F480362

General Info

Members Datasets Scaffolds Average Seq Length
777 281 777 95

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_101427936|Ga0068871_1014279361
Length 100
Sequence MEFDWNNPPFNLDSSLTLQEIEESFEDPFAVRVLPDSPRFSVQARFFNLGMSAGGVGIFTVYRTNGKQIRIIYARPFEPEERFFYQRKVDQTLAVGERDK

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
267 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 3.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11510544 3300004799 Unclassified 537
2 Ga0058860_12232918 3300004801 Unclassified 870
3 Ga0058862_10971528 3300004803 Bacteria 543
4 Ga0065707_10960953 3300005295 Unclassified 549
5 Ga0070658_10115420 3300005327 Bacteria 2227
6 Ga0070658_10682727 3300005327 Bacteria 891
7 Ga0070658_10752795 3300005327 Bacteria 846
8 Ga0070658_10808282 3300005327 Bacteria 815
9 Ga0070658_11244481 3300005327 Unclassified 647
10 Ga0070676_10512517 3300005328 Unclassified 853
11 Ga0070683_102147433 3300005329 Unclassified 536
12 Ga0070690_100003263 3300005330 Bacteria 8857
13 Ga0068869_101458883 3300005334 Unclassified 607
14 Ga0070666_10023056 3300005335 Bacteria 4048
15 Ga0070666_11396513 3300005335 Unclassified 523
16 Ga0070682_101765492 3300005337 Unclassified 539
17 Ga0068868_100227923 3300005338 Bacteria 1562
18 Ga0068868_100909395 3300005338 Bacteria 800
19 Ga0068868_101274129 3300005338 Bacteria 682
20 Ga0068868_102027746 3300005338 Unclassified 546
21 Ga0068868_102045725 3300005338 Unclassified 544
22 Ga0070689_100033442 3300005340 Bacteria 3918
23 Ga0070689_100154286 3300005340 Unclassified 1853
24 Ga0070689_100419056 3300005340 Bacteria 1134
25 Ga0070689_100551740 3300005340 Bacteria 993
26 Ga0070689_100600468 3300005340 Unclassified 953
27 Ga0070689_100848526 3300005340 Bacteria 806
28 Ga0070689_101357451 3300005340 Unclassified 641
29 Ga0070689_101514758 3300005340 Unclassified 608
30 Ga0070689_102205501 3300005340 Unclassified 505
31 Ga0070691_10028998 3300005341 Unclassified 2588
32 Ga0070691_10051968 3300005341 Bacteria 1959
33 Ga0070687_100676205 3300005343 Bacteria 718
34 Ga0070687_101012636 3300005343 Unclassified 603
35 Ga0070692_11046091 3300005345 Unclassified 573
36 Ga0070668_100903747 3300005347 Bacteria 789
37 Ga0070668_102038237 3300005347 Unclassified 529
38 Ga0070669_101440414 3300005353 Bacteria 598
39 Ga0070675_100645041 3300005354 Bacteria 962
40 Ga0070675_101299864 3300005354 Unclassified 670
41 Ga0070675_101443973 3300005354 Bacteria 634
42 Ga0070671_100699642 3300005355 Unclassified 879
43 Ga0070674_100784802 3300005356 Bacteria 821
44 Ga0070674_101889740 3300005356 Unclassified 542
45 Ga0070673_100539919 3300005364 Bacteria 1058
46 Ga0070673_102404849 3300005364 Bacteria 501
47 Ga0070688_100026549 3300005365 Bacteria 3442
48 Ga0070688_100123717 3300005365 Bacteria 1736
49 Ga0070688_100429879 3300005365 Bacteria 983
50 Ga0070688_100430454 3300005365 Unclassified 982
51 Ga0070688_101217340 3300005365 Unclassified 605
52 Ga0070714_100027149 3300005435 Bacteria 4737
53 Ga0070714_102475879 3300005435 Bacteria 504
54 Ga0070713_100067334 3300005436 Bacteria 3015
55 Ga0070713_100654135 3300005436 Bacteria 1001
56 Ga0070713_100983192 3300005436 Bacteria 814
57 Ga0070713_102092158 3300005436 Bacteria 549
58 Ga0070710_11391709 3300005437 Unclassified 524
59 Ga0070710_11466846 3300005437 Unclassified 512
60 Ga0070701_11095667 3300005438 Unclassified 560
61 Ga0070711_100301601 3300005439 Bacteria 1274
62 Ga0070711_100877092 3300005439 Bacteria 765
63 Ga0070711_101956615 3300005439 Bacteria 515
64 Ga0070705_101452877 3300005440 Unclassified 573
65 Ga0070700_100681657 3300005441 Bacteria 815
66 Ga0070694_100734133 3300005444 Unclassified 805
67 Ga0070678_101256202 3300005456 Unclassified 688
68 Ga0070662_101742423 3300005457 Bacteria 538
69 Ga0070681_10077982 3300005458 Bacteria 3270
70 Ga0070681_10353516 3300005458 Unclassified 1379
71 Ga0070685_10400759 3300005466 Bacteria 950
72 Ga0070685_10702480 3300005466 Unclassified 737
73 Ga0070685_11217580 3300005466 Unclassified 573
74 Ga0070707_102201639 3300005468 Unclassified 519
75 Ga0070679_100400227 3300005530 Bacteria 1319
76 Ga0070679_100609689 3300005530 Bacteria 1035
77 Ga0070679_100686182 3300005530 Unclassified 967
78 Ga0070679_101079731 3300005530 Bacteria 747
79 Ga0070684_101576845 3300005535 Unclassified 619
80 Ga0070684_101664385 3300005535 Unclassified 602
81 Ga0070672_100747958 3300005543 Bacteria 858
82 Ga0070686_100147887 3300005544 Bacteria 1642
83 Ga0070686_100329480 3300005544 Bacteria 1141
84 Ga0070686_100564458 3300005544 Bacteria 892
85 Ga0070686_101658085 3300005544 Unclassified 542
86 Ga0070686_101689201 3300005544 Unclassified 537
87 Ga0070695_100537720 3300005545 Unclassified 909
88 Ga0070695_101435200 3300005545 Unclassified 573
89 Ga0070696_100499695 3300005546 Bacteria 967
90 Ga0070704_101185687 3300005549 Unclassified 696
91 Ga0068855_100181145 3300005563 Bacteria 2382
92 Ga0068855_100594062 3300005563 Bacteria 1194
93 Ga0068855_100744440 3300005563 Bacteria 1046
94 Ga0068855_101143852 3300005563 Bacteria 812
95 Ga0068855_101379109 3300005563 Unclassified 727
96 Ga0068857_100981396 3300005577 Bacteria 812
97 Ga0068856_100002798 3300005614 Bacteria 17858
98 Ga0068856_100014899 3300005614 Bacteria 7504
99 Ga0068856_100485674 3300005614 Bacteria 1256
100 Ga0068856_101042129 3300005614 Unclassified 836
101 Ga0068856_102176829 3300005614 Unclassified 564
102 Ga0070702_100958535 3300005615 Bacteria 674
103 Ga0068852_101381641 3300005616 Unclassified 726
104 Ga0068852_101417753 3300005616 Unclassified 717
105 Ga0068859_100023109 3300005617 Bacteria 6237
106 Ga0068859_101814311 3300005617 Unclassified 674
107 Ga0068859_101979183 3300005617 Unclassified 643
108 Ga0068859_102969123 3300005617 Bacteria 519
109 Ga0068864_100263320 3300005618 Bacteria 1604
110 Ga0068864_100536056 3300005618 Bacteria 1130
111 Ga0068864_101718194 3300005618 Unclassified 632
112 Ga0068864_101883077 3300005618 Unclassified 604
113 Ga0068864_102497305 3300005618 Unclassified 523
114 Ga0068861_100608686 3300005719 Bacteria 1004
115 Ga0068861_101150284 3300005719 Bacteria 748
116 Ga0068851_10863407 3300005834 Unclassified 565
117 Ga0068863_100184044 3300005841 Bacteria 2006
118 Ga0068863_100330546 3300005841 Unclassified 1482
119 Ga0068863_100502503 3300005841 Bacteria 1194
120 Ga0068863_100822777 3300005841 Bacteria 927
121 Ga0068863_100930784 3300005841 Unclassified 870
122 Ga0068858_100521382 3300005842 Bacteria 1149
123 Ga0068858_100801023 3300005842 Bacteria 919
124 Ga0068860_100452901 3300005843 Unclassified 1276
125 Ga0068860_101516174 3300005843 Unclassified 692
126 Ga0068860_102225373 3300005843 Unclassified 569
127 Ga0068860_102450039 3300005843 Unclassified 542
128 Ga0068862_100311034 3300005844 Unclassified 1452
129 Ga0070717_11048036 3300006028 Bacteria 743
130 Ga0070717_12156785 3300006028 Unclassified 501
131 Ga0070715_10125489 3300006163 Bacteria 1229
132 Ga0070715_11056509 3300006163 Unclassified 509
133 Ga0070716_100870238 3300006173 Bacteria 703
134 Ga0070712_101124922 3300006175 Unclassified 682
135 Ga0097621_100292419 3300006237 Unclassified 1436
136 Ga0097621_100433305 3300006237 Bacteria 1182
137 Ga0097621_100732623 3300006237 Unclassified 912
138 Ga0068871_100156929 3300006358 Bacteria 1943
139 Ga0068871_100440014 3300006358 Bacteria 1167
140 Ga0068871_101265849 3300006358 Unclassified 693
141 Ga0068871_101427936 3300006358 Unclassified 653
142 Ga0075433_10613432 3300006852 Bacteria 955
143 Ga0075429_101378833 3300006880 Unclassified 614
144 Ga0068865_100409838 3300006881 Unclassified 1112
145 Ga0068865_100895359 3300006881 Bacteria 771
146 Ga0075436_100267045 3300006914 Bacteria 1221
147 Ga0097620_100023109 3300006931 Bacteria 6237
148 Ga0097620_101814385 3300006931 Unclassified 674
149 Ga0097620_101980092 3300006931 Unclassified 643
150 Ga0097620_102071774 3300006931 Unclassified 628
151 Ga0097620_102924185 3300006931 Unclassified 523
152 Ga0097620_102968778 3300006931 Bacteria 519
153 Ga0075435_100849743 3300007076 Bacteria 795
154 Ga0099794_10392331 3300007265 Unclassified 725
155 Ga0099794_10483699 3300007265 Bacteria 651
156 Ga0099794_10790363 3300007265 Bacteria 508
157 Ga0099794_10807308 3300007265 Unclassified 502
158 Ga0099795_10045715 3300007788 Bacteria 1575
159 Ga0105240_10047636 3300009093 Bacteria 5423
160 Ga0105240_10101978 3300009093 Bacteria 3489
161 Ga0105240_10115127 3300009093 Bacteria 3247
162 Ga0105240_10247162 3300009093 Bacteria 2065
163 Ga0105240_10400180 3300009093 Bacteria 1547
164 Ga0105240_10428626 3300009093 Unclassified 1484
165 Ga0105240_10580433 3300009093 Bacteria 1237
166 Ga0105240_10621951 3300009093 Bacteria 1187
167 Ga0105240_10849605 3300009093 Unclassified 985
168 Ga0105240_11761039 3300009093 Unclassified 646
169 Ga0111539_10167114 3300009094 Bacteria 2571
170 Ga0111539_10335934 3300009094 Unclassified 1759
171 Ga0111539_10851883 3300009094 Unclassified 1061
172 Ga0111539_11948797 3300009094 Unclassified 681
173 Ga0111539_13450423 3300009094 Unclassified 508
174 Ga0111539_13458249 3300009094 Bacteria 507
175 Ga0105245_10049590 3300009098 Bacteria 3760
176 Ga0105245_11209051 3300009098 Unclassified 804
177 Ga0105245_11421986 3300009098 Unclassified 744
178 Ga0105245_11435230 3300009098 Unclassified 740
179 Ga0105245_12408171 3300009098 Bacteria 580
180 Ga0105245_12663560 3300009098 Unclassified 553
181 Ga0114129_12524696 3300009147 Unclassified 614
182 Ga0105241_10511930 3300009174 Bacteria 1072
183 Ga0105241_12430360 3300009174 Unclassified 523
184 Ga0105242_10131680 3300009176 Bacteria 2160
185 Ga0105242_10507128 3300009176 Bacteria 1148
186 Ga0105242_10699561 3300009176 Bacteria 991
187 Ga0105242_10818974 3300009176 Bacteria 923
188 Ga0105242_10883112 3300009176 Unclassified 892
189 Ga0105242_11369051 3300009176 Unclassified 734
190 Ga0105242_11752773 3300009176 Bacteria 658
191 Ga0105242_11816017 3300009176 Unclassified 648
192 Ga0105242_11924984 3300009176 Unclassified 632
193 Ga0105242_12311854 3300009176 Bacteria 584
194 Ga0105248_10102792 3300009177 Bacteria 3221
195 Ga0105248_10635178 3300009177 Bacteria 1205
196 Ga0105248_10731508 3300009177 Unclassified 1116
197 Ga0105248_10959587 3300009177 Unclassified 966
198 Ga0105248_11309040 3300009177 Unclassified 820
199 Ga0105248_12064307 3300009177 Unclassified 648
200 Ga0105248_12129477 3300009177 Unclassified 638
201 Ga0105248_12561578 3300009177 Unclassified 581
202 Ga0105237_10392932 3300009545 Bacteria 1392
203 Ga0105237_10728191 3300009545 Bacteria 998
204 Ga0105237_11813844 3300009545 Bacteria 618
205 Ga0105237_12333514 3300009545 Bacteria 545
206 Ga0105237_12717901 3300009545 Bacteria 506
207 Ga0105238_10022647 3300009551 Bacteria 6404
208 Ga0105238_10058361 3300009551 Bacteria 3869
