550 237
38 3300037068 Ga0373925_0075572 Ga0373925_0075572_321_1058 241
39 3300046558 Ga0495633_0003399 Ga0495633_0003399_8269_9045 242
40 3300006844 Ga0075428_100371521 Ga0075428_1003715212 243
41 3300027695 Ga0209966_1010126 Ga0209966_10101262 243
42 3300042001 Ga0439441_000026 Ga0439441_000026_6360_7091 243
43 3300042436 Ga0439435_0000435 Ga0439435_0000435_3709_4440 243
44 3300042436 Ga0439435_0028107 Ga0439435_0028107_735_1466 243
45 3300042437 Ga0439444_0001983 Ga0439444_0001983_1276_2007 243
46 3300042461 Ga0439460_0000313 Ga0439460_0000313_814_1545 243
47 3300042461 Ga0439460_0012358 Ga0439460_0012358_516_1247 243
48 3300049570 Ga0501033_0191533 Ga0501033_0191533_640_1371 243
49 3300049573 Ga0501037_0067378 Ga0501037_0067378_132_863 243
50 3300049574 Ga0501038_0117546 Ga0501038_0117546_712_1443 243
51 3300049574 Ga0501038_0306974 Ga0501038_0306974_35_766 243
52 3300049575 Ga0501039_0008828 Ga0501039_0008828_977_1708 243
53 3300049576 Ga0501040_0002520 Ga0501040_0002520_405_1136 243
54 3300049576 Ga0501040_0023339 Ga0501040_0023339_2222_2953 243
55 3300049577 Ga0501041_0029704 Ga0501041_0029704_1915_2646 243
56 3300049578 Ga0501042_0039603 Ga0501042_0039603_1969_2700 243
57 3300049578 Ga0501042_0076035 Ga0501042_0076035_120_851 243
58 3300049578 Ga0501042_0096818 Ga0501042_0096818_135_866 243
59 3300049580 Ga0501046_0130813 Ga0501046_0130813_441_1172 243
60 3300049580 Ga0501046_0135259 Ga0501046_0135259_520_1251 243
61 3300049582 Ga0501048_0262683 Ga0501048_0262683_392_1123 243
62 3300049587 Ga0501071_0493907 Ga0501071_0493907_165_896 243
63 3300049588 Ga0501072_0018126 Ga0501072_0018126_1782_2513 243
64 3300049591 Ga0501075_0003215 Ga0501075_0003215_1978_2709 243
65 3300049591 Ga0501075_0070253 Ga0501075_0070253_1138_1869 243
66 3300049593 Ga0501077_0024862 Ga0501077_0024862_2786_3517 243
67 3300049741 Ga0501079_0004535 Ga0501079_0004535_8004_8735 243
68 3300049741 Ga0501079_0045544 Ga0501079_0045544_1342_2073 243
69 3300049741 Ga0501079_0266550 Ga0501079_0266550_34_765 243
70 3300049742 Ga0501080_0009888 Ga0501080_0009888_5377_6108 243
71 3300049743 Ga0501081_0012551 Ga0501081_0012551_3168_3899 243
72 3300049822 Ga0501035_0310050 Ga0501035_0310050_19_750 243
73 3300049824 Ga0501045_0209211 Ga0501045_0209211_617_1348 243
74 3300050508 nmdc:mga09592_71497_c1 nmdc:mga09592_71497_c1_491_1222 243
75 3300050509 nmdc:mga0qj67_55712_c1 nmdc:mga0qj67_55712_c1_944_1675 243
76 3300050510 nmdc:mga06r32_106357_c1 nmdc:mga06r32_106357_c1_590_1321 243
77 3300054114 Ga0501084_0050222 Ga0501084_0050222_934_1665 243
78 3300060353 Ga0501082_0116447 Ga0501082_0116447_111_842 243
79 3300061734 Ga0530510_0001937 Ga0530510_0001937_6896_7627 243
80 3300005545 Ga0070695_100149731 Ga0070695_1001497312 244
81 3300006914 Ga0075436_100004495 Ga0075436_1000044958 244
82 3300031731 Ga0307405_10297351 Ga0307405_102973512 244
83 3300035113 Ga0373936_0070284 Ga0373936_0070284_681_1415 244
84 3300036401 Ga0373937_0309366 Ga0373937_0309366_471_1205 244
85 3300046454 Ga0495592_0080106 Ga0495592_0080106_970_1704 244
86 3300046476 Ga0495662_0017151 Ga0495662_0017151_2549_3283 244
87 3300046511 Ga0495608_0001761 Ga0495608_0001761_5908_6642 244
88 3300046516 Ga0495628_0092428 Ga0495628_0092428_1406_2140 244
89 3300046529 Ga0495652_0039920 Ga0495652_0039920_407_1141 244
90 3300046535 Ga0495586_0022883 Ga0495586_0022883_2561_3295 244
91 3300046536 Ga0495587_0112243 Ga0495587_0112243_505_1239 244
92 3300046642 Ga0495634_0009572 Ga0495634_0009572_2334_3068 244
93 3300046683 Ga0495658_0053331 Ga0495658_0053331_1219_1953 244
94 3300046689 Ga0495613_0027382 Ga0495613_0027382_34_768 244
95 3300046690 Ga0495624_0220077 Ga0495624_0220077_294_1028 244
96 3300047322 Ga0495680_0066161 Ga0495680_0066161_649_1383 244
97 3300047471 Ga0495684_0244441 Ga0495684_0244441_529_1263 244
98 3300061734 Ga0530510_0291677 Ga0530510_0291677_81_845 244
99 3300005617 Ga0068859_100139513 Ga0068859_1001395133 245
100 3300005843 Ga0068860_100340376 Ga0068860_1003403762 245
101 3300005844 Ga0068862_100722287 Ga0068862_1007222871 245
102 3300005985 Ga0081539_10121412 Ga0081539_101214122 245
103 3300006852 Ga0075433_10005407 Ga0075433_100054074 245
104 3300006871 Ga0075434_100000566 Ga0075434_1000005666 245
105 3300006914 Ga0075436_100001004 Ga0075436_10000100414 245
106 3300006914 Ga0075436_100001732 Ga0075436_10000173212 245
107 3300006931 Ga0097620_100139505 Ga0097620_1001395053 245
108 3300007076 Ga0075435_100000249 Ga0075435_10000024913 245
109 3300009094 Ga0111539_10005703 Ga0111539_1000570317 245
110 3300014745 Ga0157377_10078775 Ga0157377_100787752 245
111 3300025918 Ga0207662_10519112 Ga0207662_105191121 245
112 3300050512 nmdc:mga0n895_511_c1 nmdc:mga0n895_511_c1_18000_18737 245
113 3300050513 nmdc:mga0rr50_1254_c1 nmdc:mga0rr50_1254_c1_3753_4490 245
114 3300050514 nmdc:mga08x19_1634_c1 nmdc:mga08x19_1634_c1_3754_4491 245
115 3300050514 nmdc:mga08x19_892_c1 nmdc:mga08x19_892_c1_4689_5426 245
116 3300050515 nmdc:mga0a205_106_c1 nmdc:mga0a205_106_c1_44020_44757 245
117 iso_pu_bacteria 2643221550 2643771471 245
118 iso_pu_bacteria 2643221564 2643836762 245
119 iso_pu_bacteria 2643221736 2644743938 245
120 iso_pu_bacteria 2841760612 2841765593 245
121 iso_pu_bacteria 2844104063 2844107203 245
122 iso_pu_bacteria 2851182111 2851186174 245
123 iso_pu_bacteria 2851246043 2851249243 245
124 iso_pu_bacteria 2881101125 2881104018 245
125 iso_pu_bacteria 2919704043 2919704758 245
126 iso_pu_bacteria 2970026789 2970030686 245
127 iso_pu_bacteria 2989349275 2989350285 245
128 iso_pu_bacteria 2996310559 2996312099 245
129 iso_pu_bacteria 8057529695 8057532239 245
130 3300005548 Ga0070665_100030435 Ga0070665_1000304352 246
131 3300013308 Ga0157375_10051481 Ga0157375_100514813 246
132 3300025294 Ga0209025_1002770 Ga0209025_100277017 246
133 3300026075 Ga0207708_10102872 Ga0207708_101028722 246
134 iso_pu_bacteria 2929199973 2929202693 246
135 3300005343 Ga0070687_100068228 Ga0070687_1000682282 247
