F480373
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 304 | 1554 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10000057|Ga0307515_10000057188 |
| Length | 309 |
| Sequence | VPLPGINNSSGPPAIRYTPLAARLSFRNIAGMTRLAKPTSHLPLTTSKKMNIHFYKYQGTGNDFVILDNRDGRYNDLTKEQVKDICDRRFGIGADGLMMLNEKAGYDFEMKYYNSDGGESSMCGNGGRCLVMFAHHAGIRKNLYHFIASDGPHEAEIDADGTVSLKMKDVNNIAEYGGDFLLDTGSPHYVKLISDVKTYDVYKKGHAIRNSEEFAEKGINVNFVQQKSDFEIIVRTYERGVEDETWSCGTGVTAAALVCYHNETGYNDVTVLTKGGKLTVEFDRISDSHYTNIFLCGPAEKVYEGDIEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 188 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 189 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 236 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 237 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 238 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 239 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 259 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 260 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 275 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 278 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 282 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 285 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 286 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 289 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 290 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 291 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 292 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 293 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 294 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 295 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 296 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 297 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 298 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 299 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 300 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 301 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 302 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 303 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 304 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.68 |
| Metatranscriptomes | 0.13 |
| Isolates | 2.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0.13 |
| Rhizoplane | 0.39 |
| Rhizosphere | 92.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307515_10000057 | 3300028794 | Bacteria | 261695 |
| 2 | JGI24741J21665_1025447 | 3300001915 | Bacteria | 904 |
| 3 | JGI24740J21852_10011969 | 3300001979 | Bacteria | 3285 |
| 4 | JGI24739J22299_10016060 | 3300001989 | Bacteria | 2715 |
| 5 | JGI24739J22299_10033908 | 3300001989 | Unclassified | 1742 |
| 6 | rootH1_10030212 | 3300003316 | Bacteria | 3758 |
| 7 | rootH1_10169668 | 3300003316 | Bacteria | 1823 |
| 8 | rootH2_10043655 | 3300003320 | Bacteria | 6638 |
| 9 | rootH2_10047649 | 3300003320 | Bacteria | 3447 |
| 10 | rootH1_10042926 | 3300003323 | Bacteria | 22782 |
| 11 | rootH1_10285767 | 3300003323 | Bacteria | 1388 |
| 12 | Ga0055534_1002554 | 3300003784 | Bacteria | 6241 |
| 13 | Ga0065712_10074708 | 3300005290 | Bacteria | 4012 |
| 14 | Ga0065712_10158488 | 3300005290 | Unclassified | 1318 |
| 15 | Ga0065712_10250953 | 3300005290 | Unclassified | 960 |
| 16 | Ga0065707_10166865 | 3300005295 | Bacteria | 1515 |
| 17 | Ga0065707_10261169 | 3300005295 | Bacteria | 1097 |
| 18 | Ga0070658_10056001 | 3300005327 | Bacteria | 3204 |
| 19 | Ga0070658_10294586 | 3300005327 | Bacteria | 1383 |
| 20 | Ga0070676_10049379 | 3300005328 | Bacteria | 2463 |
| 21 | Ga0070676_10088708 | 3300005328 | Bacteria | 1890 |
| 22 | Ga0070676_10277299 | 3300005328 | Unclassified | 1128 |
| 23 | Ga0070683_100010531 | 3300005329 | Bacteria | 7950 |
| 24 | Ga0070690_100041628 | 3300005330 | Bacteria | 2909 |
| 25 | Ga0070690_100079159 | 3300005330 | Unclassified | 2148 |
| 26 | Ga0070670_100078635 | 3300005331 | Bacteria | 2833 |
| 27 | Ga0070670_100086613 | 3300005331 | Bacteria | 2692 |
| 28 | Ga0070670_100088908 | 3300005331 | Bacteria | 2655 |
| 29 | Ga0070670_100090533 | 3300005331 | Bacteria | 2629 |
| 30 | Ga0070670_100206334 | 3300005331 | Unclassified | 1708 |
| 31 | Ga0068869_100023151 | 3300005334 | Bacteria | 4286 |
| 32 | Ga0068869_100024847 | 3300005334 | Unclassified | 4153 |
| 33 | Ga0068869_100143925 | 3300005334 | Bacteria | 1843 |
| 34 | Ga0070666_10000047 | 3300005335 | Bacteria | 106512 |
| 35 | Ga0070666_10069509 | 3300005335 | Bacteria | 2394 |
| 36 | Ga0070666_10079635 | 3300005335 | Bacteria | 2238 |
| 37 | Ga0070666_10122185 | 3300005335 | Bacteria | 1806 |
| 38 | Ga0070680_100032023 | 3300005336 | Bacteria | 4230 |
| 39 | Ga0070680_100060149 | 3300005336 | Bacteria | 3109 |
| 40 | Ga0070682_100000336 | 3300005337 | Bacteria | 32281 |
| 41 | Ga0070682_100015123 | 3300005337 | Bacteria | 4468 |
| 42 | Ga0070682_100143263 | 3300005337 | Bacteria | 1632 |
| 43 | Ga0068868_100010137 | 3300005338 | Bacteria | 6809 |
| 44 | Ga0068868_100033573 | 3300005338 | Bacteria | 3956 |
| 45 | Ga0068868_100068025 | 3300005338 | Bacteria | 2835 |
| 46 | Ga0068868_100506130 | 3300005338 | Bacteria | 1058 |
| 47 | Ga0070660_100035363 | 3300005339 | Bacteria | 3781 |
| 48 | Ga0070660_100039565 | 3300005339 | Bacteria | 3585 |
| 49 | Ga0070660_100048632 | 3300005339 | Bacteria | 3257 |
| 50 | Ga0070660_100110330 | 3300005339 | Bacteria | 2188 |
| 51 | Ga0070660_100303589 | 3300005339 | Bacteria | 1309 |
| 52 | Ga0070689_100051848 | 3300005340 | Bacteria | 3172 |
| 53 | Ga0070689_100072876 | 3300005340 | Unclassified | 2685 |
| 54 | Ga0070689_100339258 | 3300005340 | Bacteria | 1258 |
| 55 | Ga0070687_100030751 | 3300005343 | Unclassified | 2627 |
| 56 | Ga0070687_100190317 | 3300005343 | Unclassified | 1236 |
| 57 | Ga0070661_100010397 | 3300005344 | Bacteria | 6469 |
| 58 | Ga0070661_100019237 | 3300005344 | Bacteria | 4865 |
| 59 | Ga0070661_100053526 | 3300005344 | Bacteria | 2954 |
| 60 | Ga0070661_100068245 | 3300005344 | Unclassified | 2613 |
| 61 | Ga0070661_100462305 | 3300005344 | Bacteria | 1011 |
| 62 | Ga0070668_100088639 | 3300005347 | Bacteria | 2436 |
| 63 | Ga0070668_100258900 | 3300005347 | Bacteria | 1446 |
| 64 | Ga0070668_100376700 | 3300005347 | Bacteria | 1207 |
| 65 | Ga0070669_100081846 | 3300005353 | Unclassified | 2406 |
| 66 | Ga0070669_100098180 | 3300005353 | Bacteria | 2206 |
| 67 | Ga0070669_100166717 | 3300005353 | Unclassified | 1715 |
| 68 | Ga0070669_100307314 | 3300005353 | Bacteria | 1277 |
| 69 | Ga0070669_100320597 | 3300005353 | Unclassified | 1251 |
| 70 | Ga0070675_100024260 | 3300005354 | Bacteria | 4857 |
| 71 | Ga0070675_100051906 | 3300005354 | Bacteria | 3371 |
| 72 | Ga0070675_100235031 | 3300005354 | Bacteria | 1600 |
| 73 | Ga0070671_100007985 | 3300005355 | Bacteria | 8469 |
| 74 | Ga0070671_100030494 | 3300005355 | Bacteria | 4450 |
| 75 | Ga0070671_100037171 | 3300005355 | Unclassified | 4038 |
| 76 | Ga0070671_100057292 | 3300005355 | Bacteria | 3242 |
| 77 | Ga0070671_100077465 | 3300005355 | Bacteria | 2778 |
| 78 | Ga0070674_100006137 | 3300005356 | Bacteria | 6986 |
| 79 | Ga0070674_100284243 | 3300005356 | Bacteria | 1312 |
| 80 | Ga0070673_100033748 | 3300005364 | Bacteria | 3867 |
| 81 | Ga0070673_100041789 | 3300005364 | Bacteria | 3530 |
| 82 | Ga0070673_100046479 | 3300005364 | Unclassified | 3372 |
| 83 | Ga0070673_100076307 | 3300005364 | Bacteria | 2706 |
| 84 | Ga0070673_100082113 | 3300005364 | Bacteria | 2615 |
| 85 | Ga0070673_100104140 | 3300005364 | Unclassified | 2342 |
| 86 | Ga0070673_100263572 | 3300005364 | Bacteria | 1506 |
| 87 | Ga0070673_100394912 | 3300005364 | Bacteria | 1236 |
| 88 | Ga0070688_100026537 | 3300005365 | Bacteria | 3442 |
| 89 | Ga0070688_100073808 | 3300005365 | Bacteria | 2189 |
| 90 | Ga0070688_100335712 | 3300005365 | Bacteria | 1102 |
| 91 | Ga0070659_100031310 | 3300005366 | Bacteria | 4119 |
| 92 | Ga0070659_100032605 | 3300005366 | Bacteria | 4041 |
| 93 | Ga0070659_100110696 | 3300005366 | Bacteria | 2216 |
| 94 | Ga0070667_100049946 | 3300005367 | Bacteria | 3524 |
| 95 | Ga0070667_100069241 | 3300005367 | Bacteria | 3003 |
| 96 | Ga0070667_100084172 | 3300005367 | Bacteria | 2726 |
| 97 | Ga0070667_100136341 | 3300005367 | Bacteria | 2146 |
| 98 | Ga0070667_100623191 | 3300005367 | Bacteria | 995 |
| 99 | Ga0070700_100224614 | 3300005441 | Bacteria | 1333 |
| 100 | Ga0070663_100073009 | 3300005455 | Bacteria | 2502 |
| 101 | Ga0070663_100300491 | 3300005455 | Bacteria | 1285 |
| 102 | Ga0070678_100000844 | 3300005456 | Bacteria | 15587 |
| 103 | Ga0070678_100033365 | 3300005456 | Bacteria | 3573 |
| 104 | Ga0070662_100029976 | 3300005457 | Bacteria | 3802 |
| 105 | Ga0070662_100041322 | 3300005457 | Bacteria | 3289 |
| 106 | Ga0070662_100205198 | 3300005457 | Unclassified | 1566 |
| 107 | Ga0070662_100382345 | 3300005457 | Bacteria | 1159 |
| 108 | Ga0070662_100413813 | 3300005457 | Unclassified | 1114 |
| 109 | Ga0070681_10087624 | 3300005458 | Bacteria | 3066 |
| 110 | Ga0070681_10199594 | 3300005458 | Bacteria | 1919 |
| 111 | Ga0068867_100029819 | 3300005459 | Unclassified | 3932 |
| 112 | Ga0068867_100089850 | 3300005459 | Bacteria | 2329 |
| 113 | Ga0068867_100119958 | 3300005459 | Bacteria | 2031 |
| 114 | Ga0068867_100309202 | 3300005459 | Bacteria | 1305 |
| 115 | Ga0070685_10027443 | 3300005466 | Unclassified | 3146 |
| 116 | Ga0070698_100006768 | 3300005471 | Bacteria | 12425 |
| 117 | Ga0070698_100043563 | 3300005471 | Bacteria | 4601 |
| 118 | Ga0070698_100081889 | 3300005471 | Bacteria | 3221 |
| 119 | Ga0070679_100327995 | 3300005530 | Bacteria | 1479 |