209 Ga0105238_10058392 3300009551 Bacteria 3867
210 Ga0105238_10090988 3300009551 Bacteria 3039
211 Ga0105238_10218190 3300009551 Bacteria 1883
212 Ga0105238_10651457 3300009551 Unclassified 1063
213 Ga0105238_10887867 3300009551 Bacteria 909
214 Ga0105238_11084935 3300009551 Bacteria 823
215 Ga0105238_11142550 3300009551 Unclassified 802
216 Ga0105238_11167475 3300009551 Unclassified 794
217 Ga0105238_11724171 3300009551 Bacteria 658
218 Ga0105249_11541964 3300009553 Unclassified 737
219 Ga0105239_11001280 3300010375 Bacteria 961
220 Ga0105239_11767158 3300010375 Bacteria 716
221 Ga0105239_12786808 3300010375 Bacteria 570
222 Ga0105246_12002802 3300011119 Unclassified 559
223 Ga0105246_12236546 3300011119 Unclassified 533
224 Ga0157373_10586839 3300013100 Bacteria 810
225 Ga0157371_10065497 3300013102 Bacteria 2573
226 Ga0157371_10235223 3300013102 Bacteria 1317
227 Ga0157371_10765815 3300013102 Unclassified 726
228 Ga0157370_10144589 3300013104 Bacteria 2215
229 Ga0157370_10314144 3300013104 Bacteria 1446
230 Ga0157370_10761743 3300013104 Bacteria 882
231 Ga0157370_11009644 3300013104 Bacteria 753
232 Ga0157369_10542131 3300013105 Bacteria 1203
233 Ga0157374_10107389 3300013296 Bacteria 2683
234 Ga0157374_10208020 3300013296 Bacteria 1918
235 Ga0157374_10447167 3300013296 Bacteria 1293
236 Ga0157374_10571514 3300013296 Bacteria 1139
237 Ga0157374_10728890 3300013296 Unclassified 1005
238 Ga0157374_10737617 3300013296 Unclassified 999
239 Ga0157374_11125289 3300013296 Unclassified 806
240 Ga0157374_11184252 3300013296 Bacteria 785
241 Ga0157374_11218483 3300013296 Bacteria 774
242 Ga0157374_11330199 3300013296 Bacteria 741
243 Ga0157374_11406898 3300013296 Unclassified 720
244 Ga0157374_11409521 3300013296 Bacteria 720
245 Ga0157374_11428382 3300013296 Unclassified 715
246 Ga0157374_11765850 3300013296 Bacteria 644
247 Ga0157374_11938459 3300013296 Unclassified 615
248 Ga0157374_12793490 3300013296 Unclassified 516
249 Ga0157378_10056872 3300013297 Bacteria 3486
250 Ga0157378_10181313 3300013297 Bacteria 1981
251 Ga0157378_10306542 3300013297 Bacteria 1539
252 Ga0157378_10643909 3300013297 Bacteria 1075
253 Ga0157378_10747003 3300013297 Bacteria 1001
254 Ga0157378_11008144 3300013297 Unclassified 867
255 Ga0157378_11217837 3300013297 Unclassified 793
256 Ga0157378_11294325 3300013297 Unclassified 770
257 Ga0157378_11850699 3300013297 Unclassified 652
258 Ga0163162_10080930 3300013306 Bacteria 3317
259 Ga0163162_10491251 3300013306 Bacteria 1358
260 Ga0163162_10540438 3300013306 Bacteria 1294
261 Ga0163162_10624645 3300013306 Bacteria 1202
262 Ga0163162_10680048 3300013306 Bacteria 1152
263 Ga0163162_10726472 3300013306 Bacteria 1114
264 Ga0163162_10762069 3300013306 Bacteria 1087
265 Ga0157372_10685509 3300013307 Bacteria 1193
266 Ga0157372_11407872 3300013307 Unclassified 804
267 Ga0157372_11843926 3300013307 Unclassified 695
268 Ga0157372_12311415 3300013307 Bacteria 617
269 Ga0157375_10000193 3300013308 Bacteria 57123
270 Ga0157375_11534848 3300013308 Unclassified 787
271 Ga0157375_11602033 3300013308 Unclassified 770
272 Ga0157375_13220750 3300013308 Unclassified 544
273 Ga0163163_10000067 3300014325 Bacteria 114831
274 Ga0163163_10059507 3300014325 Bacteria 3779
275 Ga0163163_10134572 3300014325 Bacteria 2512
276 Ga0163163_10338153 3300014325 Bacteria 1560
277 Ga0163163_12514715 3300014325 Unclassified 573
278 Ga0157380_10231426 3300014326 Unclassified 1660
279 Ga0157380_12005629 3300014326 Unclassified 640
280 Ga0157380_12606286 3300014326 Unclassified 572
281 Ga0157377_11269281 3300014745 Unclassified 574
282 Ga0157379_10204734 3300014968 Bacteria 1785
283 Ga0157379_10903119 3300014968 Unclassified 838
284 Ga0157379_10943511 3300014968 Bacteria 820
285 Ga0157379_10972997 3300014968 Unclassified 808
286 Ga0157379_11013697 3300014968 Unclassified 792
287 Ga0157376_10263247 3300014969 Bacteria 1616
288 Ga0157376_10453044 3300014969 Unclassified 1252
289 Ga0157376_10961254 3300014969 Unclassified 875
290 Ga0157376_11001752 3300014969 Bacteria 858
291 Ga0157376_11109156 3300014969 Bacteria 817
292 Ga0157376_11572957 3300014969 Unclassified 691
293 Ga0157376_11785274 3300014969 Bacteria 651
294 Ga0157376_12467429 3300014969 Bacteria 560
295 Ga0182007_10418969 3300015262 Unclassified 512
296 Ga0163161_10520740 3300017792 Bacteria 971
297 Ga0163161_10880384 3300017792 Unclassified 757
298 Ga0197907_10093562 3300020069 Unclassified 668
299 Ga0197907_10678080 3300020069 Unclassified 760
300 Ga0197907_11318956 3300020069 Bacteria 541
301 Ga0197907_11380623 3300020069 Bacteria 819
302 Ga0197907_11490927 3300020069 Unclassified 1004
303 Ga0206356_10061388 3300020070 Bacteria 535
304 Ga0206356_10271924 3300020070 Bacteria 978
305 Ga0206356_11175132 3300020070 Unclassified 889
306 Ga0206356_11803190 3300020070 Bacteria 739
307 Ga0206355_1170980 3300020076 Unclassified 748
308 Ga0206351_10916508 3300020077 Unclassified 575
309 Ga0206352_10077544 3300020078 Bacteria 555
310 Ga0206352_10327707 3300020078 Unclassified 805
311 Ga0206352_10694369 3300020078 Bacteria 606
312 Ga0206352_11021632 3300020078 Unclassified 961
313 Ga0206352_11302396 3300020078 Unclassified 510
314 Ga0206352_11361878 3300020078 Unclassified 674
315 Ga0206350_10848227 3300020080 Bacteria 671
316 Ga0206350_11044168 3300020080 Unclassified 518
317 Ga0206350_11356146 3300020080 Unclassified 533
318 Ga0206350_11359674 3300020080 Bacteria 642
319 Ga0206354_11266248 3300020081 Unclassified 782
320 Ga0206353_10136047 3300020082 Unclassified 741
321 Ga0224712_10014740 3300022467 Bacteria 2526
322 Ga0224712_10533823 3300022467 Bacteria 569
323 Ga0207685_10693173 3300025905 Unclassified 554
324 Ga0207645_10718064 3300025907 Bacteria 679
325 Ga0207705_10097830 3300025909 Bacteria 2155
326 Ga0207705_10622501 3300025909 Bacteria 839
327 Ga0207705_10936393 3300025909 Unclassified 670
328 Ga0207705_11323714 3300025909 Bacteria 550
329 Ga0207654_10837903 3300025911 Unclassified 665
330 Ga0207707_10093442 3300025912 Bacteria 2627
331 Ga0207707_10141503 3300025912 Bacteria 2103
332 Ga0207695_10042188 3300025913 Bacteria 4876
333 Ga0207695_10104842 3300025913 Bacteria 2815
334 Ga0207695_10152455 3300025913 Bacteria 2249
335 Ga0207695_10246758 3300025913 Bacteria 1685
336 Ga0207695_10253930 3300025913 Bacteria 1657
337 Ga0207695_10680131 3300025913 Unclassified 910
338 Ga0207695_11619000 3300025913 Unclassified 528
339 Ga0207671_10441233 3300025914 Unclassified 1036
340 Ga0207671_11386733 3300025914 Bacteria 545
341 Ga0207693_10062717 3300025915 Bacteria 2912
342 Ga0207693_10601293 3300025915 Unclassified 856
343 Ga0207693_10929201 3300025915 Unclassified 667
344 Ga0207663_10018773 3300025916 Bacteria 3883
345 Ga0207663_10690452 3300025916 Unclassified 808
346 Ga0207663_10719843 3300025916 Bacteria 791
347 Ga0207663_11612455 3300025916 Bacteria 522
348 Ga0207662_10419697 3300025918 Unclassified 910
349 Ga0207652_10677121 3300025921 Bacteria 921
350 Ga0207652_10794443 3300025921 Unclassified 841
351 Ga0207652_11647774 3300025921 Unclassified 546
352 Ga0207694_10010783 3300025924 Bacteria 6901
353 Ga0207694_10056957 3300025924 Bacteria 3037
354 Ga0207694_10229630 3300025924 Bacteria 1515
355 Ga0207694_10404762 3300025924 Bacteria 1135
356 Ga0207694_10712285 3300025924 Bacteria 847
357 Ga0207694_10840383 3300025924 Unclassified 776
358 Ga0207659_10910642 3300025926 Unclassified 756
359 Ga0207664_10022118 3300025929 Bacteria 4742
360 Ga0207664_10586981 3300025929 Bacteria 1000
361 Ga0207644_11447238 3300025931 Unclassified 577
362 Ga0207706_10782871 3300025933 Bacteria 811
363 Ga0207686_10517279 3300025934 Bacteria 928
364 Ga0207686_10863602 3300025934 Bacteria 728
365 Ga0207686_10982166 3300025934 Bacteria 684
366 Ga0207670_10016966 3300025936 Bacteria 4390
367 Ga0207670_10180763 3300025936 Bacteria 1589
368 Ga0207670_10333131 3300025936 Bacteria 1197
369 Ga0207670_10352704 3300025936 Bacteria 1165
370 Ga0207670_10990097 3300025936 Bacteria 707
371 Ga0207704_10420236 3300025938 Unclassified 1060
372 Ga0207665_10440124 3300025939 Bacteria 999
373 Ga0207711_10405246 3300025941 Unclassified 1267
374 Ga0207711_10688860 3300025941 Unclassified 953
375 Ga0207711_11484938 3300025941 Unclassified 621
376 Ga0207711_11760788 3300025941 Unclassified 563
377 Ga0207667_10063721 3300025949 Bacteria 3852
378 Ga0207667_10085720 3300025949 Bacteria 3260
379 Ga0207667_10141077 3300025949 Bacteria 2481
380 Ga0207667_10279608 3300025949 Bacteria 1706
381 Ga0207667_10397425 3300025949 Unclassified 1403
382 Ga0207667_11606036 3300025949 Bacteria 619
383 Ga0207651_10427834 3300025960 Bacteria 1131
384 Ga0207712_10526962 3300025961 Unclassified 1013
385 Ga0207712_10577605 3300025961 Unclassified 970
386 Ga0207703_10872680 3300026035 Bacteria 861
387 Ga0207703_11381294 3300026035 Bacteria 677
388 Ga0207703_11958267 3300026035 Unclassified 562
389 Ga0207702_10001987 3300026078 Bacteria 19847
390 Ga0207702_10015367 3300026078 Bacteria 6344
391 Ga0207641_10073907 3300026088 Bacteria 2939
392 Ga0207641_10295308 3300026088 Bacteria 1529
393 Ga0207641_10336223 3300026088 Bacteria 1436
394 Ga0207641_10608064 3300026088 Unclassified 1071
395 Ga0207641_10633890 3300026088 Bacteria 1049
396 Ga0207641_10841785 3300026088 Bacteria 909
397 Ga0207648_10723017 3300026089 Bacteria 924
398 Ga0207676_10446444 3300026095 Bacteria 1218
399 Ga0207676_10541887 3300026095 Unclassified 1111
400 Ga0207676_11481873 3300026095 Unclassified 675
401 Ga0207674_10119451 3300026116 Bacteria 2605
402 Ga0207674_10561603 3300026116 Unclassified 1102
403 Ga0207698_11448018 3300026142 Unclassified 702
404 Ga0207698_12685197 3300026142 Unclassified 507
405 Ga0207428_10591147 3300027907 Unclassified 800
406 Ga0207428_10907620 3300027907 Unclassified 622
407 Ga0268265_11005754 3300028380 Bacteria 824
408 Ga0268264_10758800 3300028381 Bacteria 967
409 Ga0265337_1001383 3300028556 Bacteria 11925
410 Ga0265337_1006315 3300028556 Bacteria 4589
411 Ga0265337_1052382 3300028556 Unclassified 1146
412 Ga0265337_1089782 3300028556 Bacteria 838
413 Ga0265337_1143152 3300028556 Bacteria 647
414 Ga0265337_1171205 3300028556 Unclassified 589
415 Ga0265326_10009649 3300028558 Bacteria 2888
416 Ga0265326_10041126 3300028558 Unclassified 1313
417 Ga0265326_10075678 3300028558 Unclassified 952
418 Ga0265326_10089624 3300028558 Bacteria 871
419 Ga0265326_10214143 3300028558 Bacteria 554
420 Ga0265319_1000181 3300028563 Bacteria 47983
421 Ga0265319_1015277 3300028563 Bacteria 2982
422 Ga0265319_1149123 3300028563 Unclassified 724
423 Ga0265319_1204408 3300028563 Unclassified 606
424 Ga0265334_10006539 3300028573 Bacteria 5017
425 Ga0265334_10015224 3300028573 Bacteria 3199
426 Ga0265334_10051809 3300028573 Unclassified 1573
