F480362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 281 | 777 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_101427936|Ga0068871_1014279361 |
| Length | 100 |
| Sequence | MEFDWNNPPFNLDSSLTLQEIEESFEDPFAVRVLPDSPRFSVQARFFNLGMSAGGVGIFTVYRTNGKQIRIIYARPFEPEERFFYQRKVDQTLAVGERDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 264 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 266 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 277 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 280 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 3.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 98.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11510544 | 3300004799 | Unclassified | 537 |
| 2 | Ga0058860_12232918 | 3300004801 | Unclassified | 870 |
| 3 | Ga0058862_10971528 | 3300004803 | Bacteria | 543 |
| 4 | Ga0065707_10960953 | 3300005295 | Unclassified | 549 |
| 5 | Ga0070658_10115420 | 3300005327 | Bacteria | 2227 |
| 6 | Ga0070658_10682727 | 3300005327 | Bacteria | 891 |
| 7 | Ga0070658_10752795 | 3300005327 | Bacteria | 846 |
| 8 | Ga0070658_10808282 | 3300005327 | Bacteria | 815 |
| 9 | Ga0070658_11244481 | 3300005327 | Unclassified | 647 |
| 10 | Ga0070676_10512517 | 3300005328 | Unclassified | 853 |
| 11 | Ga0070683_102147433 | 3300005329 | Unclassified | 536 |
| 12 | Ga0070690_100003263 | 3300005330 | Bacteria | 8857 |
| 13 | Ga0068869_101458883 | 3300005334 | Unclassified | 607 |
| 14 | Ga0070666_10023056 | 3300005335 | Bacteria | 4048 |
| 15 | Ga0070666_11396513 | 3300005335 | Unclassified | 523 |
| 16 | Ga0070682_101765492 | 3300005337 | Unclassified | 539 |
| 17 | Ga0068868_100227923 | 3300005338 | Bacteria | 1562 |
| 18 | Ga0068868_100909395 | 3300005338 | Bacteria | 800 |
| 19 | Ga0068868_101274129 | 3300005338 | Bacteria | 682 |
| 20 | Ga0068868_102027746 | 3300005338 | Unclassified | 546 |
| 21 | Ga0068868_102045725 | 3300005338 | Unclassified | 544 |
| 22 | Ga0070689_100033442 | 3300005340 | Bacteria | 3918 |
| 23 | Ga0070689_100154286 | 3300005340 | Unclassified | 1853 |
| 24 | Ga0070689_100419056 | 3300005340 | Bacteria | 1134 |
| 25 | Ga0070689_100551740 | 3300005340 | Bacteria | 993 |
| 26 | Ga0070689_100600468 | 3300005340 | Unclassified | 953 |
| 27 | Ga0070689_100848526 | 3300005340 | Bacteria | 806 |
| 28 | Ga0070689_101357451 | 3300005340 | Unclassified | 641 |
| 29 | Ga0070689_101514758 | 3300005340 | Unclassified | 608 |
| 30 | Ga0070689_102205501 | 3300005340 | Unclassified | 505 |
| 31 | Ga0070691_10028998 | 3300005341 | Unclassified | 2588 |
| 32 | Ga0070691_10051968 | 3300005341 | Bacteria | 1959 |
| 33 | Ga0070687_100676205 | 3300005343 | Bacteria | 718 |
| 34 | Ga0070687_101012636 | 3300005343 | Unclassified | 603 |
| 35 | Ga0070692_11046091 | 3300005345 | Unclassified | 573 |
| 36 | Ga0070668_100903747 | 3300005347 | Bacteria | 789 |
| 37 | Ga0070668_102038237 | 3300005347 | Unclassified | 529 |
| 38 | Ga0070669_101440414 | 3300005353 | Bacteria | 598 |
| 39 | Ga0070675_100645041 | 3300005354 | Bacteria | 962 |
| 40 | Ga0070675_101299864 | 3300005354 | Unclassified | 670 |
| 41 | Ga0070675_101443973 | 3300005354 | Bacteria | 634 |
| 42 | Ga0070671_100699642 | 3300005355 | Unclassified | 879 |
| 43 | Ga0070674_100784802 | 3300005356 | Bacteria | 821 |
| 44 | Ga0070674_101889740 | 3300005356 | Unclassified | 542 |
| 45 | Ga0070673_100539919 | 3300005364 | Bacteria | 1058 |
| 46 | Ga0070673_102404849 | 3300005364 | Bacteria | 501 |
| 47 | Ga0070688_100026549 | 3300005365 | Bacteria | 3442 |
| 48 | Ga0070688_100123717 | 3300005365 | Bacteria | 1736 |
| 49 | Ga0070688_100429879 | 3300005365 | Bacteria | 983 |
| 50 | Ga0070688_100430454 | 3300005365 | Unclassified | 982 |
| 51 | Ga0070688_101217340 | 3300005365 | Unclassified | 605 |
| 52 | Ga0070714_100027149 | 3300005435 | Bacteria | 4737 |
| 53 | Ga0070714_102475879 | 3300005435 | Bacteria | 504 |
| 54 | Ga0070713_100067334 | 3300005436 | Bacteria | 3015 |
| 55 | Ga0070713_100654135 | 3300005436 | Bacteria | 1001 |
| 56 | Ga0070713_100983192 | 3300005436 | Bacteria | 814 |
| 57 | Ga0070713_102092158 | 3300005436 | Bacteria | 549 |
| 58 | Ga0070710_11391709 | 3300005437 | Unclassified | 524 |
| 59 | Ga0070710_11466846 | 3300005437 | Unclassified | 512 |
| 60 | Ga0070701_11095667 | 3300005438 | Unclassified | 560 |
| 61 | Ga0070711_100301601 | 3300005439 | Bacteria | 1274 |
| 62 | Ga0070711_100877092 | 3300005439 | Bacteria | 765 |
| 63 | Ga0070711_101956615 | 3300005439 | Bacteria | 515 |
| 64 | Ga0070705_101452877 | 3300005440 | Unclassified | 573 |
| 65 | Ga0070700_100681657 | 3300005441 | Bacteria | 815 |
| 66 | Ga0070694_100734133 | 3300005444 | Unclassified | 805 |
| 67 | Ga0070678_101256202 | 3300005456 | Unclassified | 688 |
| 68 | Ga0070662_101742423 | 3300005457 | Bacteria | 538 |
| 69 | Ga0070681_10077982 | 3300005458 | Bacteria | 3270 |
| 70 | Ga0070681_10353516 | 3300005458 | Unclassified | 1379 |
| 71 | Ga0070685_10400759 | 3300005466 | Bacteria | 950 |
| 72 | Ga0070685_10702480 | 3300005466 | Unclassified | 737 |
| 73 | Ga0070685_11217580 | 3300005466 | Unclassified | 573 |
| 74 | Ga0070707_102201639 | 3300005468 | Unclassified | 519 |
| 75 | Ga0070679_100400227 | 3300005530 | Bacteria | 1319 |
| 76 | Ga0070679_100609689 | 3300005530 | Bacteria | 1035 |
| 77 | Ga0070679_100686182 | 3300005530 | Unclassified | 967 |
| 78 | Ga0070679_101079731 | 3300005530 | Bacteria | 747 |
| 79 | Ga0070684_101576845 | 3300005535 | Unclassified | 619 |
| 80 | Ga0070684_101664385 | 3300005535 | Unclassified | 602 |
| 81 | Ga0070672_100747958 | 3300005543 | Bacteria | 858 |
| 82 | Ga0070686_100147887 | 3300005544 | Bacteria | 1642 |
| 83 | Ga0070686_100329480 | 3300005544 | Bacteria | 1141 |
| 84 | Ga0070686_100564458 | 3300005544 | Bacteria | 892 |
| 85 | Ga0070686_101658085 | 3300005544 | Unclassified | 542 |
| 86 | Ga0070686_101689201 | 3300005544 | Unclassified | 537 |
| 87 | Ga0070695_100537720 | 3300005545 | Unclassified | 909 |
| 88 | Ga0070695_101435200 | 3300005545 | Unclassified | 573 |
| 89 | Ga0070696_100499695 | 3300005546 | Bacteria | 967 |
| 90 | Ga0070704_101185687 | 3300005549 | Unclassified | 696 |
| 91 | Ga0068855_100181145 | 3300005563 | Bacteria | 2382 |
| 92 | Ga0068855_100594062 | 3300005563 | Bacteria | 1194 |
| 93 | Ga0068855_100744440 | 3300005563 | Bacteria | 1046 |
| 94 | Ga0068855_101143852 | 3300005563 | Bacteria | 812 |
| 95 | Ga0068855_101379109 | 3300005563 | Unclassified | 727 |
| 96 | Ga0068857_100981396 | 3300005577 | Bacteria | 812 |
| 97 | Ga0068856_100002798 | 3300005614 | Bacteria | 17858 |
| 98 | Ga0068856_100014899 | 3300005614 | Bacteria | 7504 |
| 99 | Ga0068856_100485674 | 3300005614 | Bacteria | 1256 |
| 100 | Ga0068856_101042129 | 3300005614 | Unclassified | 836 |
| 101 | Ga0068856_102176829 | 3300005614 | Unclassified | 564 |
| 102 | Ga0070702_100958535 | 3300005615 | Bacteria | 674 |
| 103 | Ga0068852_101381641 | 3300005616 | Unclassified | 726 |
| 104 | Ga0068852_101417753 | 3300005616 | Unclassified | 717 |
| 105 | Ga0068859_100023109 | 3300005617 | Bacteria | 6237 |
| 106 | Ga0068859_101814311 | 3300005617 | Unclassified | 674 |
| 107 | Ga0068859_101979183 | 3300005617 | Unclassified | 643 |
| 108 | Ga0068859_102969123 | 3300005617 | Bacteria | 519 |
| 109 | Ga0068864_100263320 | 3300005618 | Bacteria | 1604 |
| 110 | Ga0068864_100536056 | 3300005618 | Bacteria | 1130 |
| 111 | Ga0068864_101718194 | 3300005618 | Unclassified | 632 |
| 112 | Ga0068864_101883077 | 3300005618 | Unclassified | 604 |
| 113 | Ga0068864_102497305 | 3300005618 | Unclassified | 523 |
| 114 | Ga0068861_100608686 | 3300005719 | Bacteria | 1004 |
| 115 | Ga0068861_101150284 | 3300005719 | Bacteria | 748 |
| 116 | Ga0068851_10863407 | 3300005834 | Unclassified | 565 |
| 117 | Ga0068863_100184044 | 3300005841 | Bacteria | 2006 |
| 118 | Ga0068863_100330546 | 3300005841 | Unclassified | 1482 |
| 119 | Ga0068863_100502503 | 3300005841 | Bacteria | 1194 |
| 120 | Ga0068863_100822777 | 3300005841 | Bacteria | 927 |
| 121 | Ga0068863_100930784 | 3300005841 | Unclassified | 870 |
| 122 | Ga0068858_100521382 | 3300005842 | Bacteria | 1149 |
| 123 | Ga0068858_100801023 | 3300005842 | Bacteria | 919 |
| 124 | Ga0068860_100452901 | 3300005843 | Unclassified | 1276 |
| 125 | Ga0068860_101516174 | 3300005843 | Unclassified | 692 |
| 126 | Ga0068860_102225373 | 3300005843 | Unclassified | 569 |
| 127 | Ga0068860_102450039 | 3300005843 | Unclassified | 542 |
| 128 | Ga0068862_100311034 | 3300005844 | Unclassified | 1452 |
| 129 | Ga0070717_11048036 | 3300006028 | Bacteria | 743 |
| 130 | Ga0070717_12156785 | 3300006028 | Unclassified | 501 |
| 131 | Ga0070715_10125489 | 3300006163 | Bacteria | 1229 |
| 132 | Ga0070715_11056509 | 3300006163 | Unclassified | 509 |
| 133 | Ga0070716_100870238 | 3300006173 | Bacteria | 703 |
| 134 | Ga0070712_101124922 | 3300006175 | Unclassified | 682 |
| 135 | Ga0097621_100292419 | 3300006237 | Unclassified | 1436 |
| 136 | Ga0097621_100433305 | 3300006237 | Bacteria | 1182 |
| 137 | Ga0097621_100732623 | 3300006237 | Unclassified | 912 |
| 138 | Ga0068871_100156929 | 3300006358 | Bacteria | 1943 |
| 139 | Ga0068871_100440014 | 3300006358 | Bacteria | 1167 |
| 140 | Ga0068871_101265849 | 3300006358 | Unclassified | 693 |
| 141 | Ga0068871_101427936 | 3300006358 | Unclassified | 653 |
| 142 | Ga0075433_10613432 | 3300006852 | Bacteria | 955 |
| 143 | Ga0075429_101378833 | 3300006880 | Unclassified | 614 |
| 144 | Ga0068865_100409838 | 3300006881 | Unclassified | 1112 |
| 145 | Ga0068865_100895359 | 3300006881 | Bacteria | 771 |
| 146 | Ga0075436_100267045 | 3300006914 | Bacteria | 1221 |
| 147 | Ga0097620_100023109 | 3300006931 | Bacteria | 6237 |
| 148 | Ga0097620_101814385 | 3300006931 | Unclassified | 674 |
| 149 | Ga0097620_101980092 | 3300006931 | Unclassified | 643 |
| 150 | Ga0097620_102071774 | 3300006931 | Unclassified | 628 |
| 151 | Ga0097620_102924185 | 3300006931 | Unclassified | 523 |
| 152 | Ga0097620_102968778 | 3300006931 | Bacteria | 519 |
| 153 | Ga0075435_100849743 | 3300007076 | Bacteria | 795 |
| 154 | Ga0099794_10392331 | 3300007265 | Unclassified | 725 |
| 155 | Ga0099794_10483699 | 3300007265 | Bacteria | 651 |
| 156 | Ga0099794_10790363 | 3300007265 | Bacteria | 508 |
| 157 | Ga0099794_10807308 | 3300007265 | Unclassified | 502 |
| 158 | Ga0099795_10045715 | 3300007788 | Bacteria | 1575 |
| 159 | Ga0105240_10047636 | 3300009093 | Bacteria | 5423 |
| 160 | Ga0105240_10101978 | 3300009093 | Bacteria | 3489 |
| 161 | Ga0105240_10115127 | 3300009093 | Bacteria | 3247 |
| 162 | Ga0105240_10247162 | 3300009093 | Bacteria | 2065 |