| 120 | Ga0070679_100551601 | 3300005530 | Unclassified | 1096 |
| 121 | Ga0070684_100009118 | 3300005535 | Bacteria | 7801 |
| 122 | Ga0070684_100009620 | 3300005535 | Bacteria | 7619 |
| 123 | Ga0070684_100014653 | 3300005535 | Bacteria | 6358 |
| 124 | Ga0070684_100073988 | 3300005535 | Bacteria | 3003 |
| 125 | Ga0068853_100004508 | 3300005539 | Bacteria | 10803 |
| 126 | Ga0068853_100024420 | 3300005539 | Bacteria | 5068 |
| 127 | Ga0068853_100028915 | 3300005539 | Bacteria | 4666 |
| 128 | Ga0068853_100059854 | 3300005539 | Bacteria | 3290 |
| 129 | Ga0068853_100102704 | 3300005539 | Bacteria | 2530 |
| 130 | Ga0068853_100769589 | 3300005539 | Bacteria | 921 |
| 131 | Ga0070672_100024555 | 3300005543 | Bacteria | 4457 |
| 132 | Ga0070672_100155326 | 3300005543 | Bacteria | 1895 |
| 133 | Ga0070672_100339571 | 3300005543 | Bacteria | 1279 |
| 134 | Ga0070686_100081313 | 3300005544 | Bacteria | 2146 |
| 135 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 136 | Ga0070665_100694512 | 3300005548 | Bacteria | 1031 |
| 137 | Ga0070704_100351840 | 3300005549 | Bacteria | 1244 |
| 138 | Ga0068855_100000257 | 3300005563 | Bacteria | 66593 |
| 139 | Ga0068855_100013876 | 3300005563 | Bacteria | 9717 |
| 140 | Ga0068855_100017522 | 3300005563 | Bacteria | 8614 |
| 141 | Ga0068855_100055208 | 3300005563 | Bacteria | 4666 |
| 142 | Ga0068855_100248774 | 3300005563 | Bacteria | 1983 |
| 143 | Ga0068855_100529236 | 3300005563 | Bacteria | 1278 |
| 144 | Ga0070664_100001985 | 3300005564 | Bacteria | 16400 |
| 145 | Ga0070664_100023092 | 3300005564 | Bacteria | 5134 |
| 146 | Ga0070664_100030316 | 3300005564 | Bacteria | 4512 |
| 147 | Ga0070664_100031713 | 3300005564 | Bacteria | 4418 |
| 148 | Ga0068857_100071126 | 3300005577 | Bacteria | 3099 |
| 149 | Ga0068857_100078080 | 3300005577 | Bacteria | 2955 |
| 150 | Ga0068857_100087992 | 3300005577 | Bacteria | 2779 |
| 151 | Ga0068857_100191527 | 3300005577 | Bacteria | 1862 |
| 152 | Ga0068857_100441262 | 3300005577 | Bacteria | 1216 |
| 153 | Ga0068857_100549625 | 3300005577 | Bacteria | 1088 |
| 154 | Ga0068857_100831603 | 3300005577 | Bacteria | 883 |
| 155 | Ga0068854_100080228 | 3300005578 | Bacteria | 2408 |
| 156 | Ga0068854_100134486 | 3300005578 | Bacteria | 1892 |
| 157 | Ga0068854_100223174 | 3300005578 | Bacteria | 1492 |
| 158 | Ga0068854_100444288 | 3300005578 | Unclassified | 1082 |
| 159 | Ga0068856_100003123 | 3300005614 | Bacteria | 16901 |
| 160 | Ga0068856_100007388 | 3300005614 | Bacteria | 10726 |
| 161 | Ga0068856_100022723 | 3300005614 | Bacteria | 6098 |
| 162 | Ga0068856_100173957 | 3300005614 | Bacteria | 2166 |
| 163 | Ga0070702_100026528 | 3300005615 | Bacteria | 3114 |
| 164 | Ga0068852_100029447 | 3300005616 | Bacteria | 4511 |
| 165 | Ga0068852_100127103 | 3300005616 | Bacteria | 2342 |
| 166 | Ga0068852_100143654 | 3300005616 | Bacteria | 2211 |
| 167 | Ga0068852_100258529 | 3300005616 | Bacteria | 1671 |
| 168 | Ga0068852_100502089 | 3300005616 | Bacteria | 1208 |
| 169 | Ga0068852_100616995 | 3300005616 | Bacteria | 1090 |
| 170 | Ga0068859_100000030 | 3300005617 | Bacteria | 175435 |
| 171 | Ga0068859_100010642 | 3300005617 | Bacteria | 9259 |
| 172 | Ga0068859_100013811 | 3300005617 | Bacteria | 8097 |
| 173 | Ga0068859_100026238 | 3300005617 | Bacteria | 5842 |
| 174 | Ga0068859_100106923 | 3300005617 | Bacteria | 2857 |
| 175 | Ga0068859_100178658 | 3300005617 | Bacteria | 2205 |
| 176 | Ga0068859_100296845 | 3300005617 | Unclassified | 1709 |
| 177 | Ga0068859_100316035 | 3300005617 | Unclassified | 1656 |
| 178 | Ga0068859_100773440 | 3300005617 | Bacteria | 1048 |
| 179 | Ga0068859_100940898 | 3300005617 | Bacteria | 948 |
| 180 | Ga0068864_100002992 | 3300005618 | Bacteria | 13977 |
| 181 | Ga0068864_100031231 | 3300005618 | Bacteria | 4519 |
| 182 | Ga0068864_100064069 | 3300005618 | Bacteria | 3187 |
| 183 | Ga0068864_100086250 | 3300005618 | Bacteria | 2762 |
| 184 | Ga0068864_100172548 | 3300005618 | Bacteria | 1973 |
| 185 | Ga0068864_100173025 | 3300005618 | Unclassified | 1970 |
| 186 | Ga0068864_100577298 | 3300005618 | Bacteria | 1089 |
| 187 | Ga0068866_10062045 | 3300005718 | Bacteria | 1944 |
| 188 | Ga0068866_10125749 | 3300005718 | Unclassified | 1451 |
| 189 | Ga0068861_100307752 | 3300005719 | Bacteria | 1375 |
| 190 | Ga0068861_100664526 | 3300005719 | Bacteria | 964 |
| 191 | Ga0068851_10017135 | 3300005834 | Bacteria | 3476 |
| 192 | Ga0068851_10050726 | 3300005834 | Bacteria | 2107 |
| 193 | Ga0068863_100021545 | 3300005841 | Bacteria | 6149 |
| 194 | Ga0068863_100022462 | 3300005841 | Bacteria | 6025 |
| 195 | Ga0068863_100033540 | 3300005841 | Bacteria | 4891 |
| 196 | Ga0068863_100140271 | 3300005841 | Bacteria | 2310 |
| 197 | Ga0068863_100199334 | 3300005841 | Bacteria | 1925 |
| 198 | Ga0068863_100244736 | 3300005841 | Bacteria | 1731 |
| 199 | Ga0068863_100504344 | 3300005841 | Bacteria | 1192 |
| 200 | Ga0068863_100514290 | 3300005841 | Unclassified | 1180 |
| 201 | Ga0068863_100549665 | 3300005841 | Bacteria | 1140 |
| 202 | Ga0068863_100600860 | 3300005841 | Bacteria | 1089 |
| 203 | Ga0068858_100007969 | 3300005842 | Bacteria | 10207 |
| 204 | Ga0068858_100124958 | 3300005842 | Unclassified | 2408 |
| 205 | Ga0068860_100002875 | 3300005843 | Bacteria | 17869 |
| 206 | Ga0068860_100018515 | 3300005843 | Bacteria | 6774 |
| 207 | Ga0068860_100021492 | 3300005843 | Bacteria | 6248 |
| 208 | Ga0068860_100050385 | 3300005843 | Bacteria | 3964 |
| 209 | Ga0068860_100093610 | 3300005843 | Bacteria | 2864 |
| 210 | Ga0068860_100652933 | 3300005843 | Bacteria | 1060 |
| 211 | Ga0068862_100053707 | 3300005844 | Bacteria | 3449 |
| 212 | Ga0068862_100128837 | 3300005844 | Bacteria | 2237 |
| 213 | Ga0081540_1095134 | 3300005983 | Bacteria | 1299 |
| 214 | Ga0081539_10000876 | 3300005985 | Bacteria | 57659 |
| 215 | Ga0081539_10067314 | 3300005985 | Bacteria | 1937 |
| 216 | Ga0070715_10220508 | 3300006163 | Bacteria | 975 |
| 217 | Ga0097621_100000300 | 3300006237 | Bacteria | 33484 |
| 218 | Ga0097621_100022158 | 3300006237 | Bacteria | 4927 |
| 219 | Ga0097621_100025287 | 3300006237 | Bacteria | 4643 |
| 220 | Ga0097621_100288029 | 3300006237 | Bacteria | 1447 |
| 221 | Ga0097621_100459453 | 3300006237 | Unclassified | 1148 |
| 222 | Ga0068871_100000593 | 3300006358 | Bacteria | 24903 |
| 223 | Ga0068871_100069501 | 3300006358 | Bacteria | 2892 |
| 224 | Ga0068871_100166701 | 3300006358 | Bacteria | 1886 |
| 225 | Ga0068871_100258825 | 3300006358 | Bacteria | 1517 |
| 226 | Ga0075428_100023774 | 3300006844 | Bacteria | 6781 |
| 227 | Ga0075428_100025378 | 3300006844 | Bacteria | 6559 |
| 228 | Ga0075428_100036884 | 3300006844 | Bacteria | 5384 |
| 229 | Ga0075428_100080948 | 3300006844 | Bacteria | 3545 |
| 230 | Ga0075428_100190536 | 3300006844 | Bacteria | 2218 |
| 231 | Ga0075428_100372137 | 3300006844 | Bacteria | 1532 |
| 232 | Ga0075430_100020249 | 3300006846 | Bacteria | 5660 |
| 233 | Ga0075431_100008997 | 3300006847 | Bacteria | 10010 |
| 234 | Ga0075431_100013434 | 3300006847 | Bacteria | 8272 |
| 235 | Ga0075434_100793847 | 3300006871 | Bacteria | 963 |
| 236 | Ga0075429_100080972 | 3300006880 | Bacteria | 2831 |
| 237 | Ga0075429_100126085 | 3300006880 | Bacteria | 2239 |
| 238 | Ga0075429_100582786 | 3300006880 | Bacteria | 980 |
| 239 | Ga0068865_100007978 | 3300006881 | Bacteria | 6535 |
| 240 | Ga0068865_100085536 | 3300006881 | Bacteria | 2275 |
| 241 | Ga0068865_100144291 | 3300006881 | Bacteria | 1798 |
| 242 | Ga0068865_100154981 | 3300006881 | Bacteria | 1741 |
| 243 | Ga0097620_100000030 | 3300006931 | Bacteria | 175435 |
| 244 | Ga0097620_100010642 | 3300006931 | Bacteria | 9259 |
| 245 | Ga0097620_100013810 | 3300006931 | Bacteria | 8097 |
| 246 | Ga0097620_100026238 | 3300006931 | Bacteria | 5842 |
| 247 | Ga0097620_100074324 | 3300006931 | Bacteria | 3438 |
| 248 | Ga0097620_100106934 | 3300006931 | Bacteria | 2857 |
| 249 | Ga0097620_100178652 | 3300006931 | Bacteria | 2205 |
| 250 | Ga0097620_100296817 | 3300006931 | Unclassified | 1709 |
| 251 | Ga0097620_100316039 | 3300006931 | Unclassified | 1656 |
| 252 | Ga0097620_100773443 | 3300006931 | Bacteria | 1048 |
| 253 | Ga0097620_100940862 | 3300006931 | Bacteria | 948 |
| 254 | Ga0105244_10000011 | 3300009036 | Bacteria | 263939 |
| 255 | Ga0105240_10000714 | 3300009093 | Bacteria | 60757 |
| 256 | Ga0105240_10000986 | 3300009093 | Bacteria | 50790 |
| 257 | Ga0105240_10001519 | 3300009093 | Bacteria | 39462 |
| 258 | Ga0105240_10010489 | 3300009093 | Bacteria | 13024 |
| 259 | Ga0105240_10027112 | 3300009093 | Bacteria | 7507 |
| 260 | Ga0105240_10131900 | 3300009093 | Bacteria | 2996 |
| 261 | Ga0105240_10140389 | 3300009093 | Bacteria | 2889 |
| 262 | Ga0105240_10207332 | 3300009093 | Bacteria | 2293 |
| 263 | Ga0105240_10257303 | 3300009093 | Bacteria | 2016 |
| 264 | Ga0111539_10097271 | 3300009094 | Bacteria | 3458 |
| 265 | Ga0111539_10155723 | 3300009094 | Bacteria | 2674 |
| 266 | Ga0111539_10584611 | 3300009094 | Bacteria | 1300 |
| 267 | Ga0105245_10566797 | 3300009098 | Bacteria | 1159 |
| 268 | Ga0105247_10001821 | 3300009101 | Bacteria | 14947 |
| 269 | Ga0114129_10009512 | 3300009147 | Bacteria | 13864 |
| 270 | Ga0114129_10356753 | 3300009147 | Bacteria | 1935 |
| 271 | Ga0105243_10134900 | 3300009148 | Bacteria | 2099 |
| 272 | Ga0105243_10216623 | 3300009148 | Bacteria | 1690 |
| 273 | Ga0105241_10000369 | 3300009174 | Bacteria | 34233 |
| 274 | Ga0105241_10107180 | 3300009174 | Bacteria | 2231 |
| 275 | Ga0105242_10004483 | 3300009176 | Bacteria | 10849 |
| 276 | Ga0105242_10019392 | 3300009176 | Bacteria | 5329 |