136 3300005468 Ga0070707_100771993 Ga0070707_1007719931 247
137 3300005616 Ga0068852_100066314 Ga0068852_1000663143 247
138 3300005834 Ga0068851_10040710 Ga0068851_100407103 247
139 3300005985 Ga0081539_10059743 Ga0081539_100597432 247
140 3300006173 Ga0070716_100255794 Ga0070716_1002557942 247
141 3300006237 Ga0097621_100501293 Ga0097621_1005012932 247
142 3300006846 Ga0075430_100070826 Ga0075430_1000708263 247
143 3300006847 Ga0075431_100227293 Ga0075431_1002272932 247
144 3300006871 Ga0075434_100377849 Ga0075434_1003778492 247
145 3300006880 Ga0075429_100036481 Ga0075429_1000364815 247
146 3300006880 Ga0075429_100252969 Ga0075429_1002529692 247
147 3300006914 Ga0075436_100087608 Ga0075436_1000876083 247
148 3300007076 Ga0075435_100140249 Ga0075435_1001402493 247
149 3300009094 Ga0111539_10036658 Ga0111539_100366584 247
150 3300025321 Ga0207656_10008444 Ga0207656_100084443 247
151 3300026142 Ga0207698_10001343 Ga0207698_1000134314 247
152 3300027378 Ga0209981_1005392 Ga0209981_10053922 247
153 3300032005 Ga0307411_10132017 Ga0307411_101320172 247
154 3300035086 Ga0373934_0092238 Ga0373934_0092238_252_995 247
155 3300035111 Ga0373923_0026736 Ga0373923_0026736_683_1426 247
156 3300035118 Ga0373954_0035235 Ga0373954_0035235_279_1022 247
157 3300035120 Ga0373957_0073157 Ga0373957_0073157_519_1262 247
158 3300035170 Ga0373943_0182483 Ga0373943_0182483_393_1136 247
159 3300035171 Ga0373946_0051263 Ga0373946_0051263_579_1322 247
160 3300035692 Ga0373935_0040267 Ga0373935_0040267_130_873 247
161 3300035724 Ga0373933_0040793 Ga0373933_0040793_1301_2044 247
162 3300037068 Ga0373925_0337141 Ga0373925_0337141_144_887 247
163 3300045051 Ga0451576_0309918 Ga0451576_0309918_586_1329 247
164 3300046454 Ga0495592_0000293 Ga0495592_0000293_23662_24405 247
165 3300046454 Ga0495592_0077559 Ga0495592_0077559_1022_1765 247
166 3300046459 Ga0495629_0194236 Ga0495629_0194236_218_961 247
167 3300046461 Ga0495641_0096769 Ga0495641_0096769_468_1211 247
168 3300046473 Ga0495582_0092534 Ga0495582_0092534_82_825 247
169 3300046476 Ga0495662_0017552 Ga0495662_0017552_2656_3399 247
170 3300046516 Ga0495628_0000746 Ga0495628_0000746_2748_3491 247
171 3300046516 Ga0495628_0327079 Ga0495628_0327079_186_929 247
172 3300046526 Ga0495666_0036188 Ga0495666_0036188_1194_1937 247
173 3300046529 Ga0495652_0076784 Ga0495652_0076784_1079_1822 247
174 3300046530 Ga0495654_0000826 Ga0495654_0000826_19565_20311 247
175 3300046531 Ga0495665_0043165 Ga0495665_0043165_1201_1944 247
176 3300046533 Ga0495640_0249640 Ga0495640_0249640_278_1021 247
177 3300046543 Ga0495645_0000344 Ga0495645_0000344_27141_27884 247
178 3300046642 Ga0495634_0152544 Ga0495634_0152544_249_992 247
179 3300046675 Ga0495657_0121780 Ga0495657_0121780_110_853 247
180 3300046678 Ga0495599_0000231 Ga0495599_0000231_34188_34931 247
181 3300046678 Ga0495599_0053162 Ga0495599_0053162_1239_1982 247
182 3300046681 Ga0495647_0045349 Ga0495647_0045349_42_785 247
183 3300046690 Ga0495624_0118955 Ga0495624_0118955_43_786 247
184 3300047317 Ga0495604_0011098 Ga0495604_0011098_4654_5397 247
185 3300047319 Ga0495674_0439379 Ga0495674_0439379_58_801 247
186 3300048907 Ga0496104_0048325 Ga0496104_0048325_374_1117 247
187 3300049568 Ga0501031_0000294 Ga0501031_0000294_24812_25555 247
188 3300049569 Ga0501032_0000076 Ga0501032_0000076_52429_53172 247
189 3300049570 Ga0501033_0000093 Ga0501033_0000093_32072_32815 247
190 3300049571 Ga0501034_0001640 Ga0501034_0001640_8319_9062 247
191 3300049572 Ga0501036_0000035 Ga0501036_0000035_34893_35636 247
192 3300049573 Ga0501037_0000026 Ga0501037_0000026_30677_31420 247
193 3300049574 Ga0501038_0000037 Ga0501038_0000037_52402_53145 247
194 3300049575 Ga0501039_0000263 Ga0501039_0000263_15058_15801 247
195 3300049578 Ga0501042_0553933 Ga0501042_0553933_32_775 247
196 3300049579 Ga0501043_0000115 Ga0501043_0000115_22514_23257 247
197 3300049580 Ga0501046_0000210 Ga0501046_0000210_22486_23229 247
198 3300049581 Ga0501047_0000094 Ga0501047_0000094_29721_30464 247
199 3300049582 Ga0501048_0056259 Ga0501048_0056259_1799_2542 247
200 3300049583 Ga0501067_0009643 Ga0501067_0009643_3915_4658 247
201 3300049584 Ga0501068_0001202 Ga0501068_0001202_5008_5751 247
202 3300049586 Ga0501070_0000134 Ga0501070_0000134_29817_30560 247
203 3300049588 Ga0501072_0034935 Ga0501072_0034935_1289_2032 247
204 3300049589 Ga0501073_0001636 Ga0501073_0001636_15300_16043 247
205 3300049742 Ga0501080_0000076 Ga0501080_0000076_16953_17696 247
206 3300049822 Ga0501035_0000533 Ga0501035_0000533_22514_23257 247
207 3300049823 Ga0501044_0000507 Ga0501044_0000507_16954_17697 247
208 3300050508 nmdc:mga09592_28428_c1 nmdc:mga09592_28428_c1_1266_2009 247
209 3300050509 nmdc:mga0qj67_60783_c1 nmdc:mga0qj67_60783_c1_1185_1928 247
210 3300050511 nmdc:mga08y16_67535_c1 nmdc:mga08y16_67535_c1_68_811 247
211 3300050512 nmdc:mga0n895_303025_c1 nmdc:mga0n895_303025_c1_312_1055 247
212 3300050513 nmdc:mga0rr50_106176_c1 nmdc:mga0rr50_106176_c1_570_1313 247
213 3300050514 nmdc:mga08x19_4635_c1 nmdc:mga08x19_4635_c1_6505_7248 247
214 3300053087 Ga0500643_002537 Ga0500643_002537_1536_2306 247
215 3300053153 Ga0500616_0047785 Ga0500616_0047785_140_883 247
216 3300053161 Ga0500634_0006374 Ga0500634_0006374_2751_3521 247
217 3300006038 Ga0075365_10000251 Ga0075365_100002516 248
218 3300006042 Ga0075368_10003183 Ga0075368_100031832 248
219 3300006048 Ga0075363_100000009 Ga0075363_10000000933 248
220 3300006051 Ga0075364_10000004 Ga0075364_1000000423 248
221 3300006177 Ga0075362_10000009 Ga0075362_1000000925 248
222 3300006178 Ga0075367_10000178 Ga0075367_100001786 248
223 3300006186 Ga0075369_10000375 Ga0075369_1000037511 248
224 3300006195 Ga0075366_10001471 Ga0075366_1000147111 248
225 3300006852 Ga0075433_10004204 Ga0075433_1000420411 248
226 3300006871 Ga0075434_100272472 Ga0075434_1002724722 248
227 3300007076 Ga0075435_100040140 Ga0075435_1000401404 248
228 3300027866 Ga0209813_10003641 Ga0209813_100036412 248