427 Ga0265334_10297102 3300028573 Unclassified 553
428 Ga0265334_10303957 3300028573 Unclassified 546
429 Ga0265318_10137394 3300028577 Bacteria 898
430 Ga0265318_10160506 3300028577 Bacteria 824
431 Ga0265318_10372184 3300028577 Unclassified 521
432 Ga0265323_10000052 3300028653 Bacteria 63341
433 Ga0265323_10013603 3300028653 Bacteria 3242
434 Ga0265323_10213367 3300028653 Unclassified 606
435 Ga0265323_10246479 3300028653 Bacteria 556
436 Ga0265322_10183055 3300028654 Unclassified 600
437 Ga0265322_10240408 3300028654 Bacteria 519
438 Ga0265336_10001439 3300028666 Bacteria 10844
439 Ga0265336_10039863 3300028666 Bacteria 1439
440 Ga0265336_10119637 3300028666 Bacteria 784
441 Ga0265336_10183919 3300028666 Bacteria 621
442 Ga0265338_10000293 3300028800 Bacteria 90033
443 Ga0265338_10000334 3300028800 Bacteria 85705
444 Ga0265338_10000338 3300028800 Bacteria 85407
445 Ga0265338_10000702 3300028800 Bacteria 57422
446 Ga0265338_10001650 3300028800 Bacteria 35635
447 Ga0265338_10003512 3300028800 Bacteria 21968
448 Ga0265338_10004217 3300028800 Bacteria 19583
449 Ga0265338_10005093 3300028800 Bacteria 17342
450 Ga0265338_10007121 3300028800 Bacteria 14005
451 Ga0265338_10008472 3300028800 Bacteria 12481
452 Ga0265338_10010207 3300028800 Bacteria 11068
453 Ga0265338_10010911 3300028800 Bacteria 10569
454 Ga0265338_10011017 3300028800 Bacteria 10500
455 Ga0265338_10019439 3300028800 Bacteria 7207
456 Ga0265338_10028064 3300028800 Bacteria 5625
457 Ga0265338_10032343 3300028800 Bacteria 5106
458 Ga0265338_10037899 3300028800 Bacteria 4577
459 Ga0265338_10051004 3300028800 Bacteria 3733
460 Ga0265338_10117457 3300028800 Bacteria 2128
461 Ga0265338_10125810 3300028800 Unclassified 2034
462 Ga0265338_10182385 3300028800 Unclassified 1599
463 Ga0265338_10210658 3300028800 Bacteria 1459
464 Ga0265338_10316521 3300028800 Unclassified 1131
465 Ga0265338_10342561 3300028800 Unclassified 1077
466 Ga0265338_10371018 3300028800 Bacteria 1025
467 Ga0265338_10510824 3300028800 Bacteria 845
468 Ga0265338_10585774 3300028800 Bacteria 778
469 Ga0265338_10589925 3300028800 Unclassified 775
470 Ga0265338_10951110 3300028800 Unclassified 583
471 Ga0265338_11110602 3300028800 Unclassified 532
472 Ga0265324_10000497 3300029957 Bacteria 27319
473 Ga0265324_10004477 3300029957 Bacteria 6288
474 Ga0265324_10005898 3300029957 Bacteria 5205
475 Ga0265324_10014914 3300029957 Bacteria 2863
476 Ga0265324_10023976 3300029957 Unclassified 2171
477 Ga0265324_10041314 3300029957 Bacteria 1596
478 Ga0265324_10062512 3300029957 Bacteria 1272
479 Ga0265324_10079037 3300029957 Bacteria 1119
480 Ga0265324_10153587 3300029957 Bacteria 781
481 Ga0265330_10376438 3300031235 Unclassified 600
482 Ga0265330_10408638 3300031235 Unclassified 575
483 Ga0265332_10326449 3300031238 Unclassified 633
484 Ga0265320_10001101 3300031240 Bacteria 19951
485 Ga0265320_10004269 3300031240 Bacteria 9394
486 Ga0265320_10034090 3300031240 Bacteria 2594
487 Ga0265320_10049012 3300031240 Bacteria 2058
488 Ga0265320_10069884 3300031240 Bacteria 1657
489 Ga0265320_10089976 3300031240 Unclassified 1423
490 Ga0265320_10169678 3300031240 Unclassified 980
491 Ga0265320_10187693 3300031240 Unclassified 925
492 Ga0265320_10194022 3300031240 Bacteria 907
493 Ga0265320_10262590 3300031240 Bacteria 765
494 Ga0265320_10531722 3300031240 Unclassified 520
495 Ga0265325_10097339 3300031241 Bacteria 1444
496 Ga0265325_10144680 3300031241 Bacteria 1128
497 Ga0265325_10198542 3300031241 Bacteria 926
498 Ga0265329_10060872 3300031242 Bacteria 1196
499 Ga0265329_10172257 3300031242 Bacteria 706
500 Ga0265340_10001821 3300031247 Bacteria 12184
501 Ga0265340_10008513 3300031247 Bacteria 5536
502 Ga0265340_10041784 3300031247 Bacteria 2253
503 Ga0265340_10098528 3300031247 Bacteria 1361
504 Ga0265340_10249798 3300031247 Unclassified 791
505 Ga0265340_10445668 3300031247 Bacteria 570
506 Ga0265340_10455733 3300031247 Unclassified 563
507 Ga0265339_10045383 3300031249 Bacteria 2419
508 Ga0265339_10047272 3300031249 Bacteria 2363
509 Ga0265339_10081811 3300031249 Bacteria 1706
510 Ga0265339_10120594 3300031249 Bacteria 1348
511 Ga0265339_10376364 3300031249 Bacteria 666
512 Ga0265331_10145531 3300031250 Bacteria 1077
513 Ga0265327_10000707 3300031251 Bacteria 52780
514 Ga0265327_10001304 3300031251 Bacteria 32595
515 Ga0265327_10007941 3300031251 Bacteria 8032
516 Ga0265316_10019145 3300031344 Bacteria 5863
517 Ga0265316_10054200 3300031344 Bacteria 3140
518 Ga0265316_10081759 3300031344 Bacteria 2476
519 Ga0265316_10109663 3300031344 Unclassified 2091
520 Ga0265316_10110646 3300031344 Bacteria 2080
521 Ga0265316_10116523 3300031344 Bacteria 2019
522 Ga0265316_10170567 3300031344 Bacteria 1623
523 Ga0265316_10301063 3300031344 Bacteria 1168
524 Ga0265316_10539635 3300031344 Bacteria 831
525 Ga0265316_10646002 3300031344 Bacteria 748
526 Ga0265316_10683884 3300031344 Bacteria 724
527 Ga0265316_10921338 3300031344 Bacteria 610
528 Ga0265316_10929551 3300031344 Bacteria 607
529 Ga0265316_11041543 3300031344 Unclassified 569
530 Ga0265316_11070914 3300031344 Unclassified 560
531 Ga0265313_10025647 3300031595 Bacteria 3117
532 Ga0265313_10045617 3300031595 Bacteria 2132
533 Ga0265313_10110582 3300031595 Unclassified 1209
534 Ga0265313_10346521 3300031595 Unclassified 589
535 Ga0265314_10022822 3300031711 Bacteria 4788
536 Ga0265314_10184840 3300031711 Bacteria 1245
537 Ga0265342_10114022 3300031712 Bacteria 1527
538 Ga0265342_10210320 3300031712 Bacteria 1052
539 Ga0265342_10437365 3300031712 Unclassified 672
540 Ga0265342_10522955 3300031712 Unclassified 604
541 Ga0265342_10649859 3300031712 Bacteria 529
542 Ga0307405_11006522 3300031731 Unclassified 711
543 Ga0307413_11501271 3300031824 Unclassified 596
544 Ga0307412_10184900 3300031911 Unclassified 1571
545 Ga0307409_101249666 3300031995 Bacteria 767
546 Ga0307414_10611136 3300032004 Unclassified 979
547 Ga0373930_0022447 3300034816 Unclassified 1248
548 Ga0373959_0015678 3300034820 Unclassified 1394
549 Ga0373926_0160551 3300035083 Unclassified 858
550 Ga0373926_0227530 3300035083 Unclassified 720
551 Ga0373928_0000024 3300035084 Bacteria 25811
552 Ga0373929_0000895 3300035085 Bacteria 5809
553 Ga0373940_0030071 3300035088 Unclassified 1443
554 Ga0373944_0000514 3300035089 Bacteria 9041
555 Ga0373949_0007193 3300035090 Unclassified 2440
556 Ga0373951_0001684 3300035091 Bacteria 5775
557 Ga0373923_0106057 3300035111 Bacteria 1244
558 Ga0373932_0000006 3300035112 Bacteria 208547
559 Ga0373936_0133561 3300035113 Bacteria 1068
560 Ga0373939_0150575 3300035114 Unclassified 846
561 Ga0373945_0130270 3300035116 Unclassified 1007
562 Ga0373945_0205207 3300035116 Bacteria 820
563 Ga0373953_0044513 3300035117 Bacteria 1775
564 Ga0373953_0441775 3300035117 Bacteria 574
565 Ga0373954_0004196 3300035118 Bacteria 6179
566 Ga0373954_0033971 3300035118 Bacteria 2360
567 Ga0373956_0013538 3300035119 Bacteria 3394
568 Ga0373956_0038253 3300035119 Bacteria 2122
569 Ga0373956_0635901 3300035119 Bacteria 509
570 Ga0373943_0207097 3300035170 Bacteria 1088
571 Ga0373943_0459057 3300035170 Unclassified 741
572 Ga0373946_0063792 3300035171 Bacteria 1574
573 Ga0373946_0322510 3300035171 Bacteria 768
574 Ga0373946_0678594 3300035171 Bacteria 538
575 Ga0373955_0128784 3300035172 Unclassified 1476
576 Ga0373955_0232990 3300035172 Unclassified 1102
577 Ga0373955_0591537 3300035172 Unclassified 679
578 Ga0373955_0940999 3300035172 Unclassified 532
579 Ga0373942_0079562 3300035207 Bacteria 971
580 Ga0373962_0000162 3300035242 Bacteria 14126
581 Ga0373931_0000009 3300035691 Bacteria 349854
582 Ga0373931_0071622 3300035691 Bacteria 1894
583 Ga0373931_0307092 3300035691 Bacteria 981
584 Ga0373931_0363796 3300035691 Bacteria 908
585 Ga0373935_0013383 3300035692 Bacteria 4949
586 Ga0373935_0061713 3300035692 Bacteria 2400
587 Ga0373935_0987743 3300035692 Bacteria 625
588 Ga0373935_1099004 3300035692 Unclassified 592
589 Ga0373927_0020430 3300035695 Bacteria 4342
590 Ga0373927_0067607 3300035695 Bacteria 2312
591 Ga0373927_0279688 3300035695 Unclassified 1098
592 Ga0373927_0304740 3300035695 Unclassified 1048
593 Ga0373927_0344516 3300035695 Bacteria 982
594 Ga0373927_0579089 3300035695 Bacteria 742
595 Ga0373947_0203163 3300035725 Bacteria 1297
596 Ga0373947_0263440 3300035725 Bacteria 1143
597 Ga0373947_0483342 3300035725 Bacteria 840
598 Ga0373937_0002559 3300036401 Bacteria 15119
599 Ga0373937_0219435 3300036401 Bacteria 1790
600 Ga0373937_0677862 3300036401 Bacteria 977
601 Ga0373937_0682099 3300036401 Bacteria 974
602 Ga0373937_1195331 3300036401 Unclassified 709
603 Ga0373937_1318498 3300036401 Unclassified 670
604 Ga0316582_0493026 3300036647 Bacteria 844
605 Ga0373925_0000498 3300037068 Bacteria 39602
606 Ga0373925_0076093 3300037068 Bacteria 2545
607 Ga0373925_0233403 3300037068 Bacteria 1471
608 Ga0373925_1352726 3300037068 Bacteria 584
609 Ga0373925_1411675 3300037068 Unclassified 570
610 Ga0436363_0725337 3300039450 Bacteria 877
611 Ga0451793_0122907 3300041452 Unclassified 580
612 Ga0451807_0872394 3300041486 Unclassified 520
613 Ga0451833_0913063 3300041491 Unclassified 747
614 Ga0451839_0496865 3300041496 Bacteria 782
615 Ga0451839_0584655 3300041496 Bacteria 630
616 Ga0451577_0001767 3300042876 Bacteria 27811
617 Ga0451577_0005602 3300042876 Bacteria 12775
618 Ga0451577_0161865 3300042876 Unclassified 2015
619 Ga0451577_0583306 3300042876 Bacteria 1015
620 Ga0453683_0737386 3300044673 Unclassified 647
621 Ga0453683_0739032 3300044673 Unclassified 646
622 Ga0453684_0000238 3300044712 Bacteria 236003
623 Ga0453684_0002796 3300044712 Bacteria 41264
624 Ga0453684_0040224 3300044712 Bacteria 6355
625 Ga0453684_0183186 3300044712 Unclassified 2457
626 Ga0453684_0851306 3300044712 Bacteria 980
627 Ga0453684_0959676 3300044712 Bacteria 912
628 Ga0453684_1576212 3300044712 Unclassified 675
629 Ga0453684_2399320 3300044712 Unclassified 522
630 Ga0451576_0061426 3300045051 Bacteria 3918
631 Ga0451576_0160484 3300045051 Unclassified 2346
632 Ga0451576_0227091 3300045051 Unclassified 1949
633 Ga0451576_0234148 3300045051 Bacteria 1918
634 Ga0451576_0268955 3300045051 Bacteria 1782
635 Ga0451576_0376963 3300045051 Bacteria 1487
636 Ga0451576_0440598 3300045051 Bacteria 1367
637 Ga0451576_0510580 3300045051 Bacteria 1263
638 Ga0451576_0548984 3300045051 Bacteria 1214
639 Ga0451576_0767631 3300045051 Bacteria 1013
640 Ga0451576_0831077 3300045051 Bacteria 970
641 Ga0451576_0883735 3300045051 Bacteria 938
642 Ga0451576_0991917 3300045051 Bacteria 880
643 Ga0451576_1050733 3300045051 Bacteria 853
644 Ga0451576_1197883 3300045051 Bacteria 793
645 Ga0451576_1336329 3300045051 Unclassified 747
646 Ga0451576_1350323 3300045051 Bacteria 742
647 Ga0451576_1430121 3300045051 Unclassified 719