| 277 | Ga0105242_10041826 | 3300009176 | Bacteria | 3698 |
| 278 | Ga0105242_10060996 | 3300009176 | Bacteria | 3101 |
| 279 | Ga0105242_10078270 | 3300009176 | Bacteria | 2760 |
| 280 | Ga0105242_10160988 | 3300009176 | Bacteria | 1965 |
| 281 | Ga0105242_10207710 | 3300009176 | Bacteria | 1743 |
| 282 | Ga0105248_10025375 | 3300009177 | Bacteria | 6590 |
| 283 | Ga0105237_10000505 | 3300009545 | Bacteria | 55179 |
| 284 | Ga0105237_10039371 | 3300009545 | Bacteria | 4772 |
| 285 | Ga0105237_10040220 | 3300009545 | Bacteria | 4716 |
| 286 | Ga0105238_10364311 | 3300009551 | Bacteria | 1435 |
| 287 | Ga0105249_10003692 | 3300009553 | Bacteria | 13197 |
| 288 | Ga0105249_10026849 | 3300009553 | Bacteria | 5192 |
| 289 | Ga0105249_10029877 | 3300009553 | Bacteria | 4924 |
| 290 | Ga0105249_10050673 | 3300009553 | Bacteria | 3785 |
| 291 | Ga0105249_10056620 | 3300009553 | Bacteria | 3589 |
| 292 | Ga0105249_10087561 | 3300009553 | Bacteria | 2906 |
| 293 | Ga0105249_10159886 | 3300009553 | Bacteria | 2176 |
| 294 | Ga0105249_10192001 | 3300009553 | Bacteria | 1994 |
| 295 | Ga0105249_10285469 | 3300009553 | Bacteria | 1650 |
| 296 | Ga0105249_10462268 | 3300009553 | Bacteria | 1309 |
| 297 | Ga0105249_10545011 | 3300009553 | Unclassified | 1210 |
| 298 | Ga0105249_10601185 | 3300009553 | Bacteria | 1154 |
| 299 | Ga0105249_11008942 | 3300009553 | Bacteria | 901 |
| 300 | Ga0105239_10000046 | 3300010375 | Bacteria | 181115 |
| 301 | Ga0105239_10011936 | 3300010375 | Bacteria | 9688 |
| 302 | Ga0105239_10030261 | 3300010375 | Bacteria | 5951 |
| 303 | Ga0105239_10039865 | 3300010375 | Bacteria | 5145 |
| 304 | Ga0105239_10048136 | 3300010375 | Bacteria | 4674 |
| 305 | Ga0105239_10076642 | 3300010375 | Bacteria | 3678 |
| 306 | Ga0105239_10102159 | 3300010375 | Bacteria | 3173 |
| 307 | Ga0105239_10212617 | 3300010375 | Bacteria | 2168 |
| 308 | Ga0105246_10009641 | 3300011119 | Bacteria | 5951 |
| 309 | Ga0105246_10011783 | 3300011119 | Bacteria | 5433 |
| 310 | Ga0105246_10547529 | 3300011119 | Bacteria | 991 |
| 311 | Ga0157373_10000001 | 3300013100 | Bacteria | 864756 |
| 312 | Ga0157373_10011835 | 3300013100 | Bacteria | 6409 |
| 313 | Ga0157373_10015138 | 3300013100 | Bacteria | 5641 |
| 314 | Ga0157373_10018891 | 3300013100 | Bacteria | 5016 |
| 315 | Ga0157373_10089998 | 3300013100 | Bacteria | 2161 |
| 316 | Ga0157371_10018644 | 3300013102 | Bacteria | 5127 |
| 317 | Ga0157371_10041637 | 3300013102 | Bacteria | 3277 |
| 318 | Ga0157371_10048434 | 3300013102 | Bacteria | 3021 |
| 319 | Ga0157371_10151097 | 3300013102 | Bacteria | 1656 |
| 320 | Ga0157371_10214866 | 3300013102 | Bacteria | 1380 |
| 321 | Ga0157370_10016092 | 3300013104 | Bacteria | 7581 |
| 322 | Ga0157370_10101326 | 3300013104 | Bacteria | 2697 |
| 323 | Ga0157370_10223096 | 3300013104 | Bacteria | 1745 |
| 324 | Ga0157369_10013999 | 3300013105 | Bacteria | 9063 |
| 325 | Ga0157369_10024739 | 3300013105 | Bacteria | 6672 |
| 326 | Ga0157369_10029858 | 3300013105 | Bacteria | 6020 |
| 327 | Ga0157369_10076176 | 3300013105 | Bacteria | 3596 |
| 328 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 329 | Ga0157374_10013141 | 3300013296 | Bacteria | 7222 |
| 330 | Ga0157374_10044269 | 3300013296 | Bacteria | 4114 |
| 331 | Ga0157374_10106855 | 3300013296 | Bacteria | 2689 |
| 332 | Ga0157374_10285770 | 3300013296 | Bacteria | 1629 |
| 333 | Ga0157378_10003187 | 3300013297 | Bacteria | 14573 |
| 334 | Ga0157378_10020443 | 3300013297 | Bacteria | 5821 |
| 335 | Ga0157378_10027456 | 3300013297 | Bacteria | 5023 |
| 336 | Ga0157378_10075858 | 3300013297 | Unclassified | 3028 |
| 337 | Ga0157378_10268314 | 3300013297 | Bacteria | 1640 |
| 338 | Ga0157378_10290107 | 3300013297 | Bacteria | 1580 |
| 339 | Ga0157378_10599853 | 3300013297 | Bacteria | 1112 |
| 340 | Ga0163162_10000728 | 3300013306 | Bacteria | 30520 |
| 341 | Ga0163162_10003244 | 3300013306 | Bacteria | 15556 |
| 342 | Ga0163162_10004724 | 3300013306 | Bacteria | 13139 |
| 343 | Ga0163162_10100853 | 3300013306 | Bacteria | 2979 |
| 344 | Ga0163162_10104979 | 3300013306 | Bacteria | 2920 |
| 345 | Ga0163162_10156322 | 3300013306 | Unclassified | 2400 |
| 346 | Ga0163162_10269969 | 3300013306 | Unclassified | 1833 |
| 347 | Ga0163162_10305515 | 3300013306 | Bacteria | 1723 |
| 348 | Ga0163162_10466081 | 3300013306 | Unclassified | 1395 |
| 349 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 350 | Ga0157372_10002614 | 3300013307 | Bacteria | 19487 |
| 351 | Ga0157372_10004776 | 3300013307 | Bacteria | 14396 |
| 352 | Ga0157372_10024446 | 3300013307 | Bacteria | 6562 |
| 353 | Ga0157372_10121826 | 3300013307 | Bacteria | 2997 |
| 354 | Ga0157372_10209889 | 3300013307 | Bacteria | 2257 |
| 355 | Ga0157372_10226585 | 3300013307 | Bacteria | 2167 |
| 356 | Ga0157372_10259243 | 3300013307 | Bacteria | 2019 |
| 357 | Ga0157372_10387944 | 3300013307 | Bacteria | 1627 |
| 358 | Ga0157372_10670499 | 3300013307 | Bacteria | 1207 |
| 359 | Ga0157372_10679732 | 3300013307 | Bacteria | 1198 |
| 360 | Ga0157375_10000453 | 3300013308 | Bacteria | 37144 |
| 361 | Ga0157375_10000737 | 3300013308 | Bacteria | 28835 |
| 362 | Ga0157375_10002980 | 3300013308 | Bacteria | 14711 |
| 363 | Ga0157375_10049603 | 3300013308 | Bacteria | 4114 |
| 364 | Ga0157375_10049671 | 3300013308 | Bacteria | 4111 |
| 365 | Ga0157375_10107162 | 3300013308 | Bacteria | 2887 |
| 366 | Ga0157375_10172280 | 3300013308 | Bacteria | 2312 |
| 367 | Ga0157375_10203757 | 3300013308 | Bacteria | 2135 |
| 368 | Ga0157375_10231816 | 3300013308 | Bacteria | 2005 |
| 369 | Ga0157375_10310343 | 3300013308 | Bacteria | 1741 |
| 370 | Ga0157375_10427687 | 3300013308 | Unclassified | 1490 |
| 371 | Ga0157375_10489307 | 3300013308 | Bacteria | 1395 |
| 372 | Ga0157375_10611526 | 3300013308 | Bacteria | 1248 |
| 373 | Ga0157375_10947326 | 3300013308 | Unclassified | 1003 |
| 374 | Ga0163163_10000176 | 3300014325 | Bacteria | 66751 |
| 375 | Ga0163163_10008019 | 3300014325 | Bacteria | 9349 |
| 376 | Ga0163163_10069063 | 3300014325 | Bacteria | 3517 |
| 377 | Ga0163163_10140667 | 3300014325 | Bacteria | 2456 |
| 378 | Ga0163163_10163145 | 3300014325 | Unclassified | 2274 |
| 379 | Ga0163163_10468711 | 3300014325 | Bacteria | 1320 |
| 380 | Ga0163163_10515377 | 3300014325 | Bacteria | 1258 |
| 381 | Ga0157380_10006039 | 3300014326 | Bacteria | 8484 |
| 382 | Ga0157380_10134402 | 3300014326 | Bacteria | 2115 |
| 383 | Ga0157380_10405301 | 3300014326 | Bacteria | 1295 |
| 384 | Ga0157377_10003813 | 3300014745 | Bacteria | 6851 |
| 385 | Ga0157377_10018439 | 3300014745 | Bacteria | 3626 |
| 386 | Ga0157377_10022699 | 3300014745 | Bacteria | 3318 |
| 387 | Ga0157377_10063728 | 3300014745 | Bacteria | 2112 |
| 388 | Ga0157377_10203480 | 3300014745 | Unclassified | 1258 |
| 389 | Ga0157379_10015761 | 3300014968 | Bacteria | 6642 |
| 390 | Ga0157379_10016844 | 3300014968 | Bacteria | 6433 |
| 391 | Ga0157379_10051164 | 3300014968 | Bacteria | 3690 |
| 392 | Ga0157379_10123875 | 3300014968 | Bacteria | 2326 |
| 393 | Ga0157379_10133897 | 3300014968 | Bacteria | 2232 |
| 394 | Ga0157379_10351849 | 3300014968 | Bacteria | 1349 |
| 395 | Ga0157376_10005480 | 3300014969 | Bacteria | 8874 |
| 396 | Ga0157376_10015529 | 3300014969 | Bacteria | 5755 |
| 397 | Ga0157376_10138561 | 3300014969 | Bacteria | 2180 |
| 398 | Ga0163161_10042853 | 3300017792 | Bacteria | 3257 |
| 399 | Ga0154015_1034610 | 3300020610 | Bacteria | 2266 |
| 400 | Ga0209675_1000112 | 3300025291 | Bacteria | 114185 |
| 401 | Ga0207697_10066989 | 3300025315 | Bacteria | 1501 |
| 402 | Ga0207656_10045611 | 3300025321 | Bacteria | 1876 |
| 403 | Ga0207655_1000242 | 3300025728 | Bacteria | 89450 |
| 404 | Ga0207642_10042248 | 3300025899 | Bacteria | 2002 |
| 405 | Ga0207642_10119413 | 3300025899 | Bacteria | 1357 |
| 406 | Ga0207642_10119989 | 3300025899 | Unclassified | 1355 |
| 407 | Ga0207710_10001437 | 3300025900 | Bacteria | 11892 |
| 408 | Ga0207710_10036703 | 3300025900 | Bacteria | 2162 |
| 409 | Ga0207688_10030899 | 3300025901 | Bacteria | 2955 |
| 410 | Ga0207680_10000084 | 3300025903 | Bacteria | 42773 |
| 411 | Ga0207680_10311992 | 3300025903 | Bacteria | 1098 |
| 412 | Ga0207647_10021658 | 3300025904 | Bacteria | 4287 |
| 413 | Ga0207647_10043228 | 3300025904 | Bacteria | 2820 |
| 414 | Ga0207645_10001451 | 3300025907 | Bacteria | 19392 |
| 415 | Ga0207645_10059318 | 3300025907 | Bacteria | 2444 |
| 416 | Ga0207645_10107580 | 3300025907 | Bacteria | 1804 |
| 417 | Ga0207645_10277652 | 3300025907 | Bacteria | 1112 |
| 418 | Ga0207643_10082144 | 3300025908 | Bacteria | 1868 |
| 419 | Ga0207705_10130151 | 3300025909 | Unclassified | 1872 |
| 420 | Ga0207654_10006591 | 3300025911 | Bacteria | 5836 |
| 421 | Ga0207654_10178893 | 3300025911 | Bacteria | 1382 |
| 422 | Ga0207695_10000245 | 3300025913 | Bacteria | 141090 |
| 423 | Ga0207695_10000447 | 3300025913 | Bacteria | 90113 |
| 424 | Ga0207695_10000981 | 3300025913 | Bacteria | 50713 |
| 425 | Ga0207695_10002676 | 3300025913 | Bacteria | 26013 |
| 426 | Ga0207695_10061792 | 3300025913 | Bacteria | 3870 |
| 427 | Ga0207695_10069899 | 3300025913 | Bacteria | 3592 |
| 428 | Ga0207695_10128971 | 3300025913 | Bacteria | 2488 |
| 429 | Ga0207695_10272742 | 3300025913 | Bacteria | 1587 |
| 430 | Ga0207671_10003744 | 3300025914 | Bacteria | 14983 |
| 431 | Ga0207671_10006596 | 3300025914 | Bacteria | 10302 |
| 432 | Ga0207671_10019590 | 3300025914 | Bacteria | 5171 |
| 433 | Ga0207671_10025451 | 3300025914 | Bacteria | 4446 |
| 434 | Ga0207660_10055628 | 3300025917 | Bacteria | 2828 |
| 435 | Ga0207662_10070751 | 3300025918 | Unclassified | 2111 |
| 436 | Ga0207662_10165068 | 3300025918 | Unclassified | 1417 |