| 163 | Ga0105240_10400180 | 3300009093 | Bacteria | 1547 |
| 164 | Ga0105240_10428626 | 3300009093 | Unclassified | 1484 |
| 165 | Ga0105240_10580433 | 3300009093 | Bacteria | 1237 |
| 166 | Ga0105240_10621951 | 3300009093 | Bacteria | 1187 |
| 167 | Ga0105240_10849605 | 3300009093 | Unclassified | 985 |
| 168 | Ga0105240_11761039 | 3300009093 | Unclassified | 646 |
| 169 | Ga0111539_10167114 | 3300009094 | Bacteria | 2571 |
| 170 | Ga0111539_10335934 | 3300009094 | Unclassified | 1759 |
| 171 | Ga0111539_10851883 | 3300009094 | Unclassified | 1061 |
| 172 | Ga0111539_11948797 | 3300009094 | Unclassified | 681 |
| 173 | Ga0111539_13450423 | 3300009094 | Unclassified | 508 |
| 174 | Ga0111539_13458249 | 3300009094 | Bacteria | 507 |
| 175 | Ga0105245_10049590 | 3300009098 | Bacteria | 3760 |
| 176 | Ga0105245_11209051 | 3300009098 | Unclassified | 804 |
| 177 | Ga0105245_11421986 | 3300009098 | Unclassified | 744 |
| 178 | Ga0105245_11435230 | 3300009098 | Unclassified | 740 |
| 179 | Ga0105245_12408171 | 3300009098 | Bacteria | 580 |
| 180 | Ga0105245_12663560 | 3300009098 | Unclassified | 553 |
| 181 | Ga0114129_12524696 | 3300009147 | Unclassified | 614 |
| 182 | Ga0105241_10511930 | 3300009174 | Bacteria | 1072 |
| 183 | Ga0105241_12430360 | 3300009174 | Unclassified | 523 |
| 184 | Ga0105242_10131680 | 3300009176 | Bacteria | 2160 |
| 185 | Ga0105242_10507128 | 3300009176 | Bacteria | 1148 |
| 186 | Ga0105242_10699561 | 3300009176 | Bacteria | 991 |
| 187 | Ga0105242_10818974 | 3300009176 | Bacteria | 923 |
| 188 | Ga0105242_10883112 | 3300009176 | Unclassified | 892 |
| 189 | Ga0105242_11369051 | 3300009176 | Unclassified | 734 |
| 190 | Ga0105242_11752773 | 3300009176 | Bacteria | 658 |
| 191 | Ga0105242_11816017 | 3300009176 | Unclassified | 648 |
| 192 | Ga0105242_11924984 | 3300009176 | Unclassified | 632 |
| 193 | Ga0105242_12311854 | 3300009176 | Bacteria | 584 |
| 194 | Ga0105248_10102792 | 3300009177 | Bacteria | 3221 |
| 195 | Ga0105248_10635178 | 3300009177 | Bacteria | 1205 |
| 196 | Ga0105248_10731508 | 3300009177 | Unclassified | 1116 |
| 197 | Ga0105248_10959587 | 3300009177 | Unclassified | 966 |
| 198 | Ga0105248_11309040 | 3300009177 | Unclassified | 820 |
| 199 | Ga0105248_12064307 | 3300009177 | Unclassified | 648 |
| 200 | Ga0105248_12129477 | 3300009177 | Unclassified | 638 |
| 201 | Ga0105248_12561578 | 3300009177 | Unclassified | 581 |
| 202 | Ga0105237_10392932 | 3300009545 | Bacteria | 1392 |
| 203 | Ga0105237_10728191 | 3300009545 | Bacteria | 998 |
| 204 | Ga0105237_11813844 | 3300009545 | Bacteria | 618 |
| 205 | Ga0105237_12333514 | 3300009545 | Bacteria | 545 |
| 206 | Ga0105237_12717901 | 3300009545 | Bacteria | 506 |
| 207 | Ga0105238_10022647 | 3300009551 | Bacteria | 6404 |
| 208 | Ga0105238_10058361 | 3300009551 | Bacteria | 3869 |
| 209 | Ga0105238_10058392 | 3300009551 | Bacteria | 3867 |
| 210 | Ga0105238_10090988 | 3300009551 | Bacteria | 3039 |
| 211 | Ga0105238_10218190 | 3300009551 | Bacteria | 1883 |
| 212 | Ga0105238_10651457 | 3300009551 | Unclassified | 1063 |
| 213 | Ga0105238_10887867 | 3300009551 | Bacteria | 909 |
| 214 | Ga0105238_11084935 | 3300009551 | Bacteria | 823 |
| 215 | Ga0105238_11142550 | 3300009551 | Unclassified | 802 |
| 216 | Ga0105238_11167475 | 3300009551 | Unclassified | 794 |
| 217 | Ga0105238_11724171 | 3300009551 | Bacteria | 658 |
| 218 | Ga0105249_11541964 | 3300009553 | Unclassified | 737 |
| 219 | Ga0105239_11001280 | 3300010375 | Bacteria | 961 |
| 220 | Ga0105239_11767158 | 3300010375 | Bacteria | 716 |
| 221 | Ga0105239_12786808 | 3300010375 | Bacteria | 570 |
| 222 | Ga0105246_12002802 | 3300011119 | Unclassified | 559 |
| 223 | Ga0105246_12236546 | 3300011119 | Unclassified | 533 |
| 224 | Ga0157373_10586839 | 3300013100 | Bacteria | 810 |
| 225 | Ga0157371_10065497 | 3300013102 | Bacteria | 2573 |
| 226 | Ga0157371_10235223 | 3300013102 | Bacteria | 1317 |
| 227 | Ga0157371_10765815 | 3300013102 | Unclassified | 726 |
| 228 | Ga0157370_10144589 | 3300013104 | Bacteria | 2215 |
| 229 | Ga0157370_10314144 | 3300013104 | Bacteria | 1446 |
| 230 | Ga0157370_10761743 | 3300013104 | Bacteria | 882 |
| 231 | Ga0157370_11009644 | 3300013104 | Bacteria | 753 |
| 232 | Ga0157369_10542131 | 3300013105 | Bacteria | 1203 |
| 233 | Ga0157374_10107389 | 3300013296 | Bacteria | 2683 |
| 234 | Ga0157374_10208020 | 3300013296 | Bacteria | 1918 |
| 235 | Ga0157374_10447167 | 3300013296 | Bacteria | 1293 |
| 236 | Ga0157374_10571514 | 3300013296 | Bacteria | 1139 |
| 237 | Ga0157374_10728890 | 3300013296 | Unclassified | 1005 |
| 238 | Ga0157374_10737617 | 3300013296 | Unclassified | 999 |
| 239 | Ga0157374_11125289 | 3300013296 | Unclassified | 806 |
| 240 | Ga0157374_11184252 | 3300013296 | Bacteria | 785 |
| 241 | Ga0157374_11218483 | 3300013296 | Bacteria | 774 |
| 242 | Ga0157374_11330199 | 3300013296 | Bacteria | 741 |
| 243 | Ga0157374_11406898 | 3300013296 | Unclassified | 720 |
| 244 | Ga0157374_11409521 | 3300013296 | Bacteria | 720 |
| 245 | Ga0157374_11428382 | 3300013296 | Unclassified | 715 |
| 246 | Ga0157374_11765850 | 3300013296 | Bacteria | 644 |
| 247 | Ga0157374_11938459 | 3300013296 | Unclassified | 615 |
| 248 | Ga0157374_12793490 | 3300013296 | Unclassified | 516 |
| 249 | Ga0157378_10056872 | 3300013297 | Bacteria | 3486 |
| 250 | Ga0157378_10181313 | 3300013297 | Bacteria | 1981 |
| 251 | Ga0157378_10306542 | 3300013297 | Bacteria | 1539 |
| 252 | Ga0157378_10643909 | 3300013297 | Bacteria | 1075 |
| 253 | Ga0157378_10747003 | 3300013297 | Bacteria | 1001 |
| 254 | Ga0157378_11008144 | 3300013297 | Unclassified | 867 |
| 255 | Ga0157378_11217837 | 3300013297 | Unclassified | 793 |
| 256 | Ga0157378_11294325 | 3300013297 | Unclassified | 770 |
| 257 | Ga0157378_11850699 | 3300013297 | Unclassified | 652 |
| 258 | Ga0163162_10080930 | 3300013306 | Bacteria | 3317 |
| 259 | Ga0163162_10491251 | 3300013306 | Bacteria | 1358 |
| 260 | Ga0163162_10540438 | 3300013306 | Bacteria | 1294 |
| 261 | Ga0163162_10624645 | 3300013306 | Bacteria | 1202 |
| 262 | Ga0163162_10680048 | 3300013306 | Bacteria | 1152 |
| 263 | Ga0163162_10726472 | 3300013306 | Bacteria | 1114 |
| 264 | Ga0163162_10762069 | 3300013306 | Bacteria | 1087 |
| 265 | Ga0157372_10685509 | 3300013307 | Bacteria | 1193 |
| 266 | Ga0157372_11407872 | 3300013307 | Unclassified | 804 |
| 267 | Ga0157372_11843926 | 3300013307 | Unclassified | 695 |
| 268 | Ga0157372_12311415 | 3300013307 | Bacteria | 617 |
| 269 | Ga0157375_10000193 | 3300013308 | Bacteria | 57123 |
| 270 | Ga0157375_11534848 | 3300013308 | Unclassified | 787 |
| 271 | Ga0157375_11602033 | 3300013308 | Unclassified | 770 |
| 272 | Ga0157375_13220750 | 3300013308 | Unclassified | 544 |
| 273 | Ga0163163_10000067 | 3300014325 | Bacteria | 114831 |
| 274 | Ga0163163_10059507 | 3300014325 | Bacteria | 3779 |
| 275 | Ga0163163_10134572 | 3300014325 | Bacteria | 2512 |
| 276 | Ga0163163_10338153 | 3300014325 | Bacteria | 1560 |
| 277 | Ga0163163_12514715 | 3300014325 | Unclassified | 573 |
| 278 | Ga0157380_10231426 | 3300014326 | Unclassified | 1660 |
| 279 | Ga0157380_12005629 | 3300014326 | Unclassified | 640 |
| 280 | Ga0157380_12606286 | 3300014326 | Unclassified | 572 |
| 281 | Ga0157377_11269281 | 3300014745 | Unclassified | 574 |
| 282 | Ga0157379_10204734 | 3300014968 | Bacteria | 1785 |
| 283 | Ga0157379_10903119 | 3300014968 | Unclassified | 838 |
| 284 | Ga0157379_10943511 | 3300014968 | Bacteria | 820 |
| 285 | Ga0157379_10972997 | 3300014968 | Unclassified | 808 |
| 286 | Ga0157379_11013697 | 3300014968 | Unclassified | 792 |
| 287 | Ga0157376_10263247 | 3300014969 | Bacteria | 1616 |
| 288 | Ga0157376_10453044 | 3300014969 | Unclassified | 1252 |
| 289 | Ga0157376_10961254 | 3300014969 | Unclassified | 875 |
| 290 | Ga0157376_11001752 | 3300014969 | Bacteria | 858 |
| 291 | Ga0157376_11109156 | 3300014969 | Bacteria | 817 |
| 292 | Ga0157376_11572957 | 3300014969 | Unclassified | 691 |
| 293 | Ga0157376_11785274 | 3300014969 | Bacteria | 651 |
| 294 | Ga0157376_12467429 | 3300014969 | Bacteria | 560 |
| 295 | Ga0182007_10418969 | 3300015262 | Unclassified | 512 |
| 296 | Ga0163161_10520740 | 3300017792 | Bacteria | 971 |
| 297 | Ga0163161_10880384 | 3300017792 | Unclassified | 757 |
| 298 | Ga0197907_10093562 | 3300020069 | Unclassified | 668 |
| 299 | Ga0197907_10678080 | 3300020069 | Unclassified | 760 |
| 300 | Ga0197907_11318956 | 3300020069 | Bacteria | 541 |
| 301 | Ga0197907_11380623 | 3300020069 | Bacteria | 819 |
| 302 | Ga0197907_11490927 | 3300020069 | Unclassified | 1004 |
| 303 | Ga0206356_10061388 | 3300020070 | Bacteria | 535 |
| 304 | Ga0206356_10271924 | 3300020070 | Bacteria | 978 |
| 305 | Ga0206356_11175132 | 3300020070 | Unclassified | 889 |
| 306 | Ga0206356_11803190 | 3300020070 | Bacteria | 739 |
| 307 | Ga0206355_1170980 | 3300020076 | Unclassified | 748 |
| 308 | Ga0206351_10916508 | 3300020077 | Unclassified | 575 |
| 309 | Ga0206352_10077544 | 3300020078 | Bacteria | 555 |
| 310 | Ga0206352_10327707 | 3300020078 | Unclassified | 805 |
| 311 | Ga0206352_10694369 | 3300020078 | Bacteria | 606 |
| 312 | Ga0206352_11021632 | 3300020078 | Unclassified | 961 |
| 313 | Ga0206352_11302396 | 3300020078 | Unclassified | 510 |
| 314 | Ga0206352_11361878 | 3300020078 | Unclassified | 674 |
| 315 | Ga0206350_10848227 | 3300020080 | Bacteria | 671 |
| 316 | Ga0206350_11044168 | 3300020080 | Unclassified | 518 |
| 317 | Ga0206350_11356146 | 3300020080 | Unclassified | 533 |
| 318 | Ga0206350_11359674 | 3300020080 | Bacteria | 642 |
| 319 | Ga0206354_11266248 | 3300020081 | Unclassified | 782 |
| 320 | Ga0206353_10136047 | 3300020082 | Unclassified | 741 |
| 321 | Ga0224712_10014740 | 3300022467 | Bacteria | 2526 |
| 322 | Ga0224712_10533823 | 3300022467 | Bacteria | 569 |
| 323 | Ga0207685_10693173 | 3300025905 | Unclassified | 554 |
| 324 | Ga0207645_10718064 | 3300025907 | Bacteria | 679 |
| 325 | Ga0207705_10097830 | 3300025909 | Bacteria | 2155 |
| 326 | Ga0207705_10622501 | 3300025909 | Bacteria | 839 |
| 327 | Ga0207705_10936393 | 3300025909 | Unclassified | 670 |
| 328 | Ga0207705_11323714 | 3300025909 | Bacteria | 550 |
| 329 | Ga0207654_10837903 | 3300025911 | Unclassified | 665 |
| 330 | Ga0207707_10093442 | 3300025912 | Bacteria | 2627 |
| 331 | Ga0207707_10141503 | 3300025912 | Bacteria | 2103 |
| 332 | Ga0207695_10042188 | 3300025913 | Bacteria | 4876 |
| 333 | Ga0207695_10104842 | 3300025913 | Bacteria | 2815 |
| 334 | Ga0207695_10152455 | 3300025913 | Bacteria | 2249 |
| 335 | Ga0207695_10246758 | 3300025913 | Bacteria | 1685 |
| 336 | Ga0207695_10253930 | 3300025913 | Bacteria | 1657 |