648 Ga0451576_1692506 3300045051 Unclassified 655
649 Ga0451576_2312339 3300045051 Bacteria 551
650 Ga0495592_0000027 3300046454 Bacteria 132938
651 Ga0495603_0211200 3300046455 Unclassified 1121
652 Ga0495629_0032554 3300046459 Bacteria 3691
653 Ga0495629_0669747 3300046459 Bacteria 690
654 Ga0495641_0054259 3300046461 Bacteria 1821
655 Ga0495651_0218694 3300046462 Bacteria 1320
656 Ga0495651_0517804 3300046462 Unclassified 762
657 Ga0495582_0029874 3300046473 Bacteria 2992
658 Ga0495639_0340601 3300046475 Unclassified 752
659 Ga0495662_0033947 3300046476 Bacteria 2464
660 Ga0495662_0669998 3300046476 Bacteria 506
661 Ga0495664_0065077 3300046477 Bacteria 2173
662 Ga0495664_0630010 3300046477 Unclassified 636
663 Ga0495594_0319076 3300046499 Unclassified 885
664 Ga0495608_0370576 3300046511 Unclassified 879
665 Ga0495618_0000627 3300046514 Bacteria 25046
666 Ga0495628_0284490 3300046516 Bacteria 1227
667 Ga0495628_0630651 3300046516 Bacteria 763
668 Ga0495628_0654555 3300046516 Bacteria 746
669 Ga0495630_0000094 3300046517 Bacteria 68804
670 Ga0495630_0430978 3300046517 Bacteria 1010
671 Ga0495630_0473504 3300046517 Bacteria 960
672 Ga0495630_0489449 3300046517 Bacteria 943
673 Ga0495630_0564692 3300046517 Unclassified 873
674 Ga0495630_1485614 3300046517 Bacteria 509
675 Ga0495666_0018485 3300046526 Bacteria 3469
676 Ga0495666_0284874 3300046526 Unclassified 749
677 Ga0495652_0365927 3300046529 Bacteria 1029
678 Ga0495665_0328917 3300046531 Bacteria 780
679 Ga0495640_0182592 3300046533 Bacteria 1336
680 Ga0495640_0203140 3300046533 Unclassified 1255
681 Ga0495586_0000110 3300046535 Bacteria 48594
682 Ga0495586_0000435 3300046535 Bacteria 25115
683 Ga0495586_0000958 3300046535 Bacteria 16352
684 Ga0495586_0026563 3300046535 Bacteria 3098
685 Ga0495586_0553280 3300046535 Unclassified 664
686 Ga0495587_0141923 3300046536 Bacteria 1371
687 Ga0495587_0380778 3300046536 Bacteria 785
688 Ga0495621_0253232 3300046539 Unclassified 720
689 Ga0495645_0019475 3300046543 Bacteria 4886
690 Ga0495645_0082744 3300046543 Bacteria 2302
691 Ga0495645_0127177 3300046543 Bacteria 1790
692 Ga0495645_0431152 3300046543 Unclassified 835
693 Ga0495645_0507110 3300046543 Unclassified 753
694 Ga0495645_0816196 3300046543 Bacteria 559
695 Ga0495622_0028227 3300046557 Bacteria 2620
696 Ga0495667_0579554 3300046559 Unclassified 700
697 Ga0495667_0769166 3300046559 Bacteria 595
698 Ga0495667_0834387 3300046559 Unclassified 567
699 Ga0495634_0009163 3300046642 Bacteria 7310
700 Ga0495634_0043769 3300046642 Bacteria 3034
701 Ga0495634_0293434 3300046642 Bacteria 985
702 Ga0495635_0189751 3300046663 Bacteria 1396
703 Ga0495588_0324818 3300046674 Unclassified 809
704 Ga0495657_0733890 3300046675 Bacteria 567
705 Ga0495599_0056448 3300046678 Bacteria 2458
706 Ga0495599_0258696 3300046678 Bacteria 1058
707 Ga0495599_0520511 3300046678 Unclassified 699
708 Ga0495646_0226172 3300046680 Unclassified 1010
709 Ga0495647_0388136 3300046681 Unclassified 640
710 Ga0495647_0428119 3300046681 Bacteria 610
711 Ga0495658_0066062 3300046683 Bacteria 2088
712 Ga0495658_0421644 3300046683 Bacteria 851
713 Ga0495658_0991879 3300046683 Unclassified 536
714 Ga0495669_0104660 3300046684 Unclassified 1317
715 Ga0495613_0014339 3300046689 Bacteria 5883
716 Ga0495613_0199537 3300046689 Unclassified 1411
717 Ga0495613_0264686 3300046689 Bacteria 1197
718 Ga0495613_0476844 3300046689 Bacteria 842
719 Ga0495613_1039756 3300046689 Unclassified 525
720 Ga0495604_1035080 3300047317 Unclassified 507
721 Ga0495636_0309781 3300047318 Unclassified 740
722 Ga0495674_0038375 3300047319 Bacteria 4300
723 Ga0495674_0699378 3300047319 Unclassified 796
724 Ga0495676_0105139 3300047321 Bacteria 2082
725 Ga0495680_0024214 3300047322 Bacteria 5037
726 Ga0495684_0054808 3300047471 Bacteria 3041
727 Ga0495684_0406021 3300047471 Unclassified 955
728 Ga0495684_0667817 3300047471 Bacteria 693
729 Ga0496106_0201388 3300048909 Unclassified 1584
730 Ga0496107_0181400 3300048910 Unclassified 1563
731 Ga0496115_0117239 3300048918 Bacteria 2190
732 Ga0501306_069203 3300049127 Unclassified 593
733 Ga0501305_097551 3300049161 Unclassified 544
734 Ga0501031_0000203 3300049568 Bacteria 33918
735 Ga0501031_0518636 3300049568 Bacteria 768
736 Ga0501032_0008432 3300049569 Bacteria 7519
737 Ga0501032_0143599 3300049569 Bacteria 1571
738 Ga0501033_0007214 3300049570 Bacteria 8674
739 Ga0501033_0498602 3300049570 Bacteria 842
740 Ga0501034_0558255 3300049571 Bacteria 1054
741 Ga0501034_1376486 3300049571 Unclassified 581
742 Ga0501036_0526368 3300049572 Bacteria 983
743 Ga0501036_1361048 3300049572 Unclassified 576
744 Ga0501038_0864430 3300049574 Bacteria 669
745 Ga0501039_0869117 3300049575 Unclassified 702
746 Ga0501046_0115284 3300049580 Bacteria 2049
747 Ga0501047_0148567 3300049581 Bacteria 2220
748 Ga0501047_1044681 3300049581 Unclassified 630
749 Ga0501070_1280925 3300049586 Unclassified 560
750 Ga0501222_021115 3300049662 Unclassified 873
751 Ga0501249_066294 3300049679 Unclassified 840
752 Ga0501257_090794 3300049686 Unclassified 795
753 Ga0501257_199329 3300049686 Unclassified 575
754 Ga0501260_055282 3300049689 Bacteria 508
755 Ga0501229_026822 3300049706 Bacteria 778
756 Ga0501080_0390850 3300049742 Bacteria 1252
757 Ga0501275_050451 3300049772 Bacteria 609
758 Ga0501035_0007635 3300049822 Bacteria 10104
759 Ga0501035_0036941 3300049822 Bacteria 4426
760 Ga0501035_0069927 3300049822 Bacteria 3110
761 Ga0501044_0000928 3300049823 Bacteria 35229
762 Ga0501044_0017307 3300049823 Bacteria 7731
763 nmdc:mga08y16_644868_c1 3300050511 Unclassified 1064
764 nmdc:mga08y16_859334_c1 3300050511 Unclassified 896
765 nmdc:mga08y16_88364_c1 3300050511 Bacteria 3230
766 nmdc:mga0n895_1692147_c1 3300050512 Bacteria 595
767 nmdc:mga0n895_1902941_c1 3300050512 Bacteria 554
768 nmdc:mga08x19_257704_c1 3300050514 Bacteria 1205
769 Ga0495601_0273052 3300053077 Bacteria 1103
770 Ga0495601_0280829 3300053077 Unclassified 1086
771 Ga0500651_0154304 3300053093 Unclassified 1377
772 Ga0500650_0077906 3300053098 Bacteria 1549
773 Ga0500650_0267547 3300053098 Unclassified 763
774 Ga0500595_153345 3300053119 Unclassified 643
775 Ga0500616_0118612 3300053153 Bacteria 1267
776 Ga0590071_035465 3300059421 Unclassified 1195
777 Ga0587128_077233 3300059630 Unclassified 660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100848526 Ga0070689_1008485262 80
2 3300005436 Ga0070713_100654135 Ga0070713_1006541352 80
3 3300005437 Ga0070710_11391709 Ga0070710_113917091 80
4 3300005468 Ga0070707_102201639 Ga0070707_1022016391 80
5 3300005530 Ga0070679_100686182 Ga0070679_1006861822 80
6 3300005617 Ga0068859_100023109 Ga0068859_1000231095 80
7 3300006931 Ga0097620_100023109 Ga0097620_1000231095 80
8 3300050511 nmdc:mga08y16_88364_c1 nmdc:mga08y16_88364_c1_10_261 80
9 3300046477 Ga0495664_0630010 Ga0495664_0630010_362_625 84
10 3300005341 Ga0070691_10028998 Ga0070691_100289982 86
11 3300005614 Ga0068856_100485674 Ga0068856_1004856742 93
12 3300009098 Ga0105245_12663560 Ga0105245_126635602 93
13 3300009551 Ga0105238_11167475 Ga0105238_111674752 93
14 3300020070 Ga0206356_11803190 Ga0206356_118031901 93
15 3300020080 Ga0206350_11359674 Ga0206350_113596742 93
16 3300022467 Ga0224712_10533823 Ga0224712_105338232 93
17 3300025924 Ga0207694_10840383 Ga0207694_108403831 93
18 3300028556 Ga0265337_1089782 Ga0265337_10897822 93
19 3300028577 Ga0265318_10160506 Ga0265318_101605062 93
20 3300028577 Ga0265318_10372184 Ga0265318_103721841 93
21 3300028666 Ga0265336_10119637 Ga0265336_101196372 93
22 3300028800 Ga0265338_10051004 Ga0265338_100510042 93
23 3300028800 Ga0265338_10510824 Ga0265338_105108242 93
24 3300029957 Ga0265324_10000497 Ga0265324_1000049711 93
25 3300029957 Ga0265324_10005898 Ga0265324_100058983 93
26 3300029957 Ga0265324_10014914 Ga0265324_100149144 93
27 3300031241 Ga0265325_10097339 Ga0265325_100973393 93
28 3300031344 Ga0265316_10646002 Ga0265316_106460023 93
29 3300035695 Ga0373927_0344516 Ga0373927_0344516_56_337 93
30 3300037068 Ga0373925_0076093 Ga0373925_0076093_596_877 93
31 3300044712 Ga0453684_0183186 Ga0453684_0183186_847_1128 93
32 3300044712 Ga0453684_0959676 Ga0453684_0959676_92_373 93
33 3300053093 Ga0500651_0154304 Ga0500651_0154304_473_754 93
34 3300053098 Ga0500650_0077906 Ga0500650_0077906_1127_1408 93
35 3300005327 Ga0070658_10682727 Ga0070658_106827271 94
36 3300005327 Ga0070658_10808282 Ga0070658_108082822 94
37 3300005327 Ga0070658_11244481 Ga0070658_112444811 94
38 3300005334 Ga0068869_101458883 Ga0068869_1014588832 94
39 3300005353 Ga0070669_101440414 Ga0070669_1014404141 94
40 3300005354 Ga0070675_101443973 Ga0070675_1014439732 94
41 3300005356 Ga0070674_101889740 Ga0070674_1018897402 94
42 3300005436 Ga0070713_100067334 Ga0070713_1000673345 94
43 3300005436 Ga0070713_102092158 Ga0070713_1020921581 94
44 3300005439 Ga0070711_101956615 Ga0070711_1019566151 94
45 3300005535 Ga0070684_101664385 Ga0070684_1016643852 94
46 3300005546 Ga0070696_100499695 Ga0070696_1004996951 94
47 3300005563 Ga0068855_100594062 Ga0068855_1005940623 94
48 3300005577 Ga0068857_100981396 Ga0068857_1009813962 94
49 3300005614 Ga0068856_100002798 Ga0068856_10000279810 94
50 3300005615 Ga0070702_100958535 Ga0070702_1009585351 94
51 3300005719 Ga0068861_101150284 Ga0068861_1011502841 94
52 3300005841 Ga0068863_100502503 Ga0068863_1005025032 94
53 3300005841 Ga0068863_100822777 Ga0068863_1008227771 94
54 3300005843 Ga0068860_100452901 Ga0068860_1004529012 94
55 3300005843 Ga0068860_101516174 Ga0068860_1015161741 94
56 3300005844 Ga0068862_100311034 Ga0068862_1003110343 94
57 3300006163 Ga0070715_11056509 Ga0070715_110565091 94
58 3300006358 Ga0068871_100440014 Ga0068871_1004400141 94
59 3300006852 Ga0075433_10613432 Ga0075433_106134322 94
60 3300006931 Ga0097620_102924185 Ga0097620_1029241851 94
61 3300007265 Ga0099794_10392331 Ga0099794_103923311 94
62 3300007265 Ga0099794_10807308 Ga0099794_108073081 94
63 3300007788 Ga0099795_10045715 Ga0099795_100457152 94
64 3300009093 Ga0105240_10247162 Ga0105240_102471624 94
65 3300009093 Ga0105240_10428626 Ga0105240_104286262 94
66 3300009098 Ga0105245_12408171 Ga0105245_124081711 94
67 3300009177 Ga0105248_10102792 Ga0105248_101027923 94
68 3300009545 Ga0105237_10728191 Ga0105237_107281914 94
69 3300009545 Ga0105237_11813844 Ga0105237_118138442 94
70 3300009551 Ga0105238_10058361 Ga0105238_100583611 94
71 3300009551 Ga0105238_10058392 Ga0105238_100583925 94
72 3300009551 Ga0105238_10090988 Ga0105238_100909884 94
73 3300009551 Ga0105238_10218190 Ga0105238_102181902 94
74 3300009551 Ga0105238_10651457 Ga0105238_106514573 94
75 3300009553 Ga0105249_11541964 Ga0105249_115419642 94
76 3300010375 Ga0105239_11767158 Ga0105239_117671581 94
77 3300011119 Ga0105246_12002802 Ga0105246_120028021 94
