F480373

General Info

Members Datasets Scaffolds Average Seq Length
777 304 1554 261

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000057|Ga0307515_10000057188
Length 309
Sequence VPLPGINNSSGPPAIRYTPLAARLSFRNIAGMTRLAKPTSHLPLTTSKKMNIHFYKYQGTGNDFVILDNRDGRYNDLTKEQVKDICDRRFGIGADGLMMLNEKAGYDFEMKYYNSDGGESSMCGNGGRCLVMFAHHAGIRKNLYHFIASDGPHEAEIDADGTVSLKMKDVNNIAEYGGDFLLDTGSPHYVKLISDVKTYDVYKKGHAIRNSEEFAEKGINVNFVQQKSDFEIIVRTYERGVEDETWSCGTGVTAAALVCYHNETGYNDVTVLTKGGKLTVEFDRISDSHYTNIFLCGPAEKVYEGDIEI

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
258 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
259 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
289 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
290 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
291 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
292 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
293 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
294 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
295 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
296 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
297 2818991444 Filimonas endophytica 3197 Isolate Unclassified
298 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
299 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
300 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
301 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
302 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
303 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
304 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0.13
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0.13
Rhizoplane 0.39
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10000057 3300028794 Bacteria 261695
2 JGI24741J21665_1025447 3300001915 Bacteria 904
3 JGI24740J21852_10011969 3300001979 Bacteria 3285
4 JGI24739J22299_10016060 3300001989 Bacteria 2715
5 JGI24739J22299_10033908 3300001989 Unclassified 1742
6 rootH1_10030212 3300003316 Bacteria 3758
7 rootH1_10169668 3300003316 Bacteria 1823
8 rootH2_10043655 3300003320 Bacteria 6638
9 rootH2_10047649 3300003320 Bacteria 3447
10 rootH1_10042926 3300003323 Bacteria 22782
11 rootH1_10285767 3300003323 Bacteria 1388
12 Ga0055534_1002554 3300003784 Bacteria 6241
13 Ga0065712_10074708 3300005290 Bacteria 4012
14 Ga0065712_10158488 3300005290 Unclassified 1318
15 Ga0065712_10250953 3300005290 Unclassified 960
16 Ga0065707_10166865 3300005295 Bacteria 1515
17 Ga0065707_10261169 3300005295 Bacteria 1097
18 Ga0070658_10056001 3300005327 Bacteria 3204
19 Ga0070658_10294586 3300005327 Bacteria 1383
20 Ga0070676_10049379 3300005328 Bacteria 2463
21 Ga0070676_10088708 3300005328 Bacteria 1890
22 Ga0070676_10277299 3300005328 Unclassified 1128
23 Ga0070683_100010531 3300005329 Bacteria 7950
24 Ga0070690_100041628 3300005330 Bacteria 2909
25 Ga0070690_100079159 3300005330 Unclassified 2148
26 Ga0070670_100078635 3300005331 Bacteria 2833
27 Ga0070670_100086613 3300005331 Bacteria 2692
28 Ga0070670_100088908 3300005331 Bacteria 2655
29 Ga0070670_100090533 3300005331 Bacteria 2629
30 Ga0070670_100206334 3300005331 Unclassified 1708
31 Ga0068869_100023151 3300005334 Bacteria 4286
32 Ga0068869_100024847 3300005334 Unclassified 4153
33 Ga0068869_100143925 3300005334 Bacteria 1843
34 Ga0070666_10000047 3300005335 Bacteria 106512
35 Ga0070666_10069509 3300005335 Bacteria 2394
36 Ga0070666_10079635 3300005335 Bacteria 2238
37 Ga0070666_10122185 3300005335 Bacteria 1806
38 Ga0070680_100032023 3300005336 Bacteria 4230
39 Ga0070680_100060149 3300005336 Bacteria 3109
40 Ga0070682_100000336 3300005337 Bacteria 32281
41 Ga0070682_100015123 3300005337 Bacteria 4468
42 Ga0070682_100143263 3300005337 Bacteria 1632
43 Ga0068868_100010137 3300005338 Bacteria 6809
44 Ga0068868_100033573 3300005338 Bacteria 3956
45 Ga0068868_100068025 3300005338 Bacteria 2835
46 Ga0068868_100506130 3300005338 Bacteria 1058
47 Ga0070660_100035363 3300005339 Bacteria 3781
48 Ga0070660_100039565 3300005339 Bacteria 3585
49 Ga0070660_100048632 3300005339 Bacteria 3257
50 Ga0070660_100110330 3300005339 Bacteria 2188
51 Ga0070660_100303589 3300005339 Bacteria 1309
52 Ga0070689_100051848 3300005340 Bacteria 3172
53 Ga0070689_100072876 3300005340 Unclassified 2685
54 Ga0070689_100339258 3300005340 Bacteria 1258
55 Ga0070687_100030751 3300005343 Unclassified 2627
56 Ga0070687_100190317 3300005343 Unclassified 1236
57 Ga0070661_100010397 3300005344 Bacteria 6469
58 Ga0070661_100019237 3300005344 Bacteria 4865
59 Ga0070661_100053526 3300005344 Bacteria 2954
60 Ga0070661_100068245 3300005344 Unclassified 2613
61 Ga0070661_100462305 3300005344 Bacteria 1011
62 Ga0070668_100088639 3300005347 Bacteria 2436
63 Ga0070668_100258900 3300005347 Bacteria 1446
64 Ga0070668_100376700 3300005347 Bacteria 1207
65 Ga0070669_100081846 3300005353 Unclassified 2406
66 Ga0070669_100098180 3300005353 Bacteria 2206
67 Ga0070669_100166717 3300005353 Unclassified 1715
68 Ga0070669_100307314 3300005353 Bacteria 1277
69 Ga0070669_100320597 3300005353 Unclassified 1251
70 Ga0070675_100024260 3300005354 Bacteria 4857
71 Ga0070675_100051906 3300005354 Bacteria 3371
72 Ga0070675_100235031 3300005354 Bacteria 1600
73 Ga0070671_100007985 3300005355 Bacteria 8469
74 Ga0070671_100030494 3300005355 Bacteria 4450
75 Ga0070671_100037171 3300005355 Unclassified 4038
76 Ga0070671_100057292 3300005355 Bacteria 3242
77 Ga0070671_100077465 3300005355 Bacteria 2778
78 Ga0070674_100006137 3300005356 Bacteria 6986
79 Ga0070674_100284243 3300005356 Bacteria 1312
80 Ga0070673_100033748 3300005364 Bacteria 3867
81 Ga0070673_100041789 3300005364 Bacteria 3530
82 Ga0070673_100046479 3300005364 Unclassified 3372
83 Ga0070673_100076307 3300005364 Bacteria 2706
84 Ga0070673_100082113 3300005364 Bacteria 2615
85 Ga0070673_100104140 3300005364 Unclassified 2342
86 Ga0070673_100263572 3300005364 Bacteria 1506
87 Ga0070673_100394912 3300005364 Bacteria 1236
88 Ga0070688_100026537 3300005365 Bacteria 3442
89 Ga0070688_100073808 3300005365 Bacteria 2189
90 Ga0070688_100335712 3300005365 Bacteria 1102
91 Ga0070659_100031310 3300005366 Bacteria 4119
92 Ga0070659_100032605 3300005366 Bacteria 4041
93 Ga0070659_100110696 3300005366 Bacteria 2216
94 Ga0070667_100049946 3300005367 Bacteria 3524
95 Ga0070667_100069241 3300005367 Bacteria 3003
96 Ga0070667_100084172 3300005367 Bacteria 2726
97 Ga0070667_100136341 3300005367 Bacteria 2146
98 Ga0070667_100623191 3300005367 Bacteria 995
99 Ga0070700_100224614 3300005441 Bacteria 1333
100 Ga0070663_100073009 3300005455 Bacteria 2502
101 Ga0070663_100300491 3300005455 Bacteria 1285
102 Ga0070678_100000844 3300005456 Bacteria 15587
103 Ga0070678_100033365 3300005456 Bacteria 3573
104 Ga0070662_100029976 3300005457 Bacteria 3802
105 Ga0070662_100041322 3300005457 Bacteria 3289
106 Ga0070662_100205198 3300005457 Unclassified 1566
107 Ga0070662_100382345 3300005457 Bacteria 1159
108 Ga0070662_100413813 3300005457 Unclassified 1114
109 Ga0070681_10087624 3300005458 Bacteria 3066
110 Ga0070681_10199594 3300005458 Bacteria 1919
111 Ga0068867_100029819 3300005459 Unclassified 3932
112 Ga0068867_100089850 3300005459 Bacteria 2329
113 Ga0068867_100119958 3300005459 Bacteria 2031
114 Ga0068867_100309202 3300005459 Bacteria 1305
115 Ga0070685_10027443 3300005466 Unclassified 3146
116 Ga0070698_100006768 3300005471 Bacteria 12425
117 Ga0070698_100043563 3300005471 Bacteria 4601