| 437 | Ga0207662_10174206 | 3300025918 | Bacteria | 1381 |
| 438 | Ga0207657_10001990 | 3300025919 | Bacteria | 22079 |
| 439 | Ga0207657_10012943 | 3300025919 | Bacteria | 8203 |
| 440 | Ga0207649_10003053 | 3300025920 | Bacteria | 9195 |
| 441 | Ga0207649_10032136 | 3300025920 | Bacteria | 3126 |
| 442 | Ga0207649_10105960 | 3300025920 | Bacteria | 1869 |
| 443 | Ga0207649_10177504 | 3300025920 | Unclassified | 1489 |
| 444 | Ga0207652_10124637 | 3300025921 | Bacteria | 2294 |
| 445 | Ga0207681_10010686 | 3300025923 | Bacteria | 5633 |
| 446 | Ga0207681_10020086 | 3300025923 | Bacteria | 4230 |
| 447 | Ga0207681_10050477 | 3300025923 | Bacteria | 2815 |
| 448 | Ga0207681_10134317 | 3300025923 | Unclassified | 1834 |
| 449 | Ga0207681_10717282 | 3300025923 | Bacteria | 832 |
| 450 | Ga0207694_10045241 | 3300025924 | Bacteria | 3400 |
| 451 | Ga0207650_10009161 | 3300025925 | Bacteria | 6765 |
| 452 | Ga0207650_10069035 | 3300025925 | Bacteria | 2655 |
| 453 | Ga0207650_10136505 | 3300025925 | Bacteria | 1924 |
| 454 | Ga0207650_10153588 | 3300025925 | Unclassified | 1819 |
| 455 | Ga0207650_10189756 | 3300025925 | Bacteria | 1642 |
| 456 | Ga0207659_10192854 | 3300025926 | Bacteria | 1622 |
| 457 | Ga0207659_10222433 | 3300025926 | Bacteria | 1518 |
| 458 | Ga0207644_10057174 | 3300025931 | Bacteria | 2816 |
| 459 | Ga0207644_10185046 | 3300025931 | Bacteria | 1635 |
| 460 | Ga0207690_10051174 | 3300025932 | Bacteria | 2761 |
| 461 | Ga0207706_10030947 | 3300025933 | Bacteria | 4772 |
| 462 | Ga0207706_10046271 | 3300025933 | Bacteria | 3853 |
| 463 | Ga0207706_10134913 | 3300025933 | Bacteria | 2171 |
| 464 | Ga0207706_10302385 | 3300025933 | Bacteria | 1394 |
| 465 | Ga0207706_10436337 | 3300025933 | Unclassified | 1134 |
| 466 | Ga0207706_10561843 | 3300025933 | Unclassified | 982 |
| 467 | Ga0207686_10000403 | 3300025934 | Bacteria | 30043 |
| 468 | Ga0207686_10032426 | 3300025934 | Bacteria | 3109 |
| 469 | Ga0207686_10164044 | 3300025934 | Bacteria | 1560 |
| 470 | Ga0207686_10364620 | 3300025934 | Bacteria | 1091 |
| 471 | Ga0207709_10178427 | 3300025935 | Bacteria | 1497 |
| 472 | Ga0207670_10023655 | 3300025936 | Bacteria | 3828 |
| 473 | Ga0207670_10063612 | 3300025936 | Bacteria | 2525 |
| 474 | Ga0207670_10295879 | 3300025936 | Unclassified | 1266 |
| 475 | Ga0207669_10155066 | 3300025937 | Bacteria | 1610 |
| 476 | Ga0207669_10381469 | 3300025937 | Bacteria | 1098 |
| 477 | Ga0207704_10057439 | 3300025938 | Bacteria | 2390 |
| 478 | Ga0207704_10174870 | 3300025938 | Bacteria | 1544 |
| 479 | Ga0207704_10411863 | 3300025938 | Unclassified | 1069 |
| 480 | Ga0207691_10032378 | 3300025940 | Bacteria | 4874 |
| 481 | Ga0207691_10039766 | 3300025940 | Bacteria | 4350 |
| 482 | Ga0207691_10096599 | 3300025940 | Bacteria | 2641 |
| 483 | Ga0207691_10132910 | 3300025940 | Bacteria | 2197 |
| 484 | Ga0207691_10342538 | 3300025940 | Bacteria | 1279 |
| 485 | Ga0207711_10036751 | 3300025941 | Bacteria | 4157 |
| 486 | Ga0207711_10385913 | 3300025941 | Unclassified | 1300 |
| 487 | Ga0207689_10000961 | 3300025942 | Bacteria | 27698 |
| 488 | Ga0207689_10007333 | 3300025942 | Bacteria | 9673 |
| 489 | Ga0207689_10011510 | 3300025942 | Bacteria | 7582 |
| 490 | Ga0207689_10017632 | 3300025942 | Bacteria | 6036 |
| 491 | Ga0207661_10001405 | 3300025944 | Bacteria | 16208 |
| 492 | Ga0207661_10001489 | 3300025944 | Bacteria | 15853 |
| 493 | Ga0207661_10021421 | 3300025944 | Bacteria | 4843 |
| 494 | Ga0207661_10716216 | 3300025944 | Bacteria | 921 |
| 495 | Ga0207679_10042191 | 3300025945 | Bacteria | 3277 |
| 496 | Ga0207679_10057702 | 3300025945 | Unclassified | 2873 |
| 497 | Ga0207679_10318834 | 3300025945 | Unclassified | 1345 |
| 498 | Ga0207667_10001087 | 3300025949 | Bacteria | 34483 |
| 499 | Ga0207667_10001322 | 3300025949 | Bacteria | 31120 |
| 500 | Ga0207667_10004997 | 3300025949 | Bacteria | 16203 |
| 501 | Ga0207667_10065468 | 3300025949 | Bacteria | 3790 |
| 502 | Ga0207651_10029622 | 3300025960 | Unclassified | 3471 |
| 503 | Ga0207651_10043703 | 3300025960 | Bacteria | 2993 |
| 504 | Ga0207651_10193470 | 3300025960 | Bacteria | 1624 |
| 505 | Ga0207651_10194324 | 3300025960 | Bacteria | 1621 |
| 506 | Ga0207712_10002957 | 3300025961 | Bacteria | 10845 |
| 507 | Ga0207712_10012803 | 3300025961 | Bacteria | 5364 |
| 508 | Ga0207712_10049316 | 3300025961 | Bacteria | 2933 |
| 509 | Ga0207712_10072563 | 3300025961 | Bacteria | 2479 |
| 510 | Ga0207712_10395643 | 3300025961 | Bacteria | 1160 |
| 511 | Ga0207712_10434125 | 3300025961 | Unclassified | 1110 |
| 512 | Ga0207668_10023404 | 3300025972 | Bacteria | 3969 |
| 513 | Ga0207640_10106203 | 3300025981 | Bacteria | 1980 |
| 514 | Ga0207640_10182425 | 3300025981 | Bacteria | 1575 |
| 515 | Ga0207658_10052389 | 3300025986 | Bacteria | 3011 |
| 516 | Ga0207658_10077048 | 3300025986 | Bacteria | 2543 |
| 517 | Ga0207658_10096576 | 3300025986 | Bacteria | 2305 |
| 518 | Ga0207658_10127980 | 3300025986 | Unclassified | 2035 |
| 519 | Ga0207658_10440050 | 3300025986 | Bacteria | 1152 |
| 520 | Ga0207677_10036514 | 3300026023 | Bacteria | 3203 |
| 521 | Ga0207677_10059268 | 3300026023 | Unclassified | 2640 |
| 522 | Ga0207677_10076945 | 3300026023 | Bacteria | 2377 |
| 523 | Ga0207703_10003284 | 3300026035 | Bacteria | 13572 |
| 524 | Ga0207703_10266693 | 3300026035 | Unclassified | 1550 |
| 525 | Ga0207639_10005705 | 3300026041 | Bacteria | 8426 |
| 526 | Ga0207639_10019058 | 3300026041 | Bacteria | 4886 |
| 527 | Ga0207639_10067706 | 3300026041 | Bacteria | 2779 |
| 528 | Ga0207639_10076610 | 3300026041 | Bacteria | 2634 |
| 529 | Ga0207639_10175056 | 3300026041 | Bacteria | 1821 |
| 530 | Ga0207639_10404548 | 3300026041 | Unclassified | 1230 |
| 531 | Ga0207678_10099422 | 3300026067 | Bacteria | 2485 |
| 532 | Ga0207678_10198628 | 3300026067 | Bacteria | 1714 |
| 533 | Ga0207708_10029505 | 3300026075 | Bacteria | 4158 |
| 534 | Ga0207708_10089827 | 3300026075 | Unclassified | 2368 |
| 535 | Ga0207702_10022716 | 3300026078 | Bacteria | 5202 |
| 536 | Ga0207702_10026742 | 3300026078 | Bacteria | 4791 |
| 537 | Ga0207702_10061967 | 3300026078 | Bacteria | 3192 |
| 538 | Ga0207702_10335836 | 3300026078 | Bacteria | 1442 |
| 539 | Ga0207702_10632248 | 3300026078 | Bacteria | 1052 |
| 540 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 541 | Ga0207641_10013412 | 3300026088 | Bacteria | 6719 |
| 542 | Ga0207641_10091472 | 3300026088 | Bacteria | 2662 |
| 543 | Ga0207641_10130729 | 3300026088 | Bacteria | 2254 |
| 544 | Ga0207641_10143558 | 3300026088 | Bacteria | 2156 |
| 545 | Ga0207641_10580862 | 3300026088 | Bacteria | 1095 |
| 546 | Ga0207648_10009148 | 3300026089 | Bacteria | 9520 |
| 547 | Ga0207648_10023846 | 3300026089 | Bacteria | 5472 |
| 548 | Ga0207676_10012723 | 3300026095 | Bacteria | 6036 |
| 549 | Ga0207676_10017719 | 3300026095 | Bacteria | 5167 |
| 550 | Ga0207676_10030930 | 3300026095 | Unclassified | 4023 |
| 551 | Ga0207676_10132988 | 3300026095 | Bacteria | 2118 |
| 552 | Ga0207676_10201665 | 3300026095 | Bacteria | 1758 |
| 553 | Ga0207676_10615152 | 3300026095 | Unclassified | 1045 |
| 554 | Ga0207674_10003604 | 3300026116 | Bacteria | 18880 |
| 555 | Ga0207674_10026446 | 3300026116 | Bacteria | 6162 |
| 556 | Ga0207674_10029767 | 3300026116 | Bacteria | 5745 |
| 557 | Ga0207674_10092637 | 3300026116 | Bacteria | 3011 |
| 558 | Ga0207674_10093303 | 3300026116 | Bacteria | 2999 |
| 559 | Ga0207674_10170753 | 3300026116 | Bacteria | 2128 |
| 560 | Ga0207674_10238216 | 3300026116 | Bacteria | 1767 |
| 561 | Ga0207674_10463309 | 3300026116 | Bacteria | 1225 |
| 562 | Ga0207675_100003242 | 3300026118 | Bacteria | 15948 |
| 563 | Ga0207675_100127031 | 3300026118 | Bacteria | 2416 |
| 564 | Ga0207675_100473349 | 3300026118 | Bacteria | 1244 |
| 565 | Ga0207675_100627967 | 3300026118 | Unclassified | 1079 |
| 566 | Ga0207683_10010880 | 3300026121 | Bacteria | 7761 |
| 567 | Ga0207683_10025819 | 3300026121 | Bacteria | 5068 |
| 568 | Ga0207683_10468501 | 3300026121 | Bacteria | 1162 |
| 569 | Ga0207698_10061920 | 3300026142 | Bacteria | 2919 |
| 570 | Ga0207698_10109069 | 3300026142 | Bacteria | 2315 |
| 571 | Ga0207698_10124550 | 3300026142 | Bacteria | 2189 |
| 572 | Ga0268266_10000149 | 3300028379 | Bacteria | 134809 |
| 573 | Ga0268266_10148716 | 3300028379 | Bacteria | 2109 |
| 574 | Ga0268265_10064799 | 3300028380 | Bacteria | 2817 |
| 575 | Ga0268265_10123497 | 3300028380 | Bacteria | 2138 |
| 576 | Ga0268264_10002062 | 3300028381 | Bacteria | 17926 |
| 577 | Ga0268264_10012988 | 3300028381 | Bacteria | 6846 |
| 578 | Ga0268264_10038071 | 3300028381 | Bacteria | 3968 |
| 579 | Ga0268264_10107849 | 3300028381 | Bacteria | 2433 |
| 580 | Ga0268264_10147106 | 3300028381 | Bacteria | 2108 |
| 581 | Ga0268264_10390350 | 3300028381 | Bacteria | 1335 |
| 582 | Ga0307517_10002960 | 3300028786 | Bacteria | 26831 |
| 583 | Ga0307517_10208347 | 3300028786 | Bacteria | 1209 |
| 584 | Ga0265338_10060582 | 3300028800 | Bacteria | 3324 |
| 585 | Ga0265327_10000415 | 3300031251 | Bacteria | 78296 |
| 586 | Ga0265327_10004289 | 3300031251 | Bacteria | 12741 |
| 587 | Ga0307513_10442972 | 3300031456 | Bacteria | 1025 |
| 588 | Ga0307509_10244091 | 3300031507 | Bacteria | 1586 |
| 589 | Ga0307509_10327561 | 3300031507 | Bacteria | 1265 |
| 590 | Ga0307509_10442479 | 3300031507 | Unclassified | 995 |
| 591 | Ga0307408_100000982 | 3300031548 | Bacteria | 22029 |
| 592 | Ga0307408_100002173 | 3300031548 | Bacteria | 14030 |
| 593 | Ga0307508_10001547 | 3300031616 | Bacteria | 25744 |
| 594 | Ga0307516_10000659 | 3300031730 | Bacteria | 46694 |
| 595 | Ga0307412_10000154 | 3300031911 | Bacteria | 49488 |