78 3300013296 Ga0157374_11125289 Ga0157374_111252891 94
79 3300013296 Ga0157374_11765850 Ga0157374_117658502 94
80 3300013306 Ga0163162_10080930 Ga0163162_100809303 94
81 3300014325 Ga0163163_10059507 Ga0163163_100595074 94
82 3300014326 Ga0157380_12005629 Ga0157380_120056292 94
83 3300014968 Ga0157379_10204734 Ga0157379_102047342 94
84 3300014969 Ga0157376_11001752 Ga0157376_110017522 94
85 3300015262 Ga0182007_10418969 Ga0182007_104189691 94
86 3300020070 Ga0206356_10061388 Ga0206356_100613881 94
87 3300020077 Ga0206351_10916508 Ga0206351_109165082 94
88 3300020078 Ga0206352_10077544 Ga0206352_100775442 94
89 3300025909 Ga0207705_10622501 Ga0207705_106225012 94
90 3300025909 Ga0207705_10936393 Ga0207705_109363932 94
91 3300025913 Ga0207695_11619000 Ga0207695_116190001 94
92 3300025914 Ga0207671_10441233 Ga0207671_104412332 94
93 3300025914 Ga0207671_11386733 Ga0207671_113867331 94
94 3300025915 Ga0207693_10062717 Ga0207693_100627171 94
95 3300025916 Ga0207663_11612455 Ga0207663_116124552 94
96 3300025924 Ga0207694_10056957 Ga0207694_100569574 94
97 3300025924 Ga0207694_10229630 Ga0207694_102296302 94
98 3300025924 Ga0207694_10404762 Ga0207694_104047622 94
99 3300025949 Ga0207667_10085720 Ga0207667_100857204 94
100 3300025949 Ga0207667_10279608 Ga0207667_102796083 94
101 3300025961 Ga0207712_10526962 Ga0207712_105269622 94
102 3300026078 Ga0207702_10001987 Ga0207702_1000198710 94
103 3300026088 Ga0207641_10336223 Ga0207641_103362232 94
104 3300026095 Ga0207676_10541887 Ga0207676_105418873 94
105 3300026116 Ga0207674_10119451 Ga0207674_101194512 94
106 3300028558 Ga0265326_10041126 Ga0265326_100411263 94
107 3300028558 Ga0265326_10214143 Ga0265326_102141432 94
108 3300028653 Ga0265323_10246479 Ga0265323_102464791 94
109 3300028800 Ga0265338_10000293 Ga0265338_1000029367 94
110 3300028800 Ga0265338_10000334 Ga0265338_100003349 94
111 3300028800 Ga0265338_10011017 Ga0265338_100110178 94
112 3300028800 Ga0265338_10028064 Ga0265338_100280642 94
113 3300028800 Ga0265338_10589925 Ga0265338_105899252 94
114 3300028800 Ga0265338_10951110 Ga0265338_109511101 94
115 3300029957 Ga0265324_10004477 Ga0265324_100044774 94
116 3300031235 Ga0265330_10376438 Ga0265330_103764381 94
117 3300031240 Ga0265320_10262590 Ga0265320_102625901 94
118 3300031249 Ga0265339_10045383 Ga0265339_100453833 94
119 3300031249 Ga0265339_10120594 Ga0265339_101205942 94
120 3300031250 Ga0265331_10145531 Ga0265331_101455312 94
121 3300031251 Ga0265327_10000707 Ga0265327_100007079 94
122 3300031251 Ga0265327_10007941 Ga0265327_100079413 94
123 3300031344 Ga0265316_10116523 Ga0265316_101165231 94
124 3300031344 Ga0265316_10170567 Ga0265316_101705671 94
125 3300031344 Ga0265316_10301063 Ga0265316_103010632 94
126 3300031344 Ga0265316_10921338 Ga0265316_109213381 94
127 3300031344 Ga0265316_11070914 Ga0265316_110709142 94
128 3300031712 Ga0265342_10437365 Ga0265342_104373652 94
129 3300031731 Ga0307405_11006522 Ga0307405_110065222 94
130 3300031824 Ga0307413_11501271 Ga0307413_115012711 94
131 3300031911 Ga0307412_10184900 Ga0307412_101849002 94
132 3300031995 Ga0307409_101249666 Ga0307409_1012496661 94
133 3300032004 Ga0307414_10611136 Ga0307414_106111361 94
134 3300034816 Ga0373930_0022447 Ga0373930_0022447_54_338 94
135 3300034820 Ga0373959_0015678 Ga0373959_0015678_758_1042 94
136 3300035083 Ga0373926_0160551 Ga0373926_0160551_122_406 94
137 3300035084 Ga0373928_0000024 Ga0373928_0000024_21167_21451 94
138 3300035085 Ga0373929_0000895 Ga0373929_0000895_2017_2301 94
139 3300035088 Ga0373940_0030071 Ga0373940_0030071_822_1106 94
140 3300035089 Ga0373944_0000514 Ga0373944_0000514_5217_5501 94
141 3300035090 Ga0373949_0007193 Ga0373949_0007193_1595_1879 94
142 3300035091 Ga0373951_0001684 Ga0373951_0001684_1873_2157 94
143 3300035112 Ga0373932_0000006 Ga0373932_0000006_198667_198951 94
144 3300035114 Ga0373939_0150575 Ga0373939_0150575_43_327 94
145 3300035170 Ga0373943_0207097 Ga0373943_0207097_388_672 94
146 3300035171 Ga0373946_0322510 Ga0373946_0322510_357_641 94
147 3300035171 Ga0373946_0678594 Ga0373946_0678594_32_316 94
148 3300035172 Ga0373955_0940999 Ga0373955_0940999_147_431 94
149 3300035207 Ga0373942_0079562 Ga0373942_0079562_661_945 94
150 3300035242 Ga0373962_0000162 Ga0373962_0000162_9534_9818 94
151 3300035691 Ga0373931_0000009 Ga0373931_0000009_196982_197266 94
152 3300035691 Ga0373931_0071622 Ga0373931_0071622_457_741 94
153 3300035691 Ga0373931_0363796 Ga0373931_0363796_396_680 94
154 3300035692 Ga0373935_0061713 Ga0373935_0061713_1793_2077 94
155 3300035692 Ga0373935_0987743 Ga0373935_0987743_145_429 94
156 3300035695 Ga0373927_0020430 Ga0373927_0020430_3693_3977 94
157 3300035695 Ga0373927_0304740 Ga0373927_0304740_497_781 94
158 3300036401 Ga0373937_1318498 Ga0373937_1318498_170_454 94
159 3300037068 Ga0373925_0000498 Ga0373925_0000498_36977_37261 94
160 3300037068 Ga0373925_0233403 Ga0373925_0233403_631_915 94
161 3300037068 Ga0373925_1352726 Ga0373925_1352726_164_448 94
162 3300037068 Ga0373925_1411675 Ga0373925_1411675_155_439 94
163 3300041496 Ga0451839_0496865 Ga0451839_0496865_296_583 94
164 3300041496 Ga0451839_0584655 Ga0451839_0584655_63_347 94
165 3300042876 Ga0451577_0583306 Ga0451577_0583306_485_769 94
166 3300044673 Ga0453683_0739032 Ga0453683_0739032_101_385 94
167 3300045051 Ga0451576_0376963 Ga0451576_0376963_708_992 94
168 3300045051 Ga0451576_0440598 Ga0451576_0440598_865_1149 94
169 3300045051 Ga0451576_0991917 Ga0451576_0991917_534_818 94
170 3300045051 Ga0451576_1050733 Ga0451576_1050733_353_637 94
171 3300045051 Ga0451576_2312339 Ga0451576_2312339_133_417 94
172 3300046455 Ga0495603_0211200 Ga0495603_0211200_651_935 94
173 3300046461 Ga0495641_0054259 Ga0495641_0054259_91_375 94
174 3300046462 Ga0495651_0218694 Ga0495651_0218694_387_671 94
175 3300046475 Ga0495639_0340601 Ga0495639_0340601_198_482 94
176 3300046517 Ga0495630_1485614 Ga0495630_1485614_197_481 94
177 3300046535 Ga0495586_0026563 Ga0495586_0026563_2121_2405 94
178 3300046543 Ga0495645_0082744 Ga0495645_0082744_627_911 94
179 3300046543 Ga0495645_0127177 Ga0495645_0127177_60_344 94
180 3300046543 Ga0495645_0816196 Ga0495645_0816196_28_312 94
181 3300046557 Ga0495622_0028227 Ga0495622_0028227_486_770 94
182 3300046663 Ga0495635_0189751 Ga0495635_0189751_821_1105 94
183 3300046678 Ga0495599_0056448 Ga0495599_0056448_170_454 94
184 3300046683 Ga0495658_0066062 Ga0495658_0066062_1414_1698 94
185 3300046689 Ga0495613_0199537 Ga0495613_0199537_426_710 94
186 3300049127 Ga0501306_069203 Ga0501306_069203_271_555 94
187 3300049161 Ga0501305_097551 Ga0501305_097551_45_329 94
188 3300049568 Ga0501031_0000203 Ga0501031_0000203_25782_26066 94
189 3300049568 Ga0501031_0518636 Ga0501031_0518636_319_603 94
190 3300049569 Ga0501032_0008432 Ga0501032_0008432_5406_5690 94
191 3300049569 Ga0501032_0143599 Ga0501032_0143599_532_816 94
192 3300049570 Ga0501033_0007214 Ga0501033_0007214_498_782 94
193 3300049570 Ga0501033_0498602 Ga0501033_0498602_513_797 94
194 3300049572 Ga0501036_0526368 Ga0501036_0526368_430_714 94
195 3300049574 Ga0501038_0864430 Ga0501038_0864430_42_326 94
196 3300049580 Ga0501046_0115284 Ga0501046_0115284_1622_1906 94
197 3300049581 Ga0501047_0148567 Ga0501047_0148567_895_1179 94
198 3300049581 Ga0501047_1044681 Ga0501047_1044681_277_561 94
199 3300049586 Ga0501070_1280925 Ga0501070_1280925_222_506 94
200 3300049662 Ga0501222_021115 Ga0501222_021115_422_706 94
201 3300049679 Ga0501249_066294 Ga0501249_066294_15_299 94
202 3300049686 Ga0501257_090794 Ga0501257_090794_468_752 94
203 3300049706 Ga0501229_026822 Ga0501229_026822_39_323 94
204 3300049742 Ga0501080_0390850 Ga0501080_0390850_262_546 94
205 3300049822 Ga0501035_0007635 Ga0501035_0007635_1015_1299 94
206 3300049822 Ga0501035_0036941 Ga0501035_0036941_1968_2252 94
207 3300049822 Ga0501035_0069927 Ga0501035_0069927_2704_2988 94
208 3300049823 Ga0501044_0000928 Ga0501044_0000928_7875_8159 94
209 3300049823 Ga0501044_0017307 Ga0501044_0017307_2196_2480 94
210 3300050512 nmdc:mga0n895_1692147_c1 nmdc:mga0n895_1692147_c1_37_321 94
211 3300059421 Ga0590071_035465 Ga0590071_035465_556_840 94
212 3300059630 Ga0587128_077233 Ga0587128_077233_48_332 94
213 3300004799 Ga0058863_11510544 Ga0058863_115105442 95
214 3300004801 Ga0058860_12232918 Ga0058860_122329183 95
215 3300004803 Ga0058862_10971528 Ga0058862_109715282 95
216 3300005295 Ga0065707_10960953 Ga0065707_109609531 95
217 3300005327 Ga0070658_10115420 Ga0070658_101154203 95
218 3300005327 Ga0070658_10752795 Ga0070658_107527951 95
219 3300005328 Ga0070676_10512517 Ga0070676_105125171 95
220 3300005329 Ga0070683_102147433 Ga0070683_1021474331 95
221 3300005330 Ga0070690_100003263 Ga0070690_1000032637 95
222 3300005335 Ga0070666_10023056 Ga0070666_100230564 95
223 3300005335 Ga0070666_11396513 Ga0070666_113965131 95
224 3300005337 Ga0070682_101765492 Ga0070682_1017654921 95
225 3300005338 Ga0068868_100227923 Ga0068868_1002279233 95
226 3300005338 Ga0068868_100909395 Ga0068868_1009093952 95
227 3300005338 Ga0068868_101274129 Ga0068868_1012741291 95
228 3300005338 Ga0068868_102027746 Ga0068868_1020277461 95
229 3300005338 Ga0068868_102045725 Ga0068868_1020457251 95
230 3300005340 Ga0070689_100033442 Ga0070689_1000334426 95
231 3300005340 Ga0070689_100154286 Ga0070689_1001542861 95
232 3300005340 Ga0070689_100419056 Ga0070689_1004190562 95
233 3300005340 Ga0070689_100551740 Ga0070689_1005517402 95
234 3300005340 Ga0070689_100600468 Ga0070689_1006004682 95
235 3300005340 Ga0070689_101357451 Ga0070689_1013574512 95
236 3300005340 Ga0070689_101514758 Ga0070689_1015147582 95
237 3300005340 Ga0070689_102205501 Ga0070689_1022055011 95
238 3300005341 Ga0070691_10051968 Ga0070691_100519683 95
239 3300005343 Ga0070687_100676205 Ga0070687_1006762051 95
240 3300005343 Ga0070687_101012636 Ga0070687_1010126362 95
241 3300005345 Ga0070692_11046091 Ga0070692_110460912 95
242 3300005347 Ga0070668_100903747 Ga0070668_1009037471 95
243 3300005347 Ga0070668_102038237 Ga0070668_1020382371 95
244 3300005354 Ga0070675_100645041 Ga0070675_1006450411 95
245 3300005354 Ga0070675_101299864 Ga0070675_1012998642 95
246 3300005355 Ga0070671_100699642 Ga0070671_1006996422 95
247 3300005356 Ga0070674_100784802 Ga0070674_1007848022 95
248 3300005364 Ga0070673_100539919 Ga0070673_1005399192 95
249 3300005364 Ga0070673_102404849 Ga0070673_1024048491 95
250 3300005365 Ga0070688_100026549 Ga0070688_1000265494 95
251 3300005365 Ga0070688_100123717 Ga0070688_1001237173 95
252 3300005365 Ga0070688_100429879 Ga0070688_1004298791 95
253 3300005365 Ga0070688_100430454 Ga0070688_1004304541 95
254 3300005365 Ga0070688_101217340 Ga0070688_1012173402 95
255 3300005435 Ga0070714_100027149 Ga0070714_1000271492 95
256 3300005435 Ga0070714_102475879 Ga0070714_1024758791 95
257 3300005436 Ga0070713_100983192 Ga0070713_1009831922 95