118 Ga0070698_100081889 3300005471 Bacteria 3221
119 Ga0070679_100327995 3300005530 Bacteria 1479
120 Ga0070679_100551601 3300005530 Unclassified 1096
121 Ga0070684_100009118 3300005535 Bacteria 7801
122 Ga0070684_100009620 3300005535 Bacteria 7619
123 Ga0070684_100014653 3300005535 Bacteria 6358
124 Ga0070684_100073988 3300005535 Bacteria 3003
125 Ga0068853_100004508 3300005539 Bacteria 10803
126 Ga0068853_100024420 3300005539 Bacteria 5068
127 Ga0068853_100028915 3300005539 Bacteria 4666
128 Ga0068853_100059854 3300005539 Bacteria 3290
129 Ga0068853_100102704 3300005539 Bacteria 2530
130 Ga0068853_100769589 3300005539 Bacteria 921
131 Ga0070672_100024555 3300005543 Bacteria 4457
132 Ga0070672_100155326 3300005543 Bacteria 1895
133 Ga0070672_100339571 3300005543 Bacteria 1279
134 Ga0070686_100081313 3300005544 Bacteria 2146
135 Ga0070665_100000016 3300005548 Bacteria 451538
136 Ga0070665_100694512 3300005548 Bacteria 1031
137 Ga0070704_100351840 3300005549 Bacteria 1244
138 Ga0068855_100000257 3300005563 Bacteria 66593
139 Ga0068855_100013876 3300005563 Bacteria 9717
140 Ga0068855_100017522 3300005563 Bacteria 8614
141 Ga0068855_100055208 3300005563 Bacteria 4666
142 Ga0068855_100248774 3300005563 Bacteria 1983
143 Ga0068855_100529236 3300005563 Bacteria 1278
144 Ga0070664_100001985 3300005564 Bacteria 16400
145 Ga0070664_100023092 3300005564 Bacteria 5134
146 Ga0070664_100030316 3300005564 Bacteria 4512
147 Ga0070664_100031713 3300005564 Bacteria 4418
148 Ga0068857_100071126 3300005577 Bacteria 3099
149 Ga0068857_100078080 3300005577 Bacteria 2955
150 Ga0068857_100087992 3300005577 Bacteria 2779
151 Ga0068857_100191527 3300005577 Bacteria 1862
152 Ga0068857_100441262 3300005577 Bacteria 1216
153 Ga0068857_100549625 3300005577 Bacteria 1088
154 Ga0068857_100831603 3300005577 Bacteria 883
155 Ga0068854_100080228 3300005578 Bacteria 2408
156 Ga0068854_100134486 3300005578 Bacteria 1892
157 Ga0068854_100223174 3300005578 Bacteria 1492
158 Ga0068854_100444288 3300005578 Unclassified 1082
159 Ga0068856_100003123 3300005614 Bacteria 16901
160 Ga0068856_100007388 3300005614 Bacteria 10726
161 Ga0068856_100022723 3300005614 Bacteria 6098
162 Ga0068856_100173957 3300005614 Bacteria 2166
163 Ga0070702_100026528 3300005615 Bacteria 3114
164 Ga0068852_100029447 3300005616 Bacteria 4511
165 Ga0068852_100127103 3300005616 Bacteria 2342
166 Ga0068852_100143654 3300005616 Bacteria 2211
167 Ga0068852_100258529 3300005616 Bacteria 1671
168 Ga0068852_100502089 3300005616 Bacteria 1208
169 Ga0068852_100616995 3300005616 Bacteria 1090
170 Ga0068859_100000030 3300005617 Bacteria 175435
171 Ga0068859_100010642 3300005617 Bacteria 9259
172 Ga0068859_100013811 3300005617 Bacteria 8097
173 Ga0068859_100026238 3300005617 Bacteria 5842
174 Ga0068859_100106923 3300005617 Bacteria 2857
175 Ga0068859_100178658 3300005617 Bacteria 2205
176 Ga0068859_100296845 3300005617 Unclassified 1709
177 Ga0068859_100316035 3300005617 Unclassified 1656
178 Ga0068859_100773440 3300005617 Bacteria 1048
179 Ga0068859_100940898 3300005617 Bacteria 948
180 Ga0068864_100002992 3300005618 Bacteria 13977
181 Ga0068864_100031231 3300005618 Bacteria 4519
182 Ga0068864_100064069 3300005618 Bacteria 3187
183 Ga0068864_100086250 3300005618 Bacteria 2762
184 Ga0068864_100172548 3300005618 Bacteria 1973
185 Ga0068864_100173025 3300005618 Unclassified 1970
186 Ga0068864_100577298 3300005618 Bacteria 1089
187 Ga0068866_10062045 3300005718 Bacteria 1944
188 Ga0068866_10125749 3300005718 Unclassified 1451
189 Ga0068861_100307752 3300005719 Bacteria 1375
190 Ga0068861_100664526 3300005719 Bacteria 964
191 Ga0068851_10017135 3300005834 Bacteria 3476
192 Ga0068851_10050726 3300005834 Bacteria 2107
193 Ga0068863_100021545 3300005841 Bacteria 6149
194 Ga0068863_100022462 3300005841 Bacteria 6025
195 Ga0068863_100033540 3300005841 Bacteria 4891
196 Ga0068863_100140271 3300005841 Bacteria 2310
197 Ga0068863_100199334 3300005841 Bacteria 1925
198 Ga0068863_100244736 3300005841 Bacteria 1731
199 Ga0068863_100504344 3300005841 Bacteria 1192
200 Ga0068863_100514290 3300005841 Unclassified 1180
201 Ga0068863_100549665 3300005841 Bacteria 1140
202 Ga0068863_100600860 3300005841 Bacteria 1089
203 Ga0068858_100007969 3300005842 Bacteria 10207
204 Ga0068858_100124958 3300005842 Unclassified 2408
205 Ga0068860_100002875 3300005843 Bacteria 17869
206 Ga0068860_100018515 3300005843 Bacteria 6774
207 Ga0068860_100021492 3300005843 Bacteria 6248
208 Ga0068860_100050385 3300005843 Bacteria 3964
209 Ga0068860_100093610 3300005843 Bacteria 2864
210 Ga0068860_100652933 3300005843 Bacteria 1060
211 Ga0068862_100053707 3300005844 Bacteria 3449
212 Ga0068862_100128837 3300005844 Bacteria 2237
213 Ga0081540_1095134 3300005983 Bacteria 1299
214 Ga0081539_10000876 3300005985 Bacteria 57659
215 Ga0081539_10067314 3300005985 Bacteria 1937
216 Ga0070715_10220508 3300006163 Bacteria 975
217 Ga0097621_100000300 3300006237 Bacteria 33484
218 Ga0097621_100022158 3300006237 Bacteria 4927
219 Ga0097621_100025287 3300006237 Bacteria 4643
220 Ga0097621_100288029 3300006237 Bacteria 1447
221 Ga0097621_100459453 3300006237 Unclassified 1148
222 Ga0068871_100000593 3300006358 Bacteria 24903
223 Ga0068871_100069501 3300006358 Bacteria 2892
224 Ga0068871_100166701 3300006358 Bacteria 1886
225 Ga0068871_100258825 3300006358 Bacteria 1517
226 Ga0075428_100023774 3300006844 Bacteria 6781
227 Ga0075428_100025378 3300006844 Bacteria 6559
228 Ga0075428_100036884 3300006844 Bacteria 5384
229 Ga0075428_100080948 3300006844 Bacteria 3545
230 Ga0075428_100190536 3300006844 Bacteria 2218
231 Ga0075428_100372137 3300006844 Bacteria 1532
232 Ga0075430_100020249 3300006846 Bacteria 5660
233 Ga0075431_100008997 3300006847 Bacteria 10010
234 Ga0075431_100013434 3300006847 Bacteria 8272
235 Ga0075434_100793847 3300006871 Bacteria 963
236 Ga0075429_100080972 3300006880 Bacteria 2831
237 Ga0075429_100126085 3300006880 Bacteria 2239
238 Ga0075429_100582786 3300006880 Bacteria 980
239 Ga0068865_100007978 3300006881 Bacteria 6535
240 Ga0068865_100085536 3300006881 Bacteria 2275
241 Ga0068865_100144291 3300006881 Bacteria 1798
242 Ga0068865_100154981 3300006881 Bacteria 1741
243 Ga0097620_100000030 3300006931 Bacteria 175435
244 Ga0097620_100010642 3300006931 Bacteria 9259
245 Ga0097620_100013810 3300006931 Bacteria 8097
246 Ga0097620_100026238 3300006931 Bacteria 5842
247 Ga0097620_100074324 3300006931 Bacteria 3438
248 Ga0097620_100106934 3300006931 Bacteria 2857
249 Ga0097620_100178652 3300006931 Bacteria 2205
250 Ga0097620_100296817 3300006931 Unclassified 1709
251 Ga0097620_100316039 3300006931 Unclassified 1656
252 Ga0097620_100773443 3300006931 Bacteria 1048
253 Ga0097620_100940862 3300006931 Bacteria 948
254 Ga0105244_10000011 3300009036 Bacteria 263939
255 Ga0105240_10000714 3300009093 Bacteria 60757
256 Ga0105240_10000986 3300009093 Bacteria 50790
257 Ga0105240_10001519 3300009093 Bacteria 39462
258 Ga0105240_10010489 3300009093 Bacteria 13024
259 Ga0105240_10027112 3300009093 Bacteria 7507
260 Ga0105240_10131900 3300009093 Bacteria 2996
261 Ga0105240_10140389 3300009093 Bacteria 2889
262 Ga0105240_10207332 3300009093 Bacteria 2293
263 Ga0105240_10257303 3300009093 Bacteria 2016
264 Ga0111539_10097271 3300009094 Bacteria 3458
265 Ga0111539_10155723 3300009094 Bacteria 2674
266 Ga0111539_10584611 3300009094 Bacteria 1300
267 Ga0105245_10566797 3300009098 Bacteria 1159