229 3300027907 Ga0207428_10037508 Ga0207428_100375084 248
230 3300035085 Ga0373929_0075460 Ga0373929_0075460_35_799 248
231 3300035088 Ga0373940_0041607 Ga0373940_0041607_167_931 248
232 3300035112 Ga0373932_0078500 Ga0373932_0078500_119_883 248
233 3300035121 Ga0373960_0099562 Ga0373960_0099562_141_905 248
234 3300035207 Ga0373942_0009381 Ga0373942_0009381_797_1561 248
235 3300035398 Ga0316574_0023966 Ga0316574_0023966_1765_2511 248
236 3300035691 Ga0373931_0002552 Ga0373931_0002552_3873_4637 248
237 3300036647 Ga0316582_0360834 Ga0316582_0360834_82_828 248
238 3300046522 Ga0495643_0062396 Ga0495643_0062396_98_847 248
239 3300046558 Ga0495633_0003906 Ga0495633_0003906_8125_8874 248
240 3300046674 Ga0495588_0038856 Ga0495588_0038856_813_1562 248
241 3300047470 Ga0495681_0017707 Ga0495681_0017707_3087_3836 248
242 3300050489 nmdc:mga03683_11_c1 nmdc:mga03683_11_c1_100572_101321 248
243 3300050490 nmdc:mga03n38_1_c1 nmdc:mga03n38_1_c1_25394_26143 248
244 3300050491 nmdc:mga00v17_1_c1 nmdc:mga00v17_1_c1_205686_206435 248
245 3300050492 nmdc:mga0yw44_59_c1 nmdc:mga0yw44_59_c1_13910_14659 248
246 3300050493 nmdc:mga0k408_1437_c1 nmdc:mga0k408_1437_c1_12036_12785 248
247 3300050494 nmdc:mga06z11_312379_c1 nmdc:mga06z11_312379_c1_141_890 248
248 3300050494 nmdc:mga06z11_4192_c1 nmdc:mga06z11_4192_c1_2627_3376 248
249 3300050495 nmdc:mga04h51_22015_c1 nmdc:mga04h51_22015_c1_1056_1805 248
250 3300050496 nmdc:mga07m45_17843_c1 nmdc:mga07m45_17843_c1_928_1677 248
251 3300050511 nmdc:mga08y16_85029_c1 nmdc:mga08y16_85029_c1_1410_2174 248
252 3300050512 nmdc:mga0n895_9838_c1 nmdc:mga0n895_9838_c1_2283_3047 248
253 3300050513 nmdc:mga0rr50_35085_c1 nmdc:mga0rr50_35085_c1_2370_3134 248
254 3300050515 nmdc:mga0a205_5548_c1 nmdc:mga0a205_5548_c1_1905_2669 248
255 3300050516 nmdc:mga0sz30_5_c1 nmdc:mga0sz30_5_c1_149491_150240 248
256 3300053107 Ga0500560_054459 Ga0500560_054459_22_771 248
257 3300053111 Ga0500572_001159 Ga0500572_001159_1319_2068 248
258 3300053111 Ga0500572_002416 Ga0500572_002416_760_1509 248
259 3300053121 Ga0500607_008580 Ga0500607_008580_1975_2724 248
260 3300053121 Ga0500607_031346 Ga0500607_031346_614_1363 248
261 3300053137 Ga0500561_0000120 Ga0500561_0000120_8297_9046 248
262 3300053153 Ga0500616_0000981 Ga0500616_0000981_5726_6475 248
263 3300053157 Ga0500624_000594 Ga0500624_000594_3710_4459 248
264 3300053161 Ga0500634_0028476 Ga0500634_0028476_931_1680 248
265 3300053177 Ga0500636_0000029 Ga0500636_0000029_28074_28823 248
266 3300002987 JGI25159J45721_1003052 JGI25159J45721_10030525 249
267 3300003187 JGI25151J46595_10063427 JGI25151J46595_100634272 249
268 3300003771 Ga0055526_1000208 Ga0055526_100020830 249
269 3300003775 Ga0055524_1012184 Ga0055524_10121843 249
270 3300005262 Ga0065165_1000545 Ga0065165_100054544 249
271 3300005327 Ga0070658_10234020 Ga0070658_102340202 249
272 3300005331 Ga0070670_100091318 Ga0070670_1000913182 249
273 3300005339 Ga0070660_100190286 Ga0070660_1001902862 249
274 3300005353 Ga0070669_100395094 Ga0070669_1003950942 249
275 3300005530 Ga0070679_100010169 Ga0070679_1000101697 249
276 3300005618 Ga0068864_100190831 Ga0068864_1001908312 249
277 3300021361 Ga0213872_10002719 Ga0213872_100027194 249
278 3300021377 Ga0213874_10018493 Ga0213874_100184933 249
279 3300021384 Ga0213876_10026642 Ga0213876_100266422 249
280 3300021388 Ga0213875_10000012 Ga0213875_10000012289 249
281 3300025284 Ga0209130_1000279 Ga0209130_100027958 249
282 3300025294 Ga0209025_1004300 Ga0209025_10043005 249
283 3300025294 Ga0209025_1026885 Ga0209025_10268853 249
284 3300025295 Ga0209564_1000031 Ga0209564_1000031277 249
285 3300025297 Ga0209758_1010140 Ga0209758_10101404 249
286 3300025299 Ga0209256_1000435 Ga0209256_100043519 249
287 3300025912 Ga0207707_10164725 Ga0207707_101647252 249
288 3300025917 Ga0207660_10016178 Ga0207660_100161784 249
289 3300025921 Ga0207652_10010471 Ga0207652_100104716 249
290 3300025925 Ga0207650_10073835 Ga0207650_100738353 249
291 3300025941 Ga0207711_10113916 Ga0207711_101139163 249
292 3300026095 Ga0207676_10172798 Ga0207676_101727982 249
293 3300031901 Ga0307406_10069755 Ga0307406_100697552 249
294 3300032004 Ga0307414_10522204 Ga0307414_105222041 249
295 3300032005 Ga0307411_10223391 Ga0307411_102233912 249
296 3300037853 Ga0436364_0202668 Ga0436364_0202668_18283_19032 249
297 3300038705 Ga0237819_03268 Ga0237819_03268_2098_2850 249
298 3300039437 Ga0436365_0939829 Ga0436365_0939829_782_1531 249
299 3300039447 Ga0436361_1164300 Ga0436361_1164300_3773_4546 249
300 3300039450 Ga0436363_0947161 Ga0436363_0947161_1257_2006 249
301 3300048090 Ga0495615_0005622 Ga0495615_0005622_362_1117 249
302 3300048908 Ga0496105_0012414 Ga0496105_0012414_106_858 249
303 3300048917 Ga0496114_0075530 Ga0496114_0075530_1012_1764 249
304 3300048925 Ga0496122_0007517 Ga0496122_0007517_3812_4564 249
305 3300048926 Ga0496123_0023614 Ga0496123_0023614_1799_2551 249
306 3300049571 Ga0501034_0000826 Ga0501034_0000826_41995_42744 249
307 3300049571 Ga0501034_0348420 Ga0501034_0348420_466_1215 249
308 3300049575 Ga0501039_0550781 Ga0501039_0550781_135_884 249
309 3300049586 Ga0501070_0115410 Ga0501070_0115410_310_1059 249
310 3300049823 Ga0501044_0473931 Ga0501044_0473931_175_927 249
311 3300053125 Ga0500618_000788 Ga0500618_000788_12461_13216 249
312 3300053735 Ga0500596_003621 Ga0500596_003621_769_1524 249
313 3300060353 Ga0501082_0747011 Ga0501082_0747011_89_838 249
314 iso_pu_bacteria 2897803580 2897804108 249
315 iso_pu_bacteria 2917699015 2917704095 249
316 3300005336 Ga0070680_100169819 Ga0070680_1001698192 250
317 3300005436 Ga0070713_100399033 Ga0070713_1003990332 250
318 3300005437 Ga0070710_10029448 Ga0070710_100294484 250
319 3300005439 Ga0070711_100031443 Ga0070711_1000314432 250
320 3300005455 Ga0070663_100350868 Ga0070663_1003508682 250
321 3300005458 Ga0070681_10066203 Ga0070681_100662033 250
322 3300005471 Ga0070698_100008480 Ga0070698_1000084808 250
323 3300005518 Ga0070699_100369682 Ga0070699_1003696821 250