258 3300005437 Ga0070710_11466846 Ga0070710_114668461 95
259 3300005438 Ga0070701_11095667 Ga0070701_110956671 95
260 3300005439 Ga0070711_100301601 Ga0070711_1003016012 95
261 3300005439 Ga0070711_100877092 Ga0070711_1008770922 95
262 3300005440 Ga0070705_101452877 Ga0070705_1014528771 95
263 3300005441 Ga0070700_100681657 Ga0070700_1006816572 95
264 3300005444 Ga0070694_100734133 Ga0070694_1007341332 95
265 3300005456 Ga0070678_101256202 Ga0070678_1012562021 95
266 3300005457 Ga0070662_101742423 Ga0070662_1017424232 95
267 3300005458 Ga0070681_10077982 Ga0070681_100779823 95
268 3300005458 Ga0070681_10353516 Ga0070681_103535163 95
269 3300005466 Ga0070685_10400759 Ga0070685_104007592 95
270 3300005466 Ga0070685_10702480 Ga0070685_107024802 95
271 3300005466 Ga0070685_11217580 Ga0070685_112175801 95
272 3300005530 Ga0070679_100400227 Ga0070679_1004002272 95
273 3300005530 Ga0070679_100609689 Ga0070679_1006096891 95
274 3300005530 Ga0070679_101079731 Ga0070679_1010797312 95
275 3300005535 Ga0070684_101576845 Ga0070684_1015768451 95
276 3300005543 Ga0070672_100747958 Ga0070672_1007479582 95
277 3300005544 Ga0070686_100147887 Ga0070686_1001478873 95
278 3300005544 Ga0070686_100329480 Ga0070686_1003294802 95
279 3300005544 Ga0070686_100564458 Ga0070686_1005644582 95
280 3300005544 Ga0070686_101658085 Ga0070686_1016580851 95
281 3300005544 Ga0070686_101689201 Ga0070686_1016892011 95
282 3300005545 Ga0070695_100537720 Ga0070695_1005377202 95
283 3300005545 Ga0070695_101435200 Ga0070695_1014352001 95
284 3300005549 Ga0070704_101185687 Ga0070704_1011856871 95
285 3300005563 Ga0068855_100181145 Ga0068855_1001811454 95
286 3300005563 Ga0068855_100744440 Ga0068855_1007444402 95
287 3300005563 Ga0068855_101143852 Ga0068855_1011438522 95
288 3300005563 Ga0068855_101379109 Ga0068855_1013791092 95
289 3300005614 Ga0068856_100014899 Ga0068856_1000148998 95
290 3300005614 Ga0068856_101042129 Ga0068856_1010421292 95
291 3300005614 Ga0068856_102176829 Ga0068856_1021768291 95
292 3300005616 Ga0068852_101381641 Ga0068852_1013816412 95
293 3300005616 Ga0068852_101417753 Ga0068852_1014177532 95
294 3300005617 Ga0068859_101814311 Ga0068859_1018143112 95
295 3300005617 Ga0068859_101979183 Ga0068859_1019791832 95
296 3300005617 Ga0068859_102969123 Ga0068859_1029691231 95
297 3300005618 Ga0068864_100263320 Ga0068864_1002633203 95
298 3300005618 Ga0068864_100536056 Ga0068864_1005360563 95
299 3300005618 Ga0068864_101718194 Ga0068864_1017181942 95
300 3300005618 Ga0068864_101883077 Ga0068864_1018830772 95
301 3300005618 Ga0068864_102497305 Ga0068864_1024973051 95
302 3300005719 Ga0068861_100608686 Ga0068861_1006086862 95
303 3300005834 Ga0068851_10863407 Ga0068851_108634071 95
304 3300005841 Ga0068863_100184044 Ga0068863_1001840441 95
305 3300005841 Ga0068863_100330546 Ga0068863_1003305462 95
306 3300005841 Ga0068863_100930784 Ga0068863_1009307843 95
307 3300005842 Ga0068858_100521382 Ga0068858_1005213822 95
308 3300005842 Ga0068858_100801023 Ga0068858_1008010232 95
309 3300005843 Ga0068860_102225373 Ga0068860_1022253731 95
310 3300005843 Ga0068860_102450039 Ga0068860_1024500391 95
311 3300006028 Ga0070717_11048036 Ga0070717_110480363 95
312 3300006028 Ga0070717_12156785 Ga0070717_121567851 95
313 3300006163 Ga0070715_10125489 Ga0070715_101254893 95
314 3300006173 Ga0070716_100870238 Ga0070716_1008702382 95
315 3300006175 Ga0070712_101124922 Ga0070712_1011249221 95
316 3300006237 Ga0097621_100292419 Ga0097621_1002924192 95
317 3300006237 Ga0097621_100433305 Ga0097621_1004333053 95
318 3300006237 Ga0097621_100732623 Ga0097621_1007326232 95
319 3300006358 Ga0068871_100156929 Ga0068871_1001569292 95
320 3300006358 Ga0068871_101265849 Ga0068871_1012658492 95
321 3300006358 Ga0068871_101427936 Ga0068871_1014279361 95
322 3300006880 Ga0075429_101378833 Ga0075429_1013788332 95
323 3300006881 Ga0068865_100409838 Ga0068865_1004098381 95
324 3300006881 Ga0068865_100895359 Ga0068865_1008953591 95
325 3300006914 Ga0075436_100267045 Ga0075436_1002670451 95
326 3300006931 Ga0097620_101814385 Ga0097620_1018143852 95
327 3300006931 Ga0097620_101980092 Ga0097620_1019800922 95
328 3300006931 Ga0097620_102071774 Ga0097620_1020717741 95
329 3300006931 Ga0097620_102968778 Ga0097620_1029687781 95
330 3300007076 Ga0075435_100849743 Ga0075435_1008497431 95
331 3300007265 Ga0099794_10483699 Ga0099794_104836991 95
332 3300007265 Ga0099794_10790363 Ga0099794_107903631 95
333 3300009093 Ga0105240_10047636 Ga0105240_100476363 95
334 3300009093 Ga0105240_10101978 Ga0105240_101019783 95
335 3300009093 Ga0105240_10115127 Ga0105240_101151274 95
336 3300009093 Ga0105240_10400180 Ga0105240_104001803 95
337 3300009093 Ga0105240_10580433 Ga0105240_105804333 95
338 3300009093 Ga0105240_10621951 Ga0105240_106219512 95
339 3300009093 Ga0105240_10849605 Ga0105240_108496051 95
340 3300009093 Ga0105240_11761039 Ga0105240_117610391 95
341 3300009094 Ga0111539_10167114 Ga0111539_101671144 95
342 3300009094 Ga0111539_10335934 Ga0111539_103359343 95
343 3300009094 Ga0111539_10851883 Ga0111539_108518832 95
344 3300009094 Ga0111539_11948797 Ga0111539_119487971 95
345 3300009094 Ga0111539_13450423 Ga0111539_134504231 95
346 3300009094 Ga0111539_13458249 Ga0111539_134582491 95
347 3300009098 Ga0105245_10049590 Ga0105245_100495903 95
348 3300009098 Ga0105245_11209051 Ga0105245_112090512 95
349 3300009098 Ga0105245_11421986 Ga0105245_114219861 95
350 3300009098 Ga0105245_11435230 Ga0105245_114352302 95
351 3300009147 Ga0114129_12524696 Ga0114129_125246962 95
352 3300009174 Ga0105241_10511930 Ga0105241_105119303 95
353 3300009174 Ga0105241_12430360 Ga0105241_124303602 95
354 3300009176 Ga0105242_10131680 Ga0105242_101316803 95
355 3300009176 Ga0105242_10507128 Ga0105242_105071282 95
356 3300009176 Ga0105242_10699561 Ga0105242_106995612 95
357 3300009176 Ga0105242_10818974 Ga0105242_108189742 95
358 3300009176 Ga0105242_10883112 Ga0105242_108831121 95
359 3300009176 Ga0105242_11369051 Ga0105242_113690511 95
360 3300009176 Ga0105242_11752773 Ga0105242_117527732 95
361 3300009176 Ga0105242_11816017 Ga0105242_118160172 95
362 3300009176 Ga0105242_11924984 Ga0105242_119249842 95
363 3300009176 Ga0105242_12311854 Ga0105242_123118542 95
364 3300009177 Ga0105248_10635178 Ga0105248_106351782 95
365 3300009177 Ga0105248_10731508 Ga0105248_107315082 95
366 3300009177 Ga0105248_10959587 Ga0105248_109595871 95
367 3300009177 Ga0105248_11309040 Ga0105248_113090401 95
368 3300009177 Ga0105248_12064307 Ga0105248_120643071 95
369 3300009177 Ga0105248_12129477 Ga0105248_121294771 95
370 3300009177 Ga0105248_12561578 Ga0105248_125615781 95
371 3300009545 Ga0105237_10392932 Ga0105237_103929322 95
372 3300009545 Ga0105237_12333514 Ga0105237_123335141 95
373 3300009545 Ga0105237_12717901 Ga0105237_127179011 95
374 3300009551 Ga0105238_10022647 Ga0105238_100226475 95
375 3300009551 Ga0105238_10887867 Ga0105238_108878671 95
376 3300009551 Ga0105238_11084935 Ga0105238_110849353 95
377 3300009551 Ga0105238_11142550 Ga0105238_111425502 95
378 3300009551 Ga0105238_11724171 Ga0105238_117241711 95
379 3300010375 Ga0105239_11001280 Ga0105239_110012803 95
380 3300010375 Ga0105239_12786808 Ga0105239_127868081 95
381 3300011119 Ga0105246_12236546 Ga0105246_122365462 95
382 3300013100 Ga0157373_10586839 Ga0157373_105868392 95
383 3300013102 Ga0157371_10065497 Ga0157371_100654972 95
384 3300013102 Ga0157371_10235223 Ga0157371_102352232 95
385 3300013102 Ga0157371_10765815 Ga0157371_107658151 95
386 3300013104 Ga0157370_10144589 Ga0157370_101445893 95
387 3300013104 Ga0157370_10314144 Ga0157370_103141442 95
388 3300013104 Ga0157370_10761743 Ga0157370_107617432 95
389 3300013104 Ga0157370_11009644 Ga0157370_110096441 95
390 3300013105 Ga0157369_10542131 Ga0157369_105421311 95
391 3300013296 Ga0157374_10107389 Ga0157374_101073893 95
392 3300013296 Ga0157374_10208020 Ga0157374_102080202 95
393 3300013296 Ga0157374_10447167 Ga0157374_104471672 95
394 3300013296 Ga0157374_10571514 Ga0157374_105715141 95
395 3300013296 Ga0157374_10728890 Ga0157374_107288902 95
396 3300013296 Ga0157374_10737617 Ga0157374_107376172 95
397 3300013296 Ga0157374_11184252 Ga0157374_111842522 95
398 3300013296 Ga0157374_11218483 Ga0157374_112184831 95
399 3300013296 Ga0157374_11330199 Ga0157374_113301991 95
400 3300013296 Ga0157374_11406898 Ga0157374_114068981 95
401 3300013296 Ga0157374_11409521 Ga0157374_114095211 95
402 3300013296 Ga0157374_11428382 Ga0157374_114283821 95
403 3300013296 Ga0157374_11938459 Ga0157374_119384591 95
404 3300013296 Ga0157374_12793490 Ga0157374_127934901 95
405 3300013297 Ga0157378_10056872 Ga0157378_100568722 95
406 3300013297 Ga0157378_10181313 Ga0157378_101813132 95
407 3300013297 Ga0157378_10306542 Ga0157378_103065422 95
408 3300013297 Ga0157378_10643909 Ga0157378_106439092 95
409 3300013297 Ga0157378_10747003 Ga0157378_107470033 95
410 3300013297 Ga0157378_11008144 Ga0157378_110081442 95
411 3300013297 Ga0157378_11217837 Ga0157378_112178371 95
412 3300013297 Ga0157378_11294325 Ga0157378_112943251 95
413 3300013297 Ga0157378_11850699 Ga0157378_118506992 95
414 3300013306 Ga0163162_10491251 Ga0163162_104912513 95
415 3300013306 Ga0163162_10540438 Ga0163162_105404382 95
416 3300013306 Ga0163162_10624645 Ga0163162_106246453 95
417 3300013306 Ga0163162_10680048 Ga0163162_106800483 95
418 3300013306 Ga0163162_10726472 Ga0163162_107264722 95
419 3300013306 Ga0163162_10762069 Ga0163162_107620692 95
420 3300013307 Ga0157372_10685509 Ga0157372_106855093 95
421 3300013307 Ga0157372_11407872 Ga0157372_114078721 95
422 3300013307 Ga0157372_11843926 Ga0157372_118439262 95
423 3300013307 Ga0157372_12311415 Ga0157372_123114152 95
424 3300013308 Ga0157375_10000193 Ga0157375_1000019334 95
425 3300013308 Ga0157375_11534848 Ga0157375_115348482 95
426 3300013308 Ga0157375_11602033 Ga0157375_116020331 95
427 3300013308 Ga0157375_13220750 Ga0157375_132207501 95
428 3300014325 Ga0163163_10000067 Ga0163163_1000006715 95
429 3300014325 Ga0163163_10134572 Ga0163163_101345722 95
430 3300014325 Ga0163163_10338153 Ga0163163_103381532 95
431 3300014325 Ga0163163_12514715 Ga0163163_125147152 95
432 3300014326 Ga0157380_10231426 Ga0157380_102314261 95
433 3300014326 Ga0157380_12606286 Ga0157380_126062862 95
434 3300014745 Ga0157377_11269281 Ga0157377_112692811 95
435 3300014968 Ga0157379_10903119 Ga0157379_109031191 95
436 3300014968 Ga0157379_10943511 Ga0157379_109435111 95
437 3300014968 Ga0157379_10972997 Ga0157379_109729972 95
438 3300014968 Ga0157379_11013697 Ga0157379_110136971 95
439 3300014969 Ga0157376_10263247 Ga0157376_102632472 95
440 3300014969 Ga0157376_10453044 Ga0157376_104530441 95
441 3300014969 Ga0157376_10961254 Ga0157376_109612542 95
442 3300014969 Ga0157376_11109156 Ga0157376_111091562 95