268 Ga0105247_10001821 3300009101 Bacteria 14947
269 Ga0114129_10009512 3300009147 Bacteria 13864
270 Ga0114129_10356753 3300009147 Bacteria 1935
271 Ga0105243_10134900 3300009148 Bacteria 2099
272 Ga0105243_10216623 3300009148 Bacteria 1690
273 Ga0105241_10000369 3300009174 Bacteria 34233
274 Ga0105241_10107180 3300009174 Bacteria 2231
275 Ga0105242_10004483 3300009176 Bacteria 10849
276 Ga0105242_10019392 3300009176 Bacteria 5329
277 Ga0105242_10041826 3300009176 Bacteria 3698
278 Ga0105242_10060996 3300009176 Bacteria 3101
279 Ga0105242_10078270 3300009176 Bacteria 2760
280 Ga0105242_10160988 3300009176 Bacteria 1965
281 Ga0105242_10207710 3300009176 Bacteria 1743
282 Ga0105248_10025375 3300009177 Bacteria 6590
283 Ga0105237_10000505 3300009545 Bacteria 55179
284 Ga0105237_10039371 3300009545 Bacteria 4772
285 Ga0105237_10040220 3300009545 Bacteria 4716
286 Ga0105238_10364311 3300009551 Bacteria 1435
287 Ga0105249_10003692 3300009553 Bacteria 13197
288 Ga0105249_10026849 3300009553 Bacteria 5192
289 Ga0105249_10029877 3300009553 Bacteria 4924
290 Ga0105249_10050673 3300009553 Bacteria 3785
291 Ga0105249_10056620 3300009553 Bacteria 3589
292 Ga0105249_10087561 3300009553 Bacteria 2906
293 Ga0105249_10159886 3300009553 Bacteria 2176
294 Ga0105249_10192001 3300009553 Bacteria 1994
295 Ga0105249_10285469 3300009553 Bacteria 1650
296 Ga0105249_10462268 3300009553 Bacteria 1309
297 Ga0105249_10545011 3300009553 Unclassified 1210
298 Ga0105249_10601185 3300009553 Bacteria 1154
299 Ga0105249_11008942 3300009553 Bacteria 901
300 Ga0105239_10000046 3300010375 Bacteria 181115
301 Ga0105239_10011936 3300010375 Bacteria 9688
302 Ga0105239_10030261 3300010375 Bacteria 5951
303 Ga0105239_10039865 3300010375 Bacteria 5145
304 Ga0105239_10048136 3300010375 Bacteria 4674
305 Ga0105239_10076642 3300010375 Bacteria 3678
306 Ga0105239_10102159 3300010375 Bacteria 3173
307 Ga0105239_10212617 3300010375 Bacteria 2168
308 Ga0105246_10009641 3300011119 Bacteria 5951
309 Ga0105246_10011783 3300011119 Bacteria 5433
310 Ga0105246_10547529 3300011119 Bacteria 991
311 Ga0157373_10000001 3300013100 Bacteria 864756
312 Ga0157373_10011835 3300013100 Bacteria 6409
313 Ga0157373_10015138 3300013100 Bacteria 5641
314 Ga0157373_10018891 3300013100 Bacteria 5016
315 Ga0157373_10089998 3300013100 Bacteria 2161
316 Ga0157371_10018644 3300013102 Bacteria 5127
317 Ga0157371_10041637 3300013102 Bacteria 3277
318 Ga0157371_10048434 3300013102 Bacteria 3021
319 Ga0157371_10151097 3300013102 Bacteria 1656
320 Ga0157371_10214866 3300013102 Bacteria 1380
321 Ga0157370_10016092 3300013104 Bacteria 7581
322 Ga0157370_10101326 3300013104 Bacteria 2697
323 Ga0157370_10223096 3300013104 Bacteria 1745
324 Ga0157369_10013999 3300013105 Bacteria 9063
325 Ga0157369_10024739 3300013105 Bacteria 6672
326 Ga0157369_10029858 3300013105 Bacteria 6020
327 Ga0157369_10076176 3300013105 Bacteria 3596
328 Ga0157374_10000003 3300013296 Bacteria 854471
329 Ga0157374_10013141 3300013296 Bacteria 7222
330 Ga0157374_10044269 3300013296 Bacteria 4114
331 Ga0157374_10106855 3300013296 Bacteria 2689
332 Ga0157374_10285770 3300013296 Bacteria 1629
333 Ga0157378_10003187 3300013297 Bacteria 14573
334 Ga0157378_10020443 3300013297 Bacteria 5821
335 Ga0157378_10027456 3300013297 Bacteria 5023
336 Ga0157378_10075858 3300013297 Unclassified 3028
337 Ga0157378_10268314 3300013297 Bacteria 1640
338 Ga0157378_10290107 3300013297 Bacteria 1580
339 Ga0157378_10599853 3300013297 Bacteria 1112
340 Ga0163162_10000728 3300013306 Bacteria 30520
341 Ga0163162_10003244 3300013306 Bacteria 15556
342 Ga0163162_10004724 3300013306 Bacteria 13139
343 Ga0163162_10100853 3300013306 Bacteria 2979
344 Ga0163162_10104979 3300013306 Bacteria 2920
345 Ga0163162_10156322 3300013306 Unclassified 2400
346 Ga0163162_10269969 3300013306 Unclassified 1833
347 Ga0163162_10305515 3300013306 Bacteria 1723
348 Ga0163162_10466081 3300013306 Unclassified 1395
349 Ga0157372_10000009 3300013307 Bacteria 302051
350 Ga0157372_10002614 3300013307 Bacteria 19487
351 Ga0157372_10004776 3300013307 Bacteria 14396
352 Ga0157372_10024446 3300013307 Bacteria 6562
353 Ga0157372_10121826 3300013307 Bacteria 2997
354 Ga0157372_10209889 3300013307 Bacteria 2257
355 Ga0157372_10226585 3300013307 Bacteria 2167
356 Ga0157372_10259243 3300013307 Bacteria 2019
357 Ga0157372_10387944 3300013307 Bacteria 1627
358 Ga0157372_10670499 3300013307 Bacteria 1207
359 Ga0157372_10679732 3300013307 Bacteria 1198
360 Ga0157375_10000453 3300013308 Bacteria 37144
361 Ga0157375_10000737 3300013308 Bacteria 28835
362 Ga0157375_10002980 3300013308 Bacteria 14711
363 Ga0157375_10049603 3300013308 Bacteria 4114
364 Ga0157375_10049671 3300013308 Bacteria 4111
365 Ga0157375_10107162 3300013308 Bacteria 2887
366 Ga0157375_10172280 3300013308 Bacteria 2312
367 Ga0157375_10203757 3300013308 Bacteria 2135
368 Ga0157375_10231816 3300013308 Bacteria 2005
369 Ga0157375_10310343 3300013308 Bacteria 1741
370 Ga0157375_10427687 3300013308 Unclassified 1490
371 Ga0157375_10489307 3300013308 Bacteria 1395
372 Ga0157375_10611526 3300013308 Bacteria 1248
373 Ga0157375_10947326 3300013308 Unclassified 1003
374 Ga0163163_10000176 3300014325 Bacteria 66751
375 Ga0163163_10008019 3300014325 Bacteria 9349
376 Ga0163163_10069063 3300014325 Bacteria 3517
377 Ga0163163_10140667 3300014325 Bacteria 2456
378 Ga0163163_10163145 3300014325 Unclassified 2274
379 Ga0163163_10468711 3300014325 Bacteria 1320
380 Ga0163163_10515377 3300014325 Bacteria 1258
381 Ga0157380_10006039 3300014326 Bacteria 8484
382 Ga0157380_10134402 3300014326 Bacteria 2115
383 Ga0157380_10405301 3300014326 Bacteria 1295
384 Ga0157377_10003813 3300014745 Bacteria 6851
385 Ga0157377_10018439 3300014745 Bacteria 3626
386 Ga0157377_10022699 3300014745 Bacteria 3318
387 Ga0157377_10063728 3300014745 Bacteria 2112
388 Ga0157377_10203480 3300014745 Unclassified 1258
389 Ga0157379_10015761 3300014968 Bacteria 6642
390 Ga0157379_10016844 3300014968 Bacteria 6433
391 Ga0157379_10051164 3300014968 Bacteria 3690
392 Ga0157379_10123875 3300014968 Bacteria 2326
393 Ga0157379_10133897 3300014968 Bacteria 2232
394 Ga0157379_10351849 3300014968 Bacteria 1349
395 Ga0157376_10005480 3300014969 Bacteria 8874
396 Ga0157376_10015529 3300014969 Bacteria 5755
397 Ga0157376_10138561 3300014969 Bacteria 2180
398 Ga0163161_10042853 3300017792 Bacteria 3257
399 Ga0154015_1034610 3300020610 Bacteria 2266
400 Ga0209675_1000112 3300025291 Bacteria 114185
401 Ga0207697_10066989 3300025315 Bacteria 1501
402 Ga0207656_10045611 3300025321 Bacteria 1876
403 Ga0207655_1000242 3300025728 Bacteria 89450
404 Ga0207642_10042248 3300025899 Bacteria 2002
405 Ga0207642_10119413 3300025899 Bacteria 1357
406 Ga0207642_10119989 3300025899 Unclassified 1355
407 Ga0207710_10001437 3300025900 Bacteria 11892
408 Ga0207710_10036703 3300025900 Bacteria 2162
409 Ga0207688_10030899 3300025901 Bacteria 2955
410 Ga0207680_10000084 3300025903 Bacteria 42773
411 Ga0207680_10311992 3300025903 Bacteria 1098
412 Ga0207647_10021658 3300025904 Bacteria 4287
413 Ga0207647_10043228 3300025904 Bacteria 2820
414 Ga0207645_10001451 3300025907 Bacteria 19392
415 Ga0207645_10059318 3300025907 Bacteria 2444
416 Ga0207645_10107580 3300025907 Bacteria 1804
417 Ga0207645_10277652 3300025907 Bacteria 1112
418 Ga0207643_10082144 3300025908 Bacteria 1868
419 Ga0207705_10130151 3300025909 Unclassified 1872