324 3300005530 Ga0070679_100227559 Ga0070679_1002275592 250
325 3300005937 Ga0081455_10007685 Ga0081455_100076852 250
326 3300005985 Ga0081539_10001002 Ga0081539_1000100228 250
327 3300006038 Ga0075365_10011418 Ga0075365_100114183 250
328 3300006038 Ga0075365_10048602 Ga0075365_100486022 250
329 3300006038 Ga0075365_10317384 Ga0075365_103173842 250
330 3300006051 Ga0075364_10051200 Ga0075364_100512002 250
331 3300006175 Ga0070712_100008801 Ga0070712_1000088014 250
332 3300006177 Ga0075362_10187229 Ga0075362_101872291 250
333 3300006178 Ga0075367_10158396 Ga0075367_101583962 250
334 3300006186 Ga0075369_10009946 Ga0075369_100099463 250
335 3300009177 Ga0105248_10274923 Ga0105248_102749232 250
336 3300013105 Ga0157369_10515717 Ga0157369_105157172 250
337 3300025912 Ga0207707_10039607 Ga0207707_100396074 250
338 3300025915 Ga0207693_10002628 Ga0207693_100026284 250
339 3300025921 Ga0207652_10083212 Ga0207652_100832123 250
340 3300025928 Ga0207700_10066003 Ga0207700_100660032 250
341 3300025972 Ga0207668_10306377 Ga0207668_103063772 250
342 3300026116 Ga0207674_10011240 Ga0207674_100112407 250
343 3300027907 Ga0207428_10180757 Ga0207428_101807572 250
344 3300028379 Ga0268266_10036179 Ga0268266_100361792 250
345 3300028379 Ga0268266_10334415 Ga0268266_103344152 250
346 3300028379 Ga0268266_10724790 Ga0268266_107247902 250
347 3300028381 Ga0268264_10286279 Ga0268264_102862792 250
348 3300028794 Ga0307515_10006150 Ga0307515_1000615011 250
349 3300031247 Ga0265340_10045456 Ga0265340_100454562 250
350 3300031456 Ga0307513_10129155 Ga0307513_101291553 250
351 3300031548 Ga0307408_100162106 Ga0307408_1001621062 250
352 3300031649 Ga0307514_10000530 Ga0307514_1000053011 250
353 3300031727 Ga0316576_10020926 Ga0316576_100209262 250
354 3300035112 Ga0373932_0005547 Ga0373932_0005547_1268_2020 250
355 3300035117 Ga0373953_0004090 Ga0373953_0004090_1516_2268 250
356 3300035118 Ga0373954_0013311 Ga0373954_0013311_1779_2531 250
357 3300035120 Ga0373957_0015583 Ga0373957_0015583_448_1200 250
358 3300035410 Ga0373924_0001607 Ga0373924_0001607_2343_3095 250
359 3300035724 Ga0373933_0108005 Ga0373933_0108005_85_852 250
360 3300036401 Ga0373937_0289984 Ga0373937_0289984_116_883 250
361 3300036647 Ga0316582_0401533 Ga0316582_0401533_65_817 250
362 3300037312 Ga0395899_0137724 Ga0395899_0137724_876_1628 250
363 3300037466 Ga0395898_0082771 Ga0395898_0082771_32_784 250
364 3300037466 Ga0395898_0273449 Ga0395898_0273449_587_1342 250
365 3300039062 Ga0400483_154484 Ga0400483_154484_53_811 250
366 3300042876 Ga0451577_0120146 Ga0451577_0120146_827_1579 250
367 3300044673 Ga0453683_0013232 Ga0453683_0013232_4110_4862 250
368 3300045051 Ga0451576_0016029 Ga0451576_0016029_5959_6711 250
369 3300045051 Ga0451576_0174857 Ga0451576_0174857_468_1235 250
370 3300046454 Ga0495592_0022152 Ga0495592_0022152_3989_4741 250
371 3300046455 Ga0495603_0184236 Ga0495603_0184236_256_1008 250
372 3300046460 Ga0495638_0004606 Ga0495638_0004606_9037_9789 250
373 3300046460 Ga0495638_0203305 Ga0495638_0203305_288_1049 250
374 3300046462 Ga0495651_0017401 Ga0495651_0017401_3949_4701 250
375 3300046463 Ga0495653_0120125 Ga0495653_0120125_89_841 250
376 3300046472 Ga0495580_0078393 Ga0495580_0078393_1336_2088 250
377 3300046473 Ga0495582_0009300 Ga0495582_0009300_4203_4955 250
378 3300046476 Ga0495662_0094328 Ga0495662_0094328_627_1379 250
379 3300046512 Ga0495610_0095563 Ga0495610_0095563_382_1134 250
380 3300046513 Ga0495616_0061122 Ga0495616_0061122_1011_1763 250
381 3300046514 Ga0495618_0307171 Ga0495618_0307171_89_841 250
382 3300046516 Ga0495628_0043841 Ga0495628_0043841_1872_2624 250
383 3300046518 Ga0495631_0209137 Ga0495631_0209137_46_798 250
384 3300046533 Ga0495640_0025411 Ga0495640_0025411_1679_2431 250
385 3300046536 Ga0495587_0029676 Ga0495587_0029676_464_1216 250
386 3300046660 Ga0495625_0035167 Ga0495625_0035167_2051_2815 250
387 3300046675 Ga0495657_0011823 Ga0495657_0011823_2465_3217 250
388 3300046678 Ga0495599_0017582 Ga0495599_0017582_3348_4100 250
389 3300046678 Ga0495599_0068111 Ga0495599_0068111_87_839 250
390 3300046681 Ga0495647_0128274 Ga0495647_0128274_216_968 250
391 3300046689 Ga0495613_0009212 Ga0495613_0009212_5097_5849 250
392 3300046809 Ga0495600_0006373 Ga0495600_0006373_4897_5649 250
393 3300047317 Ga0495604_0041532 Ga0495604_0041532_624_1376 250
394 3300047319 Ga0495674_0036262 Ga0495674_0036262_3158_3910 250
395 3300047322 Ga0495680_0121848 Ga0495680_0121848_724_1476 250
396 3300047444 Ga0495675_0068400 Ga0495675_0068400_216_968 250
397 3300047471 Ga0495684_0041912 Ga0495684_0041912_721_1473 250
398 3300048089 Ga0495614_0051299 Ga0495614_0051299_83_835 250
399 3300048903 Ga0496100_0114021 Ga0496100_0114021_1042_1842 250
400 3300048912 Ga0496109_0537256 Ga0496109_0537256_301_1056 250
401 3300048914 Ga0496111_0374877 Ga0496111_0374877_236_991 250
402 3300048920 Ga0496117_0313825 Ga0496117_0313825_31_783 250
403 3300048925 Ga0496122_0022553 Ga0496122_0022553_2128_2880 250
404 3300048926 Ga0496123_0100138 Ga0496123_0100138_120_872 250
405 3300048927 Ga0496124_0043405 Ga0496124_0043405_1898_2650 250
406 3300048929 Ga0496126_0222345 Ga0496126_0222345_739_1491 250
407 3300049569 Ga0501032_0000049 Ga0501032_0000049_31106_31864 250
408 3300049570 Ga0501033_0000368 Ga0501033_0000368_11356_12114 250
409 3300049571 Ga0501034_0000915 Ga0501034_0000915_11219_11977 250
410 3300049572 Ga0501036_0000014 Ga0501036_0000014_116842_117600 250
411 3300049573 Ga0501037_0000042 Ga0501037_0000042_86544_87302 250
412 3300049574 Ga0501038_0000024 Ga0501038_0000024_116842_117600 250
413 3300049575 Ga0501039_0000052 Ga0501039_0000052_63175_63933 250
414 3300049575 Ga0501039_0426464 Ga0501039_0426464_56_808 250
415 3300049576 Ga0501040_0000634 Ga0501040_0000634_15945_16703 250
416 3300049578 Ga0501042_0440510 Ga0501042_0440510_140_892 250
417 3300049579 Ga0501043_0000506 Ga0501043_0000506_3199_3957 250
418 3300049581 Ga0501047_0000542 Ga0501047_0000542_8914_9672 250