| 596 | Ga0307414_10000659 | 3300032004 | Bacteria | 17666 |
| 597 | Ga0307414_10583676 | 3300032004 | Bacteria | 1000 |
| 598 | Ga0307510_10000079 | 3300033180 | Bacteria | 73286 |
| 599 | Ga0373957_0055546 | 3300035120 | Bacteria | 1523 |
| 600 | Ga0373943_0136519 | 3300035170 | Bacteria | 1317 |
| 601 | Ga0373955_0125271 | 3300035172 | Bacteria | 1496 |
| 602 | Ga0316574_0241348 | 3300035398 | Bacteria | 1155 |
| 603 | Ga0373927_0043822 | 3300035695 | Bacteria | 2896 |
| 604 | Ga0373933_0006824 | 3300035724 | Bacteria | 6215 |
| 605 | Ga0373937_0006391 | 3300036401 | Bacteria | 10170 |
| 606 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 607 | Ga0395899_0000780 | 3300037312 | Bacteria | 31338 |
| 608 | Ga0395905_0764516 | 3300037471 | Bacteria | 869 |
| 609 | Ga0439453_0036201 | 3300041408 | Bacteria | 953 |
| 610 | Ga0439465_0089029 | 3300041413 | Bacteria | 1054 |
| 611 | Ga0451798_0813648 | 3300041458 | Bacteria | 732 |
| 612 | Ga0451839_1055358 | 3300041496 | Bacteria | 1122 |
| 613 | Ga0451853_1735788 | 3300041512 | Bacteria | 1300 |
| 614 | Ga0439449_0017711 | 3300042007 | Bacteria | 2674 |
| 615 | Ga0439457_006873 | 3300042014 | Bacteria | 2753 |
| 616 | Ga0451577_0091371 | 3300042876 | Bacteria | 2717 |
| 617 | Ga0466972_0000027 | 3300044658 | Bacteria | 174082 |
| 618 | Ga0466972_0003586 | 3300044658 | Bacteria | 7717 |
| 619 | Ga0453684_0040546 | 3300044712 | Bacteria | 6320 |
| 620 | Ga0453684_0277219 | 3300044712 | Bacteria | 1914 |
| 621 | Ga0453684_1048424 | 3300044712 | Unclassified | 864 |
| 622 | Ga0466968_0034075 | 3300044735 | Bacteria | 2124 |
| 623 | Ga0466968_0091102 | 3300044735 | Bacteria | 1351 |
| 624 | Ga0466970_0015421 | 3300044765 | Bacteria | 3928 |
| 625 | Ga0466970_0042836 | 3300044765 | Bacteria | 2408 |
| 626 | Ga0466970_0167680 | 3300044765 | Bacteria | 1216 |
| 627 | Ga0466959_0023656 | 3300045049 | Bacteria | 4547 |
| 628 | Ga0451576_0007056 | 3300045051 | Bacteria | 13572 |
| 629 | Ga0466967_0709401 | 3300045976 | Bacteria | 997 |
| 630 | Ga0495638_0175451 | 3300046460 | Bacteria | 1227 |
| 631 | Ga0495638_0254261 | 3300046460 | Bacteria | 967 |
| 632 | Ga0495650_0026116 | 3300046471 | Bacteria | 2723 |
| 633 | Ga0495580_0047808 | 3300046472 | Bacteria | 3032 |
| 634 | Ga0495580_0172524 | 3300046472 | Bacteria | 1495 |
| 635 | Ga0495594_0226606 | 3300046499 | Bacteria | 1066 |
| 636 | Ga0495596_0001111 | 3300046500 | Bacteria | 15937 |
| 637 | Ga0495606_0002451 | 3300046507 | Bacteria | 21528 |
| 638 | Ga0495606_0007874 | 3300046507 | Bacteria | 9404 |
| 639 | Ga0495606_0016541 | 3300046507 | Bacteria | 5616 |
| 640 | Ga0495608_0074642 | 3300046511 | Bacteria | 2210 |
| 641 | Ga0495618_0059102 | 3300046514 | Bacteria | 2429 |
| 642 | Ga0495628_0042506 | 3300046516 | Bacteria | 3625 |
| 643 | Ga0495630_0054771 | 3300046517 | Bacteria | 2988 |
| 644 | Ga0495632_0004739 | 3300046519 | Bacteria | 9172 |
| 645 | Ga0495648_0017904 | 3300046524 | Bacteria | 5045 |
| 646 | Ga0495586_0089716 | 3300046535 | Bacteria | 1697 |
| 647 | Ga0495587_0187419 | 3300046536 | Bacteria | 1172 |
| 648 | Ga0495622_0041455 | 3300046557 | Bacteria | 2141 |
| 649 | Ga0495633_0002997 | 3300046558 | Bacteria | 11532 |
| 650 | Ga0495667_0053457 | 3300046559 | Bacteria | 2660 |
| 651 | Ga0495611_0000727 | 3300046648 | Bacteria | 18510 |
| 652 | Ga0495611_0129345 | 3300046648 | Bacteria | 1178 |
| 653 | Ga0495625_0003276 | 3300046660 | Bacteria | 16367 |
| 654 | Ga0495625_0095525 | 3300046660 | Bacteria | 2049 |
| 655 | Ga0495599_0104354 | 3300046678 | Bacteria | 1766 |
| 656 | Ga0495624_0274217 | 3300046690 | Bacteria | 1019 |
| 657 | Ga0495649_0064270 | 3300046694 | Bacteria | 1971 |
| 658 | Ga0495674_0094415 | 3300047319 | Bacteria | 2551 |
| 659 | Ga0495680_0074052 | 3300047322 | Bacteria | 2587 |
| 660 | Ga0495686_0000039 | 3300047472 | Bacteria | 304821 |
| 661 | Ga0495686_0006681 | 3300047472 | Bacteria | 8778 |
| 662 | Ga0496102_0031826 | 3300048905 | Bacteria | 4735 |
| 663 | Ga0496111_0102996 | 3300048914 | Bacteria | 2099 |
| 664 | Ga0496116_0000266 | 3300048919 | Bacteria | 91468 |
| 665 | Ga0496117_0000365 | 3300048920 | Bacteria | 78847 |
| 666 | Ga0496118_0000672 | 3300048921 | Bacteria | 55573 |
| 667 | Ga0496118_0098674 | 3300048921 | Bacteria | 1983 |
| 668 | Ga0496119_0000227 | 3300048922 | Bacteria | 78848 |
| 669 | Ga0496120_0100642 | 3300048923 | Bacteria | 1528 |
| 670 | Ga0496121_0045208 | 3300048924 | Bacteria | 3786 |
| 671 | Ga0496122_0000698 | 3300048925 | Bacteria | 66677 |
| 672 | Ga0496122_0013041 | 3300048925 | Bacteria | 8186 |
| 673 | Ga0496123_0001073 | 3300048926 | Bacteria | 41335 |
| 674 | Ga0496124_0003284 | 3300048927 | Bacteria | 19949 |
| 675 | Ga0496124_0067573 | 3300048927 | Bacteria | 2974 |
| 676 | Ga0496125_0001623 | 3300048928 | Bacteria | 31693 |
| 677 | Ga0496125_0016266 | 3300048928 | Bacteria | 7150 |
| 678 | Ga0496126_0000809 | 3300048929 | Bacteria | 55872 |
| 679 | Ga0501031_0052491 | 3300049568 | Bacteria | 2656 |
| 680 | Ga0501031_0201624 | 3300049568 | Bacteria | 1298 |
| 681 | Ga0501032_0000947 | 3300049569 | Bacteria | 23434 |
| 682 | Ga0501032_0002494 | 3300049569 | Bacteria | 14369 |
| 683 | Ga0501033_0046663 | 3300049570 | Bacteria | 3221 |
| 684 | Ga0501033_0352520 | 3300049570 | Bacteria | 1031 |
| 685 | Ga0501034_0000043 | 3300049571 | Bacteria | 229049 |
| 686 | Ga0501034_0001945 | 3300049571 | Bacteria | 26170 |
| 687 | Ga0501034_0019093 | 3300049571 | Bacteria | 7019 |
| 688 | Ga0501034_0135290 | 3300049571 | Bacteria | 2445 |
| 689 | Ga0501034_0659213 | 3300049571 | Bacteria | 948 |
| 690 | Ga0501036_0039263 | 3300049572 | Bacteria | 4006 |
| 691 | Ga0501036_0047391 | 3300049572 | Bacteria | 3640 |
| 692 | Ga0501036_0113287 | 3300049572 | Bacteria | 2292 |
| 693 | Ga0501037_0002466 | 3300049573 | Bacteria | 13369 |
| 694 | Ga0501037_0099890 | 3300049573 | Bacteria | 2096 |
| 695 | Ga0501037_0170161 | 3300049573 | Bacteria | 1549 |
| 696 | Ga0501038_0008855 | 3300049574 | Bacteria | 9235 |
| 697 | Ga0501038_0017091 | 3300049574 | Bacteria | 6563 |
| 698 | Ga0501038_0018795 | 3300049574 | Bacteria | 6238 |
| 699 | Ga0501039_0033080 | 3300049575 | Bacteria | 3989 |
| 700 | Ga0501039_0042656 | 3300049575 | Bacteria | 3505 |
| 701 | Ga0501039_0067930 | 3300049575 | Bacteria | 2767 |
| 702 | Ga0501042_0258002 | 3300049578 | Bacteria | 1258 |
| 703 | Ga0501043_0014475 | 3300049579 | Bacteria | 6176 |
| 704 | Ga0501043_0116138 | 3300049579 | Bacteria | 2100 |
| 705 | Ga0501046_0005083 | 3300049580 | Bacteria | 11795 |
| 706 | Ga0501047_0007499 | 3300049581 | Bacteria | 10265 |
| 707 | Ga0501047_0030454 | 3300049581 | Bacteria | 5202 |
| 708 | Ga0501047_0032712 | 3300049581 | Bacteria | 5021 |
| 709 | Ga0501048_0194807 | 3300049582 | Bacteria | 1436 |
| 710 | Ga0501070_0049245 | 3300049586 | Bacteria | 3499 |
| 711 | Ga0501070_0244581 | 3300049586 | Bacteria | 1468 |
| 712 | Ga0501073_0019741 | 3300049589 | Bacteria | 4864 |
| 713 | Ga0501073_0193399 | 3300049589 | Bacteria | 1408 |
| 714 | Ga0501074_0012376 | 3300049590 | Bacteria | 6202 |
| 715 | Ga0501077_0644754 | 3300049593 | Unclassified | 680 |
| 716 | Ga0501227_040294 | 3300049665 | Bacteria | 1152 |
| 717 | Ga0501257_007918 | 3300049686 | Bacteria | 2381 |
| 718 | Ga0501219_000062 | 3300049703 | Bacteria | 17657 |
| 719 | Ga0501225_0046243 | 3300049705 | Bacteria | 1206 |
| 720 | Ga0501079_0243902 | 3300049741 | Bacteria | 1404 |
| 721 | Ga0501080_0047315 | 3300049742 | Bacteria | 4004 |
| 722 | Ga0501080_0056535 | 3300049742 | Bacteria | 3653 |
| 723 | Ga0501083_0075955 | 3300049744 | Bacteria | 2230 |
| 724 | Ga0501269_000101 | 3300049766 | Bacteria | 26831 |
| 725 | Ga0501035_0000663 | 3300049822 | Bacteria | 37968 |
| 726 | Ga0501035_0025393 | 3300049822 | Bacteria | 5432 |
| 727 | Ga0501035_0122726 | 3300049822 | Bacteria | 2269 |
| 728 | Ga0501035_0126883 | 3300049822 | Bacteria | 2227 |
| 729 | Ga0501035_0165076 | 3300049822 | Bacteria | 1915 |
| 730 | Ga0501044_0003040 | 3300049823 | Bacteria | 18988 |
| 731 | Ga0501044_0291817 | 3300049823 | Bacteria | 1562 |
| 732 | Ga0501284_00075 | 3300050005 | Bacteria | 28010 |
| 733 | nmdc:mga05p37_14748_c1 | 3300050507 | Bacteria | 9386 |
| 734 | nmdc:mga05p37_437639_c1 | 3300050507 | Bacteria | 1517 |
| 735 | nmdc:mga09592_140738_c1 | 3300050508 | Bacteria | 2080 |
| 736 | nmdc:mga09592_355013_c1 | 3300050508 | Bacteria | 1268 |
| 737 | nmdc:mga06r32_153545_c1 | 3300050510 | Bacteria | 2282 |
| 738 | nmdc:mga06r32_215259_c1 | 3300050510 | Unclassified | 1909 |
| 739 | nmdc:mga08y16_120384_c1 | 3300050511 | Bacteria | 2731 |
| 740 | nmdc:mga08y16_92469_c1 | 3300050511 | Bacteria | 3152 |
| 741 | nmdc:mga0n895_765873_c1 | 3300050512 | Bacteria | 957 |
| 742 | Ga0500644_0059096 | 3300053088 | Unclassified | 1344 |
| 743 | Ga0500646_0002325 | 3300053090 | Bacteria | 4939 |
| 744 | Ga0500646_0016349 | 3300053090 | Bacteria | 1937 |
| 745 | Ga0500583_0034175 | 3300053092 | Bacteria | 2258 |
| 746 | Ga0500641_0058123 | 3300053096 | Unclassified | 1606 |
| 747 | Ga0500562_000085 | 3300053108 | Bacteria | 39648 |
| 748 | Ga0500594_0048151 | 3300053118 | Bacteria | 1191 |
| 749 | Ga0500642_0002298 | 3300053130 | Bacteria | 5587 |
| 750 | Ga0500559_0016384 | 3300053136 | Bacteria | 3128 |
| 751 | Ga0500568_0000384 | 3300053139 | Bacteria | 33842 |
| 752 | Ga0500568_0033542 | 3300053139 | Bacteria | 2106 |
| 753 | Ga0500604_0005155 | 3300053151 | Bacteria | 3450 |
| 754 | Ga0500616_0068632 | 3300053153 | Bacteria | 1815 |
| 755 | Ga0500616_0133346 | 3300053153 | Bacteria | 1171 |
| 756 | Ga0500622_0000082 | 3300053156 | Bacteria | 101502 |