420 Ga0207654_10006591 3300025911 Bacteria 5836
421 Ga0207654_10178893 3300025911 Bacteria 1382
422 Ga0207695_10000245 3300025913 Bacteria 141090
423 Ga0207695_10000447 3300025913 Bacteria 90113
424 Ga0207695_10000981 3300025913 Bacteria 50713
425 Ga0207695_10002676 3300025913 Bacteria 26013
426 Ga0207695_10061792 3300025913 Bacteria 3870
427 Ga0207695_10069899 3300025913 Bacteria 3592
428 Ga0207695_10128971 3300025913 Bacteria 2488
429 Ga0207695_10272742 3300025913 Bacteria 1587
430 Ga0207671_10003744 3300025914 Bacteria 14983
431 Ga0207671_10006596 3300025914 Bacteria 10302
432 Ga0207671_10019590 3300025914 Bacteria 5171
433 Ga0207671_10025451 3300025914 Bacteria 4446
434 Ga0207660_10055628 3300025917 Bacteria 2828
435 Ga0207662_10070751 3300025918 Unclassified 2111
436 Ga0207662_10165068 3300025918 Unclassified 1417
437 Ga0207662_10174206 3300025918 Bacteria 1381
438 Ga0207657_10001990 3300025919 Bacteria 22079
439 Ga0207657_10012943 3300025919 Bacteria 8203
440 Ga0207649_10003053 3300025920 Bacteria 9195
441 Ga0207649_10032136 3300025920 Bacteria 3126
442 Ga0207649_10105960 3300025920 Bacteria 1869
443 Ga0207649_10177504 3300025920 Unclassified 1489
444 Ga0207652_10124637 3300025921 Bacteria 2294
445 Ga0207681_10010686 3300025923 Bacteria 5633
446 Ga0207681_10020086 3300025923 Bacteria 4230
447 Ga0207681_10050477 3300025923 Bacteria 2815
448 Ga0207681_10134317 3300025923 Unclassified 1834
449 Ga0207681_10717282 3300025923 Bacteria 832
450 Ga0207694_10045241 3300025924 Bacteria 3400
451 Ga0207650_10009161 3300025925 Bacteria 6765
452 Ga0207650_10069035 3300025925 Bacteria 2655
453 Ga0207650_10136505 3300025925 Bacteria 1924
454 Ga0207650_10153588 3300025925 Unclassified 1819
455 Ga0207650_10189756 3300025925 Bacteria 1642
456 Ga0207659_10192854 3300025926 Bacteria 1622
457 Ga0207659_10222433 3300025926 Bacteria 1518
458 Ga0207644_10057174 3300025931 Bacteria 2816
459 Ga0207644_10185046 3300025931 Bacteria 1635
460 Ga0207690_10051174 3300025932 Bacteria 2761
461 Ga0207706_10030947 3300025933 Bacteria 4772
462 Ga0207706_10046271 3300025933 Bacteria 3853
463 Ga0207706_10134913 3300025933 Bacteria 2171
464 Ga0207706_10302385 3300025933 Bacteria 1394
465 Ga0207706_10436337 3300025933 Unclassified 1134
466 Ga0207706_10561843 3300025933 Unclassified 982
467 Ga0207686_10000403 3300025934 Bacteria 30043
468 Ga0207686_10032426 3300025934 Bacteria 3109
469 Ga0207686_10164044 3300025934 Bacteria 1560
470 Ga0207686_10364620 3300025934 Bacteria 1091
471 Ga0207709_10178427 3300025935 Bacteria 1497
472 Ga0207670_10023655 3300025936 Bacteria 3828
473 Ga0207670_10063612 3300025936 Bacteria 2525
474 Ga0207670_10295879 3300025936 Unclassified 1266
475 Ga0207669_10155066 3300025937 Bacteria 1610
476 Ga0207669_10381469 3300025937 Bacteria 1098
477 Ga0207704_10057439 3300025938 Bacteria 2390
478 Ga0207704_10174870 3300025938 Bacteria 1544
479 Ga0207704_10411863 3300025938 Unclassified 1069
480 Ga0207691_10032378 3300025940 Bacteria 4874
481 Ga0207691_10039766 3300025940 Bacteria 4350
482 Ga0207691_10096599 3300025940 Bacteria 2641
483 Ga0207691_10132910 3300025940 Bacteria 2197
484 Ga0207691_10342538 3300025940 Bacteria 1279
485 Ga0207711_10036751 3300025941 Bacteria 4157
486 Ga0207711_10385913 3300025941 Unclassified 1300
487 Ga0207689_10000961 3300025942 Bacteria 27698
488 Ga0207689_10007333 3300025942 Bacteria 9673
489 Ga0207689_10011510 3300025942 Bacteria 7582
490 Ga0207689_10017632 3300025942 Bacteria 6036
491 Ga0207661_10001405 3300025944 Bacteria 16208
492 Ga0207661_10001489 3300025944 Bacteria 15853
493 Ga0207661_10021421 3300025944 Bacteria 4843
494 Ga0207661_10716216 3300025944 Bacteria 921
495 Ga0207679_10042191 3300025945 Bacteria 3277
496 Ga0207679_10057702 3300025945 Unclassified 2873
497 Ga0207679_10318834 3300025945 Unclassified 1345
498 Ga0207667_10001087 3300025949 Bacteria 34483
499 Ga0207667_10001322 3300025949 Bacteria 31120
500 Ga0207667_10004997 3300025949 Bacteria 16203
501 Ga0207667_10065468 3300025949 Bacteria 3790
502 Ga0207651_10029622 3300025960 Unclassified 3471
503 Ga0207651_10043703 3300025960 Bacteria 2993
504 Ga0207651_10193470 3300025960 Bacteria 1624
505 Ga0207651_10194324 3300025960 Bacteria 1621
506 Ga0207712_10002957 3300025961 Bacteria 10845
507 Ga0207712_10012803 3300025961 Bacteria 5364
508 Ga0207712_10049316 3300025961 Bacteria 2933
509 Ga0207712_10072563 3300025961 Bacteria 2479
510 Ga0207712_10395643 3300025961 Bacteria 1160
511 Ga0207712_10434125 3300025961 Unclassified 1110
512 Ga0207668_10023404 3300025972 Bacteria 3969
513 Ga0207640_10106203 3300025981 Bacteria 1980
514 Ga0207640_10182425 3300025981 Bacteria 1575
515 Ga0207658_10052389 3300025986 Bacteria 3011
516 Ga0207658_10077048 3300025986 Bacteria 2543
517 Ga0207658_10096576 3300025986 Bacteria 2305
518 Ga0207658_10127980 3300025986 Unclassified 2035
519 Ga0207658_10440050 3300025986 Bacteria 1152
520 Ga0207677_10036514 3300026023 Bacteria 3203
521 Ga0207677_10059268 3300026023 Unclassified 2640
522 Ga0207677_10076945 3300026023 Bacteria 2377
523 Ga0207703_10003284 3300026035 Bacteria 13572
524 Ga0207703_10266693 3300026035 Unclassified 1550
525 Ga0207639_10005705 3300026041 Bacteria 8426
526 Ga0207639_10019058 3300026041 Bacteria 4886
527 Ga0207639_10067706 3300026041 Bacteria 2779
528 Ga0207639_10076610 3300026041 Bacteria 2634
529 Ga0207639_10175056 3300026041 Bacteria 1821
530 Ga0207639_10404548 3300026041 Unclassified 1230
531 Ga0207678_10099422 3300026067 Bacteria 2485
532 Ga0207678_10198628 3300026067 Bacteria 1714
533 Ga0207708_10029505 3300026075 Bacteria 4158
534 Ga0207708_10089827 3300026075 Unclassified 2368
535 Ga0207702_10022716 3300026078 Bacteria 5202
536 Ga0207702_10026742 3300026078 Bacteria 4791
537 Ga0207702_10061967 3300026078 Bacteria 3192
538 Ga0207702_10335836 3300026078 Bacteria 1442
539 Ga0207702_10632248 3300026078 Bacteria 1052
540 Ga0207641_10000061 3300026088 Bacteria 160161
541 Ga0207641_10013412 3300026088 Bacteria 6719
542 Ga0207641_10091472 3300026088 Bacteria 2662
543 Ga0207641_10130729 3300026088 Bacteria 2254
544 Ga0207641_10143558 3300026088 Bacteria 2156
545 Ga0207641_10580862 3300026088 Bacteria 1095
546 Ga0207648_10009148 3300026089 Bacteria 9520
547 Ga0207648_10023846 3300026089 Bacteria 5472
548 Ga0207676_10012723 3300026095 Bacteria 6036
549 Ga0207676_10017719 3300026095 Bacteria 5167
550 Ga0207676_10030930 3300026095 Unclassified 4023
551 Ga0207676_10132988 3300026095 Bacteria 2118
552 Ga0207676_10201665 3300026095 Bacteria 1758
553 Ga0207676_10615152 3300026095 Unclassified 1045
554 Ga0207674_10003604 3300026116 Bacteria 18880
555 Ga0207674_10026446 3300026116 Bacteria 6162
556 Ga0207674_10029767 3300026116 Bacteria 5745
557 Ga0207674_10092637 3300026116 Bacteria 3011
558 Ga0207674_10093303 3300026116 Bacteria 2999
559 Ga0207674_10170753 3300026116 Bacteria 2128
560 Ga0207674_10238216 3300026116 Bacteria 1767
561 Ga0207674_10463309 3300026116 Bacteria 1225
562 Ga0207675_100003242 3300026118 Bacteria 15948
563 Ga0207675_100127031 3300026118 Bacteria 2416
564 Ga0207675_100473349 3300026118 Bacteria 1244
565 Ga0207675_100627967 3300026118 Unclassified 1079
566 Ga0207683_10010880 3300026121 Bacteria 7761
567 Ga0207683_10025819 3300026121 Bacteria 5068
568 Ga0207683_10468501 3300026121 Bacteria 1162
569 Ga0207698_10061920 3300026142 Bacteria 2919
570 Ga0207698_10109069 3300026142 Bacteria 2315
571 Ga0207698_10124550 3300026142 Bacteria 2189