419 3300049586 Ga0501070_0030970 Ga0501070_0030970_2414_3172 250
420 3300049586 Ga0501070_0123682 Ga0501070_0123682_693_1445 250
421 3300049586 Ga0501070_0184020 Ga0501070_0184020_595_1347 250
422 3300049822 Ga0501035_0000045 Ga0501035_0000045_31106_31864 250
423 3300049823 Ga0501044_0000044 Ga0501044_0000044_116842_117600 250
424 3300049824 Ga0501045_0328515 Ga0501045_0328515_171_929 250
425 3300050489 nmdc:mga03683_104131_c1 nmdc:mga03683_104131_c1_334_1086 250
426 3300050492 nmdc:mga0yw44_15969_c1 nmdc:mga0yw44_15969_c1_1742_2494 250
427 3300050492 nmdc:mga0yw44_69602_c1 nmdc:mga0yw44_69602_c1_1171_1923 250
428 3300050496 nmdc:mga07m45_234592_c1 nmdc:mga07m45_234592_c1_126_878 250
429 3300050511 nmdc:mga08y16_228040_c1 nmdc:mga08y16_228040_c1_891_1643 250
430 3300050516 nmdc:mga0sz30_135785_c1 nmdc:mga0sz30_135785_c1_228_980 250
431 3300050516 nmdc:mga0sz30_393_c1 nmdc:mga0sz30_393_c1_3108_3860 250
432 3300053084 Ga0495595_0006358 Ga0495595_0006358_109_861 250
433 3300053085 Ga0495619_0033847 Ga0495619_0033847_2104_2856 250
434 3300053088 Ga0500644_0112787 Ga0500644_0112787_12_764 250
435 3300053108 Ga0500562_013980 Ga0500562_013980_672_1424 250
436 3300053109 Ga0500569_042677 Ga0500569_042677_462_1214 250
437 3300053151 Ga0500604_0103237 Ga0500604_0103237_85_837 250
438 3300053153 Ga0500616_0001578 Ga0500616_0001578_2165_2917 250
439 3300053161 Ga0500634_0049897 Ga0500634_0049897_218_970 250
440 iso_pu_bacteria 8055909800 8055910265 250
441 3300003792 Ga0055540_1014170 Ga0055540_10141702 251
442 3300003794 Ga0055531_10001259 Ga0055531_100012592 251
443 3300005436 Ga0070713_100227564 Ga0070713_1002275642 251
444 3300005471 Ga0070698_100339756 Ga0070698_1003397562 251
445 3300006847 Ga0075431_100060020 Ga0075431_1000600204 251
446 3300006914 Ga0075436_100097669 Ga0075436_1000976693 251
447 3300009176 Ga0105242_10093120 Ga0105242_100931203 251
448 3300025297 Ga0209758_1028125 Ga0209758_10281253 251
449 3300025303 Ga0209051_1000254 Ga0209051_100025447 251
450 3300025304 Ga0209257_1000012 Ga0209257_1000012673 251
451 3300025304 Ga0209257_1000045 Ga0209257_100004579 251
452 3300025304 Ga0209257_1000137 Ga0209257_100013777 251
453 3300025934 Ga0207686_10182471 Ga0207686_101824711 251
454 3300036401 Ga0373937_0945995 Ga0373937_0945995_30_785 251
455 3300037068 Ga0373925_0566391 Ga0373925_0566391_68_823 251
456 3300042876 Ga0451577_0432952 Ga0451577_0432952_197_955 251
457 3300048918 Ga0496115_0014189 Ga0496115_0014189_1393_2151 251
458 3300049572 Ga0501036_0292759 Ga0501036_0292759_405_1160 251
459 3300049581 Ga0501047_0268050 Ga0501047_0268050_551_1306 251
460 3300049591 Ga0501075_0324186 Ga0501075_0324186_235_990 251
461 3300049823 Ga0501044_0217078 Ga0501044_0217078_1083_1841 251
462 3300050493 nmdc:mga0k408_62655_c1 nmdc:mga0k408_62655_c1_197_964 251
463 3300050510 nmdc:mga06r32_441013_c1 nmdc:mga06r32_441013_c1_180_935 251
464 3300050514 nmdc:mga08x19_15633_c1 nmdc:mga08x19_15633_c1_2706_3461 251
465 3300053111 Ga0500572_045189 Ga0500572_045189_43_798 251
466 3300005347 Ga0070668_100420044 Ga0070668_1004200441 252
467 3300005367 Ga0070667_100291235 Ga0070667_1002912352 252
468 3300005435 Ga0070714_100146740 Ga0070714_1001467402 252
469 3300005457 Ga0070662_100016800 Ga0070662_1000168004 252
470 3300005564 Ga0070664_100087000 Ga0070664_1000870003 252
471 3300005844 Ga0068862_100229086 Ga0068862_1002290862 252
472 3300005937 Ga0081455_10010700 Ga0081455_100107004 252
473 3300005937 Ga0081455_10032195 Ga0081455_100321954 252
474 3300006028 Ga0070717_10091564 Ga0070717_100915643 252
475 3300006844 Ga0075428_100171759 Ga0075428_1001717592 252
476 3300006846 Ga0075430_100091977 Ga0075430_1000919772 252
477 3300006847 Ga0075431_100208611 Ga0075431_1002086112 252
478 3300006852 Ga0075433_10097265 Ga0075433_100972653 252
479 3300006871 Ga0075434_100437829 Ga0075434_1004378292 252
480 3300006880 Ga0075429_100080870 Ga0075429_1000808703 252
481 3300006880 Ga0075429_100212882 Ga0075429_1002128822 252
482 3300006914 Ga0075436_100024858 Ga0075436_1000248583 252
483 3300007076 Ga0075435_100039504 Ga0075435_1000395044 252
484 3300009094 Ga0111539_10470781 Ga0111539_104707811 252
485 3300009147 Ga0114129_10065588 Ga0114129_100655887 252
486 3300009148 Ga0105243_10515412 Ga0105243_105154122 252
487 3300010375 Ga0105239_10161158 Ga0105239_101611582 252
488 3300013306 Ga0163162_10020933 Ga0163162_100209332 252
489 3300015683 Ga0183362_10002 Ga0183362_100021120 252
490 3300025910 Ga0207684_10086724 Ga0207684_100867242 252
491 3300025933 Ga0207706_10010420 Ga0207706_100104203 252
492 3300027907 Ga0207428_10221271 Ga0207428_102212712 252
493 3300028577 Ga0265318_10057032 Ga0265318_100570322 252
494 3300031649 Ga0307514_10012378 Ga0307514_100123787 252
495 3300035115 Ga0373941_0030720 Ga0373941_0030720_465_1223 252
496 3300035241 Ga0373961_0113029 Ga0373961_0113029_91_849 252
497 3300037471 Ga0395905_0110891 Ga0395905_0110891_1249_2013 252
498 3300039093 Ga0400489_92491 Ga0400489_92491_2839_3600 252
499 3300039450 Ga0436363_1612610 Ga0436363_1612610_59_823 252
500 3300045051 Ga0451576_0388737 Ga0451576_0388737_515_1276 252
501 3300046472 Ga0495580_0169580 Ga0495580_0169580_512_1273 252
502 3300046543 Ga0495645_0077136 Ga0495645_0077136_548_1399 252
503 3300046683 Ga0495658_0172353 Ga0495658_0172353_225_986 252
504 3300048903 Ga0496100_0196857 Ga0496100_0196857_536_1303 252
505 3300048907 Ga0496104_0000463 Ga0496104_0000463_6274_7071 252
506 3300048908 Ga0496105_0002198 Ga0496105_0002198_3892_4689 252
507 3300049574 Ga0501038_0017697 Ga0501038_0017697_3022_3780 252
508 3300049576 Ga0501040_0213076 Ga0501040_0213076_110_868 252
509 3300049578 Ga0501042_0032822 Ga0501042_0032822_1827_2585 252
510 3300049579 Ga0501043_0200986 Ga0501043_0200986_667_1425 252
511 3300049582 Ga0501048_0048274 Ga0501048_0048274_1419_2177 252
512 3300049587 Ga0501071_0022936 Ga0501071_0022936_2039_2797 252
513 3300049588 Ga0501072_0093062 Ga0501072_0093062_933_1691 252