| 757 | Ga0500622_0001640 | 3300053156 | Bacteria | 17525 |
| 758 | Ga0500611_000018 | 3300053727 | Bacteria | 111023 |
| 759 | Ga0500645_008906 | 3300053730 | Bacteria | 3395 |
| 760 | Ga0501084_0091974 | 3300054114 | Bacteria | 2547 |
| 761 | 2585144584 | 2582581278 | Bacteria | 5296881 |
| 762 | 2588208775 | 2585428182 | Bacteria | 5007281 |
| 763 | 2588212514 | 2585428183 | Bacteria | 5166119 |
| 764 | 2588220153 | 2585428184 | Bacteria | 4978681 |
| 765 | 2588224950 | 2585428185 | Bacteria | 4969476 |
| 766 | 2588231772 | 2585428187 | Bacteria | 4629388 |
| 767 | 2644374411 | 2643221667 | Bacteria | 5627472 |
| 768 | 2765572086 | 2765235839 | Bacteria | 5314748 |
| 769 | 2816872298 | 2816332188 | Bacteria | 5133218 |
| 770 | 2819587435 | 2818991444 | Bacteria | 6968812 |
| 771 | 2833640139 | 2833640130 | Bacteria | 4858325 |
| 772 | 2871724235 | 2871720351 | Bacteria | 4862476 |
| 773 | 2881957945 | 2881955468 | Bacteria | 3545609 |
| 774 | 2889292442 | 2889290771 | Bacteria | 5530962 |
| 775 | 2919400649 | 2919399522 | Bacteria | 5164947 |
| 776 | 2945927643 | 2945924605 | Bacteria | 4296724 |
| 777 | 2965323262 | 2965320100 | Bacteria | 3975600 |
| 778 | Ga0307515_10000057 | |||
| 779 | JGI24741J21665_1025447 | |||
| 780 | JGI24740J21852_10011969 | |||
| 781 | JGI24739J22299_10016060 | |||
| 782 | JGI24739J22299_10033908 | |||
| 783 | rootH1_10030212 | |||
| 784 | rootH1_10169668 | |||
| 785 | rootH2_10043655 | |||
| 786 | rootH2_10047649 | |||
| 787 | rootH1_10042926 | |||
| 788 | rootH1_10285767 | |||
| 789 | Ga0055534_1002554 | |||
| 790 | Ga0065712_10074708 | |||
| 791 | Ga0065712_10158488 | |||
| 792 | Ga0065712_10250953 | |||
| 793 | Ga0065707_10166865 | |||
| 794 | Ga0065707_10261169 | |||
| 795 | Ga0070658_10056001 | |||
| 796 | Ga0070658_10294586 | |||
| 797 | Ga0070676_10049379 | |||
| 798 | Ga0070676_10088708 | |||
| 799 | Ga0070676_10277299 | |||
| 800 | Ga0070683_100010531 | |||
| 801 | Ga0070690_100041628 | |||
| 802 | Ga0070690_100079159 | |||
| 803 | Ga0070670_100078635 | |||
| 804 | Ga0070670_100086613 | |||
| 805 | Ga0070670_100088908 | |||
| 806 | Ga0070670_100090533 | |||
| 807 | Ga0070670_100206334 | |||
| 808 | Ga0068869_100023151 | |||
| 809 | Ga0068869_100024847 | |||
| 810 | Ga0068869_100143925 | |||
| 811 | Ga0070666_10000047 | |||
| 812 | Ga0070666_10069509 | |||
| 813 | Ga0070666_10079635 | |||
| 814 | Ga0070666_10122185 | |||
| 815 | Ga0070680_100032023 | |||
| 816 | Ga0070680_100060149 | |||
| 817 | Ga0070682_100000336 | |||
| 818 | Ga0070682_100015123 | |||
| 819 | Ga0070682_100143263 | |||
| 820 | Ga0068868_100010137 | |||
| 821 | Ga0068868_100033573 | |||
| 822 | Ga0068868_100068025 | |||
| 823 | Ga0068868_100506130 | |||
| 824 | Ga0070660_100035363 | |||
| 825 | Ga0070660_100039565 | |||
| 826 | Ga0070660_100048632 | |||
| 827 | Ga0070660_100110330 | |||
| 828 | Ga0070660_100303589 | |||
| 829 | Ga0070689_100051848 | |||
| 830 | Ga0070689_100072876 | |||
| 831 | Ga0070689_100339258 | |||
| 832 | Ga0070687_100030751 | |||
| 833 | Ga0070687_100190317 | |||
| 834 | Ga0070661_100010397 | |||
| 835 | Ga0070661_100019237 | |||
| 836 | Ga0070661_100053526 | |||
| 837 | Ga0070661_100068245 | |||
| 838 | Ga0070661_100462305 | |||
| 839 | Ga0070668_100088639 | |||
| 840 | Ga0070668_100258900 | |||
| 841 | Ga0070668_100376700 | |||
| 842 | Ga0070669_100081846 | |||
| 843 | Ga0070669_100098180 | |||
| 844 | Ga0070669_100166717 | |||
| 845 | Ga0070669_100307314 | |||
| 846 | Ga0070669_100320597 | |||
| 847 | Ga0070675_100024260 | |||
| 848 | Ga0070675_100051906 | |||
| 849 | Ga0070675_100235031 | |||
| 850 | Ga0070671_100007985 | |||
| 851 | Ga0070671_100030494 | |||
| 852 | Ga0070671_100037171 | |||
| 853 | Ga0070671_100057292 | |||
| 854 | Ga0070671_100077465 | |||
| 855 | Ga0070674_100006137 | |||
| 856 | Ga0070674_100284243 | |||
| 857 | Ga0070673_100033748 | |||
| 858 | Ga0070673_100041789 | |||
| 859 | Ga0070673_100046479 | |||
| 860 | Ga0070673_100076307 | |||
| 861 | Ga0070673_100082113 | |||
| 862 | Ga0070673_100104140 | |||
| 863 | Ga0070673_100263572 | |||
| 864 | Ga0070673_100394912 | |||
| 865 | Ga0070688_100026537 | |||
| 866 | Ga0070688_100073808 | |||
| 867 | Ga0070688_100335712 | |||
| 868 | Ga0070659_100031310 | |||
| 869 | Ga0070659_100032605 | |||
| 870 | Ga0070659_100110696 | |||
| 871 | Ga0070667_100049946 | |||
| 872 | Ga0070667_100069241 | |||
| 873 | Ga0070667_100084172 | |||
| 874 | Ga0070667_100136341 | |||
| 875 | Ga0070667_100623191 | |||
| 876 | Ga0070700_100224614 | |||
| 877 | Ga0070663_100073009 | |||
| 878 | Ga0070663_100300491 | |||
| 879 | Ga0070678_100000844 | |||
| 880 | Ga0070678_100033365 | |||
| 881 | Ga0070662_100029976 | |||
| 882 | Ga0070662_100041322 | |||
| 883 | Ga0070662_100205198 | |||
| 884 | Ga0070662_100382345 | |||
| 885 | Ga0070662_100413813 | |||
| 886 | Ga0070681_10087624 | |||
| 887 | Ga0070681_10199594 | |||
| 888 | Ga0068867_100029819 | |||
| 889 | Ga0068867_100089850 | |||
| 890 | Ga0068867_100119958 | |||
| 891 | Ga0068867_100309202 | |||
| 892 | Ga0070685_10027443 | |||
| 893 | Ga0070698_100006768 | |||
| 894 | Ga0070698_100043563 | |||
| 895 | Ga0070698_100081889 | |||
| 896 | Ga0070679_100327995 | |||
| 897 | Ga0070679_100551601 | |||
| 898 | Ga0070684_100009118 | |||
| 899 | Ga0070684_100009620 | |||
| 900 | Ga0070684_100014653 | |||
| 901 | Ga0070684_100073988 | |||
| 902 | Ga0068853_100004508 | |||
| 903 | Ga0068853_100024420 | |||
| 904 | Ga0068853_100028915 | |||
| 905 | Ga0068853_100059854 | |||
| 906 | Ga0068853_100102704 | |||
| 907 | Ga0068853_100769589 | |||
| 908 | Ga0070672_100024555 | |||
| 909 | Ga0070672_100155326 | |||
| 910 | Ga0070672_100339571 | |||
| 911 | Ga0070686_100081313 | |||
| 912 | Ga0070665_100000016 | |||
| 913 | Ga0070665_100694512 | |||
| 914 | Ga0070704_100351840 | |||
| 915 | Ga0068855_100000257 | |||
| 916 | Ga0068855_100013876 | |||
| 917 | Ga0068855_100017522 | |||
| 918 | Ga0068855_100055208 | |||
| 919 | Ga0068855_100248774 | |||
| 920 | Ga0068855_100529236 | |||
| 921 | Ga0070664_100001985 | |||
| 922 | Ga0070664_100023092 | |||
| 923 | Ga0070664_100030316 | |||
| 924 | Ga0070664_100031713 | |||
| 925 | Ga0068857_100071126 | |||
| 926 | Ga0068857_100078080 | |||
| 927 | Ga0068857_100087992 | |||
| 928 | Ga0068857_100191527 | |||
| 929 | Ga0068857_100441262 | |||
| 930 | Ga0068857_100549625 | |||
| 931 | Ga0068857_100831603 | |||
| 932 | Ga0068854_100080228 | |||
| 933 | Ga0068854_100134486 | |||
| 934 | Ga0068854_100223174 | |||
| 935 | Ga0068854_100444288 | |||
| 936 | Ga0068856_100003123 | |||
| 937 | Ga0068856_100007388 | |||
| 938 | Ga0068856_100022723 | |||
| 939 | Ga0068856_100173957 | |||
| 940 | Ga0070702_100026528 | |||
| 941 | Ga0068852_100029447 | |||
| 942 | Ga0068852_100127103 | |||
| 943 | Ga0068852_100143654 | |||
| 944 | Ga0068852_100258529 | |||
| 945 | Ga0068852_100502089 | |||
| 946 | Ga0068852_100616995 | |||
| 947 | Ga0068859_100000030 | |||
| 948 | Ga0068859_100010642 | |||
| 949 | Ga0068859_100013811 | |||
| 950 | Ga0068859_100026238 | |||
| 951 | Ga0068859_100106923 | |||
| 952 | Ga0068859_100178658 | |||
| 953 | Ga0068859_100296845 | |||
| 954 | Ga0068859_100316035 | |||
| 955 | Ga0068859_100773440 | |||
| 956 | Ga0068859_100940898 | |||
| 957 | Ga0068864_100002992 | |||
| 958 | Ga0068864_100031231 | |||
| 959 | Ga0068864_100064069 | |||
| 960 | Ga0068864_100086250 | |||
| 961 | Ga0068864_100172548 | |||
| 962 | Ga0068864_100173025 | |||
| 963 | Ga0068864_100577298 | |||
| 964 | Ga0068866_10062045 | |||
| 965 | Ga0068866_10125749 | |||
| 966 | Ga0068861_100307752 | |||
| 967 | Ga0068861_100664526 | |||
| 968 | Ga0068851_10017135 | |||
| 969 | Ga0068851_10050726 | |||
| 970 | Ga0068863_100021545 | |||
| 971 | Ga0068863_100022462 | |||
| 972 | Ga0068863_100033540 | |||
| 973 | Ga0068863_100140271 | |||
| 974 | Ga0068863_100199334 | |||
| 975 | Ga0068863_100244736 | |||
| 976 | Ga0068863_100504344 | |||
| 977 | Ga0068863_100514290 | |||
| 978 | Ga0068863_100549665 | |||
| 979 | Ga0068863_100600860 | |||
| 980 | Ga0068858_100007969 | |||
| 981 | Ga0068858_100124958 | |||
| 982 | Ga0068860_100002875 | |||
| 983 | Ga0068860_100018515 | |||
| 984 | Ga0068860_100021492 | |||
| 985 | Ga0068860_100050385 | |||
| 986 | Ga0068860_100093610 | |||
| 987 | Ga0068860_100652933 | |||
| 988 | Ga0068862_100053707 | |||
| 989 | Ga0068862_100128837 | |||
| 990 | Ga0081540_1095134 | |||
| 991 | Ga0081539_10000876 | |||
| 992 | Ga0081539_10067314 | |||
| 993 | Ga0070715_10220508 | |||
| 994 | Ga0097621_100000300 | |||
| 995 | Ga0097621_100022158 | |||
| 996 | Ga0097621_100025287 | |||
| 997 | Ga0097621_100288029 | |||
| 998 | Ga0097621_100459453 | |||
| 999 | Ga0068871_100000593 | |||
| 1000 | Ga0068871_100069501 | |||
| 1001 | Ga0068871_100166701 | |||
| 1002 | Ga0068871_100258825 | |||
| 1003 | Ga0075428_100023774 | |||
| 1004 | Ga0075428_100025378 | |||
| 1005 | Ga0075428_100036884 | |||
| 1006 | Ga0075428_100080948 | |||
| 1007 | Ga0075428_100190536 | |||
| 1008 | Ga0075428_100372137 | |||
| 1009 | Ga0075430_100020249 | |||
| 1010 | Ga0075431_100008997 | |||
| 1011 | Ga0075431_100013434 | |||
| 1012 | Ga0075434_100793847 | |||
| 1013 | Ga0075429_100080972 | |||
| 1014 | Ga0075429_100126085 | |||
| 1015 | Ga0075429_100582786 | |||
| 1016 | Ga0068865_100007978 | |||
| 1017 | Ga0068865_100085536 | |||
| 1018 | Ga0068865_100144291 | |||
| 1019 | Ga0068865_100154981 | |||
| 1020 | Ga0097620_100000030 | |||
| 1021 | Ga0097620_100010642 | |||
| 1022 | Ga0097620_100013810 | |||
| 1023 | Ga0097620_100026238 | |||
| 1024 | Ga0097620_100074324 | |||
| 1025 | Ga0097620_100106934 | |||
| 1026 | Ga0097620_100178652 | |||
| 1027 | Ga0097620_100296817 | |||