572 Ga0268266_10000149 3300028379 Bacteria 134809
573 Ga0268266_10148716 3300028379 Bacteria 2109
574 Ga0268265_10064799 3300028380 Bacteria 2817
575 Ga0268265_10123497 3300028380 Bacteria 2138
576 Ga0268264_10002062 3300028381 Bacteria 17926
577 Ga0268264_10012988 3300028381 Bacteria 6846
578 Ga0268264_10038071 3300028381 Bacteria 3968
579 Ga0268264_10107849 3300028381 Bacteria 2433
580 Ga0268264_10147106 3300028381 Bacteria 2108
581 Ga0268264_10390350 3300028381 Bacteria 1335
582 Ga0307517_10002960 3300028786 Bacteria 26831
583 Ga0307517_10208347 3300028786 Bacteria 1209
584 Ga0265338_10060582 3300028800 Bacteria 3324
585 Ga0265327_10000415 3300031251 Bacteria 78296
586 Ga0265327_10004289 3300031251 Bacteria 12741
587 Ga0307513_10442972 3300031456 Bacteria 1025
588 Ga0307509_10244091 3300031507 Bacteria 1586
589 Ga0307509_10327561 3300031507 Bacteria 1265
590 Ga0307509_10442479 3300031507 Unclassified 995
591 Ga0307408_100000982 3300031548 Bacteria 22029
592 Ga0307408_100002173 3300031548 Bacteria 14030
593 Ga0307508_10001547 3300031616 Bacteria 25744
594 Ga0307516_10000659 3300031730 Bacteria 46694
595 Ga0307412_10000154 3300031911 Bacteria 49488
596 Ga0307414_10000659 3300032004 Bacteria 17666
597 Ga0307414_10583676 3300032004 Bacteria 1000
598 Ga0307510_10000079 3300033180 Bacteria 73286
599 Ga0373957_0055546 3300035120 Bacteria 1523
600 Ga0373943_0136519 3300035170 Bacteria 1317
601 Ga0373955_0125271 3300035172 Bacteria 1496
602 Ga0316574_0241348 3300035398 Bacteria 1155
603 Ga0373927_0043822 3300035695 Bacteria 2896
604 Ga0373933_0006824 3300035724 Bacteria 6215
605 Ga0373937_0006391 3300036401 Bacteria 10170
606 Ga0395899_0000011 3300037312 Bacteria 521331
607 Ga0395899_0000780 3300037312 Bacteria 31338
608 Ga0395905_0764516 3300037471 Bacteria 869
609 Ga0439453_0036201 3300041408 Bacteria 953
610 Ga0439465_0089029 3300041413 Bacteria 1054
611 Ga0451798_0813648 3300041458 Bacteria 732
612 Ga0451839_1055358 3300041496 Bacteria 1122
613 Ga0451853_1735788 3300041512 Bacteria 1300
614 Ga0439449_0017711 3300042007 Bacteria 2674
615 Ga0439457_006873 3300042014 Bacteria 2753
616 Ga0451577_0091371 3300042876 Bacteria 2717
617 Ga0466972_0000027 3300044658 Bacteria 174082
618 Ga0466972_0003586 3300044658 Bacteria 7717
619 Ga0453684_0040546 3300044712 Bacteria 6320
620 Ga0453684_0277219 3300044712 Bacteria 1914
621 Ga0453684_1048424 3300044712 Unclassified 864
622 Ga0466968_0034075 3300044735 Bacteria 2124
623 Ga0466968_0091102 3300044735 Bacteria 1351
624 Ga0466970_0015421 3300044765 Bacteria 3928
625 Ga0466970_0042836 3300044765 Bacteria 2408
626 Ga0466970_0167680 3300044765 Bacteria 1216
627 Ga0466959_0023656 3300045049 Bacteria 4547
628 Ga0451576_0007056 3300045051 Bacteria 13572
629 Ga0466967_0709401 3300045976 Bacteria 997
630 Ga0495638_0175451 3300046460 Bacteria 1227
631 Ga0495638_0254261 3300046460 Bacteria 967
632 Ga0495650_0026116 3300046471 Bacteria 2723
633 Ga0495580_0047808 3300046472 Bacteria 3032
634 Ga0495580_0172524 3300046472 Bacteria 1495
635 Ga0495594_0226606 3300046499 Bacteria 1066
636 Ga0495596_0001111 3300046500 Bacteria 15937
637 Ga0495606_0002451 3300046507 Bacteria 21528
638 Ga0495606_0007874 3300046507 Bacteria 9404
639 Ga0495606_0016541 3300046507 Bacteria 5616
640 Ga0495608_0074642 3300046511 Bacteria 2210
641 Ga0495618_0059102 3300046514 Bacteria 2429
642 Ga0495628_0042506 3300046516 Bacteria 3625
643 Ga0495630_0054771 3300046517 Bacteria 2988
644 Ga0495632_0004739 3300046519 Bacteria 9172
645 Ga0495648_0017904 3300046524 Bacteria 5045
646 Ga0495586_0089716 3300046535 Bacteria 1697
647 Ga0495587_0187419 3300046536 Bacteria 1172
648 Ga0495622_0041455 3300046557 Bacteria 2141
649 Ga0495633_0002997 3300046558 Bacteria 11532
650 Ga0495667_0053457 3300046559 Bacteria 2660
651 Ga0495611_0000727 3300046648 Bacteria 18510
652 Ga0495611_0129345 3300046648 Bacteria 1178
653 Ga0495625_0003276 3300046660 Bacteria 16367
654 Ga0495625_0095525 3300046660 Bacteria 2049
655 Ga0495599_0104354 3300046678 Bacteria 1766
656 Ga0495624_0274217 3300046690 Bacteria 1019
657 Ga0495649_0064270 3300046694 Bacteria 1971
658 Ga0495674_0094415 3300047319 Bacteria 2551
659 Ga0495680_0074052 3300047322 Bacteria 2587
660 Ga0495686_0000039 3300047472 Bacteria 304821
661 Ga0495686_0006681 3300047472 Bacteria 8778
662 Ga0496102_0031826 3300048905 Bacteria 4735
663 Ga0496111_0102996 3300048914 Bacteria 2099
664 Ga0496116_0000266 3300048919 Bacteria 91468
665 Ga0496117_0000365 3300048920 Bacteria 78847
666 Ga0496118_0000672 3300048921 Bacteria 55573
667 Ga0496118_0098674 3300048921 Bacteria 1983
668 Ga0496119_0000227 3300048922 Bacteria 78848
669 Ga0496120_0100642 3300048923 Bacteria 1528
670 Ga0496121_0045208 3300048924 Bacteria 3786
671 Ga0496122_0000698 3300048925 Bacteria 66677
672 Ga0496122_0013041 3300048925 Bacteria 8186
673 Ga0496123_0001073 3300048926 Bacteria 41335
674 Ga0496124_0003284 3300048927 Bacteria 19949
675 Ga0496124_0067573 3300048927 Bacteria 2974
676 Ga0496125_0001623 3300048928 Bacteria 31693
677 Ga0496125_0016266 3300048928 Bacteria 7150
678 Ga0496126_0000809 3300048929 Bacteria 55872
679 Ga0501031_0052491 3300049568 Bacteria 2656
680 Ga0501031_0201624 3300049568 Bacteria 1298
681 Ga0501032_0000947 3300049569 Bacteria 23434
682 Ga0501032_0002494 3300049569 Bacteria 14369
683 Ga0501033_0046663 3300049570 Bacteria 3221
684 Ga0501033_0352520 3300049570 Bacteria 1031
685 Ga0501034_0000043 3300049571 Bacteria 229049
686 Ga0501034_0001945 3300049571 Bacteria 26170
687 Ga0501034_0019093 3300049571 Bacteria 7019
688 Ga0501034_0135290 3300049571 Bacteria 2445
689 Ga0501034_0659213 3300049571 Bacteria 948
690 Ga0501036_0039263 3300049572 Bacteria 4006
691 Ga0501036_0047391 3300049572 Bacteria 3640
692 Ga0501036_0113287 3300049572 Bacteria 2292
693 Ga0501037_0002466 3300049573 Bacteria 13369
694 Ga0501037_0099890 3300049573 Bacteria 2096
695 Ga0501037_0170161 3300049573 Bacteria 1549
696 Ga0501038_0008855 3300049574 Bacteria 9235
697 Ga0501038_0017091 3300049574 Bacteria 6563
698 Ga0501038_0018795 3300049574 Bacteria 6238
699 Ga0501039_0033080 3300049575 Bacteria 3989
700 Ga0501039_0042656 3300049575 Bacteria 3505
701 Ga0501039_0067930 3300049575 Bacteria 2767
702 Ga0501042_0258002 3300049578 Bacteria 1258
703 Ga0501043_0014475 3300049579 Bacteria 6176
704 Ga0501043_0116138 3300049579 Bacteria 2100
705 Ga0501046_0005083 3300049580 Bacteria 11795
706 Ga0501047_0007499 3300049581 Bacteria 10265
707 Ga0501047_0030454 3300049581 Bacteria 5202
708 Ga0501047_0032712 3300049581 Bacteria 5021
709 Ga0501048_0194807 3300049582 Bacteria 1436
710 Ga0501070_0049245 3300049586 Bacteria 3499
711 Ga0501070_0244581 3300049586 Bacteria 1468
712 Ga0501073_0019741 3300049589 Bacteria 4864
713 Ga0501073_0193399 3300049589 Bacteria 1408
714 Ga0501074_0012376 3300049590 Bacteria 6202
715 Ga0501077_0644754 3300049593 Unclassified 680
716 Ga0501227_040294 3300049665 Bacteria 1152
717 Ga0501257_007918 3300049686 Bacteria 2381
718 Ga0501219_000062 3300049703 Bacteria 17657
719 Ga0501225_0046243 3300049705 Bacteria 1206
720 Ga0501079_0243902 3300049741 Bacteria 1404
721 Ga0501080_0047315 3300049742 Bacteria 4004
722 Ga0501080_0056535 3300049742 Bacteria 3653
723 Ga0501083_0075955 3300049744 Bacteria 2230
724 Ga0501269_000101 3300049766 Bacteria 26831
725 Ga0501035_0000663 3300049822 Bacteria 37968
726 Ga0501035_0025393 3300049822 Bacteria 5432
727 Ga0501035_0122726 3300049822 Bacteria 2269