514 3300049588 Ga0501072_0165536 Ga0501072_0165536_451_1209 252
515 3300049591 Ga0501075_0016426 Ga0501075_0016426_3046_3804 252
516 3300049592 Ga0501076_0003634 Ga0501076_0003634_3240_3998 252
517 3300049741 Ga0501079_0036212 Ga0501079_0036212_553_1311 252
518 3300049742 Ga0501080_0073773 Ga0501080_0073773_1232_1990 252
519 3300049822 Ga0501035_0104813 Ga0501035_0104813_185_943 252
520 3300049824 Ga0501045_0028758 Ga0501045_0028758_2294_3052 252
521 3300050507 nmdc:mga05p37_254119_c1 nmdc:mga05p37_254119_c1_657_1415 252
522 3300050508 nmdc:mga09592_244315_c1 nmdc:mga09592_244315_c1_480_1238 252
523 3300050510 nmdc:mga06r32_154133_c1 nmdc:mga06r32_154133_c1_742_1503 252
524 3300050511 nmdc:mga08y16_271970_c1 nmdc:mga08y16_271970_c1_61_822 252
525 3300053153 Ga0500616_0003402 Ga0500616_0003402_2044_2805 252
526 3300054114 Ga0501084_0053585 Ga0501084_0053585_1107_1865 252
527 3300061734 Ga0530510_0015068 Ga0530510_0015068_4303_5061 252
528 3300005467 Ga0070706_100000143 Ga0070706_10000014369 253
529 3300005468 Ga0070707_100010752 Ga0070707_1000107524 253
530 3300005471 Ga0070698_100099339 Ga0070698_1000993393 253
531 3300005536 Ga0070697_100008684 Ga0070697_1000086844 253
532 3300025910 Ga0207684_10000210 Ga0207684_1000021070 253
533 3300035695 Ga0373927_0022658 Ga0373927_0022658_2133_2897 253
534 3300037068 Ga0373925_0048818 Ga0373925_0048818_930_1694 253
535 3300045051 Ga0451576_0075928 Ga0451576_0075928_2471_3247 253
536 3300049581 Ga0501047_0354342 Ga0501047_0354342_444_1211 253
537 3300049588 Ga0501072_0062604 Ga0501072_0062604_701_1462 253
538 3300049743 Ga0501081_0108093 Ga0501081_0108093_81_842 253
539 3300049824 Ga0501045_0246490 Ga0501045_0246490_516_1277 253
540 3300005518 Ga0070699_100067780 Ga0070699_1000677802 254
541 3300005937 Ga0081455_10032729 Ga0081455_100327293 254
542 3300005981 Ga0081538_10041774 Ga0081538_100417743 254
543 3300005983 Ga0081540_1046425 Ga0081540_10464252 254
544 3300006051 Ga0075364_10250832 Ga0075364_102508322 254
545 3300006844 Ga0075428_100237381 Ga0075428_1002373813 254
546 3300006847 Ga0075431_100061230 Ga0075431_1000612303 254
547 3300009094 Ga0111539_10266676 Ga0111539_102666762 254
548 3300021384 Ga0213876_10074291 Ga0213876_100742912 254
549 3300039437 Ga0436365_0995234 Ga0436365_0995234_1042_1815 254
550 3300045051 Ga0451576_0173969 Ga0451576_0173969_532_1320 254
551 3300050489 nmdc:mga03683_53179_c1 nmdc:mga03683_53179_c1_553_1317 254
552 3300050491 nmdc:mga00v17_332103_c1 nmdc:mga00v17_332103_c1_205_969 254
553 3300050492 nmdc:mga0yw44_84551_c1 nmdc:mga0yw44_84551_c1_226_990 254
554 3300050507 nmdc:mga05p37_151446_c1 nmdc:mga05p37_151446_c1_1212_1976 254
555 3300050509 nmdc:mga0qj67_53906_c1 nmdc:mga0qj67_53906_c1_1431_2195 254
556 3300050510 nmdc:mga06r32_75944_c1 nmdc:mga06r32_75944_c1_1357_2121 254
557 3300050511 nmdc:mga08y16_315748_c1 nmdc:mga08y16_315748_c1_92_856 254
558 3300001991 JGI24743J22301_10000807 JGI24743J22301_100008074 256
559 3300002075 JGI24738J21930_10004627 JGI24738J21930_100046272 256
560 3300002077 JGI24744J21845_10005767 JGI24744J21845_100057673 256
561 3300002239 JGI24034J26672_10006804 JGI24034J26672_100068042 256
562 3300002244 JGI24742J22300_10000495 JGI24742J22300_100004955 256
563 3300002459 JGI24751J29686_10010577 JGI24751J29686_100105772 256
564 3300005328 Ga0070676_10077808 Ga0070676_100778082 256
565 3300005329 Ga0070683_100090387 Ga0070683_1000903873 256
566 3300005330 Ga0070690_100004018 Ga0070690_1000040185 256
567 3300005331 Ga0070670_100017039 Ga0070670_1000170396 256
568 3300005331 Ga0070670_100343942 Ga0070670_1003439422 256
569 3300005334 Ga0068869_100010076 Ga0068869_1000100763 256
570 3300005338 Ga0068868_100005853 Ga0068868_1000058537 256
571 3300005341 Ga0070691_10050916 Ga0070691_100509162 256
572 3300005343 Ga0070687_100025293 Ga0070687_1000252932 256
573 3300005353 Ga0070669_100099484 Ga0070669_1000994843 256
574 3300005354 Ga0070675_100059013 Ga0070675_1000590133 256
575 3300005356 Ga0070674_100032599 Ga0070674_1000325994 256
576 3300005364 Ga0070673_100168008 Ga0070673_1001680082 256
577 3300005365 Ga0070688_100179932 Ga0070688_1001799322 256
578 3300005366 Ga0070659_100036341 Ga0070659_1000363413 256
579 3300005367 Ga0070667_100055487 Ga0070667_1000554873 256
580 3300005367 Ga0070667_100693523 Ga0070667_1006935231 256
581 3300005437 Ga0070710_10031956 Ga0070710_100319562 256
582 3300005439 Ga0070711_100027700 Ga0070711_1000277002 256
583 3300005441 Ga0070700_100007292 Ga0070700_1000072922 256
584 3300005444 Ga0070694_100038643 Ga0070694_1000386432 256
585 3300005444 Ga0070694_100628932 Ga0070694_1006289321 256
586 3300005445 Ga0070708_100395891 Ga0070708_1003958912 256
587 3300005459 Ga0068867_100025736 Ga0068867_1000257364 256
588 3300005466 Ga0070685_10005128 Ga0070685_100051285 256
589 3300005535 Ga0070684_100299396 Ga0070684_1002993962 256
590 3300005543 Ga0070672_100014112 Ga0070672_1000141126 256
591 3300005544 Ga0070686_100004245 Ga0070686_1000042455 256
592 3300005546 Ga0070696_100351399 Ga0070696_1003513992 256
593 3300005547 Ga0070693_100415968 Ga0070693_1004159681 256
594 3300005548 Ga0070665_100147957 Ga0070665_1001479573 256
595 3300005549 Ga0070704_100404240 Ga0070704_1004042401 256
596 3300005563 Ga0068855_100709067 Ga0068855_1007090672 256
597 3300005564 Ga0070664_100253423 Ga0070664_1002534232 256
598 3300005577 Ga0068857_100071485 Ga0068857_1000714852 256
599 3300005578 Ga0068854_100034610 Ga0068854_1000346103 256
600 3300005614 Ga0068856_100143218 Ga0068856_1001432182 256
601 3300005615 Ga0070702_100044518 Ga0070702_1000445183 256
602 3300005616 Ga0068852_100454413 Ga0068852_1004544132 256
603 3300005617 Ga0068859_100047957 Ga0068859_1000479573 256
604 3300005618 Ga0068864_100007948 Ga0068864_1000079485 256
605 3300005718 Ga0068866_10120908 Ga0068866_101209082 256
606 3300005834 Ga0068851_10027848 Ga0068851_100278483 256
607 3300005840 Ga0068870_10006927 Ga0068870_100069273 256