| 337 | Ga0207695_10680131 | 3300025913 | Unclassified | 910 |
| 338 | Ga0207695_11619000 | 3300025913 | Unclassified | 528 |
| 339 | Ga0207671_10441233 | 3300025914 | Unclassified | 1036 |
| 340 | Ga0207671_11386733 | 3300025914 | Bacteria | 545 |
| 341 | Ga0207693_10062717 | 3300025915 | Bacteria | 2912 |
| 342 | Ga0207693_10601293 | 3300025915 | Unclassified | 856 |
| 343 | Ga0207693_10929201 | 3300025915 | Unclassified | 667 |
| 344 | Ga0207663_10018773 | 3300025916 | Bacteria | 3883 |
| 345 | Ga0207663_10690452 | 3300025916 | Unclassified | 808 |
| 346 | Ga0207663_10719843 | 3300025916 | Bacteria | 791 |
| 347 | Ga0207663_11612455 | 3300025916 | Bacteria | 522 |
| 348 | Ga0207662_10419697 | 3300025918 | Unclassified | 910 |
| 349 | Ga0207652_10677121 | 3300025921 | Bacteria | 921 |
| 350 | Ga0207652_10794443 | 3300025921 | Unclassified | 841 |
| 351 | Ga0207652_11647774 | 3300025921 | Unclassified | 546 |
| 352 | Ga0207694_10010783 | 3300025924 | Bacteria | 6901 |
| 353 | Ga0207694_10056957 | 3300025924 | Bacteria | 3037 |
| 354 | Ga0207694_10229630 | 3300025924 | Bacteria | 1515 |
| 355 | Ga0207694_10404762 | 3300025924 | Bacteria | 1135 |
| 356 | Ga0207694_10712285 | 3300025924 | Bacteria | 847 |
| 357 | Ga0207694_10840383 | 3300025924 | Unclassified | 776 |
| 358 | Ga0207659_10910642 | 3300025926 | Unclassified | 756 |
| 359 | Ga0207664_10022118 | 3300025929 | Bacteria | 4742 |
| 360 | Ga0207664_10586981 | 3300025929 | Bacteria | 1000 |
| 361 | Ga0207644_11447238 | 3300025931 | Unclassified | 577 |
| 362 | Ga0207706_10782871 | 3300025933 | Bacteria | 811 |
| 363 | Ga0207686_10517279 | 3300025934 | Bacteria | 928 |
| 364 | Ga0207686_10863602 | 3300025934 | Bacteria | 728 |
| 365 | Ga0207686_10982166 | 3300025934 | Bacteria | 684 |
| 366 | Ga0207670_10016966 | 3300025936 | Bacteria | 4390 |
| 367 | Ga0207670_10180763 | 3300025936 | Bacteria | 1589 |
| 368 | Ga0207670_10333131 | 3300025936 | Bacteria | 1197 |
| 369 | Ga0207670_10352704 | 3300025936 | Bacteria | 1165 |
| 370 | Ga0207670_10990097 | 3300025936 | Bacteria | 707 |
| 371 | Ga0207704_10420236 | 3300025938 | Unclassified | 1060 |
| 372 | Ga0207665_10440124 | 3300025939 | Bacteria | 999 |
| 373 | Ga0207711_10405246 | 3300025941 | Unclassified | 1267 |
| 374 | Ga0207711_10688860 | 3300025941 | Unclassified | 953 |
| 375 | Ga0207711_11484938 | 3300025941 | Unclassified | 621 |
| 376 | Ga0207711_11760788 | 3300025941 | Unclassified | 563 |
| 377 | Ga0207667_10063721 | 3300025949 | Bacteria | 3852 |
| 378 | Ga0207667_10085720 | 3300025949 | Bacteria | 3260 |
| 379 | Ga0207667_10141077 | 3300025949 | Bacteria | 2481 |
| 380 | Ga0207667_10279608 | 3300025949 | Bacteria | 1706 |
| 381 | Ga0207667_10397425 | 3300025949 | Unclassified | 1403 |
| 382 | Ga0207667_11606036 | 3300025949 | Bacteria | 619 |
| 383 | Ga0207651_10427834 | 3300025960 | Bacteria | 1131 |
| 384 | Ga0207712_10526962 | 3300025961 | Unclassified | 1013 |
| 385 | Ga0207712_10577605 | 3300025961 | Unclassified | 970 |
| 386 | Ga0207703_10872680 | 3300026035 | Bacteria | 861 |
| 387 | Ga0207703_11381294 | 3300026035 | Bacteria | 677 |
| 388 | Ga0207703_11958267 | 3300026035 | Unclassified | 562 |
| 389 | Ga0207702_10001987 | 3300026078 | Bacteria | 19847 |
| 390 | Ga0207702_10015367 | 3300026078 | Bacteria | 6344 |
| 391 | Ga0207641_10073907 | 3300026088 | Bacteria | 2939 |
| 392 | Ga0207641_10295308 | 3300026088 | Bacteria | 1529 |
| 393 | Ga0207641_10336223 | 3300026088 | Bacteria | 1436 |
| 394 | Ga0207641_10608064 | 3300026088 | Unclassified | 1071 |
| 395 | Ga0207641_10633890 | 3300026088 | Bacteria | 1049 |
| 396 | Ga0207641_10841785 | 3300026088 | Bacteria | 909 |
| 397 | Ga0207648_10723017 | 3300026089 | Bacteria | 924 |
| 398 | Ga0207676_10446444 | 3300026095 | Bacteria | 1218 |
| 399 | Ga0207676_10541887 | 3300026095 | Unclassified | 1111 |
| 400 | Ga0207676_11481873 | 3300026095 | Unclassified | 675 |
| 401 | Ga0207674_10119451 | 3300026116 | Bacteria | 2605 |
| 402 | Ga0207674_10561603 | 3300026116 | Unclassified | 1102 |
| 403 | Ga0207698_11448018 | 3300026142 | Unclassified | 702 |
| 404 | Ga0207698_12685197 | 3300026142 | Unclassified | 507 |
| 405 | Ga0207428_10591147 | 3300027907 | Unclassified | 800 |
| 406 | Ga0207428_10907620 | 3300027907 | Unclassified | 622 |
| 407 | Ga0268265_11005754 | 3300028380 | Bacteria | 824 |
| 408 | Ga0268264_10758800 | 3300028381 | Bacteria | 967 |
| 409 | Ga0265337_1001383 | 3300028556 | Bacteria | 11925 |
| 410 | Ga0265337_1006315 | 3300028556 | Bacteria | 4589 |
| 411 | Ga0265337_1052382 | 3300028556 | Unclassified | 1146 |
| 412 | Ga0265337_1089782 | 3300028556 | Bacteria | 838 |
| 413 | Ga0265337_1143152 | 3300028556 | Bacteria | 647 |
| 414 | Ga0265337_1171205 | 3300028556 | Unclassified | 589 |
| 415 | Ga0265326_10009649 | 3300028558 | Bacteria | 2888 |
| 416 | Ga0265326_10041126 | 3300028558 | Unclassified | 1313 |
| 417 | Ga0265326_10075678 | 3300028558 | Unclassified | 952 |
| 418 | Ga0265326_10089624 | 3300028558 | Bacteria | 871 |
| 419 | Ga0265326_10214143 | 3300028558 | Bacteria | 554 |
| 420 | Ga0265319_1000181 | 3300028563 | Bacteria | 47983 |
| 421 | Ga0265319_1015277 | 3300028563 | Bacteria | 2982 |
| 422 | Ga0265319_1149123 | 3300028563 | Unclassified | 724 |
| 423 | Ga0265319_1204408 | 3300028563 | Unclassified | 606 |
| 424 | Ga0265334_10006539 | 3300028573 | Bacteria | 5017 |
| 425 | Ga0265334_10015224 | 3300028573 | Bacteria | 3199 |
| 426 | Ga0265334_10051809 | 3300028573 | Unclassified | 1573 |
| 427 | Ga0265334_10297102 | 3300028573 | Unclassified | 553 |
| 428 | Ga0265334_10303957 | 3300028573 | Unclassified | 546 |
| 429 | Ga0265318_10137394 | 3300028577 | Bacteria | 898 |
| 430 | Ga0265318_10160506 | 3300028577 | Bacteria | 824 |
| 431 | Ga0265318_10372184 | 3300028577 | Unclassified | 521 |
| 432 | Ga0265323_10000052 | 3300028653 | Bacteria | 63341 |
| 433 | Ga0265323_10013603 | 3300028653 | Bacteria | 3242 |
| 434 | Ga0265323_10213367 | 3300028653 | Unclassified | 606 |
| 435 | Ga0265323_10246479 | 3300028653 | Bacteria | 556 |
| 436 | Ga0265322_10183055 | 3300028654 | Unclassified | 600 |
| 437 | Ga0265322_10240408 | 3300028654 | Bacteria | 519 |
| 438 | Ga0265336_10001439 | 3300028666 | Bacteria | 10844 |
| 439 | Ga0265336_10039863 | 3300028666 | Bacteria | 1439 |
| 440 | Ga0265336_10119637 | 3300028666 | Bacteria | 784 |
| 441 | Ga0265336_10183919 | 3300028666 | Bacteria | 621 |
| 442 | Ga0265338_10000293 | 3300028800 | Bacteria | 90033 |
| 443 | Ga0265338_10000334 | 3300028800 | Bacteria | 85705 |
| 444 | Ga0265338_10000338 | 3300028800 | Bacteria | 85407 |
| 445 | Ga0265338_10000702 | 3300028800 | Bacteria | 57422 |
| 446 | Ga0265338_10001650 | 3300028800 | Bacteria | 35635 |
| 447 | Ga0265338_10003512 | 3300028800 | Bacteria | 21968 |
| 448 | Ga0265338_10004217 | 3300028800 | Bacteria | 19583 |
| 449 | Ga0265338_10005093 | 3300028800 | Bacteria | 17342 |
| 450 | Ga0265338_10007121 | 3300028800 | Bacteria | 14005 |
| 451 | Ga0265338_10008472 | 3300028800 | Bacteria | 12481 |
| 452 | Ga0265338_10010207 | 3300028800 | Bacteria | 11068 |
| 453 | Ga0265338_10010911 | 3300028800 | Bacteria | 10569 |
| 454 | Ga0265338_10011017 | 3300028800 | Bacteria | 10500 |
| 455 | Ga0265338_10019439 | 3300028800 | Bacteria | 7207 |
| 456 | Ga0265338_10028064 | 3300028800 | Bacteria | 5625 |
| 457 | Ga0265338_10032343 | 3300028800 | Bacteria | 5106 |
| 458 | Ga0265338_10037899 | 3300028800 | Bacteria | 4577 |
| 459 | Ga0265338_10051004 | 3300028800 | Bacteria | 3733 |
| 460 | Ga0265338_10117457 | 3300028800 | Bacteria | 2128 |
| 461 | Ga0265338_10125810 | 3300028800 | Unclassified | 2034 |
| 462 | Ga0265338_10182385 | 3300028800 | Unclassified | 1599 |
| 463 | Ga0265338_10210658 | 3300028800 | Bacteria | 1459 |
| 464 | Ga0265338_10316521 | 3300028800 | Unclassified | 1131 |
| 465 | Ga0265338_10342561 | 3300028800 | Unclassified | 1077 |
| 466 | Ga0265338_10371018 | 3300028800 | Bacteria | 1025 |
| 467 | Ga0265338_10510824 | 3300028800 | Bacteria | 845 |
| 468 | Ga0265338_10585774 | 3300028800 | Bacteria | 778 |
| 469 | Ga0265338_10589925 | 3300028800 | Unclassified | 775 |
| 470 | Ga0265338_10951110 | 3300028800 | Unclassified | 583 |
| 471 | Ga0265338_11110602 | 3300028800 | Unclassified | 532 |
| 472 | Ga0265324_10000497 | 3300029957 | Bacteria | 27319 |
| 473 | Ga0265324_10004477 | 3300029957 | Bacteria | 6288 |
| 474 | Ga0265324_10005898 | 3300029957 | Bacteria | 5205 |
| 475 | Ga0265324_10014914 | 3300029957 | Bacteria | 2863 |
| 476 | Ga0265324_10023976 | 3300029957 | Unclassified | 2171 |
| 477 | Ga0265324_10041314 | 3300029957 | Bacteria | 1596 |
| 478 | Ga0265324_10062512 | 3300029957 | Bacteria | 1272 |
| 479 | Ga0265324_10079037 | 3300029957 | Bacteria | 1119 |
| 480 | Ga0265324_10153587 | 3300029957 | Bacteria | 781 |
| 481 | Ga0265330_10376438 | 3300031235 | Unclassified | 600 |
| 482 | Ga0265330_10408638 | 3300031235 | Unclassified | 575 |
| 483 | Ga0265332_10326449 | 3300031238 | Unclassified | 633 |
| 484 | Ga0265320_10001101 | 3300031240 | Bacteria | 19951 |
| 485 | Ga0265320_10004269 | 3300031240 | Bacteria | 9394 |
| 486 | Ga0265320_10034090 | 3300031240 | Bacteria | 2594 |
| 487 | Ga0265320_10049012 | 3300031240 | Bacteria | 2058 |
| 488 | Ga0265320_10069884 | 3300031240 | Bacteria | 1657 |
| 489 | Ga0265320_10089976 | 3300031240 | Unclassified | 1423 |
| 490 | Ga0265320_10169678 | 3300031240 | Unclassified | 980 |
| 491 | Ga0265320_10187693 | 3300031240 | Unclassified | 925 |
| 492 | Ga0265320_10194022 | 3300031240 | Bacteria | 907 |
| 493 | Ga0265320_10262590 | 3300031240 | Bacteria | 765 |
| 494 | Ga0265320_10531722 | 3300031240 | Unclassified | 520 |
| 495 | Ga0265325_10097339 | 3300031241 | Bacteria | 1444 |
| 496 | Ga0265325_10144680 | 3300031241 | Bacteria | 1128 |
| 497 | Ga0265325_10198542 | 3300031241 | Bacteria | 926 |
| 498 | Ga0265329_10060872 | 3300031242 | Bacteria | 1196 |
| 499 | Ga0265329_10172257 | 3300031242 | Bacteria | 706 |
| 500 | Ga0265340_10001821 | 3300031247 | Bacteria | 12184 |
| 501 | Ga0265340_10008513 | 3300031247 | Bacteria | 5536 |
| 502 | Ga0265340_10041784 | 3300031247 | Bacteria | 2253 |
| 503 | Ga0265340_10098528 | 3300031247 | Bacteria | 1361 |
| 504 | Ga0265340_10249798 | 3300031247 | Unclassified | 791 |
| 505 | Ga0265340_10445668 | 3300031247 | Bacteria | 570 |
| 506 | Ga0265340_10455733 | 3300031247 | Unclassified | 563 |
| 507 | Ga0265339_10045383 | 3300031249 | Bacteria | 2419 |
| 508 | Ga0265339_10047272 | 3300031249 | Bacteria | 2363 |
| 509 | Ga0265339_10081811 | 3300031249 | Bacteria | 1706 |
| 510 | Ga0265339_10120594 | 3300031249 | Bacteria | 1348 |