728 Ga0501035_0126883 3300049822 Bacteria 2227
729 Ga0501035_0165076 3300049822 Bacteria 1915
730 Ga0501044_0003040 3300049823 Bacteria 18988
731 Ga0501044_0291817 3300049823 Bacteria 1562
732 Ga0501284_00075 3300050005 Bacteria 28010
733 nmdc:mga05p37_14748_c1 3300050507 Bacteria 9386
734 nmdc:mga05p37_437639_c1 3300050507 Bacteria 1517
735 nmdc:mga09592_140738_c1 3300050508 Bacteria 2080
736 nmdc:mga09592_355013_c1 3300050508 Bacteria 1268
737 nmdc:mga06r32_153545_c1 3300050510 Bacteria 2282
738 nmdc:mga06r32_215259_c1 3300050510 Unclassified 1909
739 nmdc:mga08y16_120384_c1 3300050511 Bacteria 2731
740 nmdc:mga08y16_92469_c1 3300050511 Bacteria 3152
741 nmdc:mga0n895_765873_c1 3300050512 Bacteria 957
742 Ga0500644_0059096 3300053088 Unclassified 1344
743 Ga0500646_0002325 3300053090 Bacteria 4939
744 Ga0500646_0016349 3300053090 Bacteria 1937
745 Ga0500583_0034175 3300053092 Bacteria 2258
746 Ga0500641_0058123 3300053096 Unclassified 1606
747 Ga0500562_000085 3300053108 Bacteria 39648
748 Ga0500594_0048151 3300053118 Bacteria 1191
749 Ga0500642_0002298 3300053130 Bacteria 5587
750 Ga0500559_0016384 3300053136 Bacteria 3128
751 Ga0500568_0000384 3300053139 Bacteria 33842
752 Ga0500568_0033542 3300053139 Bacteria 2106
753 Ga0500604_0005155 3300053151 Bacteria 3450
754 Ga0500616_0068632 3300053153 Bacteria 1815
755 Ga0500616_0133346 3300053153 Bacteria 1171
756 Ga0500622_0000082 3300053156 Bacteria 101502
757 Ga0500622_0001640 3300053156 Bacteria 17525
758 Ga0500611_000018 3300053727 Bacteria 111023
759 Ga0500645_008906 3300053730 Bacteria 3395
760 Ga0501084_0091974 3300054114 Bacteria 2547
761 2585144584 2582581278 Bacteria 5296881
762 2588208775 2585428182 Bacteria 5007281
763 2588212514 2585428183 Bacteria 5166119
764 2588220153 2585428184 Bacteria 4978681
765 2588224950 2585428185 Bacteria 4969476
766 2588231772 2585428187 Bacteria 4629388
767 2644374411 2643221667 Bacteria 5627472
768 2765572086 2765235839 Bacteria 5314748
769 2816872298 2816332188 Bacteria 5133218
770 2819587435 2818991444 Bacteria 6968812
771 2833640139 2833640130 Bacteria 4858325
772 2871724235 2871720351 Bacteria 4862476
773 2881957945 2881955468 Bacteria 3545609
774 2889292442 2889290771 Bacteria 5530962
775 2919400649 2919399522 Bacteria 5164947
776 2945927643 2945924605 Bacteria 4296724
777 2965323262 2965320100 Bacteria 3975600
778 Ga0307515_10000057
779 JGI24741J21665_1025447
780 JGI24740J21852_10011969
781 JGI24739J22299_10016060
782 JGI24739J22299_10033908
783 rootH1_10030212
784 rootH1_10169668
785 rootH2_10043655
786 rootH2_10047649
787 rootH1_10042926
788 rootH1_10285767
789 Ga0055534_1002554
790 Ga0065712_10074708
791 Ga0065712_10158488
792 Ga0065712_10250953
793 Ga0065707_10166865
794 Ga0065707_10261169
795 Ga0070658_10056001
796 Ga0070658_10294586
797 Ga0070676_10049379
798 Ga0070676_10088708
799 Ga0070676_10277299
800 Ga0070683_100010531
801 Ga0070690_100041628
802 Ga0070690_100079159
803 Ga0070670_100078635
804 Ga0070670_100086613
805 Ga0070670_100088908
806 Ga0070670_100090533
807 Ga0070670_100206334
808 Ga0068869_100023151
809 Ga0068869_100024847
810 Ga0068869_100143925
811 Ga0070666_10000047
812 Ga0070666_10069509
813 Ga0070666_10079635
814 Ga0070666_10122185
815 Ga0070680_100032023
816 Ga0070680_100060149
817 Ga0070682_100000336
818 Ga0070682_100015123
819 Ga0070682_100143263
820 Ga0068868_100010137
821 Ga0068868_100033573
822 Ga0068868_100068025
823 Ga0068868_100506130
824 Ga0070660_100035363
825 Ga0070660_100039565
826 Ga0070660_100048632
827 Ga0070660_100110330
828 Ga0070660_100303589
829 Ga0070689_100051848
830 Ga0070689_100072876
831 Ga0070689_100339258
832 Ga0070687_100030751
833 Ga0070687_100190317
834 Ga0070661_100010397
835 Ga0070661_100019237
836 Ga0070661_100053526
837 Ga0070661_100068245
838 Ga0070661_100462305
839 Ga0070668_100088639
840 Ga0070668_100258900
841 Ga0070668_100376700
842 Ga0070669_100081846
843 Ga0070669_100098180
844 Ga0070669_100166717
845 Ga0070669_100307314
846 Ga0070669_100320597
847 Ga0070675_100024260
848 Ga0070675_100051906
849 Ga0070675_100235031
850 Ga0070671_100007985
851 Ga0070671_100030494
852 Ga0070671_100037171
853 Ga0070671_100057292
854 Ga0070671_100077465
855 Ga0070674_100006137
856 Ga0070674_100284243
857 Ga0070673_100033748
858 Ga0070673_100041789
859 Ga0070673_100046479
860 Ga0070673_100076307
861 Ga0070673_100082113
862 Ga0070673_100104140
863 Ga0070673_100263572
864 Ga0070673_100394912
865 Ga0070688_100026537
866 Ga0070688_100073808
867 Ga0070688_100335712
868 Ga0070659_100031310
869 Ga0070659_100032605
870 Ga0070659_100110696
871 Ga0070667_100049946
872 Ga0070667_100069241
873 Ga0070667_100084172
874 Ga0070667_100136341
875 Ga0070667_100623191
876 Ga0070700_100224614
877 Ga0070663_100073009
878 Ga0070663_100300491
879 Ga0070678_100000844
880 Ga0070678_100033365
881 Ga0070662_100029976
882 Ga0070662_100041322
883 Ga0070662_100205198
884 Ga0070662_100382345
885 Ga0070662_100413813
886 Ga0070681_10087624
887 Ga0070681_10199594
888 Ga0068867_100029819
889 Ga0068867_100089850
890 Ga0068867_100119958
891 Ga0068867_100309202
892 Ga0070685_10027443
893 Ga0070698_100006768
894 Ga0070698_100043563
895 Ga0070698_100081889
896 Ga0070679_100327995
897 Ga0070679_100551601
898 Ga0070684_100009118
899 Ga0070684_100009620
900 Ga0070684_100014653
901 Ga0070684_100073988
902 Ga0068853_100004508
903 Ga0068853_100024420
904 Ga0068853_100028915
905 Ga0068853_100059854
906 Ga0068853_100102704
907 Ga0068853_100769589
908 Ga0070672_100024555
909 Ga0070672_100155326
910 Ga0070672_100339571
911 Ga0070686_100081313
912 Ga0070665_100000016
913 Ga0070665_100694512
914 Ga0070704_100351840
915 Ga0068855_100000257
916 Ga0068855_100013876
917 Ga0068855_100017522
918 Ga0068855_100055208
919 Ga0068855_100248774
920 Ga0068855_100529236
921 Ga0070664_100001985
922 Ga0070664_100023092
923 Ga0070664_100030316
924 Ga0070664_100031713
925 Ga0068857_100071126
926 Ga0068857_100078080
927 Ga0068857_100087992
928 Ga0068857_100191527
929 Ga0068857_100441262
930 Ga0068857_100549625
931 Ga0068857_100831603
932 Ga0068854_100080228
933 Ga0068854_100134486
934 Ga0068854_100223174
935 Ga0068854_100444288
936 Ga0068856_100003123
937 Ga0068856_100007388
938 Ga0068856_100022723
939 Ga0068856_100173957
940 Ga0070702_100026528
941 Ga0068852_100029447
942 Ga0068852_100127103
943 Ga0068852_100143654
944 Ga0068852_100258529
945 Ga0068852_100502089
946 Ga0068852_100616995
947 Ga0068859_100000030
948 Ga0068859_100010642
949 Ga0068859_100013811
950 Ga0068859_100026238
951 Ga0068859_100106923
952 Ga0068859_100178658
953 Ga0068859_100296845
954 Ga0068859_100316035
955 Ga0068859_100773440
956 Ga0068859_100940898
957 Ga0068864_100002992
958 Ga0068864_100031231
959 Ga0068864_100064069
960 Ga0068864_100086250
961 Ga0068864_100172548
962 Ga0068864_100173025
963 Ga0068864_100577298
964 Ga0068866_10062045
965 Ga0068866_10125749
966 Ga0068861_100307752
967 Ga0068861_100664526
968 Ga0068851_10017135
969 Ga0068851_10050726
970 Ga0068863_100021545
971 Ga0068863_100022462
972 Ga0068863_100033540
973 Ga0068863_100140271
974 Ga0068863_100199334
975 Ga0068863_100244736
976 Ga0068863_100504344
977 Ga0068863_100514290
978 Ga0068863_100549665
979 Ga0068863_100600860
980 Ga0068858_100007969
981 Ga0068858_100124958
982 Ga0068860_100002875
983 Ga0068860_100018515
984 Ga0068860_100021492
985 Ga0068860_100050385
986 Ga0068860_100093610
987 Ga0068860_100652933
988 Ga0068862_100053707