443 3300014969 Ga0157376_11572957 Ga0157376_115729572 95
444 3300014969 Ga0157376_11785274 Ga0157376_117852742 95
445 3300014969 Ga0157376_12467429 Ga0157376_124674291 95
446 3300017792 Ga0163161_10520740 Ga0163161_105207402 95
447 3300017792 Ga0163161_10880384 Ga0163161_108803842 95
448 3300020069 Ga0197907_10093562 Ga0197907_100935621 95
449 3300020069 Ga0197907_10678080 Ga0197907_106780802 95
450 3300020069 Ga0197907_11318956 Ga0197907_113189561 95
451 3300020069 Ga0197907_11380623 Ga0197907_113806233 95
452 3300020069 Ga0197907_11490927 Ga0197907_114909271 95
453 3300020070 Ga0206356_10271924 Ga0206356_102719241 95
454 3300020070 Ga0206356_11175132 Ga0206356_111751321 95
455 3300020076 Ga0206355_1170980 Ga0206355_11709801 95
456 3300020078 Ga0206352_10327707 Ga0206352_103277072 95
457 3300020078 Ga0206352_10694369 Ga0206352_106943691 95
458 3300020078 Ga0206352_11021632 Ga0206352_110216321 95
459 3300020078 Ga0206352_11302396 Ga0206352_113023961 95
460 3300020078 Ga0206352_11361878 Ga0206352_113618781 95
461 3300020080 Ga0206350_10848227 Ga0206350_108482272 95
462 3300020080 Ga0206350_11044168 Ga0206350_110441681 95
463 3300020080 Ga0206350_11356146 Ga0206350_113561462 95
464 3300020081 Ga0206354_11266248 Ga0206354_112662482 95
465 3300020082 Ga0206353_10136047 Ga0206353_101360472 95
466 3300022467 Ga0224712_10014740 Ga0224712_100147401 95
467 3300025905 Ga0207685_10693173 Ga0207685_106931731 95
468 3300025907 Ga0207645_10718064 Ga0207645_107180641 95
469 3300025909 Ga0207705_10097830 Ga0207705_100978302 95
470 3300025909 Ga0207705_11323714 Ga0207705_113237142 95
471 3300025911 Ga0207654_10837903 Ga0207654_108379031 95
472 3300025912 Ga0207707_10093442 Ga0207707_100934423 95
473 3300025912 Ga0207707_10141503 Ga0207707_101415034 95
474 3300025913 Ga0207695_10042188 Ga0207695_100421883 95
475 3300025913 Ga0207695_10104842 Ga0207695_101048422 95
476 3300025913 Ga0207695_10152455 Ga0207695_101524554 95
477 3300025913 Ga0207695_10246758 Ga0207695_102467582 95
478 3300025913 Ga0207695_10253930 Ga0207695_102539303 95
479 3300025913 Ga0207695_10680131 Ga0207695_106801311 95
480 3300025915 Ga0207693_10601293 Ga0207693_106012931 95
481 3300025915 Ga0207693_10929201 Ga0207693_109292011 95
482 3300025916 Ga0207663_10018773 Ga0207663_100187732 95
483 3300025916 Ga0207663_10690452 Ga0207663_106904522 95
484 3300025916 Ga0207663_10719843 Ga0207663_107198431 95
485 3300025918 Ga0207662_10419697 Ga0207662_104196972 95
486 3300025921 Ga0207652_10677121 Ga0207652_106771211 95
487 3300025921 Ga0207652_10794443 Ga0207652_107944431 95
488 3300025921 Ga0207652_11647774 Ga0207652_116477741 95
489 3300025924 Ga0207694_10010783 Ga0207694_100107834 95
490 3300025924 Ga0207694_10712285 Ga0207694_107122852 95
491 3300025926 Ga0207659_10910642 Ga0207659_109106421 95
492 3300025929 Ga0207664_10022118 Ga0207664_100221182 95
493 3300025929 Ga0207664_10586981 Ga0207664_105869813 95
494 3300025931 Ga0207644_11447238 Ga0207644_114472382 95
495 3300025933 Ga0207706_10782871 Ga0207706_107828711 95
496 3300025934 Ga0207686_10517279 Ga0207686_105172791 95
497 3300025934 Ga0207686_10863602 Ga0207686_108636021 95
498 3300025934 Ga0207686_10982166 Ga0207686_109821662 95
499 3300025936 Ga0207670_10016966 Ga0207670_100169667 95
500 3300025936 Ga0207670_10180763 Ga0207670_101807632 95
501 3300025936 Ga0207670_10333131 Ga0207670_103331312 95
502 3300025936 Ga0207670_10352704 Ga0207670_103527042 95
503 3300025936 Ga0207670_10990097 Ga0207670_109900971 95
504 3300025938 Ga0207704_10420236 Ga0207704_104202362 95
505 3300025939 Ga0207665_10440124 Ga0207665_104401242 95
506 3300025941 Ga0207711_10405246 Ga0207711_104052462 95
507 3300025941 Ga0207711_10688860 Ga0207711_106888601 95
508 3300025941 Ga0207711_11484938 Ga0207711_114849382 95
509 3300025941 Ga0207711_11760788 Ga0207711_117607882 95
510 3300025949 Ga0207667_10063721 Ga0207667_100637213 95
511 3300025949 Ga0207667_10141077 Ga0207667_101410774 95
512 3300025949 Ga0207667_10397425 Ga0207667_103974253 95
513 3300025949 Ga0207667_11606036 Ga0207667_116060361 95
514 3300025960 Ga0207651_10427834 Ga0207651_104278342 95
515 3300025961 Ga0207712_10577605 Ga0207712_105776052 95
516 3300026035 Ga0207703_10872680 Ga0207703_108726802 95
517 3300026035 Ga0207703_11381294 Ga0207703_113812942 95
518 3300026035 Ga0207703_11958267 Ga0207703_119582671 95
519 3300026078 Ga0207702_10015367 Ga0207702_100153672 95
520 3300026088 Ga0207641_10073907 Ga0207641_100739074 95
521 3300026088 Ga0207641_10295308 Ga0207641_102953081 95
522 3300026088 Ga0207641_10608064 Ga0207641_106080641 95
523 3300026088 Ga0207641_10633890 Ga0207641_106338903 95
524 3300026088 Ga0207641_10841785 Ga0207641_108417851 95
525 3300026089 Ga0207648_10723017 Ga0207648_107230173 95
526 3300026095 Ga0207676_10446444 Ga0207676_104464442 95
527 3300026095 Ga0207676_11481873 Ga0207676_114818732 95
528 3300026116 Ga0207674_10561603 Ga0207674_105616032 95
529 3300026142 Ga0207698_11448018 Ga0207698_114480182 95
530 3300026142 Ga0207698_12685197 Ga0207698_126851971 95
531 3300027907 Ga0207428_10591147 Ga0207428_105911471 95
532 3300027907 Ga0207428_10907620 Ga0207428_109076201 95
533 3300028380 Ga0268265_11005754 Ga0268265_110057542 95
534 3300028381 Ga0268264_10758800 Ga0268264_107588003 95
535 3300028556 Ga0265337_1001383 Ga0265337_10013834 95
536 3300028556 Ga0265337_1006315 Ga0265337_10063154 95
537 3300028556 Ga0265337_1052382 Ga0265337_10523822 95
538 3300028556 Ga0265337_1143152 Ga0265337_11431521 95
539 3300028556 Ga0265337_1171205 Ga0265337_11712051 95
540 3300028558 Ga0265326_10009649 Ga0265326_100096493 95
541 3300028558 Ga0265326_10075678 Ga0265326_100756781 95
542 3300028558 Ga0265326_10089624 Ga0265326_100896243 95
543 3300028563 Ga0265319_1000181 Ga0265319_100018134 95
544 3300028563 Ga0265319_1015277 Ga0265319_10152773 95
545 3300028563 Ga0265319_1149123 Ga0265319_11491232 95
546 3300028563 Ga0265319_1204408 Ga0265319_12044082 95
547 3300028573 Ga0265334_10006539 Ga0265334_100065396 95
548 3300028573 Ga0265334_10015224 Ga0265334_100152242 95
549 3300028573 Ga0265334_10051809 Ga0265334_100518092 95
550 3300028573 Ga0265334_10297102 Ga0265334_102971022 95
551 3300028573 Ga0265334_10303957 Ga0265334_103039571 95
552 3300028577 Ga0265318_10137394 Ga0265318_101373942 95
553 3300028653 Ga0265323_10000052 Ga0265323_100000525 95
554 3300028653 Ga0265323_10013603 Ga0265323_100136033 95
555 3300028653 Ga0265323_10213367 Ga0265323_102133672 95
556 3300028654 Ga0265322_10183055 Ga0265322_101830552 95
557 3300028654 Ga0265322_10240408 Ga0265322_102404081 95
558 3300028666 Ga0265336_10001439 Ga0265336_100014396 95
559 3300028666 Ga0265336_10039863 Ga0265336_100398632 95
560 3300028666 Ga0265336_10183919 Ga0265336_101839192 95
561 3300028800 Ga0265338_10000338 Ga0265338_100003386 95
562 3300028800 Ga0265338_10000702 Ga0265338_1000070245 95
563 3300028800 Ga0265338_10001650 Ga0265338_1000165010 95
564 3300028800 Ga0265338_10003512 Ga0265338_100035126 95
565 3300028800 Ga0265338_10004217 Ga0265338_100042172 95
566 3300028800 Ga0265338_10005093 Ga0265338_100050938 95
567 3300028800 Ga0265338_10007121 Ga0265338_100071214 95
568 3300028800 Ga0265338_10008472 Ga0265338_100084725 95
569 3300028800 Ga0265338_10010207 Ga0265338_1001020711 95
570 3300028800 Ga0265338_10010911 Ga0265338_100109117 95
571 3300028800 Ga0265338_10019439 Ga0265338_100194392 95
572 3300028800 Ga0265338_10032343 Ga0265338_100323435 95
573 3300028800 Ga0265338_10037899 Ga0265338_100378993 95
574 3300028800 Ga0265338_10117457 Ga0265338_101174572 95
575 3300028800 Ga0265338_10125810 Ga0265338_101258104 95
576 3300028800 Ga0265338_10182385 Ga0265338_101823852 95
577 3300028800 Ga0265338_10210658 Ga0265338_102106583 95
578 3300028800 Ga0265338_10316521 Ga0265338_103165211 95
579 3300028800 Ga0265338_10342561 Ga0265338_103425611 95
580 3300028800 Ga0265338_10371018 Ga0265338_103710182 95
581 3300028800 Ga0265338_10585774 Ga0265338_105857742 95
582 3300028800 Ga0265338_11110602 Ga0265338_111106021 95
583 3300029957 Ga0265324_10023976 Ga0265324_100239762 95
584 3300029957 Ga0265324_10041314 Ga0265324_100413142 95
585 3300029957 Ga0265324_10062512 Ga0265324_100625122 95
586 3300029957 Ga0265324_10079037 Ga0265324_100790373 95
587 3300029957 Ga0265324_10153587 Ga0265324_101535871 95
588 3300031235 Ga0265330_10408638 Ga0265330_104086382 95
589 3300031238 Ga0265332_10326449 Ga0265332_103264492 95
590 3300031240 Ga0265320_10001101 Ga0265320_100011013 95
591 3300031240 Ga0265320_10004269 Ga0265320_100042693 95
592 3300031240 Ga0265320_10034090 Ga0265320_100340902 95
593 3300031240 Ga0265320_10049012 Ga0265320_100490124 95
594 3300031240 Ga0265320_10069884 Ga0265320_100698842 95
595 3300031240 Ga0265320_10089976 Ga0265320_100899762 95
596 3300031240 Ga0265320_10169678 Ga0265320_101696783 95
597 3300031240 Ga0265320_10187693 Ga0265320_101876932 95
598 3300031240 Ga0265320_10194022 Ga0265320_101940221 95
599 3300031240 Ga0265320_10531722 Ga0265320_105317221 95
600 3300031241 Ga0265325_10144680 Ga0265325_101446801 95
601 3300031241 Ga0265325_10198542 Ga0265325_101985421 95
602 3300031242 Ga0265329_10060872 Ga0265329_100608721 95
603 3300031242 Ga0265329_10172257 Ga0265329_101722572 95
604 3300031247 Ga0265340_10001821 Ga0265340_100018216 95
605 3300031247 Ga0265340_10008513 Ga0265340_100085136 95
606 3300031247 Ga0265340_10041784 Ga0265340_100417842 95
607 3300031247 Ga0265340_10098528 Ga0265340_100985283 95
608 3300031247 Ga0265340_10249798 Ga0265340_102497982 95
609 3300031247 Ga0265340_10445668 Ga0265340_104456682 95
610 3300031247 Ga0265340_10455733 Ga0265340_104557331 95
611 3300031249 Ga0265339_10047272 Ga0265339_100472723 95
612 3300031249 Ga0265339_10081811 Ga0265339_100818111 95
613 3300031249 Ga0265339_10376364 Ga0265339_103763642 95
614 3300031251 Ga0265327_10001304 Ga0265327_100013048 95
615 3300031344 Ga0265316_10019145 Ga0265316_100191458 95
616 3300031344 Ga0265316_10054200 Ga0265316_100542005 95
617 3300031344 Ga0265316_10081759 Ga0265316_100817593 95
618 3300031344 Ga0265316_10109663 Ga0265316_101096632 95
619 3300031344 Ga0265316_10110646 Ga0265316_101106461 95
620 3300031344 Ga0265316_10539635 Ga0265316_105396352 95
621 3300031344 Ga0265316_10683884 Ga0265316_106838842 95
622 3300031344 Ga0265316_10929551 Ga0265316_109295512 95
623 3300031344 Ga0265316_11041543 Ga0265316_110415431 95
624 3300031595 Ga0265313_10025647 Ga0265313_100256472 95
625 3300031595 Ga0265313_10045617 Ga0265313_100456173 95
626 3300031595 Ga0265313_10110582 Ga0265313_101105823 95
627 3300031595 Ga0265313_10346521 Ga0265313_103465211 95
628 3300031711 Ga0265314_10022822 Ga0265314_100228225 95
629 3300031711 Ga0265314_10184840 Ga0265314_101848403 95
630 3300031712 Ga0265342_10114022 Ga0265342_101140223 95