608 3300005841 Ga0068863_100049255 Ga0068863_1000492552 256
609 3300005842 Ga0068858_100019529 Ga0068858_1000195293 256
610 3300005843 Ga0068860_100014017 Ga0068860_1000140174 256
611 3300005937 Ga0081455_10024977 Ga0081455_100249775 256
612 3300006038 Ga0075365_10038565 Ga0075365_100385653 256
613 3300006051 Ga0075364_10063037 Ga0075364_100630372 256
614 3300006175 Ga0070712_100046697 Ga0070712_1000466973 256
615 3300006178 Ga0075367_10109957 Ga0075367_101099572 256
616 3300006237 Ga0097621_100132627 Ga0097621_1001326272 256
617 3300006358 Ga0068871_100030574 Ga0068871_1000305743 256
618 3300006844 Ga0075428_100031660 Ga0075428_1000316605 256
619 3300006871 Ga0075434_100064742 Ga0075434_1000647423 256
620 3300006871 Ga0075434_100137293 Ga0075434_1001372933 256
621 3300006881 Ga0068865_100103789 Ga0068865_1001037893 256
622 3300006914 Ga0075436_100157948 Ga0075436_1001579482 256
623 3300006931 Ga0097620_100047957 Ga0097620_1000479573 256
624 3300007076 Ga0075435_100215984 Ga0075435_1002159842 256
625 3300009094 Ga0111539_10025147 Ga0111539_100251473 256
626 3300009098 Ga0105245_10015927 Ga0105245_100159277 256
627 3300009101 Ga0105247_10007157 Ga0105247_100071574 256
628 3300009101 Ga0105247_10106101 Ga0105247_101061012 256
629 3300009177 Ga0105248_10019483 Ga0105248_100194835 256
630 3300009545 Ga0105237_10021363 Ga0105237_100213635 256
631 3300009551 Ga0105238_10105147 Ga0105238_101051473 256
632 3300009553 Ga0105249_10046267 Ga0105249_100462674 256
633 3300009553 Ga0105249_10639158 Ga0105249_106391582 256
634 3300010375 Ga0105239_10057469 Ga0105239_100574693 256
635 3300013296 Ga0157374_10112267 Ga0157374_101122673 256
636 3300013297 Ga0157378_10067520 Ga0157378_100675202 256
637 3300013306 Ga0163162_10366265 Ga0163162_103662652 256
638 3300013308 Ga0157375_10059199 Ga0157375_100591994 256
639 3300014325 Ga0163163_10051301 Ga0163163_100513014 256
640 3300014325 Ga0163163_10065850 Ga0163163_100658502 256
641 3300014326 Ga0157380_10041185 Ga0157380_100411854 256
642 3300014968 Ga0157379_10093834 Ga0157379_100938343 256
643 3300014969 Ga0157376_10301818 Ga0157376_103018182 256
644 3300025315 Ga0207697_10037576 Ga0207697_100375762 256
645 3300025898 Ga0207692_10020204 Ga0207692_100202042 256
646 3300025900 Ga0207710_10006578 Ga0207710_100065783 256
647 3300025901 Ga0207688_10001955 Ga0207688_100019559 256
648 3300025904 Ga0207647_10014950 Ga0207647_100149505 256
649 3300025907 Ga0207645_10085814 Ga0207645_100858143 256
650 3300025908 Ga0207643_10002306 Ga0207643_100023068 256
651 3300025910 Ga0207684_10169937 Ga0207684_101699372 256
652 3300025915 Ga0207693_10018726 Ga0207693_100187265 256
653 3300025915 Ga0207693_10460585 Ga0207693_104605852 256
654 3300025918 Ga0207662_10005153 Ga0207662_100051534 256
655 3300025919 Ga0207657_10031712 Ga0207657_100317122 256
656 3300025920 Ga0207649_10031949 Ga0207649_100319494 256
657 3300025923 Ga0207681_10070311 Ga0207681_100703112 256
658 3300025925 Ga0207650_10022493 Ga0207650_100224932 256
659 3300025925 Ga0207650_10163679 Ga0207650_101636792 256
660 3300025927 Ga0207687_10008703 Ga0207687_100087037 256
661 3300025928 Ga0207700_10240305 Ga0207700_102403052 256
662 3300025931 Ga0207644_10112746 Ga0207644_101127462 256
663 3300025932 Ga0207690_10050226 Ga0207690_100502262 256
664 3300025933 Ga0207706_10012014 Ga0207706_100120146 256
665 3300025934 Ga0207686_10137275 Ga0207686_101372752 256
666 3300025935 Ga0207709_10010119 Ga0207709_100101194 256
667 3300025936 Ga0207670_10019125 Ga0207670_100191254 256
668 3300025937 Ga0207669_10008071 Ga0207669_100080712 256
669 3300025938 Ga0207704_10015967 Ga0207704_100159672 256
670 3300025940 Ga0207691_10014822 Ga0207691_100148223 256
671 3300025941 Ga0207711_10026744 Ga0207711_100267443 256
672 3300025942 Ga0207689_10007381 Ga0207689_100073814 256
673 3300025944 Ga0207661_10026048 Ga0207661_100260483 256
674 3300025945 Ga0207679_10163410 Ga0207679_101634102 256
675 3300025949 Ga0207667_10383808 Ga0207667_103838082 256
676 3300025960 Ga0207651_10067955 Ga0207651_100679552 256
677 3300025961 Ga0207712_10006588 Ga0207712_100065884 256
678 3300025961 Ga0207712_10266697 Ga0207712_102666972 256
679 3300025972 Ga0207668_10261025 Ga0207668_102610252 256
680 3300025981 Ga0207640_10026341 Ga0207640_100263412 256
681 3300025986 Ga0207658_10049277 Ga0207658_100492773 256
682 3300026023 Ga0207677_10021718 Ga0207677_100217182 256
683 3300026035 Ga0207703_10011944 Ga0207703_100119446 256
684 3300026041 Ga0207639_10201169 Ga0207639_102011691 256
685 3300026067 Ga0207678_10020954 Ga0207678_100209545 256
686 3300026075 Ga0207708_10017847 Ga0207708_100178474 256
687 3300026078 Ga0207702_10180153 Ga0207702_101801532 256
688 3300026088 Ga0207641_10021597 Ga0207641_100215975 256
689 3300026089 Ga0207648_10024517 Ga0207648_100245172 256
690 3300026095 Ga0207676_10064959 Ga0207676_100649592 256
691 3300026116 Ga0207674_10057274 Ga0207674_100572742 256
692 3300026118 Ga0207675_100008557 Ga0207675_1000085576 256
693 3300026121 Ga0207683_10011574 Ga0207683_100115748 256
694 3300026142 Ga0207698_10023423 Ga0207698_100234232 256
695 3300028380 Ga0268265_10188811 Ga0268265_101888112 256
696 3300028381 Ga0268264_10083710 Ga0268264_100837101 256
697 3300035113 Ga0373936_0011666 Ga0373936_0011666_1622_2392 256
698 3300035170 Ga0373943_0012623 Ga0373943_0012623_575_1345 256
699 3300035170 Ga0373943_0369929 Ga0373943_0369929_17_787 256
700 3300035171 Ga0373946_0043534 Ga0373946_0043534_567_1337 256
701 3300035695 Ga0373927_0018040 Ga0373927_0018040_2618_3388 256
702 3300035695 Ga0373927_0454926 Ga0373927_0454926_37_807 256
703 3300035725 Ga0373947_0034180 Ga0373947_0034180_563_1333 256
704 3300037068 Ga0373925_0096751 Ga0373925_0096751_280_1050 256
705 3300037068 Ga0373925_0249292 Ga0373925_0249292_549_1319 256
706 3300046453 Ga0495627_069015 Ga0495627_069015_177_947 256
707 3300046455 Ga0495603_0004084 Ga0495603_0004084_1344_2114 256
708 3300046461 Ga0495641_0031174 Ga0495641_0031174_809_1579 256