| 511 | Ga0265339_10376364 | 3300031249 | Bacteria | 666 |
| 512 | Ga0265331_10145531 | 3300031250 | Bacteria | 1077 |
| 513 | Ga0265327_10000707 | 3300031251 | Bacteria | 52780 |
| 514 | Ga0265327_10001304 | 3300031251 | Bacteria | 32595 |
| 515 | Ga0265327_10007941 | 3300031251 | Bacteria | 8032 |
| 516 | Ga0265316_10019145 | 3300031344 | Bacteria | 5863 |
| 517 | Ga0265316_10054200 | 3300031344 | Bacteria | 3140 |
| 518 | Ga0265316_10081759 | 3300031344 | Bacteria | 2476 |
| 519 | Ga0265316_10109663 | 3300031344 | Unclassified | 2091 |
| 520 | Ga0265316_10110646 | 3300031344 | Bacteria | 2080 |
| 521 | Ga0265316_10116523 | 3300031344 | Bacteria | 2019 |
| 522 | Ga0265316_10170567 | 3300031344 | Bacteria | 1623 |
| 523 | Ga0265316_10301063 | 3300031344 | Bacteria | 1168 |
| 524 | Ga0265316_10539635 | 3300031344 | Bacteria | 831 |
| 525 | Ga0265316_10646002 | 3300031344 | Bacteria | 748 |
| 526 | Ga0265316_10683884 | 3300031344 | Bacteria | 724 |
| 527 | Ga0265316_10921338 | 3300031344 | Bacteria | 610 |
| 528 | Ga0265316_10929551 | 3300031344 | Bacteria | 607 |
| 529 | Ga0265316_11041543 | 3300031344 | Unclassified | 569 |
| 530 | Ga0265316_11070914 | 3300031344 | Unclassified | 560 |
| 531 | Ga0265313_10025647 | 3300031595 | Bacteria | 3117 |
| 532 | Ga0265313_10045617 | 3300031595 | Bacteria | 2132 |
| 533 | Ga0265313_10110582 | 3300031595 | Unclassified | 1209 |
| 534 | Ga0265313_10346521 | 3300031595 | Unclassified | 589 |
| 535 | Ga0265314_10022822 | 3300031711 | Bacteria | 4788 |
| 536 | Ga0265314_10184840 | 3300031711 | Bacteria | 1245 |
| 537 | Ga0265342_10114022 | 3300031712 | Bacteria | 1527 |
| 538 | Ga0265342_10210320 | 3300031712 | Bacteria | 1052 |
| 539 | Ga0265342_10437365 | 3300031712 | Unclassified | 672 |
| 540 | Ga0265342_10522955 | 3300031712 | Unclassified | 604 |
| 541 | Ga0265342_10649859 | 3300031712 | Bacteria | 529 |
| 542 | Ga0307405_11006522 | 3300031731 | Unclassified | 711 |
| 543 | Ga0307413_11501271 | 3300031824 | Unclassified | 596 |
| 544 | Ga0307412_10184900 | 3300031911 | Unclassified | 1571 |
| 545 | Ga0307409_101249666 | 3300031995 | Bacteria | 767 |
| 546 | Ga0307414_10611136 | 3300032004 | Unclassified | 979 |
| 547 | Ga0373930_0022447 | 3300034816 | Unclassified | 1248 |
| 548 | Ga0373959_0015678 | 3300034820 | Unclassified | 1394 |
| 549 | Ga0373926_0160551 | 3300035083 | Unclassified | 858 |
| 550 | Ga0373926_0227530 | 3300035083 | Unclassified | 720 |
| 551 | Ga0373928_0000024 | 3300035084 | Bacteria | 25811 |
| 552 | Ga0373929_0000895 | 3300035085 | Bacteria | 5809 |
| 553 | Ga0373940_0030071 | 3300035088 | Unclassified | 1443 |
| 554 | Ga0373944_0000514 | 3300035089 | Bacteria | 9041 |
| 555 | Ga0373949_0007193 | 3300035090 | Unclassified | 2440 |
| 556 | Ga0373951_0001684 | 3300035091 | Bacteria | 5775 |
| 557 | Ga0373923_0106057 | 3300035111 | Bacteria | 1244 |
| 558 | Ga0373932_0000006 | 3300035112 | Bacteria | 208547 |
| 559 | Ga0373936_0133561 | 3300035113 | Bacteria | 1068 |
| 560 | Ga0373939_0150575 | 3300035114 | Unclassified | 846 |
| 561 | Ga0373945_0130270 | 3300035116 | Unclassified | 1007 |
| 562 | Ga0373945_0205207 | 3300035116 | Bacteria | 820 |
| 563 | Ga0373953_0044513 | 3300035117 | Bacteria | 1775 |
| 564 | Ga0373953_0441775 | 3300035117 | Bacteria | 574 |
| 565 | Ga0373954_0004196 | 3300035118 | Bacteria | 6179 |
| 566 | Ga0373954_0033971 | 3300035118 | Bacteria | 2360 |
| 567 | Ga0373956_0013538 | 3300035119 | Bacteria | 3394 |
| 568 | Ga0373956_0038253 | 3300035119 | Bacteria | 2122 |
| 569 | Ga0373956_0635901 | 3300035119 | Bacteria | 509 |
| 570 | Ga0373943_0207097 | 3300035170 | Bacteria | 1088 |
| 571 | Ga0373943_0459057 | 3300035170 | Unclassified | 741 |
| 572 | Ga0373946_0063792 | 3300035171 | Bacteria | 1574 |
| 573 | Ga0373946_0322510 | 3300035171 | Bacteria | 768 |
| 574 | Ga0373946_0678594 | 3300035171 | Bacteria | 538 |
| 575 | Ga0373955_0128784 | 3300035172 | Unclassified | 1476 |
| 576 | Ga0373955_0232990 | 3300035172 | Unclassified | 1102 |
| 577 | Ga0373955_0591537 | 3300035172 | Unclassified | 679 |
| 578 | Ga0373955_0940999 | 3300035172 | Unclassified | 532 |
| 579 | Ga0373942_0079562 | 3300035207 | Bacteria | 971 |
| 580 | Ga0373962_0000162 | 3300035242 | Bacteria | 14126 |
| 581 | Ga0373931_0000009 | 3300035691 | Bacteria | 349854 |
| 582 | Ga0373931_0071622 | 3300035691 | Bacteria | 1894 |
| 583 | Ga0373931_0307092 | 3300035691 | Bacteria | 981 |
| 584 | Ga0373931_0363796 | 3300035691 | Bacteria | 908 |
| 585 | Ga0373935_0013383 | 3300035692 | Bacteria | 4949 |
| 586 | Ga0373935_0061713 | 3300035692 | Bacteria | 2400 |
| 587 | Ga0373935_0987743 | 3300035692 | Bacteria | 625 |
| 588 | Ga0373935_1099004 | 3300035692 | Unclassified | 592 |
| 589 | Ga0373927_0020430 | 3300035695 | Bacteria | 4342 |
| 590 | Ga0373927_0067607 | 3300035695 | Bacteria | 2312 |
| 591 | Ga0373927_0279688 | 3300035695 | Unclassified | 1098 |
| 592 | Ga0373927_0304740 | 3300035695 | Unclassified | 1048 |
| 593 | Ga0373927_0344516 | 3300035695 | Bacteria | 982 |
| 594 | Ga0373927_0579089 | 3300035695 | Bacteria | 742 |
| 595 | Ga0373947_0203163 | 3300035725 | Bacteria | 1297 |
| 596 | Ga0373947_0263440 | 3300035725 | Bacteria | 1143 |
| 597 | Ga0373947_0483342 | 3300035725 | Bacteria | 840 |
| 598 | Ga0373937_0002559 | 3300036401 | Bacteria | 15119 |
| 599 | Ga0373937_0219435 | 3300036401 | Bacteria | 1790 |
| 600 | Ga0373937_0677862 | 3300036401 | Bacteria | 977 |
| 601 | Ga0373937_0682099 | 3300036401 | Bacteria | 974 |
| 602 | Ga0373937_1195331 | 3300036401 | Unclassified | 709 |
| 603 | Ga0373937_1318498 | 3300036401 | Unclassified | 670 |
| 604 | Ga0316582_0493026 | 3300036647 | Bacteria | 844 |
| 605 | Ga0373925_0000498 | 3300037068 | Bacteria | 39602 |
| 606 | Ga0373925_0076093 | 3300037068 | Bacteria | 2545 |
| 607 | Ga0373925_0233403 | 3300037068 | Bacteria | 1471 |
| 608 | Ga0373925_1352726 | 3300037068 | Bacteria | 584 |
| 609 | Ga0373925_1411675 | 3300037068 | Unclassified | 570 |
| 610 | Ga0436363_0725337 | 3300039450 | Bacteria | 877 |
| 611 | Ga0451793_0122907 | 3300041452 | Unclassified | 580 |
| 612 | Ga0451807_0872394 | 3300041486 | Unclassified | 520 |
| 613 | Ga0451833_0913063 | 3300041491 | Unclassified | 747 |
| 614 | Ga0451839_0496865 | 3300041496 | Bacteria | 782 |
| 615 | Ga0451839_0584655 | 3300041496 | Bacteria | 630 |
| 616 | Ga0451577_0001767 | 3300042876 | Bacteria | 27811 |
| 617 | Ga0451577_0005602 | 3300042876 | Bacteria | 12775 |
| 618 | Ga0451577_0161865 | 3300042876 | Unclassified | 2015 |
| 619 | Ga0451577_0583306 | 3300042876 | Bacteria | 1015 |
| 620 | Ga0453683_0737386 | 3300044673 | Unclassified | 647 |
| 621 | Ga0453683_0739032 | 3300044673 | Unclassified | 646 |
| 622 | Ga0453684_0000238 | 3300044712 | Bacteria | 236003 |
| 623 | Ga0453684_0002796 | 3300044712 | Bacteria | 41264 |
| 624 | Ga0453684_0040224 | 3300044712 | Bacteria | 6355 |
| 625 | Ga0453684_0183186 | 3300044712 | Unclassified | 2457 |
| 626 | Ga0453684_0851306 | 3300044712 | Bacteria | 980 |
| 627 | Ga0453684_0959676 | 3300044712 | Bacteria | 912 |
| 628 | Ga0453684_1576212 | 3300044712 | Unclassified | 675 |
| 629 | Ga0453684_2399320 | 3300044712 | Unclassified | 522 |
| 630 | Ga0451576_0061426 | 3300045051 | Bacteria | 3918 |
| 631 | Ga0451576_0160484 | 3300045051 | Unclassified | 2346 |
| 632 | Ga0451576_0227091 | 3300045051 | Unclassified | 1949 |
| 633 | Ga0451576_0234148 | 3300045051 | Bacteria | 1918 |
| 634 | Ga0451576_0268955 | 3300045051 | Bacteria | 1782 |
| 635 | Ga0451576_0376963 | 3300045051 | Bacteria | 1487 |
| 636 | Ga0451576_0440598 | 3300045051 | Bacteria | 1367 |
| 637 | Ga0451576_0510580 | 3300045051 | Bacteria | 1263 |
| 638 | Ga0451576_0548984 | 3300045051 | Bacteria | 1214 |
| 639 | Ga0451576_0767631 | 3300045051 | Bacteria | 1013 |
| 640 | Ga0451576_0831077 | 3300045051 | Bacteria | 970 |
| 641 | Ga0451576_0883735 | 3300045051 | Bacteria | 938 |
| 642 | Ga0451576_0991917 | 3300045051 | Bacteria | 880 |
| 643 | Ga0451576_1050733 | 3300045051 | Bacteria | 853 |
| 644 | Ga0451576_1197883 | 3300045051 | Bacteria | 793 |
| 645 | Ga0451576_1336329 | 3300045051 | Unclassified | 747 |
| 646 | Ga0451576_1350323 | 3300045051 | Bacteria | 742 |
| 647 | Ga0451576_1430121 | 3300045051 | Unclassified | 719 |
| 648 | Ga0451576_1692506 | 3300045051 | Unclassified | 655 |
| 649 | Ga0451576_2312339 | 3300045051 | Bacteria | 551 |
| 650 | Ga0495592_0000027 | 3300046454 | Bacteria | 132938 |
| 651 | Ga0495603_0211200 | 3300046455 | Unclassified | 1121 |
| 652 | Ga0495629_0032554 | 3300046459 | Bacteria | 3691 |
| 653 | Ga0495629_0669747 | 3300046459 | Bacteria | 690 |
| 654 | Ga0495641_0054259 | 3300046461 | Bacteria | 1821 |
| 655 | Ga0495651_0218694 | 3300046462 | Bacteria | 1320 |
| 656 | Ga0495651_0517804 | 3300046462 | Unclassified | 762 |
| 657 | Ga0495582_0029874 | 3300046473 | Bacteria | 2992 |
| 658 | Ga0495639_0340601 | 3300046475 | Unclassified | 752 |
| 659 | Ga0495662_0033947 | 3300046476 | Bacteria | 2464 |
| 660 | Ga0495662_0669998 | 3300046476 | Bacteria | 506 |
| 661 | Ga0495664_0065077 | 3300046477 | Bacteria | 2173 |
| 662 | Ga0495664_0630010 | 3300046477 | Unclassified | 636 |
| 663 | Ga0495594_0319076 | 3300046499 | Unclassified | 885 |
| 664 | Ga0495608_0370576 | 3300046511 | Unclassified | 879 |
| 665 | Ga0495618_0000627 | 3300046514 | Bacteria | 25046 |
| 666 | Ga0495628_0284490 | 3300046516 | Bacteria | 1227 |
| 667 | Ga0495628_0630651 | 3300046516 | Bacteria | 763 |
| 668 | Ga0495628_0654555 | 3300046516 | Bacteria | 746 |
| 669 | Ga0495630_0000094 | 3300046517 | Bacteria | 68804 |
| 670 | Ga0495630_0430978 | 3300046517 | Bacteria | 1010 |
| 671 | Ga0495630_0473504 | 3300046517 | Bacteria | 960 |
| 672 | Ga0495630_0489449 | 3300046517 | Bacteria | 943 |
| 673 | Ga0495630_0564692 | 3300046517 | Unclassified | 873 |
| 674 | Ga0495630_1485614 | 3300046517 | Bacteria | 509 |
| 675 | Ga0495666_0018485 | 3300046526 | Bacteria | 3469 |
| 676 | Ga0495666_0284874 | 3300046526 | Unclassified | 749 |
| 677 | Ga0495652_0365927 | 3300046529 | Bacteria | 1029 |
| 678 | Ga0495665_0328917 | 3300046531 | Bacteria | 780 |
| 679 | Ga0495640_0182592 | 3300046533 | Bacteria | 1336 |
| 680 | Ga0495640_0203140 | 3300046533 | Unclassified | 1255 |
| 681 | Ga0495586_0000110 | 3300046535 | Bacteria | 48594 |
| 682 | Ga0495586_0000435 | 3300046535 | Bacteria | 25115 |
| 683 | Ga0495586_0000958 | 3300046535 | Bacteria | 16352 |
| 684 | Ga0495586_0026563 | 3300046535 | Bacteria | 3098 |
| 685 | Ga0495586_0553280 | 3300046535 | Unclassified | 664 |
| 686 | Ga0495587_0141923 | 3300046536 | Bacteria | 1371 |