631 3300031712 Ga0265342_10210320 Ga0265342_102103202 95
632 3300031712 Ga0265342_10522955 Ga0265342_105229552 95
633 3300031712 Ga0265342_10649859 Ga0265342_106498591 95
634 3300035083 Ga0373926_0227530 Ga0373926_0227530_225_512 95
635 3300035111 Ga0373923_0106057 Ga0373923_0106057_431_718 95
636 3300035113 Ga0373936_0133561 Ga0373936_0133561_736_1023 95
637 3300035116 Ga0373945_0130270 Ga0373945_0130270_289_576 95
638 3300035116 Ga0373945_0205207 Ga0373945_0205207_72_359 95
639 3300035117 Ga0373953_0044513 Ga0373953_0044513_1018_1314 95
640 3300035117 Ga0373953_0441775 Ga0373953_0441775_140_427 95
641 3300035118 Ga0373954_0004196 Ga0373954_0004196_1990_2286 95
642 3300035118 Ga0373954_0033971 Ga0373954_0033971_1098_1385 95
643 3300035119 Ga0373956_0013538 Ga0373956_0013538_152_448 95
644 3300035119 Ga0373956_0038253 Ga0373956_0038253_417_704 95
645 3300035119 Ga0373956_0635901 Ga0373956_0635901_76_363 95
646 3300035170 Ga0373943_0459057 Ga0373943_0459057_371_658 95
647 3300035171 Ga0373946_0063792 Ga0373946_0063792_828_1115 95
648 3300035172 Ga0373955_0128784 Ga0373955_0128784_1052_1348 95
649 3300035172 Ga0373955_0232990 Ga0373955_0232990_764_1051 95
650 3300035172 Ga0373955_0591537 Ga0373955_0591537_132_428 95
651 3300035691 Ga0373931_0307092 Ga0373931_0307092_310_597 95
652 3300035692 Ga0373935_0013383 Ga0373935_0013383_4413_4700 95
653 3300035692 Ga0373935_1099004 Ga0373935_1099004_227_514 95
654 3300035695 Ga0373927_0067607 Ga0373927_0067607_1367_1654 95
655 3300035695 Ga0373927_0279688 Ga0373927_0279688_264_551 95
656 3300035695 Ga0373927_0579089 Ga0373927_0579089_51_338 95
657 3300035725 Ga0373947_0203163 Ga0373947_0203163_295_582 95
658 3300035725 Ga0373947_0263440 Ga0373947_0263440_310_597 95
659 3300035725 Ga0373947_0483342 Ga0373947_0483342_156_443 95
660 3300036401 Ga0373937_0002559 Ga0373937_0002559_7361_7657 95
661 3300036401 Ga0373937_0219435 Ga0373937_0219435_1224_1511 95
662 3300036401 Ga0373937_0677862 Ga0373937_0677862_154_441 95
663 3300036401 Ga0373937_0682099 Ga0373937_0682099_602_889 95
664 3300036401 Ga0373937_1195331 Ga0373937_1195331_351_638 95
665 3300036647 Ga0316582_0493026 Ga0316582_0493026_510_797 95
666 3300039450 Ga0436363_0725337 Ga0436363_0725337_211_498 95
667 3300041452 Ga0451793_0122907 Ga0451793_0122907_111_398 95
668 3300041486 Ga0451807_0872394 Ga0451807_0872394_22_309 95
669 3300041491 Ga0451833_0913063 Ga0451833_0913063_264_554 95
670 3300042876 Ga0451577_0001767 Ga0451577_0001767_15985_16272 95
671 3300042876 Ga0451577_0005602 Ga0451577_0005602_9603_9890 95
672 3300042876 Ga0451577_0161865 Ga0451577_0161865_918_1205 95
673 3300044673 Ga0453683_0737386 Ga0453683_0737386_44_331 95
674 3300044712 Ga0453684_0000238 Ga0453684_0000238_109614_109901 95
675 3300044712 Ga0453684_0002796 Ga0453684_0002796_31702_31989 95
676 3300044712 Ga0453684_0040224 Ga0453684_0040224_5011_5298 95
677 3300044712 Ga0453684_0851306 Ga0453684_0851306_138_428 95
678 3300044712 Ga0453684_1576212 Ga0453684_1576212_226_513 95
679 3300044712 Ga0453684_2399320 Ga0453684_2399320_96_383 95
680 3300045051 Ga0451576_0061426 Ga0451576_0061426_3122_3409 95
681 3300045051 Ga0451576_0160484 Ga0451576_0160484_300_590 95
682 3300045051 Ga0451576_0227091 Ga0451576_0227091_774_1061 95
683 3300045051 Ga0451576_0234148 Ga0451576_0234148_1192_1479 95
684 3300045051 Ga0451576_0268955 Ga0451576_0268955_403_690 95
685 3300045051 Ga0451576_0510580 Ga0451576_0510580_261_548 95
686 3300045051 Ga0451576_0548984 Ga0451576_0548984_730_1017 95
687 3300045051 Ga0451576_0767631 Ga0451576_0767631_272_559 95
688 3300045051 Ga0451576_0831077 Ga0451576_0831077_544_831 95
689 3300045051 Ga0451576_0883735 Ga0451576_0883735_558_845 95
690 3300045051 Ga0451576_1197883 Ga0451576_1197883_35_322 95
691 3300045051 Ga0451576_1336329 Ga0451576_1336329_225_512 95
692 3300045051 Ga0451576_1350323 Ga0451576_1350323_320_607 95
693 3300045051 Ga0451576_1430121 Ga0451576_1430121_38_325 95
694 3300045051 Ga0451576_1692506 Ga0451576_1692506_348_644 95
695 3300046454 Ga0495592_0000027 Ga0495592_0000027_91428_91715 95
696 3300046459 Ga0495629_0032554 Ga0495629_0032554_3339_3635 95
697 3300046459 Ga0495629_0669747 Ga0495629_0669747_213_500 95
698 3300046462 Ga0495651_0517804 Ga0495651_0517804_381_668 95
699 3300046473 Ga0495582_0029874 Ga0495582_0029874_2481_2768 95
700 3300046476 Ga0495662_0033947 Ga0495662_0033947_189_476 95
701 3300046476 Ga0495662_0669998 Ga0495662_0669998_101_388 95
702 3300046477 Ga0495664_0065077 Ga0495664_0065077_752_1039 95
703 3300046499 Ga0495594_0319076 Ga0495594_0319076_430_717 95
704 3300046511 Ga0495608_0370576 Ga0495608_0370576_99_386 95
705 3300046514 Ga0495618_0000627 Ga0495618_0000627_5087_5383 95
706 3300046516 Ga0495628_0284490 Ga0495628_0284490_692_979 95
707 3300046516 Ga0495628_0630651 Ga0495628_0630651_156_452 95
708 3300046516 Ga0495628_0654555 Ga0495628_0654555_66_353 95
709 3300046517 Ga0495630_0000094 Ga0495630_0000094_3485_3772 95
710 3300046517 Ga0495630_0430978 Ga0495630_0430978_234_521 95
711 3300046517 Ga0495630_0473504 Ga0495630_0473504_592_879 95
712 3300046517 Ga0495630_0489449 Ga0495630_0489449_195_485 95
713 3300046517 Ga0495630_0564692 Ga0495630_0564692_235_531 95
714 3300046526 Ga0495666_0018485 Ga0495666_0018485_2478_2765 95
715 3300046526 Ga0495666_0284874 Ga0495666_0284874_244_531 95
716 3300046529 Ga0495652_0365927 Ga0495652_0365927_203_490 95
717 3300046531 Ga0495665_0328917 Ga0495665_0328917_403_690 95
718 3300046533 Ga0495640_0182592 Ga0495640_0182592_231_527 95
719 3300046533 Ga0495640_0203140 Ga0495640_0203140_79_366 95
720 3300046535 Ga0495586_0000110 Ga0495586_0000110_3278_3565 95
721 3300046535 Ga0495586_0000435 Ga0495586_0000435_14981_15277 95
722 3300046535 Ga0495586_0000958 Ga0495586_0000958_6766_7053 95
723 3300046535 Ga0495586_0553280 Ga0495586_0553280_197_484 95
724 3300046536 Ga0495587_0141923 Ga0495587_0141923_317_604 95
725 3300046536 Ga0495587_0380778 Ga0495587_0380778_269_556 95
726 3300046539 Ga0495621_0253232 Ga0495621_0253232_286_573 95
727 3300046543 Ga0495645_0019475 Ga0495645_0019475_1248_1535 95
728 3300046543 Ga0495645_0431152 Ga0495645_0431152_331_618 95
729 3300046543 Ga0495645_0507110 Ga0495645_0507110_204_491 95
730 3300046559 Ga0495667_0579554 Ga0495667_0579554_259_546 95
731 3300046559 Ga0495667_0769166 Ga0495667_0769166_167_454 95
732 3300046559 Ga0495667_0834387 Ga0495667_0834387_10_297 95
733 3300046642 Ga0495634_0009163 Ga0495634_0009163_4191_4487 95
734 3300046642 Ga0495634_0043769 Ga0495634_0043769_302_589 95
735 3300046642 Ga0495634_0293434 Ga0495634_0293434_419_706 95
736 3300046674 Ga0495588_0324818 Ga0495588_0324818_406_693 95
737 3300046675 Ga0495657_0733890 Ga0495657_0733890_83_370 95
738 3300046678 Ga0495599_0258696 Ga0495599_0258696_561_848 95
739 3300046678 Ga0495599_0520511 Ga0495599_0520511_65_352 95
740 3300046680 Ga0495646_0226172 Ga0495646_0226172_100_387 95
741 3300046681 Ga0495647_0388136 Ga0495647_0388136_284_571 95
742 3300046681 Ga0495647_0428119 Ga0495647_0428119_196_483 95
743 3300046683 Ga0495658_0421644 Ga0495658_0421644_363_650 95
744 3300046683 Ga0495658_0991879 Ga0495658_0991879_18_305 95
745 3300046684 Ga0495669_0104660 Ga0495669_0104660_686_973 95
746 3300046689 Ga0495613_0014339 Ga0495613_0014339_439_735 95
747 3300046689 Ga0495613_0264686 Ga0495613_0264686_858_1145 95
748 3300046689 Ga0495613_0476844 Ga0495613_0476844_50_337 95
749 3300046689 Ga0495613_1039756 Ga0495613_1039756_65_352 95
750 3300047317 Ga0495604_1035080 Ga0495604_1035080_50_337 95
751 3300047318 Ga0495636_0309781 Ga0495636_0309781_147_434 95
752 3300047319 Ga0495674_0038375 Ga0495674_0038375_2853_3140 95
753 3300047319 Ga0495674_0699378 Ga0495674_0699378_258_548 95
754 3300047321 Ga0495676_0105139 Ga0495676_0105139_1637_1924 95
755 3300047322 Ga0495680_0024214 Ga0495680_0024214_4592_4888 95
756 3300047471 Ga0495684_0054808 Ga0495684_0054808_2492_2779 95
757 3300047471 Ga0495684_0406021 Ga0495684_0406021_399_695 95
758 3300047471 Ga0495684_0667817 Ga0495684_0667817_54_341 95
759 3300048909 Ga0496106_0201388 Ga0496106_0201388_664_951 95
760 3300048910 Ga0496107_0181400 Ga0496107_0181400_387_674 95
761 3300048918 Ga0496115_0117239 Ga0496115_0117239_568_855 95
762 3300049571 Ga0501034_0558255 Ga0501034_0558255_234_521 95
763 3300049571 Ga0501034_1376486 Ga0501034_1376486_55_342 95
764 3300049572 Ga0501036_1361048 Ga0501036_1361048_150_437 95
765 3300049575 Ga0501039_0869117 Ga0501039_0869117_99_386 95
766 3300049686 Ga0501257_199329 Ga0501257_199329_31_321 95
767 3300049689 Ga0501260_055282 Ga0501260_055282_159_446 95
768 3300049772 Ga0501275_050451 Ga0501275_050451_13_303 95
769 3300050511 nmdc:mga08y16_644868_c1 nmdc:mga08y16_644868_c1_415_702 95
770 3300050511 nmdc:mga08y16_859334_c1 nmdc:mga08y16_859334_c1_195_482 95
771 3300050512 nmdc:mga0n895_1902941_c1 nmdc:mga0n895_1902941_c1_203_490 95
772 3300050514 nmdc:mga08x19_257704_c1 nmdc:mga08x19_257704_c1_731_1018 95
773 3300053077 Ga0495601_0273052 Ga0495601_0273052_75_362 95
774 3300053077 Ga0495601_0280829 Ga0495601_0280829_130_417 95
775 3300053098 Ga0500650_0267547 Ga0500650_0267547_420_707 95
776 3300053119 Ga0500595_153345 Ga0500595_153345_197_484 95
777 3300053153 Ga0500616_0118612 Ga0500616_0118612_33_320 95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vd7-assembly1.cif.gz_A toxin - antitoxin complex from salmonella enterica serovar typhimurium 0.7262 2 86
3ub1-assembly2.cif.gz_B ntf2 like protein involved in plasmid conjugation 0.7167 45 77
5g3l-assembly1.cif.gz_H escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar 0.6664 55 78
4ttz-assembly1.cif.gz_C n-terminal domain of c. reinhardtii sas-6 homolog bld12p variant g94e f145w q147k (nn26) 0.6637 34 79
7vd7-assembly1.cif.gz_A toxin - antitoxin complex from salmonella enterica serovar typhimurium 0.6593 2 86
ID Description Score Start End Superfamily
af_Q22071_294_406_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7959 45 74 2.40.128.630
af_Q8IDM8_1_363_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7465 42 77 2.130.10.10
af_P40395_458_862_2.130.10.110 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain 0.697 43 79 2.130.10.110
af_E9QFZ1_2430_2658_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6839 45 77 2.130.10.10
af_A0A0R4ICS1_30_455_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.6792 41 78 2.130.10.130
ID Description Score Start End GO Terms
AF-A0A538NX32-F1-model_v4 BrnT family toxin 0.8984 1 95
AF-A0A520QR87-F1-model_v4 BrnT family toxin 0.8976 1 93
AF-A0A3A4V243-F1-model_v4 BrnT family toxin 0.8829 12 87
AF-A0A832HW20-F1-model_v4 BrnT family toxin 0.8823 1 95
AF-A0A520QR87-F1-model_v4 BrnT family toxin 0.879 1 93

Feature Viewer

pLDDT pTM Quality
83.99 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map