989 Ga0068862_100128837
990 Ga0081540_1095134
991 Ga0081539_10000876
992 Ga0081539_10067314
993 Ga0070715_10220508
994 Ga0097621_100000300
995 Ga0097621_100022158
996 Ga0097621_100025287
997 Ga0097621_100288029
998 Ga0097621_100459453
999 Ga0068871_100000593
1000 Ga0068871_100069501
1001 Ga0068871_100166701
1002 Ga0068871_100258825
1003 Ga0075428_100023774
1004 Ga0075428_100025378
1005 Ga0075428_100036884
1006 Ga0075428_100080948
1007 Ga0075428_100190536
1008 Ga0075428_100372137
1009 Ga0075430_100020249
1010 Ga0075431_100008997
1011 Ga0075431_100013434
1012 Ga0075434_100793847
1013 Ga0075429_100080972
1014 Ga0075429_100126085
1015 Ga0075429_100582786
1016 Ga0068865_100007978
1017 Ga0068865_100085536
1018 Ga0068865_100144291
1019 Ga0068865_100154981
1020 Ga0097620_100000030
1021 Ga0097620_100010642
1022 Ga0097620_100013810
1023 Ga0097620_100026238
1024 Ga0097620_100074324
1025 Ga0097620_100106934
1026 Ga0097620_100178652
1027 Ga0097620_100296817
1028 Ga0097620_100316039
1029 Ga0097620_100773443
1030 Ga0097620_100940862
1031 Ga0105244_10000011
1032 Ga0105240_10000714
1033 Ga0105240_10000986
1034 Ga0105240_10001519
1035 Ga0105240_10010489
1036 Ga0105240_10027112
1037 Ga0105240_10131900
1038 Ga0105240_10140389
1039 Ga0105240_10207332
1040 Ga0105240_10257303
1041 Ga0111539_10097271
1042 Ga0111539_10155723
1043 Ga0111539_10584611
1044 Ga0105245_10566797
1045 Ga0105247_10001821
1046 Ga0114129_10009512
1047 Ga0114129_10356753
1048 Ga0105243_10134900
1049 Ga0105243_10216623
1050 Ga0105241_10000369
1051 Ga0105241_10107180
1052 Ga0105242_10004483
1053 Ga0105242_10019392
1054 Ga0105242_10041826
1055 Ga0105242_10060996
1056 Ga0105242_10078270
1057 Ga0105242_10160988
1058 Ga0105242_10207710
1059 Ga0105248_10025375
1060 Ga0105237_10000505
1061 Ga0105237_10039371
1062 Ga0105237_10040220
1063 Ga0105238_10364311
1064 Ga0105249_10003692
1065 Ga0105249_10026849
1066 Ga0105249_10029877
1067 Ga0105249_10050673
1068 Ga0105249_10056620
1069 Ga0105249_10087561
1070 Ga0105249_10159886
1071 Ga0105249_10192001
1072 Ga0105249_10285469
1073 Ga0105249_10462268
1074 Ga0105249_10545011
1075 Ga0105249_10601185
1076 Ga0105249_11008942
1077 Ga0105239_10000046
1078 Ga0105239_10011936
1079 Ga0105239_10030261
1080 Ga0105239_10039865
1081 Ga0105239_10048136
1082 Ga0105239_10076642
1083 Ga0105239_10102159
1084 Ga0105239_10212617
1085 Ga0105246_10009641
1086 Ga0105246_10011783
1087 Ga0105246_10547529
1088 Ga0157373_10000001
1089 Ga0157373_10011835
1090 Ga0157373_10015138
1091 Ga0157373_10018891
1092 Ga0157373_10089998
1093 Ga0157371_10018644
1094 Ga0157371_10041637
1095 Ga0157371_10048434
1096 Ga0157371_10151097
1097 Ga0157371_10214866
1098 Ga0157370_10016092
1099 Ga0157370_10101326
1100 Ga0157370_10223096
1101 Ga0157369_10013999
1102 Ga0157369_10024739
1103 Ga0157369_10029858
1104 Ga0157369_10076176
1105 Ga0157374_10000003
1106 Ga0157374_10013141
1107 Ga0157374_10044269
1108 Ga0157374_10106855
1109 Ga0157374_10285770
1110 Ga0157378_10003187
1111 Ga0157378_10020443
1112 Ga0157378_10027456
1113 Ga0157378_10075858
1114 Ga0157378_10268314
1115 Ga0157378_10290107
1116 Ga0157378_10599853
1117 Ga0163162_10000728
1118 Ga0163162_10003244
1119 Ga0163162_10004724
1120 Ga0163162_10100853
1121 Ga0163162_10104979
1122 Ga0163162_10156322
1123 Ga0163162_10269969
1124 Ga0163162_10305515
1125 Ga0163162_10466081
1126 Ga0157372_10000009
1127 Ga0157372_10002614
1128 Ga0157372_10004776
1129 Ga0157372_10024446
1130 Ga0157372_10121826
1131 Ga0157372_10209889
1132 Ga0157372_10226585
1133 Ga0157372_10259243
1134 Ga0157372_10387944
1135 Ga0157372_10670499
1136 Ga0157372_10679732
1137 Ga0157375_10000453
1138 Ga0157375_10000737
1139 Ga0157375_10002980
1140 Ga0157375_10049603
1141 Ga0157375_10049671
1142 Ga0157375_10107162
1143 Ga0157375_10172280
1144 Ga0157375_10203757
1145 Ga0157375_10231816
1146 Ga0157375_10310343
1147 Ga0157375_10427687
1148 Ga0157375_10489307
1149 Ga0157375_10611526
1150 Ga0157375_10947326
1151 Ga0163163_10000176
1152 Ga0163163_10008019
1153 Ga0163163_10069063
1154 Ga0163163_10140667
1155 Ga0163163_10163145
1156 Ga0163163_10468711
1157 Ga0163163_10515377
1158 Ga0157380_10006039
1159 Ga0157380_10134402
1160 Ga0157380_10405301
1161 Ga0157377_10003813
1162 Ga0157377_10018439
1163 Ga0157377_10022699
1164 Ga0157377_10063728
1165 Ga0157377_10203480
1166 Ga0157379_10015761
1167 Ga0157379_10016844
1168 Ga0157379_10051164
1169 Ga0157379_10123875
1170 Ga0157379_10133897
1171 Ga0157379_10351849
1172 Ga0157376_10005480
1173 Ga0157376_10015529
1174 Ga0157376_10138561
1175 Ga0163161_10042853
1176 Ga0154015_1034610
1177 Ga0209675_1000112
1178 Ga0207697_10066989
1179 Ga0207656_10045611
1180 Ga0207655_1000242
1181 Ga0207642_10042248
1182 Ga0207642_10119413
1183 Ga0207642_10119989
1184 Ga0207710_10001437
1185 Ga0207710_10036703
1186 Ga0207688_10030899
1187 Ga0207680_10000084
1188 Ga0207680_10311992
1189 Ga0207647_10021658
1190 Ga0207647_10043228
1191 Ga0207645_10001451
1192 Ga0207645_10059318
1193 Ga0207645_10107580
1194 Ga0207645_10277652
1195 Ga0207643_10082144
1196 Ga0207705_10130151
1197 Ga0207654_10006591
1198 Ga0207654_10178893
1199 Ga0207695_10000245
1200 Ga0207695_10000447
1201 Ga0207695_10000981
1202 Ga0207695_10002676
1203 Ga0207695_10061792
1204 Ga0207695_10069899
1205 Ga0207695_10128971
1206 Ga0207695_10272742
1207 Ga0207671_10003744
1208 Ga0207671_10006596
1209 Ga0207671_10019590
1210 Ga0207671_10025451
1211 Ga0207660_10055628
1212 Ga0207662_10070751
1213 Ga0207662_10165068
1214 Ga0207662_10174206
1215 Ga0207657_10001990
1216 Ga0207657_10012943
1217 Ga0207649_10003053
1218 Ga0207649_10032136
1219 Ga0207649_10105960
1220 Ga0207649_10177504
1221 Ga0207652_10124637
1222 Ga0207681_10010686
1223 Ga0207681_10020086
1224 Ga0207681_10050477
1225 Ga0207681_10134317
1226 Ga0207681_10717282
1227 Ga0207694_10045241
1228 Ga0207650_10009161
1229 Ga0207650_10069035
1230 Ga0207650_10136505
1231 Ga0207650_10153588
1232 Ga0207650_10189756
1233 Ga0207659_10192854
1234 Ga0207659_10222433
1235 Ga0207644_10057174
1236 Ga0207644_10185046
1237 Ga0207690_10051174
1238 Ga0207706_10030947
1239 Ga0207706_10046271
1240 Ga0207706_10134913
1241 Ga0207706_10302385
1242 Ga0207706_10436337
1243 Ga0207706_10561843
1244 Ga0207686_10000403
1245 Ga0207686_10032426
1246 Ga0207686_10164044
1247 Ga0207686_10364620
1248 Ga0207709_10178427
1249 Ga0207670_10023655
1250 Ga0207670_10063612
1251 Ga0207670_10295879
1252 Ga0207669_10155066
1253 Ga0207669_10381469
1254 Ga0207704_10057439
1255 Ga0207704_10174870
1256 Ga0207704_10411863
1257 Ga0207691_10032378
1258 Ga0207691_10039766
1259 Ga0207691_10096599
1260 Ga0207691_10132910
1261 Ga0207691_10342538
1262 Ga0207711_10036751
1263 Ga0207711_10385913
1264 Ga0207689_10000961
1265 Ga0207689_10007333
1266 Ga0207689_10011510
1267 Ga0207689_10017632
1268 Ga0207661_10001405
1269 Ga0207661_10001489
1270 Ga0207661_10021421
1271 Ga0207661_10716216
1272 Ga0207679_10042191
1273 Ga0207679_10057702
1274 Ga0207679_10318834
1275 Ga0207667_10001087
1276 Ga0207667_10001322
1277 Ga0207667_10004997
1278 Ga0207667_10065468
1279 Ga0207651_10029622
1280 Ga0207651_10043703
1281 Ga0207651_10193470
1282 Ga0207651_10194324
1283 Ga0207712_10002957
1284 Ga0207712_10012803
1285 Ga0207712_10049316
1286 Ga0207712_10072563
1287 Ga0207712_10395643
1288 Ga0207712_10434125
1289 Ga0207668_10023404
1290 Ga0207640_10106203
1291 Ga0207640_10182425
1292 Ga0207658_10052389
1293 Ga0207658_10077048
1294 Ga0207658_10096576
1295 Ga0207658_10127980