| 687 | Ga0495587_0380778 | 3300046536 | Bacteria | 785 |
| 688 | Ga0495621_0253232 | 3300046539 | Unclassified | 720 |
| 689 | Ga0495645_0019475 | 3300046543 | Bacteria | 4886 |
| 690 | Ga0495645_0082744 | 3300046543 | Bacteria | 2302 |
| 691 | Ga0495645_0127177 | 3300046543 | Bacteria | 1790 |
| 692 | Ga0495645_0431152 | 3300046543 | Unclassified | 835 |
| 693 | Ga0495645_0507110 | 3300046543 | Unclassified | 753 |
| 694 | Ga0495645_0816196 | 3300046543 | Bacteria | 559 |
| 695 | Ga0495622_0028227 | 3300046557 | Bacteria | 2620 |
| 696 | Ga0495667_0579554 | 3300046559 | Unclassified | 700 |
| 697 | Ga0495667_0769166 | 3300046559 | Bacteria | 595 |
| 698 | Ga0495667_0834387 | 3300046559 | Unclassified | 567 |
| 699 | Ga0495634_0009163 | 3300046642 | Bacteria | 7310 |
| 700 | Ga0495634_0043769 | 3300046642 | Bacteria | 3034 |
| 701 | Ga0495634_0293434 | 3300046642 | Bacteria | 985 |
| 702 | Ga0495635_0189751 | 3300046663 | Bacteria | 1396 |
| 703 | Ga0495588_0324818 | 3300046674 | Unclassified | 809 |
| 704 | Ga0495657_0733890 | 3300046675 | Bacteria | 567 |
| 705 | Ga0495599_0056448 | 3300046678 | Bacteria | 2458 |
| 706 | Ga0495599_0258696 | 3300046678 | Bacteria | 1058 |
| 707 | Ga0495599_0520511 | 3300046678 | Unclassified | 699 |
| 708 | Ga0495646_0226172 | 3300046680 | Unclassified | 1010 |
| 709 | Ga0495647_0388136 | 3300046681 | Unclassified | 640 |
| 710 | Ga0495647_0428119 | 3300046681 | Bacteria | 610 |
| 711 | Ga0495658_0066062 | 3300046683 | Bacteria | 2088 |
| 712 | Ga0495658_0421644 | 3300046683 | Bacteria | 851 |
| 713 | Ga0495658_0991879 | 3300046683 | Unclassified | 536 |
| 714 | Ga0495669_0104660 | 3300046684 | Unclassified | 1317 |
| 715 | Ga0495613_0014339 | 3300046689 | Bacteria | 5883 |
| 716 | Ga0495613_0199537 | 3300046689 | Unclassified | 1411 |
| 717 | Ga0495613_0264686 | 3300046689 | Bacteria | 1197 |
| 718 | Ga0495613_0476844 | 3300046689 | Bacteria | 842 |
| 719 | Ga0495613_1039756 | 3300046689 | Unclassified | 525 |
| 720 | Ga0495604_1035080 | 3300047317 | Unclassified | 507 |
| 721 | Ga0495636_0309781 | 3300047318 | Unclassified | 740 |
| 722 | Ga0495674_0038375 | 3300047319 | Bacteria | 4300 |
| 723 | Ga0495674_0699378 | 3300047319 | Unclassified | 796 |
| 724 | Ga0495676_0105139 | 3300047321 | Bacteria | 2082 |
| 725 | Ga0495680_0024214 | 3300047322 | Bacteria | 5037 |
| 726 | Ga0495684_0054808 | 3300047471 | Bacteria | 3041 |
| 727 | Ga0495684_0406021 | 3300047471 | Unclassified | 955 |
| 728 | Ga0495684_0667817 | 3300047471 | Bacteria | 693 |
| 729 | Ga0496106_0201388 | 3300048909 | Unclassified | 1584 |
| 730 | Ga0496107_0181400 | 3300048910 | Unclassified | 1563 |
| 731 | Ga0496115_0117239 | 3300048918 | Bacteria | 2190 |
| 732 | Ga0501306_069203 | 3300049127 | Unclassified | 593 |
| 733 | Ga0501305_097551 | 3300049161 | Unclassified | 544 |
| 734 | Ga0501031_0000203 | 3300049568 | Bacteria | 33918 |
| 735 | Ga0501031_0518636 | 3300049568 | Bacteria | 768 |
| 736 | Ga0501032_0008432 | 3300049569 | Bacteria | 7519 |
| 737 | Ga0501032_0143599 | 3300049569 | Bacteria | 1571 |
| 738 | Ga0501033_0007214 | 3300049570 | Bacteria | 8674 |
| 739 | Ga0501033_0498602 | 3300049570 | Bacteria | 842 |
| 740 | Ga0501034_0558255 | 3300049571 | Bacteria | 1054 |
| 741 | Ga0501034_1376486 | 3300049571 | Unclassified | 581 |
| 742 | Ga0501036_0526368 | 3300049572 | Bacteria | 983 |
| 743 | Ga0501036_1361048 | 3300049572 | Unclassified | 576 |
| 744 | Ga0501038_0864430 | 3300049574 | Bacteria | 669 |
| 745 | Ga0501039_0869117 | 3300049575 | Unclassified | 702 |
| 746 | Ga0501046_0115284 | 3300049580 | Bacteria | 2049 |
| 747 | Ga0501047_0148567 | 3300049581 | Bacteria | 2220 |
| 748 | Ga0501047_1044681 | 3300049581 | Unclassified | 630 |
| 749 | Ga0501070_1280925 | 3300049586 | Unclassified | 560 |
| 750 | Ga0501222_021115 | 3300049662 | Unclassified | 873 |
| 751 | Ga0501249_066294 | 3300049679 | Unclassified | 840 |
| 752 | Ga0501257_090794 | 3300049686 | Unclassified | 795 |
| 753 | Ga0501257_199329 | 3300049686 | Unclassified | 575 |
| 754 | Ga0501260_055282 | 3300049689 | Bacteria | 508 |
| 755 | Ga0501229_026822 | 3300049706 | Bacteria | 778 |
| 756 | Ga0501080_0390850 | 3300049742 | Bacteria | 1252 |
| 757 | Ga0501275_050451 | 3300049772 | Bacteria | 609 |
| 758 | Ga0501035_0007635 | 3300049822 | Bacteria | 10104 |
| 759 | Ga0501035_0036941 | 3300049822 | Bacteria | 4426 |
| 760 | Ga0501035_0069927 | 3300049822 | Bacteria | 3110 |
| 761 | Ga0501044_0000928 | 3300049823 | Bacteria | 35229 |
| 762 | Ga0501044_0017307 | 3300049823 | Bacteria | 7731 |
| 763 | nmdc:mga08y16_644868_c1 | 3300050511 | Unclassified | 1064 |
| 764 | nmdc:mga08y16_859334_c1 | 3300050511 | Unclassified | 896 |
| 765 | nmdc:mga08y16_88364_c1 | 3300050511 | Bacteria | 3230 |
| 766 | nmdc:mga0n895_1692147_c1 | 3300050512 | Bacteria | 595 |
| 767 | nmdc:mga0n895_1902941_c1 | 3300050512 | Bacteria | 554 |
| 768 | nmdc:mga08x19_257704_c1 | 3300050514 | Bacteria | 1205 |
| 769 | Ga0495601_0273052 | 3300053077 | Bacteria | 1103 |
| 770 | Ga0495601_0280829 | 3300053077 | Unclassified | 1086 |
| 771 | Ga0500651_0154304 | 3300053093 | Unclassified | 1377 |
| 772 | Ga0500650_0077906 | 3300053098 | Bacteria | 1549 |
| 773 | Ga0500650_0267547 | 3300053098 | Unclassified | 763 |
| 774 | Ga0500595_153345 | 3300053119 | Unclassified | 643 |
| 775 | Ga0500616_0118612 | 3300053153 | Bacteria | 1267 |
| 776 | Ga0590071_035465 | 3300059421 | Unclassified | 1195 |
| 777 | Ga0587128_077233 | 3300059630 | Unclassified | 660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100848526 | Ga0070689_1008485262 | 80 |
| 2 | 3300005436 | Ga0070713_100654135 | Ga0070713_1006541352 | 80 |
| 3 | 3300005437 | Ga0070710_11391709 | Ga0070710_113917091 | 80 |
| 4 | 3300005468 | Ga0070707_102201639 | Ga0070707_1022016391 | 80 |
| 5 | 3300005530 | Ga0070679_100686182 | Ga0070679_1006861822 | 80 |
| 6 | 3300005617 | Ga0068859_100023109 | Ga0068859_1000231095 | 80 |
| 7 | 3300006931 | Ga0097620_100023109 | Ga0097620_1000231095 | 80 |
| 8 | 3300050511 | nmdc:mga08y16_88364_c1 | nmdc:mga08y16_88364_c1_10_261 | 80 |
| 9 | 3300046477 | Ga0495664_0630010 | Ga0495664_0630010_362_625 | 84 |
| 10 | 3300005341 | Ga0070691_10028998 | Ga0070691_100289982 | 86 |
| 11 | 3300005614 | Ga0068856_100485674 | Ga0068856_1004856742 | 93 |
| 12 | 3300009098 | Ga0105245_12663560 | Ga0105245_126635602 | 93 |
| 13 | 3300009551 | Ga0105238_11167475 | Ga0105238_111674752 | 93 |
| 14 | 3300020070 | Ga0206356_11803190 | Ga0206356_118031901 | 93 |
| 15 | 3300020080 | Ga0206350_11359674 | Ga0206350_113596742 | 93 |
| 16 | 3300022467 | Ga0224712_10533823 | Ga0224712_105338232 | 93 |
| 17 | 3300025924 | Ga0207694_10840383 | Ga0207694_108403831 | 93 |
| 18 | 3300028556 | Ga0265337_1089782 | Ga0265337_10897822 | 93 |
| 19 | 3300028577 | Ga0265318_10160506 | Ga0265318_101605062 | 93 |
| 20 | 3300028577 | Ga0265318_10372184 | Ga0265318_103721841 | 93 |
| 21 | 3300028666 | Ga0265336_10119637 | Ga0265336_101196372 | 93 |
| 22 | 3300028800 | Ga0265338_10051004 | Ga0265338_100510042 | 93 |
| 23 | 3300028800 | Ga0265338_10510824 | Ga0265338_105108242 | 93 |
| 24 | 3300029957 | Ga0265324_10000497 | Ga0265324_1000049711 | 93 |
| 25 | 3300029957 | Ga0265324_10005898 | Ga0265324_100058983 | 93 |
| 26 | 3300029957 | Ga0265324_10014914 | Ga0265324_100149144 | 93 |
| 27 | 3300031241 | Ga0265325_10097339 | Ga0265325_100973393 | 93 |
| 28 | 3300031344 | Ga0265316_10646002 | Ga0265316_106460023 | 93 |
| 29 | 3300035695 | Ga0373927_0344516 | Ga0373927_0344516_56_337 | 93 |
| 30 | 3300037068 | Ga0373925_0076093 | Ga0373925_0076093_596_877 | 93 |
| 31 | 3300044712 | Ga0453684_0183186 | Ga0453684_0183186_847_1128 | 93 |
| 32 | 3300044712 | Ga0453684_0959676 | Ga0453684_0959676_92_373 | 93 |
| 33 | 3300053093 | Ga0500651_0154304 | Ga0500651_0154304_473_754 | 93 |
| 34 | 3300053098 | Ga0500650_0077906 | Ga0500650_0077906_1127_1408 | 93 |
| 35 | 3300005327 | Ga0070658_10682727 | Ga0070658_106827271 | 94 |
| 36 | 3300005327 | Ga0070658_10808282 | Ga0070658_108082822 | 94 |
| 37 | 3300005327 | Ga0070658_11244481 | Ga0070658_112444811 | 94 |
| 38 | 3300005334 | Ga0068869_101458883 | Ga0068869_1014588832 | 94 |
| 39 | 3300005353 | Ga0070669_101440414 | Ga0070669_1014404141 | 94 |
| 40 | 3300005354 | Ga0070675_101443973 | Ga0070675_1014439732 | 94 |
| 41 | 3300005356 | Ga0070674_101889740 | Ga0070674_1018897402 | 94 |
| 42 | 3300005436 | Ga0070713_100067334 | Ga0070713_1000673345 | 94 |
| 43 | 3300005436 | Ga0070713_102092158 | Ga0070713_1020921581 | 94 |
| 44 | 3300005439 | Ga0070711_101956615 | Ga0070711_1019566151 | 94 |
| 45 | 3300005535 | Ga0070684_101664385 | Ga0070684_1016643852 | 94 |
| 46 | 3300005546 | Ga0070696_100499695 | Ga0070696_1004996951 | 94 |
| 47 | 3300005563 | Ga0068855_100594062 | Ga0068855_1005940623 | 94 |
| 48 | 3300005577 | Ga0068857_100981396 | Ga0068857_1009813962 | 94 |
| 49 | 3300005614 | Ga0068856_100002798 | Ga0068856_10000279810 | 94 |
| 50 | 3300005615 | Ga0070702_100958535 | Ga0070702_1009585351 | 94 |
| 51 | 3300005719 | Ga0068861_101150284 | Ga0068861_1011502841 | 94 |
| 52 | 3300005841 | Ga0068863_100502503 | Ga0068863_1005025032 | 94 |
| 53 | 3300005841 | Ga0068863_100822777 | Ga0068863_1008227771 | 94 |
| 54 | 3300005843 | Ga0068860_100452901 | Ga0068860_1004529012 | 94 |
| 55 | 3300005843 | Ga0068860_101516174 | Ga0068860_1015161741 | 94 |
| 56 | 3300005844 | Ga0068862_100311034 | Ga0068862_1003110343 | 94 |
| 57 | 3300006163 | Ga0070715_11056509 | Ga0070715_110565091 | 94 |
| 58 | 3300006358 | Ga0068871_100440014 | Ga0068871_1004400141 | 94 |
| 59 | 3300006852 | Ga0075433_10613432 | Ga0075433_106134322 | 94 |
| 60 | 3300006931 | Ga0097620_102924185 | Ga0097620_1029241851 | 94 |
| 61 | 3300007265 | Ga0099794_10392331 | Ga0099794_103923311 | 94 |
| 62 | 3300007265 | Ga0099794_10807308 | Ga0099794_108073081 | 94 |
| 63 | 3300007788 | Ga0099795_10045715 | Ga0099795_100457152 | 94 |
| 64 | 3300009093 | Ga0105240_10247162 | Ga0105240_102471624 | 94 |
| 65 | 3300009093 | Ga0105240_10428626 | Ga0105240_104286262 | 94 |
| 66 | 3300009098 | Ga0105245_12408171 | Ga0105245_124081711 | 94 |
| 67 | 3300009177 | Ga0105248_10102792 | Ga0105248_101027923 | 94 |
| 68 | 3300009545 | Ga0105237_10728191 | Ga0105237_107281914 | 94 |
| 69 | 3300009545 | Ga0105237_11813844 | Ga0105237_118138442 | 94 |
| 70 | 3300009551 | Ga0105238_10058361 | Ga0105238_100583611 | 94 |
| 71 | 3300009551 | Ga0105238_10058392 | Ga0105238_100583925 | 94 |
| 72 | 3300009551 | Ga0105238_10090988 | Ga0105238_100909884 | 94 |
| 73 | 3300009551 | Ga0105238_10218190 | Ga0105238_102181902 | 94 |