| 1028 | Ga0097620_100316039 | |||
| 1029 | Ga0097620_100773443 | |||
| 1030 | Ga0097620_100940862 | |||
| 1031 | Ga0105244_10000011 | |||
| 1032 | Ga0105240_10000714 | |||
| 1033 | Ga0105240_10000986 | |||
| 1034 | Ga0105240_10001519 | |||
| 1035 | Ga0105240_10010489 | |||
| 1036 | Ga0105240_10027112 | |||
| 1037 | Ga0105240_10131900 | |||
| 1038 | Ga0105240_10140389 | |||
| 1039 | Ga0105240_10207332 | |||
| 1040 | Ga0105240_10257303 | |||
| 1041 | Ga0111539_10097271 | |||
| 1042 | Ga0111539_10155723 | |||
| 1043 | Ga0111539_10584611 | |||
| 1044 | Ga0105245_10566797 | |||
| 1045 | Ga0105247_10001821 | |||
| 1046 | Ga0114129_10009512 | |||
| 1047 | Ga0114129_10356753 | |||
| 1048 | Ga0105243_10134900 | |||
| 1049 | Ga0105243_10216623 | |||
| 1050 | Ga0105241_10000369 | |||
| 1051 | Ga0105241_10107180 | |||
| 1052 | Ga0105242_10004483 | |||
| 1053 | Ga0105242_10019392 | |||
| 1054 | Ga0105242_10041826 | |||
| 1055 | Ga0105242_10060996 | |||
| 1056 | Ga0105242_10078270 | |||
| 1057 | Ga0105242_10160988 | |||
| 1058 | Ga0105242_10207710 | |||
| 1059 | Ga0105248_10025375 | |||
| 1060 | Ga0105237_10000505 | |||
| 1061 | Ga0105237_10039371 | |||
| 1062 | Ga0105237_10040220 | |||
| 1063 | Ga0105238_10364311 | |||
| 1064 | Ga0105249_10003692 | |||
| 1065 | Ga0105249_10026849 | |||
| 1066 | Ga0105249_10029877 | |||
| 1067 | Ga0105249_10050673 | |||
| 1068 | Ga0105249_10056620 | |||
| 1069 | Ga0105249_10087561 | |||
| 1070 | Ga0105249_10159886 | |||
| 1071 | Ga0105249_10192001 | |||
| 1072 | Ga0105249_10285469 | |||
| 1073 | Ga0105249_10462268 | |||
| 1074 | Ga0105249_10545011 | |||
| 1075 | Ga0105249_10601185 | |||
| 1076 | Ga0105249_11008942 | |||
| 1077 | Ga0105239_10000046 | |||
| 1078 | Ga0105239_10011936 | |||
| 1079 | Ga0105239_10030261 | |||
| 1080 | Ga0105239_10039865 | |||
| 1081 | Ga0105239_10048136 | |||
| 1082 | Ga0105239_10076642 | |||
| 1083 | Ga0105239_10102159 | |||
| 1084 | Ga0105239_10212617 | |||
| 1085 | Ga0105246_10009641 | |||
| 1086 | Ga0105246_10011783 | |||
| 1087 | Ga0105246_10547529 | |||
| 1088 | Ga0157373_10000001 | |||
| 1089 | Ga0157373_10011835 | |||
| 1090 | Ga0157373_10015138 | |||
| 1091 | Ga0157373_10018891 | |||
| 1092 | Ga0157373_10089998 | |||
| 1093 | Ga0157371_10018644 | |||
| 1094 | Ga0157371_10041637 | |||
| 1095 | Ga0157371_10048434 | |||
| 1096 | Ga0157371_10151097 | |||
| 1097 | Ga0157371_10214866 | |||
| 1098 | Ga0157370_10016092 | |||
| 1099 | Ga0157370_10101326 | |||
| 1100 | Ga0157370_10223096 | |||
| 1101 | Ga0157369_10013999 | |||
| 1102 | Ga0157369_10024739 | |||
| 1103 | Ga0157369_10029858 | |||
| 1104 | Ga0157369_10076176 | |||
| 1105 | Ga0157374_10000003 | |||
| 1106 | Ga0157374_10013141 | |||
| 1107 | Ga0157374_10044269 | |||
| 1108 | Ga0157374_10106855 | |||
| 1109 | Ga0157374_10285770 | |||
| 1110 | Ga0157378_10003187 | |||
| 1111 | Ga0157378_10020443 | |||
| 1112 | Ga0157378_10027456 | |||
| 1113 | Ga0157378_10075858 | |||
| 1114 | Ga0157378_10268314 | |||
| 1115 | Ga0157378_10290107 | |||
| 1116 | Ga0157378_10599853 | |||
| 1117 | Ga0163162_10000728 | |||
| 1118 | Ga0163162_10003244 | |||
| 1119 | Ga0163162_10004724 | |||
| 1120 | Ga0163162_10100853 | |||
| 1121 | Ga0163162_10104979 | |||
| 1122 | Ga0163162_10156322 | |||
| 1123 | Ga0163162_10269969 | |||
| 1124 | Ga0163162_10305515 | |||
| 1125 | Ga0163162_10466081 | |||
| 1126 | Ga0157372_10000009 | |||
| 1127 | Ga0157372_10002614 | |||
| 1128 | Ga0157372_10004776 | |||
| 1129 | Ga0157372_10024446 | |||
| 1130 | Ga0157372_10121826 | |||
| 1131 | Ga0157372_10209889 | |||
| 1132 | Ga0157372_10226585 | |||
| 1133 | Ga0157372_10259243 | |||
| 1134 | Ga0157372_10387944 | |||
| 1135 | Ga0157372_10670499 | |||
| 1136 | Ga0157372_10679732 | |||
| 1137 | Ga0157375_10000453 | |||
| 1138 | Ga0157375_10000737 | |||
| 1139 | Ga0157375_10002980 | |||
| 1140 | Ga0157375_10049603 | |||
| 1141 | Ga0157375_10049671 | |||
| 1142 | Ga0157375_10107162 | |||
| 1143 | Ga0157375_10172280 | |||
| 1144 | Ga0157375_10203757 | |||
| 1145 | Ga0157375_10231816 | |||
| 1146 | Ga0157375_10310343 | |||
| 1147 | Ga0157375_10427687 | |||
| 1148 | Ga0157375_10489307 | |||
| 1149 | Ga0157375_10611526 | |||
| 1150 | Ga0157375_10947326 | |||
| 1151 | Ga0163163_10000176 | |||
| 1152 | Ga0163163_10008019 | |||
| 1153 | Ga0163163_10069063 | |||
| 1154 | Ga0163163_10140667 | |||
| 1155 | Ga0163163_10163145 | |||
| 1156 | Ga0163163_10468711 | |||
| 1157 | Ga0163163_10515377 | |||
| 1158 | Ga0157380_10006039 | |||
| 1159 | Ga0157380_10134402 | |||
| 1160 | Ga0157380_10405301 | |||
| 1161 | Ga0157377_10003813 | |||
| 1162 | Ga0157377_10018439 | |||
| 1163 | Ga0157377_10022699 | |||
| 1164 | Ga0157377_10063728 | |||
| 1165 | Ga0157377_10203480 | |||
| 1166 | Ga0157379_10015761 | |||
| 1167 | Ga0157379_10016844 | |||
| 1168 | Ga0157379_10051164 | |||
| 1169 | Ga0157379_10123875 | |||
| 1170 | Ga0157379_10133897 | |||
| 1171 | Ga0157379_10351849 | |||
| 1172 | Ga0157376_10005480 | |||
| 1173 | Ga0157376_10015529 | |||
| 1174 | Ga0157376_10138561 | |||
| 1175 | Ga0163161_10042853 | |||
| 1176 | Ga0154015_1034610 | |||
| 1177 | Ga0209675_1000112 | |||
| 1178 | Ga0207697_10066989 | |||
| 1179 | Ga0207656_10045611 | |||
| 1180 | Ga0207655_1000242 | |||
| 1181 | Ga0207642_10042248 | |||
| 1182 | Ga0207642_10119413 | |||
| 1183 | Ga0207642_10119989 | |||
| 1184 | Ga0207710_10001437 | |||
| 1185 | Ga0207710_10036703 | |||
| 1186 | Ga0207688_10030899 | |||
| 1187 | Ga0207680_10000084 | |||
| 1188 | Ga0207680_10311992 | |||
| 1189 | Ga0207647_10021658 | |||
| 1190 | Ga0207647_10043228 | |||
| 1191 | Ga0207645_10001451 | |||
| 1192 | Ga0207645_10059318 | |||
| 1193 | Ga0207645_10107580 | |||
| 1194 | Ga0207645_10277652 | |||
| 1195 | Ga0207643_10082144 | |||
| 1196 | Ga0207705_10130151 | |||
| 1197 | Ga0207654_10006591 | |||
| 1198 | Ga0207654_10178893 | |||
| 1199 | Ga0207695_10000245 | |||
| 1200 | Ga0207695_10000447 | |||
| 1201 | Ga0207695_10000981 | |||
| 1202 | Ga0207695_10002676 | |||
| 1203 | Ga0207695_10061792 | |||
| 1204 | Ga0207695_10069899 | |||
| 1205 | Ga0207695_10128971 | |||
| 1206 | Ga0207695_10272742 | |||
| 1207 | Ga0207671_10003744 | |||
| 1208 | Ga0207671_10006596 | |||
| 1209 | Ga0207671_10019590 | |||
| 1210 | Ga0207671_10025451 | |||
| 1211 | Ga0207660_10055628 | |||
| 1212 | Ga0207662_10070751 | |||
| 1213 | Ga0207662_10165068 | |||
| 1214 | Ga0207662_10174206 | |||
| 1215 | Ga0207657_10001990 | |||
| 1216 | Ga0207657_10012943 | |||
| 1217 | Ga0207649_10003053 | |||
| 1218 | Ga0207649_10032136 | |||
| 1219 | Ga0207649_10105960 | |||
| 1220 | Ga0207649_10177504 | |||
| 1221 | Ga0207652_10124637 | |||
| 1222 | Ga0207681_10010686 | |||
| 1223 | Ga0207681_10020086 | |||
| 1224 | Ga0207681_10050477 | |||
| 1225 | Ga0207681_10134317 | |||
| 1226 | Ga0207681_10717282 | |||
| 1227 | Ga0207694_10045241 | |||
| 1228 | Ga0207650_10009161 | |||
| 1229 | Ga0207650_10069035 | |||
| 1230 | Ga0207650_10136505 | |||
| 1231 | Ga0207650_10153588 | |||
| 1232 | Ga0207650_10189756 | |||
| 1233 | Ga0207659_10192854 | |||
| 1234 | Ga0207659_10222433 | |||
| 1235 | Ga0207644_10057174 | |||
| 1236 | Ga0207644_10185046 | |||
| 1237 | Ga0207690_10051174 | |||
| 1238 | Ga0207706_10030947 | |||
| 1239 | Ga0207706_10046271 | |||
| 1240 | Ga0207706_10134913 | |||
| 1241 | Ga0207706_10302385 | |||
| 1242 | Ga0207706_10436337 | |||
| 1243 | Ga0207706_10561843 | |||
| 1244 | Ga0207686_10000403 | |||
| 1245 | Ga0207686_10032426 | |||
| 1246 | Ga0207686_10164044 | |||
| 1247 | Ga0207686_10364620 | |||
| 1248 | Ga0207709_10178427 | |||
| 1249 | Ga0207670_10023655 | |||
| 1250 | Ga0207670_10063612 | |||
| 1251 | Ga0207670_10295879 | |||
| 1252 | Ga0207669_10155066 | |||
| 1253 | Ga0207669_10381469 | |||
| 1254 | Ga0207704_10057439 | |||
| 1255 | Ga0207704_10174870 | |||
| 1256 | Ga0207704_10411863 | |||
| 1257 | Ga0207691_10032378 | |||
| 1258 | Ga0207691_10039766 | |||
| 1259 | Ga0207691_10096599 | |||
| 1260 | Ga0207691_10132910 | |||
| 1261 | Ga0207691_10342538 | |||
| 1262 | Ga0207711_10036751 | |||
| 1263 | Ga0207711_10385913 | |||
| 1264 | Ga0207689_10000961 | |||
| 1265 | Ga0207689_10007333 | |||
| 1266 | Ga0207689_10011510 | |||
| 1267 | Ga0207689_10017632 | |||
| 1268 | Ga0207661_10001405 | |||
| 1269 | Ga0207661_10001489 | |||
| 1270 | Ga0207661_10021421 | |||
| 1271 | Ga0207661_10716216 | |||
| 1272 | Ga0207679_10042191 | |||
| 1273 | Ga0207679_10057702 | |||
| 1274 | Ga0207679_10318834 | |||
| 1275 | Ga0207667_10001087 | |||
| 1276 | Ga0207667_10001322 | |||
| 1277 | Ga0207667_10004997 | |||
| 1278 | Ga0207667_10065468 | |||
| 1279 | Ga0207651_10029622 | |||
| 1280 | Ga0207651_10043703 | |||
| 1281 | Ga0207651_10193470 | |||
| 1282 | Ga0207651_10194324 | |||
| 1283 | Ga0207712_10002957 | |||
| 1284 | Ga0207712_10012803 | |||
| 1285 | Ga0207712_10049316 | |||
| 1286 | Ga0207712_10072563 | |||
| 1287 | Ga0207712_10395643 | |||
| 1288 | Ga0207712_10434125 | |||
| 1289 | Ga0207668_10023404 | |||
| 1290 | Ga0207640_10106203 | |||
| 1291 | Ga0207640_10182425 | |||
| 1292 | Ga0207658_10052389 | |||
| 1293 | Ga0207658_10077048 | |||
| 1294 | Ga0207658_10096576 | |||
| 1295 | Ga0207658_10127980 | |||
| 1296 | Ga0207658_10440050 | |||
| 1297 | Ga0207677_10036514 | |||
| 1298 | Ga0207677_10059268 | |||
| 1299 | Ga0207677_10076945 | |||
| 1300 | Ga0207703_10003284 | |||
| 1301 | Ga0207703_10266693 | |||
| 1302 | Ga0207639_10005705 | |||
| 1303 | Ga0207639_10019058 | |||
| 1304 | Ga0207639_10067706 | |||
| 1305 | Ga0207639_10076610 | |||
| 1306 | Ga0207639_10175056 | |||
| 1307 | Ga0207639_10404548 | |||
| 1308 | Ga0207678_10099422 | |||
| 1309 | Ga0207678_10198628 | |||
| 1310 | Ga0207708_10029505 | |||