1296 Ga0207658_10440050
1297 Ga0207677_10036514
1298 Ga0207677_10059268
1299 Ga0207677_10076945
1300 Ga0207703_10003284
1301 Ga0207703_10266693
1302 Ga0207639_10005705
1303 Ga0207639_10019058
1304 Ga0207639_10067706
1305 Ga0207639_10076610
1306 Ga0207639_10175056
1307 Ga0207639_10404548
1308 Ga0207678_10099422
1309 Ga0207678_10198628
1310 Ga0207708_10029505
1311 Ga0207708_10089827
1312 Ga0207702_10022716
1313 Ga0207702_10026742
1314 Ga0207702_10061967
1315 Ga0207702_10335836
1316 Ga0207702_10632248
1317 Ga0207641_10000061
1318 Ga0207641_10013412
1319 Ga0207641_10091472
1320 Ga0207641_10130729
1321 Ga0207641_10143558
1322 Ga0207641_10580862
1323 Ga0207648_10009148
1324 Ga0207648_10023846
1325 Ga0207676_10012723
1326 Ga0207676_10017719
1327 Ga0207676_10030930
1328 Ga0207676_10132988
1329 Ga0207676_10201665
1330 Ga0207676_10615152
1331 Ga0207674_10003604
1332 Ga0207674_10026446
1333 Ga0207674_10029767
1334 Ga0207674_10092637
1335 Ga0207674_10093303
1336 Ga0207674_10170753
1337 Ga0207674_10238216
1338 Ga0207674_10463309
1339 Ga0207675_100003242
1340 Ga0207675_100127031
1341 Ga0207675_100473349
1342 Ga0207675_100627967
1343 Ga0207683_10010880
1344 Ga0207683_10025819
1345 Ga0207683_10468501
1346 Ga0207698_10061920
1347 Ga0207698_10109069
1348 Ga0207698_10124550
1349 Ga0268266_10000149
1350 Ga0268266_10148716
1351 Ga0268265_10064799
1352 Ga0268265_10123497
1353 Ga0268264_10002062
1354 Ga0268264_10012988
1355 Ga0268264_10038071
1356 Ga0268264_10107849
1357 Ga0268264_10147106
1358 Ga0268264_10390350
1359 Ga0307517_10002960
1360 Ga0307517_10208347
1361 Ga0265338_10060582
1362 Ga0265327_10000415
1363 Ga0265327_10004289
1364 Ga0307513_10442972
1365 Ga0307509_10244091
1366 Ga0307509_10327561
1367 Ga0307509_10442479
1368 Ga0307408_100000982
1369 Ga0307408_100002173
1370 Ga0307508_10001547
1371 Ga0307516_10000659
1372 Ga0307412_10000154
1373 Ga0307414_10000659
1374 Ga0307414_10583676
1375 Ga0307510_10000079
1376 Ga0373957_0055546
1377 Ga0373943_0136519
1378 Ga0373955_0125271
1379 Ga0316574_0241348
1380 Ga0373927_0043822
1381 Ga0373933_0006824
1382 Ga0373937_0006391
1383 Ga0395899_0000011
1384 Ga0395899_0000780
1385 Ga0395905_0764516
1386 Ga0439453_0036201
1387 Ga0439465_0089029
1388 Ga0451798_0813648
1389 Ga0451839_1055358
1390 Ga0451853_1735788
1391 Ga0439449_0017711
1392 Ga0439457_006873
1393 Ga0451577_0091371
1394 Ga0466972_0000027
1395 Ga0466972_0003586
1396 Ga0453684_0040546
1397 Ga0453684_0277219
1398 Ga0453684_1048424
1399 Ga0466968_0034075
1400 Ga0466968_0091102
1401 Ga0466970_0015421
1402 Ga0466970_0042836
1403 Ga0466970_0167680
1404 Ga0466959_0023656
1405 Ga0451576_0007056
1406 Ga0466967_0709401
1407 Ga0495638_0175451
1408 Ga0495638_0254261
1409 Ga0495650_0026116
1410 Ga0495580_0047808
1411 Ga0495580_0172524
1412 Ga0495594_0226606
1413 Ga0495596_0001111
1414 Ga0495606_0002451
1415 Ga0495606_0007874
1416 Ga0495606_0016541
1417 Ga0495608_0074642
1418 Ga0495618_0059102
1419 Ga0495628_0042506
1420 Ga0495630_0054771
1421 Ga0495632_0004739
1422 Ga0495648_0017904
1423 Ga0495586_0089716
1424 Ga0495587_0187419
1425 Ga0495622_0041455
1426 Ga0495633_0002997
1427 Ga0495667_0053457
1428 Ga0495611_0000727
1429 Ga0495611_0129345
1430 Ga0495625_0003276
1431 Ga0495625_0095525
1432 Ga0495599_0104354
1433 Ga0495624_0274217
1434 Ga0495649_0064270
1435 Ga0495674_0094415
1436 Ga0495680_0074052
1437 Ga0495686_0000039
1438 Ga0495686_0006681
1439 Ga0496102_0031826
1440 Ga0496111_0102996
1441 Ga0496116_0000266
1442 Ga0496117_0000365
1443 Ga0496118_0000672
1444 Ga0496118_0098674
1445 Ga0496119_0000227
1446 Ga0496120_0100642
1447 Ga0496121_0045208
1448 Ga0496122_0000698
1449 Ga0496122_0013041
1450 Ga0496123_0001073
1451 Ga0496124_0003284
1452 Ga0496124_0067573
1453 Ga0496125_0001623
1454 Ga0496125_0016266
1455 Ga0496126_0000809
1456 Ga0501031_0052491
1457 Ga0501031_0201624
1458 Ga0501032_0000947
1459 Ga0501032_0002494
1460 Ga0501033_0046663
1461 Ga0501033_0352520
1462 Ga0501034_0000043
1463 Ga0501034_0001945
1464 Ga0501034_0019093
1465 Ga0501034_0135290
1466 Ga0501034_0659213
1467 Ga0501036_0039263
1468 Ga0501036_0047391
1469 Ga0501036_0113287
1470 Ga0501037_0002466
1471 Ga0501037_0099890
1472 Ga0501037_0170161
1473 Ga0501038_0008855
1474 Ga0501038_0017091
1475 Ga0501038_0018795
1476 Ga0501039_0033080
1477 Ga0501039_0042656
1478 Ga0501039_0067930
1479 Ga0501042_0258002
1480 Ga0501043_0014475
1481 Ga0501043_0116138
1482 Ga0501046_0005083
1483 Ga0501047_0007499
1484 Ga0501047_0030454
1485 Ga0501047_0032712
1486 Ga0501048_0194807
1487 Ga0501070_0049245
1488 Ga0501070_0244581
1489 Ga0501073_0019741
1490 Ga0501073_0193399
1491 Ga0501074_0012376
1492 Ga0501077_0644754
1493 Ga0501227_040294
1494 Ga0501257_007918
1495 Ga0501219_000062
1496 Ga0501225_0046243
1497 Ga0501079_0243902
1498 Ga0501080_0047315
1499 Ga0501080_0056535
1500 Ga0501083_0075955
1501 Ga0501269_000101
1502 Ga0501035_0000663
1503 Ga0501035_0025393
1504 Ga0501035_0122726
1505 Ga0501035_0126883
1506 Ga0501035_0165076
1507 Ga0501044_0003040
1508 Ga0501044_0291817
1509 Ga0501284_00075
1510 nmdc:mga05p37_14748_c1
1511 nmdc:mga05p37_437639_c1
1512 nmdc:mga09592_140738_c1
1513 nmdc:mga09592_355013_c1
1514 nmdc:mga06r32_153545_c1
1515 nmdc:mga06r32_215259_c1
1516 nmdc:mga08y16_120384_c1
1517 nmdc:mga08y16_92469_c1
1518 nmdc:mga0n895_765873_c1
1519 Ga0500644_0059096
1520 Ga0500646_0002325
1521 Ga0500646_0016349
1522 Ga0500583_0034175
1523 Ga0500641_0058123
1524 Ga0500562_000085
1525 Ga0500594_0048151
1526 Ga0500642_0002298
1527 Ga0500559_0016384
1528 Ga0500568_0000384
1529 Ga0500568_0033542
1530 Ga0500604_0005155
1531 Ga0500616_0068632
1532 Ga0500616_0133346
1533 Ga0500622_0000082
1534 Ga0500622_0001640
1535 Ga0500611_000018
1536 Ga0500645_008906
1537 Ga0501084_0091974
1538 2585144584
1539 2588208775
1540 2588212514
1541 2588220153
1542 2588224950
1543 2588231772
1544 2644374411
1545 2765572086
1546 2816872298
1547 2819587435
1548 2833640139
1549 2871724235
1550 2881957945
1551 2889292442
1552 2919400649
1553 2945927643
1554 2965323262

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

54

173

0.92

PF01678

DAP_epimerase

Diaminopimelate epimerase

180

302

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.8888 1 253
2otn-assembly1.cif.gz_A crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis 0.882 2 250
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.8789 1 253
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.8788 1 253
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.869 1 253
ID Description Score Start End Superfamily
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9344 1 107 3.10.310.10
2q9jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9108 1 107 3.10.310.10
af_P9WP19_1_130_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9033 1 107 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8953 1 106 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.887 1 107 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A3M1BZ07-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9832 1 250 GO:0005829
GO:0008837
GO:0009089
AF-A0A0Q5ZLH9-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9817 1 253 GO:0005829
GO:0008837
GO:0009089
AF-H8XVK7-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9815 2 250 GO:0005829
GO:0008837
GO:0009089
AF-C2M7N1-F1-model_v4 deleted 0.9809 1 250
AF-A0A661ZDA5-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9796 1 253 GO:0005829
GO:0008837
GO:0009089

Map