| 74 | 3300009551 | Ga0105238_10651457 | Ga0105238_106514573 | 94 |
| 75 | 3300009553 | Ga0105249_11541964 | Ga0105249_115419642 | 94 |
| 76 | 3300010375 | Ga0105239_11767158 | Ga0105239_117671581 | 94 |
| 77 | 3300011119 | Ga0105246_12002802 | Ga0105246_120028021 | 94 |
| 78 | 3300013296 | Ga0157374_11125289 | Ga0157374_111252891 | 94 |
| 79 | 3300013296 | Ga0157374_11765850 | Ga0157374_117658502 | 94 |
| 80 | 3300013306 | Ga0163162_10080930 | Ga0163162_100809303 | 94 |
| 81 | 3300014325 | Ga0163163_10059507 | Ga0163163_100595074 | 94 |
| 82 | 3300014326 | Ga0157380_12005629 | Ga0157380_120056292 | 94 |
| 83 | 3300014968 | Ga0157379_10204734 | Ga0157379_102047342 | 94 |
| 84 | 3300014969 | Ga0157376_11001752 | Ga0157376_110017522 | 94 |
| 85 | 3300015262 | Ga0182007_10418969 | Ga0182007_104189691 | 94 |
| 86 | 3300020070 | Ga0206356_10061388 | Ga0206356_100613881 | 94 |
| 87 | 3300020077 | Ga0206351_10916508 | Ga0206351_109165082 | 94 |
| 88 | 3300020078 | Ga0206352_10077544 | Ga0206352_100775442 | 94 |
| 89 | 3300025909 | Ga0207705_10622501 | Ga0207705_106225012 | 94 |
| 90 | 3300025909 | Ga0207705_10936393 | Ga0207705_109363932 | 94 |
| 91 | 3300025913 | Ga0207695_11619000 | Ga0207695_116190001 | 94 |
| 92 | 3300025914 | Ga0207671_10441233 | Ga0207671_104412332 | 94 |
| 93 | 3300025914 | Ga0207671_11386733 | Ga0207671_113867331 | 94 |
| 94 | 3300025915 | Ga0207693_10062717 | Ga0207693_100627171 | 94 |
| 95 | 3300025916 | Ga0207663_11612455 | Ga0207663_116124552 | 94 |
| 96 | 3300025924 | Ga0207694_10056957 | Ga0207694_100569574 | 94 |
| 97 | 3300025924 | Ga0207694_10229630 | Ga0207694_102296302 | 94 |
| 98 | 3300025924 | Ga0207694_10404762 | Ga0207694_104047622 | 94 |
| 99 | 3300025949 | Ga0207667_10085720 | Ga0207667_100857204 | 94 |
| 100 | 3300025949 | Ga0207667_10279608 | Ga0207667_102796083 | 94 |
| 101 | 3300025961 | Ga0207712_10526962 | Ga0207712_105269622 | 94 |
| 102 | 3300026078 | Ga0207702_10001987 | Ga0207702_1000198710 | 94 |
| 103 | 3300026088 | Ga0207641_10336223 | Ga0207641_103362232 | 94 |
| 104 | 3300026095 | Ga0207676_10541887 | Ga0207676_105418873 | 94 |
| 105 | 3300026116 | Ga0207674_10119451 | Ga0207674_101194512 | 94 |
| 106 | 3300028558 | Ga0265326_10041126 | Ga0265326_100411263 | 94 |
| 107 | 3300028558 | Ga0265326_10214143 | Ga0265326_102141432 | 94 |
| 108 | 3300028653 | Ga0265323_10246479 | Ga0265323_102464791 | 94 |
| 109 | 3300028800 | Ga0265338_10000293 | Ga0265338_1000029367 | 94 |
| 110 | 3300028800 | Ga0265338_10000334 | Ga0265338_100003349 | 94 |
| 111 | 3300028800 | Ga0265338_10011017 | Ga0265338_100110178 | 94 |
| 112 | 3300028800 | Ga0265338_10028064 | Ga0265338_100280642 | 94 |
| 113 | 3300028800 | Ga0265338_10589925 | Ga0265338_105899252 | 94 |
| 114 | 3300028800 | Ga0265338_10951110 | Ga0265338_109511101 | 94 |
| 115 | 3300029957 | Ga0265324_10004477 | Ga0265324_100044774 | 94 |
| 116 | 3300031235 | Ga0265330_10376438 | Ga0265330_103764381 | 94 |
| 117 | 3300031240 | Ga0265320_10262590 | Ga0265320_102625901 | 94 |
| 118 | 3300031249 | Ga0265339_10045383 | Ga0265339_100453833 | 94 |
| 119 | 3300031249 | Ga0265339_10120594 | Ga0265339_101205942 | 94 |
| 120 | 3300031250 | Ga0265331_10145531 | Ga0265331_101455312 | 94 |
| 121 | 3300031251 | Ga0265327_10000707 | Ga0265327_100007079 | 94 |
| 122 | 3300031251 | Ga0265327_10007941 | Ga0265327_100079413 | 94 |
| 123 | 3300031344 | Ga0265316_10116523 | Ga0265316_101165231 | 94 |
| 124 | 3300031344 | Ga0265316_10170567 | Ga0265316_101705671 | 94 |
| 125 | 3300031344 | Ga0265316_10301063 | Ga0265316_103010632 | 94 |
| 126 | 3300031344 | Ga0265316_10921338 | Ga0265316_109213381 | 94 |
| 127 | 3300031344 | Ga0265316_11070914 | Ga0265316_110709142 | 94 |
| 128 | 3300031712 | Ga0265342_10437365 | Ga0265342_104373652 | 94 |
| 129 | 3300031731 | Ga0307405_11006522 | Ga0307405_110065222 | 94 |
| 130 | 3300031824 | Ga0307413_11501271 | Ga0307413_115012711 | 94 |
| 131 | 3300031911 | Ga0307412_10184900 | Ga0307412_101849002 | 94 |
| 132 | 3300031995 | Ga0307409_101249666 | Ga0307409_1012496661 | 94 |
| 133 | 3300032004 | Ga0307414_10611136 | Ga0307414_106111361 | 94 |
| 134 | 3300034816 | Ga0373930_0022447 | Ga0373930_0022447_54_338 | 94 |
| 135 | 3300034820 | Ga0373959_0015678 | Ga0373959_0015678_758_1042 | 94 |
| 136 | 3300035083 | Ga0373926_0160551 | Ga0373926_0160551_122_406 | 94 |
| 137 | 3300035084 | Ga0373928_0000024 | Ga0373928_0000024_21167_21451 | 94 |
| 138 | 3300035085 | Ga0373929_0000895 | Ga0373929_0000895_2017_2301 | 94 |
| 139 | 3300035088 | Ga0373940_0030071 | Ga0373940_0030071_822_1106 | 94 |
| 140 | 3300035089 | Ga0373944_0000514 | Ga0373944_0000514_5217_5501 | 94 |
| 141 | 3300035090 | Ga0373949_0007193 | Ga0373949_0007193_1595_1879 | 94 |
| 142 | 3300035091 | Ga0373951_0001684 | Ga0373951_0001684_1873_2157 | 94 |
| 143 | 3300035112 | Ga0373932_0000006 | Ga0373932_0000006_198667_198951 | 94 |
| 144 | 3300035114 | Ga0373939_0150575 | Ga0373939_0150575_43_327 | 94 |
| 145 | 3300035170 | Ga0373943_0207097 | Ga0373943_0207097_388_672 | 94 |
| 146 | 3300035171 | Ga0373946_0322510 | Ga0373946_0322510_357_641 | 94 |
| 147 | 3300035171 | Ga0373946_0678594 | Ga0373946_0678594_32_316 | 94 |
| 148 | 3300035172 | Ga0373955_0940999 | Ga0373955_0940999_147_431 | 94 |
| 149 | 3300035207 | Ga0373942_0079562 | Ga0373942_0079562_661_945 | 94 |
| 150 | 3300035242 | Ga0373962_0000162 | Ga0373962_0000162_9534_9818 | 94 |
| 151 | 3300035691 | Ga0373931_0000009 | Ga0373931_0000009_196982_197266 | 94 |
| 152 | 3300035691 | Ga0373931_0071622 | Ga0373931_0071622_457_741 | 94 |
| 153 | 3300035691 | Ga0373931_0363796 | Ga0373931_0363796_396_680 | 94 |
| 154 | 3300035692 | Ga0373935_0061713 | Ga0373935_0061713_1793_2077 | 94 |
| 155 | 3300035692 | Ga0373935_0987743 | Ga0373935_0987743_145_429 | 94 |
| 156 | 3300035695 | Ga0373927_0020430 | Ga0373927_0020430_3693_3977 | 94 |
| 157 | 3300035695 | Ga0373927_0304740 | Ga0373927_0304740_497_781 | 94 |
| 158 | 3300036401 | Ga0373937_1318498 | Ga0373937_1318498_170_454 | 94 |
| 159 | 3300037068 | Ga0373925_0000498 | Ga0373925_0000498_36977_37261 | 94 |
| 160 | 3300037068 | Ga0373925_0233403 | Ga0373925_0233403_631_915 | 94 |
| 161 | 3300037068 | Ga0373925_1352726 | Ga0373925_1352726_164_448 | 94 |
| 162 | 3300037068 | Ga0373925_1411675 | Ga0373925_1411675_155_439 | 94 |
| 163 | 3300041496 | Ga0451839_0496865 | Ga0451839_0496865_296_583 | 94 |
| 164 | 3300041496 | Ga0451839_0584655 | Ga0451839_0584655_63_347 | 94 |
| 165 | 3300042876 | Ga0451577_0583306 | Ga0451577_0583306_485_769 | 94 |
| 166 | 3300044673 | Ga0453683_0739032 | Ga0453683_0739032_101_385 | 94 |
| 167 | 3300045051 | Ga0451576_0376963 | Ga0451576_0376963_708_992 | 94 |
| 168 | 3300045051 | Ga0451576_0440598 | Ga0451576_0440598_865_1149 | 94 |
| 169 | 3300045051 | Ga0451576_0991917 | Ga0451576_0991917_534_818 | 94 |
| 170 | 3300045051 | Ga0451576_1050733 | Ga0451576_1050733_353_637 | 94 |
| 171 | 3300045051 | Ga0451576_2312339 | Ga0451576_2312339_133_417 | 94 |
| 172 | 3300046455 | Ga0495603_0211200 | Ga0495603_0211200_651_935 | 94 |
| 173 | 3300046461 | Ga0495641_0054259 | Ga0495641_0054259_91_375 | 94 |
| 174 | 3300046462 | Ga0495651_0218694 | Ga0495651_0218694_387_671 | 94 |
| 175 | 3300046475 | Ga0495639_0340601 | Ga0495639_0340601_198_482 | 94 |
| 176 | 3300046517 | Ga0495630_1485614 | Ga0495630_1485614_197_481 | 94 |
| 177 | 3300046535 | Ga0495586_0026563 | Ga0495586_0026563_2121_2405 | 94 |
| 178 | 3300046543 | Ga0495645_0082744 | Ga0495645_0082744_627_911 | 94 |
| 179 | 3300046543 | Ga0495645_0127177 | Ga0495645_0127177_60_344 | 94 |
| 180 | 3300046543 | Ga0495645_0816196 | Ga0495645_0816196_28_312 | 94 |
| 181 | 3300046557 | Ga0495622_0028227 | Ga0495622_0028227_486_770 | 94 |
| 182 | 3300046663 | Ga0495635_0189751 | Ga0495635_0189751_821_1105 | 94 |
| 183 | 3300046678 | Ga0495599_0056448 | Ga0495599_0056448_170_454 | 94 |
| 184 | 3300046683 | Ga0495658_0066062 | Ga0495658_0066062_1414_1698 | 94 |
| 185 | 3300046689 | Ga0495613_0199537 | Ga0495613_0199537_426_710 | 94 |
| 186 | 3300049127 | Ga0501306_069203 | Ga0501306_069203_271_555 | 94 |
| 187 | 3300049161 | Ga0501305_097551 | Ga0501305_097551_45_329 | 94 |
| 188 | 3300049568 | Ga0501031_0000203 | Ga0501031_0000203_25782_26066 | 94 |
| 189 | 3300049568 | Ga0501031_0518636 | Ga0501031_0518636_319_603 | 94 |
| 190 | 3300049569 | Ga0501032_0008432 | Ga0501032_0008432_5406_5690 | 94 |
| 191 | 3300049569 | Ga0501032_0143599 | Ga0501032_0143599_532_816 | 94 |
| 192 | 3300049570 | Ga0501033_0007214 | Ga0501033_0007214_498_782 | 94 |
| 193 | 3300049570 | Ga0501033_0498602 | Ga0501033_0498602_513_797 | 94 |
| 194 | 3300049572 | Ga0501036_0526368 | Ga0501036_0526368_430_714 | 94 |
| 195 | 3300049574 | Ga0501038_0864430 | Ga0501038_0864430_42_326 | 94 |
| 196 | 3300049580 | Ga0501046_0115284 | Ga0501046_0115284_1622_1906 | 94 |
| 197 | 3300049581 | Ga0501047_0148567 | Ga0501047_0148567_895_1179 | 94 |
| 198 | 3300049581 | Ga0501047_1044681 | Ga0501047_1044681_277_561 | 94 |
| 199 | 3300049586 | Ga0501070_1280925 | Ga0501070_1280925_222_506 | 94 |
| 200 | 3300049662 | Ga0501222_021115 | Ga0501222_021115_422_706 | 94 |
| 201 | 3300049679 | Ga0501249_066294 | Ga0501249_066294_15_299 | 94 |
| 202 | 3300049686 | Ga0501257_090794 | Ga0501257_090794_468_752 | 94 |
| 203 | 3300049706 | Ga0501229_026822 | Ga0501229_026822_39_323 | 94 |
| 204 | 3300049742 | Ga0501080_0390850 | Ga0501080_0390850_262_546 | 94 |
| 205 | 3300049822 | Ga0501035_0007635 | Ga0501035_0007635_1015_1299 | 94 |
| 206 | 3300049822 | Ga0501035_0036941 | Ga0501035_0036941_1968_2252 | 94 |
| 207 | 3300049822 | Ga0501035_0069927 | Ga0501035_0069927_2704_2988 | 94 |
| 208 | 3300049823 | Ga0501044_0000928 | Ga0501044_0000928_7875_8159 | 94 |
| 209 | 3300049823 | Ga0501044_0017307 | Ga0501044_0017307_2196_2480 | 94 |
| 210 | 3300050512 | nmdc:mga0n895_1692147_c1 | nmdc:mga0n895_1692147_c1_37_321 | 94 |
| 211 | 3300059421 | Ga0590071_035465 | Ga0590071_035465_556_840 | 94 |
| 212 | 3300059630 | Ga0587128_077233 | Ga0587128_077233_48_332 | 94 |
| 213 | 3300004799 | Ga0058863_11510544 | Ga0058863_115105442 | 95 |
| 214 | 3300004801 | Ga0058860_12232918 | Ga0058860_122329183 | 95 |
| 215 | 3300004803 | Ga0058862_10971528 | Ga0058862_109715282 | 95 |
| 216 | 3300005295 | Ga0065707_10960953 | Ga0065707_109609531 | 95 |
| 217 | 3300005327 | Ga0070658_10115420 | Ga0070658_101154203 | 95 |
| 218 | 3300005327 | Ga0070658_10752795 | Ga0070658_107527951 | 95 |
| 219 | 3300005328 | Ga0070676_10512517 | Ga0070676_105125171 | 95 |
| 220 | 3300005329 | Ga0070683_102147433 | Ga0070683_1021474331 | 95 |
| 221 | 3300005330 | Ga0070690_100003263 | Ga0070690_1000032637 | 95 |