709 3300046461 Ga0495641_0088767 Ga0495641_0088767_77_847 256
710 3300046473 Ga0495582_0005948 Ga0495582_0005948_4810_5580 256
711 3300046474 Ga0495605_0129333 Ga0495605_0129333_329_1099 256
712 3300046475 Ga0495639_0038379 Ga0495639_0038379_573_1343 256
713 3300046499 Ga0495594_0029549 Ga0495594_0029549_301_1071 256
714 3300046500 Ga0495596_0059724 Ga0495596_0059724_621_1391 256
715 3300046514 Ga0495618_0239457 Ga0495618_0239457_57_827 256
716 3300046516 Ga0495628_0093551 Ga0495628_0093551_314_1084 256
717 3300046523 Ga0495644_0007801 Ga0495644_0007801_1406_2176 256
718 3300046533 Ga0495640_0180418 Ga0495640_0180418_94_864 256
719 3300046537 Ga0495598_0000685 Ga0495598_0000685_3553_4323 256
720 3300046537 Ga0495598_0021304 Ga0495598_0021304_102_872 256
721 3300046615 Ga0495656_0071753 Ga0495656_0071753_745_1515 256
722 3300046665 Ga0495661_0149861 Ga0495661_0149861_291_1061 256
723 3300046674 Ga0495588_0015365 Ga0495588_0015365_1256_2026 256
724 3300046681 Ga0495647_0032041 Ga0495647_0032041_91_861 256
725 3300046683 Ga0495658_0088218 Ga0495658_0088218_108_878 256
726 3300046684 Ga0495669_0237680 Ga0495669_0237680_21_791 256
727 3300046689 Ga0495613_0143616 Ga0495613_0143616_301_1071 256
728 3300047321 Ga0495676_0002963 Ga0495676_0002963_2930_3700 256
729 3300047321 Ga0495676_0125672 Ga0495676_0125672_82_852 256
730 3300047673 Ga0495593_0011139 Ga0495593_0011139_2889_3659 256
731 3300048903 Ga0496100_0013107 Ga0496100_0013107_1722_2492 256
732 3300048904 Ga0496101_0022282 Ga0496101_0022282_2373_3143 256
733 3300048904 Ga0496101_0026227 Ga0496101_0026227_111_881 256
734 3300048906 Ga0496103_0026099 Ga0496103_0026099_1072_1842 256
735 3300048907 Ga0496104_0064199 Ga0496104_0064199_1569_2339 256
736 3300048908 Ga0496105_0005212 Ga0496105_0005212_4413_5183 256
737 3300048908 Ga0496105_0026741 Ga0496105_0026741_1955_2752 256
738 3300048908 Ga0496105_0042957 Ga0496105_0042957_2516_3286 256
739 3300048909 Ga0496106_0041073 Ga0496106_0041073_1569_2339 256
740 3300048910 Ga0496107_0039933 Ga0496107_0039933_225_995 256
741 3300048910 Ga0496107_0175831 Ga0496107_0175831_59_829 256
742 3300048911 Ga0496108_0001525 Ga0496108_0001525_17283_18053 256
743 3300048911 Ga0496108_0016595 Ga0496108_0016595_1569_2339 256
744 3300048911 Ga0496108_0061059 Ga0496108_0061059_952_1749 256
745 3300048912 Ga0496109_0009507 Ga0496109_0009507_7455_8225 256
746 3300048912 Ga0496109_0315887 Ga0496109_0315887_536_1333 256
747 3300048912 Ga0496109_0330721 Ga0496109_0330721_353_1123 256
748 3300048913 Ga0496110_0103767 Ga0496110_0103767_813_1589 256
749 3300048913 Ga0496110_0251926 Ga0496110_0251926_663_1460 256
750 3300048914 Ga0496111_0014852 Ga0496111_0014852_2013_2783 256
751 3300048914 Ga0496111_0147680 Ga0496111_0147680_687_1457 256
752 3300048915 Ga0496112_0003444 Ga0496112_0003444_5012_5782 256
753 3300048915 Ga0496112_0114032 Ga0496112_0114032_753_1523 256
754 3300048916 Ga0496113_0023841 Ga0496113_0023841_2757_3527 256
755 3300048917 Ga0496114_0061573 Ga0496114_0061573_801_1571 256
756 3300048917 Ga0496114_0071119 Ga0496114_0071119_282_1052 256
757 3300048917 Ga0496114_0159005 Ga0496114_0159005_800_1570 256
758 3300048918 Ga0496115_0051466 Ga0496115_0051466_446_1216 256
759 3300048918 Ga0496115_0079123 Ga0496115_0079123_81_878 256
760 3300048918 Ga0496115_0092307 Ga0496115_0092307_1604_2401 256
761 3300048918 Ga0496115_0246831 Ga0496115_0246831_267_1037 256
762 3300049581 Ga0501047_0200556 Ga0501047_0200556_611_1393 256
763 3300049586 Ga0501070_0023866 Ga0501070_0023866_3323_4105 256
764 3300049742 Ga0501080_0018127 Ga0501080_0018127_326_1108 256
765 3300049822 Ga0501035_0291976 Ga0501035_0291976_378_1160 256
766 3300049823 Ga0501044_0005311 Ga0501044_0005311_12530_13312 256
767 3300050490 nmdc:mga03n38_67202_c1 nmdc:mga03n38_67202_c1_644_1414 256
768 3300050491 nmdc:mga00v17_345416_c1 nmdc:mga00v17_345416_c1_164_934 256
769 3300050492 nmdc:mga0yw44_2741_c1 nmdc:mga0yw44_2741_c1_2500_3270 256
770 3300050494 nmdc:mga06z11_124219_c1 nmdc:mga06z11_124219_c1_402_1172 256
771 3300050507 nmdc:mga05p37_211951_c1 nmdc:mga05p37_211951_c1_62_838 256
772 3300050511 nmdc:mga08y16_153159_c1 nmdc:mga08y16_153159_c1_624_1394 256
773 3300050512 nmdc:mga0n895_79017_c1 nmdc:mga0n895_79017_c1_2317_3087 256
774 3300050512 nmdc:mga0n895_79816_c1 nmdc:mga0n895_79816_c1_398_1174 256
775 3300053083 Ga0495655_0018811 Ga0495655_0018811_420_1190 256
776 3300053085 Ga0495619_0002736 Ga0495619_0002736_10446_11216 256
777 3300053085 Ga0495619_0042447 Ga0495619_0042447_274_1044 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

208

0.94

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

255

281

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9245 6 234
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9176 5 234
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9145 6 234
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9145 6 234
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9131 4 229
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9287 5 247 3.40.50.300
af_Q0E8Q7_447_706_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9248 4 235 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9226 6 229 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9168 6 241 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9151 3 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q3MZI9-F1-model_v4 ATP-binding cassette domain-containing protein 0.9474 3 103 GO:0005524
GO:0005886
GO:0016887
AF-B6WB92-F1-model_v4 ABC transporter, ATP-binding protein 0.9458 130 230 GO:0005524
GO:0016020
GO:0016887
AF-A0A6N6XCL8-F1-model_v4 deleted 0.9406 1 77
AF-A0A527YQI0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9391 4 104 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A5M6I481-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9351 3 248 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.86 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map