| 1311 | Ga0207708_10089827 | |||
| 1312 | Ga0207702_10022716 | |||
| 1313 | Ga0207702_10026742 | |||
| 1314 | Ga0207702_10061967 | |||
| 1315 | Ga0207702_10335836 | |||
| 1316 | Ga0207702_10632248 | |||
| 1317 | Ga0207641_10000061 | |||
| 1318 | Ga0207641_10013412 | |||
| 1319 | Ga0207641_10091472 | |||
| 1320 | Ga0207641_10130729 | |||
| 1321 | Ga0207641_10143558 | |||
| 1322 | Ga0207641_10580862 | |||
| 1323 | Ga0207648_10009148 | |||
| 1324 | Ga0207648_10023846 | |||
| 1325 | Ga0207676_10012723 | |||
| 1326 | Ga0207676_10017719 | |||
| 1327 | Ga0207676_10030930 | |||
| 1328 | Ga0207676_10132988 | |||
| 1329 | Ga0207676_10201665 | |||
| 1330 | Ga0207676_10615152 | |||
| 1331 | Ga0207674_10003604 | |||
| 1332 | Ga0207674_10026446 | |||
| 1333 | Ga0207674_10029767 | |||
| 1334 | Ga0207674_10092637 | |||
| 1335 | Ga0207674_10093303 | |||
| 1336 | Ga0207674_10170753 | |||
| 1337 | Ga0207674_10238216 | |||
| 1338 | Ga0207674_10463309 | |||
| 1339 | Ga0207675_100003242 | |||
| 1340 | Ga0207675_100127031 | |||
| 1341 | Ga0207675_100473349 | |||
| 1342 | Ga0207675_100627967 | |||
| 1343 | Ga0207683_10010880 | |||
| 1344 | Ga0207683_10025819 | |||
| 1345 | Ga0207683_10468501 | |||
| 1346 | Ga0207698_10061920 | |||
| 1347 | Ga0207698_10109069 | |||
| 1348 | Ga0207698_10124550 | |||
| 1349 | Ga0268266_10000149 | |||
| 1350 | Ga0268266_10148716 | |||
| 1351 | Ga0268265_10064799 | |||
| 1352 | Ga0268265_10123497 | |||
| 1353 | Ga0268264_10002062 | |||
| 1354 | Ga0268264_10012988 | |||
| 1355 | Ga0268264_10038071 | |||
| 1356 | Ga0268264_10107849 | |||
| 1357 | Ga0268264_10147106 | |||
| 1358 | Ga0268264_10390350 | |||
| 1359 | Ga0307517_10002960 | |||
| 1360 | Ga0307517_10208347 | |||
| 1361 | Ga0265338_10060582 | |||
| 1362 | Ga0265327_10000415 | |||
| 1363 | Ga0265327_10004289 | |||
| 1364 | Ga0307513_10442972 | |||
| 1365 | Ga0307509_10244091 | |||
| 1366 | Ga0307509_10327561 | |||
| 1367 | Ga0307509_10442479 | |||
| 1368 | Ga0307408_100000982 | |||
| 1369 | Ga0307408_100002173 | |||
| 1370 | Ga0307508_10001547 | |||
| 1371 | Ga0307516_10000659 | |||
| 1372 | Ga0307412_10000154 | |||
| 1373 | Ga0307414_10000659 | |||
| 1374 | Ga0307414_10583676 | |||
| 1375 | Ga0307510_10000079 | |||
| 1376 | Ga0373957_0055546 | |||
| 1377 | Ga0373943_0136519 | |||
| 1378 | Ga0373955_0125271 | |||
| 1379 | Ga0316574_0241348 | |||
| 1380 | Ga0373927_0043822 | |||
| 1381 | Ga0373933_0006824 | |||
| 1382 | Ga0373937_0006391 | |||
| 1383 | Ga0395899_0000011 | |||
| 1384 | Ga0395899_0000780 | |||
| 1385 | Ga0395905_0764516 | |||
| 1386 | Ga0439453_0036201 | |||
| 1387 | Ga0439465_0089029 | |||
| 1388 | Ga0451798_0813648 | |||
| 1389 | Ga0451839_1055358 | |||
| 1390 | Ga0451853_1735788 | |||
| 1391 | Ga0439449_0017711 | |||
| 1392 | Ga0439457_006873 | |||
| 1393 | Ga0451577_0091371 | |||
| 1394 | Ga0466972_0000027 | |||
| 1395 | Ga0466972_0003586 | |||
| 1396 | Ga0453684_0040546 | |||
| 1397 | Ga0453684_0277219 | |||
| 1398 | Ga0453684_1048424 | |||
| 1399 | Ga0466968_0034075 | |||
| 1400 | Ga0466968_0091102 | |||
| 1401 | Ga0466970_0015421 | |||
| 1402 | Ga0466970_0042836 | |||
| 1403 | Ga0466970_0167680 | |||
| 1404 | Ga0466959_0023656 | |||
| 1405 | Ga0451576_0007056 | |||
| 1406 | Ga0466967_0709401 | |||
| 1407 | Ga0495638_0175451 | |||
| 1408 | Ga0495638_0254261 | |||
| 1409 | Ga0495650_0026116 | |||
| 1410 | Ga0495580_0047808 | |||
| 1411 | Ga0495580_0172524 | |||
| 1412 | Ga0495594_0226606 | |||
| 1413 | Ga0495596_0001111 | |||
| 1414 | Ga0495606_0002451 | |||
| 1415 | Ga0495606_0007874 | |||
| 1416 | Ga0495606_0016541 | |||
| 1417 | Ga0495608_0074642 | |||
| 1418 | Ga0495618_0059102 | |||
| 1419 | Ga0495628_0042506 | |||
| 1420 | Ga0495630_0054771 | |||
| 1421 | Ga0495632_0004739 | |||
| 1422 | Ga0495648_0017904 | |||
| 1423 | Ga0495586_0089716 | |||
| 1424 | Ga0495587_0187419 | |||
| 1425 | Ga0495622_0041455 | |||
| 1426 | Ga0495633_0002997 | |||
| 1427 | Ga0495667_0053457 | |||
| 1428 | Ga0495611_0000727 | |||
| 1429 | Ga0495611_0129345 | |||
| 1430 | Ga0495625_0003276 | |||
| 1431 | Ga0495625_0095525 | |||
| 1432 | Ga0495599_0104354 | |||
| 1433 | Ga0495624_0274217 | |||
| 1434 | Ga0495649_0064270 | |||
| 1435 | Ga0495674_0094415 | |||
| 1436 | Ga0495680_0074052 | |||
| 1437 | Ga0495686_0000039 | |||
| 1438 | Ga0495686_0006681 | |||
| 1439 | Ga0496102_0031826 | |||
| 1440 | Ga0496111_0102996 | |||
| 1441 | Ga0496116_0000266 | |||
| 1442 | Ga0496117_0000365 | |||
| 1443 | Ga0496118_0000672 | |||
| 1444 | Ga0496118_0098674 | |||
| 1445 | Ga0496119_0000227 | |||
| 1446 | Ga0496120_0100642 | |||
| 1447 | Ga0496121_0045208 | |||
| 1448 | Ga0496122_0000698 | |||
| 1449 | Ga0496122_0013041 | |||
| 1450 | Ga0496123_0001073 | |||
| 1451 | Ga0496124_0003284 | |||
| 1452 | Ga0496124_0067573 | |||
| 1453 | Ga0496125_0001623 | |||
| 1454 | Ga0496125_0016266 | |||
| 1455 | Ga0496126_0000809 | |||
| 1456 | Ga0501031_0052491 | |||
| 1457 | Ga0501031_0201624 | |||
| 1458 | Ga0501032_0000947 | |||
| 1459 | Ga0501032_0002494 | |||
| 1460 | Ga0501033_0046663 | |||
| 1461 | Ga0501033_0352520 | |||
| 1462 | Ga0501034_0000043 | |||
| 1463 | Ga0501034_0001945 | |||
| 1464 | Ga0501034_0019093 | |||
| 1465 | Ga0501034_0135290 | |||
| 1466 | Ga0501034_0659213 | |||
| 1467 | Ga0501036_0039263 | |||
| 1468 | Ga0501036_0047391 | |||
| 1469 | Ga0501036_0113287 | |||
| 1470 | Ga0501037_0002466 | |||
| 1471 | Ga0501037_0099890 | |||
| 1472 | Ga0501037_0170161 | |||
| 1473 | Ga0501038_0008855 | |||
| 1474 | Ga0501038_0017091 | |||
| 1475 | Ga0501038_0018795 | |||
| 1476 | Ga0501039_0033080 | |||
| 1477 | Ga0501039_0042656 | |||
| 1478 | Ga0501039_0067930 | |||
| 1479 | Ga0501042_0258002 | |||
| 1480 | Ga0501043_0014475 | |||
| 1481 | Ga0501043_0116138 | |||
| 1482 | Ga0501046_0005083 | |||
| 1483 | Ga0501047_0007499 | |||
| 1484 | Ga0501047_0030454 | |||
| 1485 | Ga0501047_0032712 | |||
| 1486 | Ga0501048_0194807 | |||
| 1487 | Ga0501070_0049245 | |||
| 1488 | Ga0501070_0244581 | |||
| 1489 | Ga0501073_0019741 | |||
| 1490 | Ga0501073_0193399 | |||
| 1491 | Ga0501074_0012376 | |||
| 1492 | Ga0501077_0644754 | |||
| 1493 | Ga0501227_040294 | |||
| 1494 | Ga0501257_007918 | |||
| 1495 | Ga0501219_000062 | |||
| 1496 | Ga0501225_0046243 | |||
| 1497 | Ga0501079_0243902 | |||
| 1498 | Ga0501080_0047315 | |||
| 1499 | Ga0501080_0056535 | |||
| 1500 | Ga0501083_0075955 | |||
| 1501 | Ga0501269_000101 | |||
| 1502 | Ga0501035_0000663 | |||
| 1503 | Ga0501035_0025393 | |||
| 1504 | Ga0501035_0122726 | |||
| 1505 | Ga0501035_0126883 | |||
| 1506 | Ga0501035_0165076 | |||
| 1507 | Ga0501044_0003040 | |||
| 1508 | Ga0501044_0291817 | |||
| 1509 | Ga0501284_00075 | |||
| 1510 | nmdc:mga05p37_14748_c1 | |||
| 1511 | nmdc:mga05p37_437639_c1 | |||
| 1512 | nmdc:mga09592_140738_c1 | |||
| 1513 | nmdc:mga09592_355013_c1 | |||
| 1514 | nmdc:mga06r32_153545_c1 | |||
| 1515 | nmdc:mga06r32_215259_c1 | |||
| 1516 | nmdc:mga08y16_120384_c1 | |||
| 1517 | nmdc:mga08y16_92469_c1 | |||
| 1518 | nmdc:mga0n895_765873_c1 | |||
| 1519 | Ga0500644_0059096 | |||
| 1520 | Ga0500646_0002325 | |||
| 1521 | Ga0500646_0016349 | |||
| 1522 | Ga0500583_0034175 | |||
| 1523 | Ga0500641_0058123 | |||
| 1524 | Ga0500562_000085 | |||
| 1525 | Ga0500594_0048151 | |||
| 1526 | Ga0500642_0002298 | |||
| 1527 | Ga0500559_0016384 | |||
| 1528 | Ga0500568_0000384 | |||
| 1529 | Ga0500568_0033542 | |||
| 1530 | Ga0500604_0005155 | |||
| 1531 | Ga0500616_0068632 | |||
| 1532 | Ga0500616_0133346 | |||
| 1533 | Ga0500622_0000082 | |||
| 1534 | Ga0500622_0001640 | |||
| 1535 | Ga0500611_000018 | |||
| 1536 | Ga0500645_008906 | |||
| 1537 | Ga0501084_0091974 | |||
| 1538 | 2585144584 | |||
| 1539 | 2588208775 | |||
| 1540 | 2588212514 | |||
| 1541 | 2588220153 | |||
| 1542 | 2588224950 | |||
| 1543 | 2588231772 | |||
| 1544 | 2644374411 | |||
| 1545 | 2765572086 | |||
| 1546 | 2816872298 | |||
| 1547 | 2819587435 | |||
| 1548 | 2833640139 | |||
| 1549 | 2871724235 | |||
| 1550 | 2881957945 | |||
| 1551 | 2889292442 | |||
| 1552 | 2919400649 | |||
| 1553 | 2945927643 | |||
| 1554 | 2965323262 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ik0-assembly1.cif.gz_A | crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli | 0.8888 | 1 | 253 |
| 2otn-assembly1.cif.gz_A | crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis | 0.882 | 2 | 250 |
| 6d13-assembly1.cif.gz_A | crystal structure of e.coli rpph-dapf complex | 0.8789 | 1 | 253 |
| 4ik0-assembly1.cif.gz_A | crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli | 0.8788 | 1 | 253 |
| 6d13-assembly1.cif.gz_A | crystal structure of e.coli rpph-dapf complex | 0.869 | 1 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9344 | 1 | 107 | 3.10.310.10 |
| 2q9jA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9108 | 1 | 107 | 3.10.310.10 |
| af_P9WP19_1_130_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9033 | 1 | 107 | 3.10.310.10 |
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8953 | 1 | 106 | 3.10.310.10 |
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.887 | 1 | 107 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1BZ07-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9832 | 1 | 250 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A0Q5ZLH9-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9817 | 1 | 253 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-H8XVK7-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9815 | 2 | 250 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-C2M7N1-F1-model_v4 | deleted | 0.9809 | 1 | 250 |
|
| AF-A0A661ZDA5-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9796 | 1 | 253 |
GO:0005829
GO:0008837 GO:0009089 |