| 222 | 3300005335 | Ga0070666_10023056 | Ga0070666_100230564 | 95 |
| 223 | 3300005335 | Ga0070666_11396513 | Ga0070666_113965131 | 95 |
| 224 | 3300005337 | Ga0070682_101765492 | Ga0070682_1017654921 | 95 |
| 225 | 3300005338 | Ga0068868_100227923 | Ga0068868_1002279233 | 95 |
| 226 | 3300005338 | Ga0068868_100909395 | Ga0068868_1009093952 | 95 |
| 227 | 3300005338 | Ga0068868_101274129 | Ga0068868_1012741291 | 95 |
| 228 | 3300005338 | Ga0068868_102027746 | Ga0068868_1020277461 | 95 |
| 229 | 3300005338 | Ga0068868_102045725 | Ga0068868_1020457251 | 95 |
| 230 | 3300005340 | Ga0070689_100033442 | Ga0070689_1000334426 | 95 |
| 231 | 3300005340 | Ga0070689_100154286 | Ga0070689_1001542861 | 95 |
| 232 | 3300005340 | Ga0070689_100419056 | Ga0070689_1004190562 | 95 |
| 233 | 3300005340 | Ga0070689_100551740 | Ga0070689_1005517402 | 95 |
| 234 | 3300005340 | Ga0070689_100600468 | Ga0070689_1006004682 | 95 |
| 235 | 3300005340 | Ga0070689_101357451 | Ga0070689_1013574512 | 95 |
| 236 | 3300005340 | Ga0070689_101514758 | Ga0070689_1015147582 | 95 |
| 237 | 3300005340 | Ga0070689_102205501 | Ga0070689_1022055011 | 95 |
| 238 | 3300005341 | Ga0070691_10051968 | Ga0070691_100519683 | 95 |
| 239 | 3300005343 | Ga0070687_100676205 | Ga0070687_1006762051 | 95 |
| 240 | 3300005343 | Ga0070687_101012636 | Ga0070687_1010126362 | 95 |
| 241 | 3300005345 | Ga0070692_11046091 | Ga0070692_110460912 | 95 |
| 242 | 3300005347 | Ga0070668_100903747 | Ga0070668_1009037471 | 95 |
| 243 | 3300005347 | Ga0070668_102038237 | Ga0070668_1020382371 | 95 |
| 244 | 3300005354 | Ga0070675_100645041 | Ga0070675_1006450411 | 95 |
| 245 | 3300005354 | Ga0070675_101299864 | Ga0070675_1012998642 | 95 |
| 246 | 3300005355 | Ga0070671_100699642 | Ga0070671_1006996422 | 95 |
| 247 | 3300005356 | Ga0070674_100784802 | Ga0070674_1007848022 | 95 |
| 248 | 3300005364 | Ga0070673_100539919 | Ga0070673_1005399192 | 95 |
| 249 | 3300005364 | Ga0070673_102404849 | Ga0070673_1024048491 | 95 |
| 250 | 3300005365 | Ga0070688_100026549 | Ga0070688_1000265494 | 95 |
| 251 | 3300005365 | Ga0070688_100123717 | Ga0070688_1001237173 | 95 |
| 252 | 3300005365 | Ga0070688_100429879 | Ga0070688_1004298791 | 95 |
| 253 | 3300005365 | Ga0070688_100430454 | Ga0070688_1004304541 | 95 |
| 254 | 3300005365 | Ga0070688_101217340 | Ga0070688_1012173402 | 95 |
| 255 | 3300005435 | Ga0070714_100027149 | Ga0070714_1000271492 | 95 |
| 256 | 3300005435 | Ga0070714_102475879 | Ga0070714_1024758791 | 95 |
| 257 | 3300005436 | Ga0070713_100983192 | Ga0070713_1009831922 | 95 |
| 258 | 3300005437 | Ga0070710_11466846 | Ga0070710_114668461 | 95 |
| 259 | 3300005438 | Ga0070701_11095667 | Ga0070701_110956671 | 95 |
| 260 | 3300005439 | Ga0070711_100301601 | Ga0070711_1003016012 | 95 |
| 261 | 3300005439 | Ga0070711_100877092 | Ga0070711_1008770922 | 95 |
| 262 | 3300005440 | Ga0070705_101452877 | Ga0070705_1014528771 | 95 |
| 263 | 3300005441 | Ga0070700_100681657 | Ga0070700_1006816572 | 95 |
| 264 | 3300005444 | Ga0070694_100734133 | Ga0070694_1007341332 | 95 |
| 265 | 3300005456 | Ga0070678_101256202 | Ga0070678_1012562021 | 95 |
| 266 | 3300005457 | Ga0070662_101742423 | Ga0070662_1017424232 | 95 |
| 267 | 3300005458 | Ga0070681_10077982 | Ga0070681_100779823 | 95 |
| 268 | 3300005458 | Ga0070681_10353516 | Ga0070681_103535163 | 95 |
| 269 | 3300005466 | Ga0070685_10400759 | Ga0070685_104007592 | 95 |
| 270 | 3300005466 | Ga0070685_10702480 | Ga0070685_107024802 | 95 |
| 271 | 3300005466 | Ga0070685_11217580 | Ga0070685_112175801 | 95 |
| 272 | 3300005530 | Ga0070679_100400227 | Ga0070679_1004002272 | 95 |
| 273 | 3300005530 | Ga0070679_100609689 | Ga0070679_1006096891 | 95 |
| 274 | 3300005530 | Ga0070679_101079731 | Ga0070679_1010797312 | 95 |
| 275 | 3300005535 | Ga0070684_101576845 | Ga0070684_1015768451 | 95 |
| 276 | 3300005543 | Ga0070672_100747958 | Ga0070672_1007479582 | 95 |
| 277 | 3300005544 | Ga0070686_100147887 | Ga0070686_1001478873 | 95 |
| 278 | 3300005544 | Ga0070686_100329480 | Ga0070686_1003294802 | 95 |
| 279 | 3300005544 | Ga0070686_100564458 | Ga0070686_1005644582 | 95 |
| 280 | 3300005544 | Ga0070686_101658085 | Ga0070686_1016580851 | 95 |
| 281 | 3300005544 | Ga0070686_101689201 | Ga0070686_1016892011 | 95 |
| 282 | 3300005545 | Ga0070695_100537720 | Ga0070695_1005377202 | 95 |
| 283 | 3300005545 | Ga0070695_101435200 | Ga0070695_1014352001 | 95 |
| 284 | 3300005549 | Ga0070704_101185687 | Ga0070704_1011856871 | 95 |
| 285 | 3300005563 | Ga0068855_100181145 | Ga0068855_1001811454 | 95 |
| 286 | 3300005563 | Ga0068855_100744440 | Ga0068855_1007444402 | 95 |
| 287 | 3300005563 | Ga0068855_101143852 | Ga0068855_1011438522 | 95 |
| 288 | 3300005563 | Ga0068855_101379109 | Ga0068855_1013791092 | 95 |
| 289 | 3300005614 | Ga0068856_100014899 | Ga0068856_1000148998 | 95 |
| 290 | 3300005614 | Ga0068856_101042129 | Ga0068856_1010421292 | 95 |
| 291 | 3300005614 | Ga0068856_102176829 | Ga0068856_1021768291 | 95 |
| 292 | 3300005616 | Ga0068852_101381641 | Ga0068852_1013816412 | 95 |
| 293 | 3300005616 | Ga0068852_101417753 | Ga0068852_1014177532 | 95 |
| 294 | 3300005617 | Ga0068859_101814311 | Ga0068859_1018143112 | 95 |
| 295 | 3300005617 | Ga0068859_101979183 | Ga0068859_1019791832 | 95 |
| 296 | 3300005617 | Ga0068859_102969123 | Ga0068859_1029691231 | 95 |
| 297 | 3300005618 | Ga0068864_100263320 | Ga0068864_1002633203 | 95 |
| 298 | 3300005618 | Ga0068864_100536056 | Ga0068864_1005360563 | 95 |
| 299 | 3300005618 | Ga0068864_101718194 | Ga0068864_1017181942 | 95 |
| 300 | 3300005618 | Ga0068864_101883077 | Ga0068864_1018830772 | 95 |
| 301 | 3300005618 | Ga0068864_102497305 | Ga0068864_1024973051 | 95 |
| 302 | 3300005719 | Ga0068861_100608686 | Ga0068861_1006086862 | 95 |
| 303 | 3300005834 | Ga0068851_10863407 | Ga0068851_108634071 | 95 |
| 304 | 3300005841 | Ga0068863_100184044 | Ga0068863_1001840441 | 95 |
| 305 | 3300005841 | Ga0068863_100330546 | Ga0068863_1003305462 | 95 |
| 306 | 3300005841 | Ga0068863_100930784 | Ga0068863_1009307843 | 95 |
| 307 | 3300005842 | Ga0068858_100521382 | Ga0068858_1005213822 | 95 |
| 308 | 3300005842 | Ga0068858_100801023 | Ga0068858_1008010232 | 95 |
| 309 | 3300005843 | Ga0068860_102225373 | Ga0068860_1022253731 | 95 |
| 310 | 3300005843 | Ga0068860_102450039 | Ga0068860_1024500391 | 95 |
| 311 | 3300006028 | Ga0070717_11048036 | Ga0070717_110480363 | 95 |
| 312 | 3300006028 | Ga0070717_12156785 | Ga0070717_121567851 | 95 |
| 313 | 3300006163 | Ga0070715_10125489 | Ga0070715_101254893 | 95 |
| 314 | 3300006173 | Ga0070716_100870238 | Ga0070716_1008702382 | 95 |
| 315 | 3300006175 | Ga0070712_101124922 | Ga0070712_1011249221 | 95 |
| 316 | 3300006237 | Ga0097621_100292419 | Ga0097621_1002924192 | 95 |
| 317 | 3300006237 | Ga0097621_100433305 | Ga0097621_1004333053 | 95 |
| 318 | 3300006237 | Ga0097621_100732623 | Ga0097621_1007326232 | 95 |
| 319 | 3300006358 | Ga0068871_100156929 | Ga0068871_1001569292 | 95 |
| 320 | 3300006358 | Ga0068871_101265849 | Ga0068871_1012658492 | 95 |
| 321 | 3300006358 | Ga0068871_101427936 | Ga0068871_1014279361 | 95 |
| 322 | 3300006880 | Ga0075429_101378833 | Ga0075429_1013788332 | 95 |
| 323 | 3300006881 | Ga0068865_100409838 | Ga0068865_1004098381 | 95 |
| 324 | 3300006881 | Ga0068865_100895359 | Ga0068865_1008953591 | 95 |
| 325 | 3300006914 | Ga0075436_100267045 | Ga0075436_1002670451 | 95 |
| 326 | 3300006931 | Ga0097620_101814385 | Ga0097620_1018143852 | 95 |
| 327 | 3300006931 | Ga0097620_101980092 | Ga0097620_1019800922 | 95 |
| 328 | 3300006931 | Ga0097620_102071774 | Ga0097620_1020717741 | 95 |
| 329 | 3300006931 | Ga0097620_102968778 | Ga0097620_1029687781 | 95 |
| 330 | 3300007076 | Ga0075435_100849743 | Ga0075435_1008497431 | 95 |
| 331 | 3300007265 | Ga0099794_10483699 | Ga0099794_104836991 | 95 |
| 332 | 3300007265 | Ga0099794_10790363 | Ga0099794_107903631 | 95 |
| 333 | 3300009093 | Ga0105240_10047636 | Ga0105240_100476363 | 95 |
| 334 | 3300009093 | Ga0105240_10101978 | Ga0105240_101019783 | 95 |
| 335 | 3300009093 | Ga0105240_10115127 | Ga0105240_101151274 | 95 |
| 336 | 3300009093 | Ga0105240_10400180 | Ga0105240_104001803 | 95 |
| 337 | 3300009093 | Ga0105240_10580433 | Ga0105240_105804333 | 95 |
| 338 | 3300009093 | Ga0105240_10621951 | Ga0105240_106219512 | 95 |
| 339 | 3300009093 | Ga0105240_10849605 | Ga0105240_108496051 | 95 |
| 340 | 3300009093 | Ga0105240_11761039 | Ga0105240_117610391 | 95 |
| 341 | 3300009094 | Ga0111539_10167114 | Ga0111539_101671144 | 95 |
| 342 | 3300009094 | Ga0111539_10335934 | Ga0111539_103359343 | 95 |
| 343 | 3300009094 | Ga0111539_10851883 | Ga0111539_108518832 | 95 |
| 344 | 3300009094 | Ga0111539_11948797 | Ga0111539_119487971 | 95 |
| 345 | 3300009094 | Ga0111539_13450423 | Ga0111539_134504231 | 95 |
| 346 | 3300009094 | Ga0111539_13458249 | Ga0111539_134582491 | 95 |
| 347 | 3300009098 | Ga0105245_10049590 | Ga0105245_100495903 | 95 |
| 348 | 3300009098 | Ga0105245_11209051 | Ga0105245_112090512 | 95 |
| 349 | 3300009098 | Ga0105245_11421986 | Ga0105245_114219861 | 95 |
| 350 | 3300009098 | Ga0105245_11435230 | Ga0105245_114352302 | 95 |
| 351 | 3300009147 | Ga0114129_12524696 | Ga0114129_125246962 | 95 |
| 352 | 3300009174 | Ga0105241_10511930 | Ga0105241_105119303 | 95 |
| 353 | 3300009174 | Ga0105241_12430360 | Ga0105241_124303602 | 95 |
| 354 | 3300009176 | Ga0105242_10131680 | Ga0105242_101316803 | 95 |
| 355 | 3300009176 | Ga0105242_10507128 | Ga0105242_105071282 | 95 |
| 356 | 3300009176 | Ga0105242_10699561 | Ga0105242_106995612 | 95 |
| 357 | 3300009176 | Ga0105242_10818974 | Ga0105242_108189742 | 95 |
| 358 | 3300009176 | Ga0105242_10883112 | Ga0105242_108831121 | 95 |
| 359 | 3300009176 | Ga0105242_11369051 | Ga0105242_113690511 | 95 |
| 360 | 3300009176 | Ga0105242_11752773 | Ga0105242_117527732 | 95 |
| 361 | 3300009176 | Ga0105242_11816017 | Ga0105242_118160172 | 95 |
| 362 | 3300009176 | Ga0105242_11924984 | Ga0105242_119249842 | 95 |
| 363 | 3300009176 | Ga0105242_12311854 | Ga0105242_123118542 | 95 |
| 364 | 3300009177 | Ga0105248_10635178 | Ga0105248_106351782 | 95 |
| 365 | 3300009177 | Ga0105248_10731508 | Ga0105248_107315082 | 95 |
| 366 | 3300009177 | Ga0105248_10959587 | Ga0105248_109595871 | 95 |
| 367 | 3300009177 | Ga0105248_11309040 | Ga0105248_113090401 | 95 |
| 368 | 3300009177 | Ga0105248_12064307 | Ga0105248_120643071 | 95 |
| 369 | 3300009177 | Ga0105248_12129477 | Ga0105248_121294771 | 95 |
| 370 | 3300009177 | Ga0105248_12561578 | Ga0105248_125615781 | 95 |
| 371 | 3300009545 | Ga0105237_10392932 | Ga0105237_103929322 | 95 |
| 372 | 3300009545 | Ga0105237_12333514 | Ga0105237_123335141 | 95 |
| 373 | 3300009545 | Ga0105237_12717901 | Ga0105237_127179011 | 95 |
| 374 | 3300009551 | Ga0105238_10022647 | Ga0105238_100226475 | 95 |
| 375 | 3300009551 | Ga0105238_10887867 | Ga0105238_108878671 | 95 |
| 376 | 3300009551 | Ga0105238_11084935 | Ga0105238_110849353 | 95 |
| 377 | 3300009551 | Ga0105238_11142550 | Ga0105238_111425502 | 95 |
| 378 | 3300009551 | Ga0105238_11724171 | Ga0105238_117241711 | 95 |
| 379 | 3300010375 | Ga0105239_11001280 | Ga0105239_110012803 | 95 |
| 380 | 3300010375 | Ga0105239_12786808 | Ga0105239_127868081 | 95 |
| 381 | 3300011119 | Ga0105246_12236546 | Ga0105246_122365462 | 95 |
| 382 | 3300013100 | Ga0157373_10586839 | Ga0157373_105868392 | 95 |
| 383 | 3300013102 | Ga0157371_10065497 | Ga0157371_100654972 | 95 |
| 384 | 3300013102 | Ga0157371_10235223 | Ga0157371_102352232 | 95 |
| 385 | 3300013102 | Ga0157371_10765815 | Ga0157371_107658151 | 95 |
| 386 | 3300013104 | Ga0157370_10144589 | Ga0157370_101445893 | 95 |
| 387 | 3300013104 | Ga0157370_10314144 | Ga0157370_103141442 | 95 |
| 388 | 3300013104 | Ga0157370_10761743 | Ga0157370_107617432 | 95 |
| 389 | 3300013104 | Ga0157370_11009644 | Ga0157370_110096441 | 95 |
| 390 | 3300013105 | Ga0157369_10542131 | Ga0157369_105421311 | 95 |
| 391 | 3300013296 | Ga0157374_10107389 | Ga0157374_101073893 | 95 |
| 392 | 3300013296 | Ga0157374_10208020 | Ga0157374_102080202 | 95 |
| 393 | 3300013296 | Ga0157374_10447167 | Ga0157374_104471672 | 95 |
| 394 | 3300013296 | Ga0157374_10571514 | Ga0157374_105715141 | 95 |
| 395 | 3300013296 | Ga0157374_10728890 | Ga0157374_107288902 | 95 |
| 396 | 3300013296 | Ga0157374_10737617 | Ga0157374_107376172 | 95 |
| 397 | 3300013296 | Ga0157374_11184252 | Ga0157374_111842522 | 95 |
| 398 | 3300013296 | Ga0157374_11218483 | Ga0157374_112184831 | 95 |
| 399 | 3300013296 | Ga0157374_11330199 | Ga0157374_113301991 | 95 |
| 400 | 3300013296 | Ga0157374_11406898 | Ga0157374_114068981 | 95 |
| 401 | 3300013296 | Ga0157374_11409521 | Ga0157374_114095211 | 95 |
| 402 | 3300013296 | Ga0157374_11428382 | Ga0157374_114283821 | 95 |
| 403 | 3300013296 | Ga0157374_11938459 | Ga0157374_119384591 | 95 |
| 404 | 3300013296 | Ga0157374_12793490 | Ga0157374_127934901 | 95 |
| 405 | 3300013297 | Ga0157378_10056872 | Ga0157378_100568722 | 95 |
| 406 | 3300013297 | Ga0157378_10181313 | Ga0157378_101813132 | 95 |
| 407 | 3300013297 | Ga0157378_10306542 | Ga0157378_103065422 | 95 |
| 408 | 3300013297 | Ga0157378_10643909 | Ga0157378_106439092 | 95 |
| 409 | 3300013297 | Ga0157378_10747003 | Ga0157378_107470033 | 95 |
| 410 | 3300013297 | Ga0157378_11008144 | Ga0157378_110081442 | 95 |
| 411 | 3300013297 | Ga0157378_11217837 | Ga0157378_112178371 | 95 |
| 412 | 3300013297 | Ga0157378_11294325 | Ga0157378_112943251 | 95 |
| 413 | 3300013297 | Ga0157378_11850699 | Ga0157378_118506992 | 95 |
| 414 | 3300013306 | Ga0163162_10491251 | Ga0163162_104912513 | 95 |
| 415 | 3300013306 | Ga0163162_10540438 | Ga0163162_105404382 | 95 |
| 416 | 3300013306 | Ga0163162_10624645 | Ga0163162_106246453 | 95 |
| 417 | 3300013306 | Ga0163162_10680048 | Ga0163162_106800483 | 95 |
| 418 | 3300013306 | Ga0163162_10726472 | Ga0163162_107264722 | 95 |
| 419 | 3300013306 | Ga0163162_10762069 | Ga0163162_107620692 | 95 |
| 420 | 3300013307 | Ga0157372_10685509 | Ga0157372_106855093 | 95 |
| 421 | 3300013307 | Ga0157372_11407872 | Ga0157372_114078721 | 95 |
| 422 | 3300013307 | Ga0157372_11843926 | Ga0157372_118439262 | 95 |
| 423 | 3300013307 | Ga0157372_12311415 | Ga0157372_123114152 | 95 |
| 424 | 3300013308 | Ga0157375_10000193 | Ga0157375_1000019334 | 95 |
| 425 | 3300013308 | Ga0157375_11534848 | Ga0157375_115348482 | 95 |
| 426 | 3300013308 | Ga0157375_11602033 | Ga0157375_116020331 | 95 |
| 427 | 3300013308 | Ga0157375_13220750 | Ga0157375_132207501 | 95 |
| 428 | 3300014325 | Ga0163163_10000067 | Ga0163163_1000006715 | 95 |
| 429 | 3300014325 | Ga0163163_10134572 | Ga0163163_101345722 | 95 |
| 430 | 3300014325 | Ga0163163_10338153 | Ga0163163_103381532 | 95 |
| 431 | 3300014325 | Ga0163163_12514715 | Ga0163163_125147152 | 95 |
| 432 | 3300014326 | Ga0157380_10231426 | Ga0157380_102314261 | 95 |
| 433 | 3300014326 | Ga0157380_12606286 | Ga0157380_126062862 | 95 |
| 434 | 3300014745 | Ga0157377_11269281 | Ga0157377_112692811 | 95 |
| 435 | 3300014968 | Ga0157379_10903119 | Ga0157379_109031191 | 95 |
| 436 | 3300014968 | Ga0157379_10943511 | Ga0157379_109435111 | 95 |
| 437 | 3300014968 | Ga0157379_10972997 | Ga0157379_109729972 | 95 |
| 438 | 3300014968 | Ga0157379_11013697 | Ga0157379_110136971 | 95 |
| 439 | 3300014969 | Ga0157376_10263247 | Ga0157376_102632472 | 95 |
| 440 | 3300014969 | Ga0157376_10453044 | Ga0157376_104530441 | 95 |
| 441 | 3300014969 | Ga0157376_10961254 | Ga0157376_109612542 | 95 |
| 442 | 3300014969 | Ga0157376_11109156 | Ga0157376_111091562 | 95 |
| 443 | 3300014969 | Ga0157376_11572957 | Ga0157376_115729572 | 95 |
| 444 | 3300014969 | Ga0157376_11785274 | Ga0157376_117852742 | 95 |
| 445 | 3300014969 | Ga0157376_12467429 | Ga0157376_124674291 | 95 |
| 446 | 3300017792 | Ga0163161_10520740 | Ga0163161_105207402 | 95 |
| 447 | 3300017792 | Ga0163161_10880384 | Ga0163161_108803842 | 95 |
| 448 | 3300020069 | Ga0197907_10093562 | Ga0197907_100935621 | 95 |
| 449 | 3300020069 | Ga0197907_10678080 | Ga0197907_106780802 | 95 |
| 450 | 3300020069 | Ga0197907_11318956 | Ga0197907_113189561 | 95 |
| 451 | 3300020069 | Ga0197907_11380623 | Ga0197907_113806233 | 95 |
| 452 | 3300020069 | Ga0197907_11490927 | Ga0197907_114909271 | 95 |
| 453 | 3300020070 | Ga0206356_10271924 | Ga0206356_102719241 | 95 |
| 454 | 3300020070 | Ga0206356_11175132 | Ga0206356_111751321 | 95 |
| 455 | 3300020076 | Ga0206355_1170980 | Ga0206355_11709801 | 95 |
| 456 | 3300020078 | Ga0206352_10327707 | Ga0206352_103277072 | 95 |
| 457 | 3300020078 | Ga0206352_10694369 | Ga0206352_106943691 | 95 |
| 458 | 3300020078 | Ga0206352_11021632 | Ga0206352_110216321 | 95 |
| 459 | 3300020078 | Ga0206352_11302396 | Ga0206352_113023961 | 95 |
| 460 | 3300020078 | Ga0206352_11361878 | Ga0206352_113618781 | 95 |
| 461 | 3300020080 | Ga0206350_10848227 | Ga0206350_108482272 | 95 |
| 462 | 3300020080 | Ga0206350_11044168 | Ga0206350_110441681 | 95 |
| 463 | 3300020080 | Ga0206350_11356146 | Ga0206350_113561462 | 95 |
| 464 | 3300020081 | Ga0206354_11266248 | Ga0206354_112662482 | 95 |
| 465 | 3300020082 | Ga0206353_10136047 | Ga0206353_101360472 | 95 |
| 466 | 3300022467 | Ga0224712_10014740 | Ga0224712_100147401 | 95 |
| 467 | 3300025905 | Ga0207685_10693173 | Ga0207685_106931731 | 95 |
| 468 | 3300025907 | Ga0207645_10718064 | Ga0207645_107180641 | 95 |
| 469 | 3300025909 | Ga0207705_10097830 | Ga0207705_100978302 | 95 |
| 470 | 3300025909 | Ga0207705_11323714 | Ga0207705_113237142 | 95 |
| 471 | 3300025911 | Ga0207654_10837903 | Ga0207654_108379031 | 95 |
| 472 | 3300025912 | Ga0207707_10093442 | Ga0207707_100934423 | 95 |
| 473 | 3300025912 | Ga0207707_10141503 | Ga0207707_101415034 | 95 |
| 474 | 3300025913 | Ga0207695_10042188 | Ga0207695_100421883 | 95 |
| 475 | 3300025913 | Ga0207695_10104842 | Ga0207695_101048422 | 95 |
| 476 | 3300025913 | Ga0207695_10152455 | Ga0207695_101524554 | 95 |
| 477 | 3300025913 | Ga0207695_10246758 | Ga0207695_102467582 | 95 |
| 478 | 3300025913 | Ga0207695_10253930 | Ga0207695_102539303 | 95 |
| 479 | 3300025913 | Ga0207695_10680131 | Ga0207695_106801311 | 95 |
| 480 | 3300025915 | Ga0207693_10601293 | Ga0207693_106012931 | 95 |
| 481 | 3300025915 | Ga0207693_10929201 | Ga0207693_109292011 | 95 |
| 482 | 3300025916 | Ga0207663_10018773 | Ga0207663_100187732 | 95 |
| 483 | 3300025916 | Ga0207663_10690452 | Ga0207663_106904522 | 95 |
| 484 | 3300025916 | Ga0207663_10719843 | Ga0207663_107198431 | 95 |
| 485 | 3300025918 | Ga0207662_10419697 | Ga0207662_104196972 | 95 |
| 486 | 3300025921 | Ga0207652_10677121 | Ga0207652_106771211 | 95 |
| 487 | 3300025921 | Ga0207652_10794443 | Ga0207652_107944431 | 95 |
| 488 | 3300025921 | Ga0207652_11647774 | Ga0207652_116477741 | 95 |
| 489 | 3300025924 | Ga0207694_10010783 | Ga0207694_100107834 | 95 |
| 490 | 3300025924 | Ga0207694_10712285 | Ga0207694_107122852 | 95 |
| 491 | 3300025926 | Ga0207659_10910642 | Ga0207659_109106421 | 95 |
| 492 | 3300025929 | Ga0207664_10022118 | Ga0207664_100221182 | 95 |
| 493 | 3300025929 | Ga0207664_10586981 | Ga0207664_105869813 | 95 |
| 494 | 3300025931 | Ga0207644_11447238 | Ga0207644_114472382 | 95 |
| 495 | 3300025933 | Ga0207706_10782871 | Ga0207706_107828711 | 95 |
| 496 | 3300025934 | Ga0207686_10517279 | Ga0207686_105172791 | 95 |
| 497 | 3300025934 | Ga0207686_10863602 | Ga0207686_108636021 | 95 |
| 498 | 3300025934 | Ga0207686_10982166 | Ga0207686_109821662 | 95 |
| 499 | 3300025936 | Ga0207670_10016966 | Ga0207670_100169667 | 95 |
| 500 | 3300025936 | Ga0207670_10180763 | Ga0207670_101807632 | 95 |
| 501 | 3300025936 | Ga0207670_10333131 | Ga0207670_103331312 | 95 |
| 502 | 3300025936 | Ga0207670_10352704 | Ga0207670_103527042 | 95 |
| 503 | 3300025936 | Ga0207670_10990097 | Ga0207670_109900971 | 95 |
| 504 | 3300025938 | Ga0207704_10420236 | Ga0207704_104202362 | 95 |
| 505 | 3300025939 | Ga0207665_10440124 | Ga0207665_104401242 | 95 |
| 506 | 3300025941 | Ga0207711_10405246 | Ga0207711_104052462 | 95 |
| 507 | 3300025941 | Ga0207711_10688860 | Ga0207711_106888601 | 95 |
| 508 | 3300025941 | Ga0207711_11484938 | Ga0207711_114849382 | 95 |
| 509 | 3300025941 | Ga0207711_11760788 | Ga0207711_117607882 | 95 |
| 510 | 3300025949 | Ga0207667_10063721 | Ga0207667_100637213 | 95 |
| 511 | 3300025949 | Ga0207667_10141077 | Ga0207667_101410774 | 95 |
| 512 | 3300025949 | Ga0207667_10397425 | Ga0207667_103974253 | 95 |
| 513 | 3300025949 | Ga0207667_11606036 | Ga0207667_116060361 | 95 |
| 514 | 3300025960 | Ga0207651_10427834 | Ga0207651_104278342 | 95 |
| 515 | 3300025961 | Ga0207712_10577605 | Ga0207712_105776052 | 95 |
| 516 | 3300026035 | Ga0207703_10872680 | Ga0207703_108726802 | 95 |
| 517 | 3300026035 | Ga0207703_11381294 | Ga0207703_113812942 | 95 |
| 518 | 3300026035 | Ga0207703_11958267 | Ga0207703_119582671 | 95 |
| 519 | 3300026078 | Ga0207702_10015367 | Ga0207702_100153672 | 95 |
| 520 | 3300026088 | Ga0207641_10073907 | Ga0207641_100739074 | 95 |
| 521 | 3300026088 | Ga0207641_10295308 | Ga0207641_102953081 | 95 |
| 522 | 3300026088 | Ga0207641_10608064 | Ga0207641_106080641 | 95 |
| 523 | 3300026088 | Ga0207641_10633890 | Ga0207641_106338903 | 95 |
| 524 | 3300026088 | Ga0207641_10841785 | Ga0207641_108417851 | 95 |
| 525 | 3300026089 | Ga0207648_10723017 | Ga0207648_107230173 | 95 |
| 526 | 3300026095 | Ga0207676_10446444 | Ga0207676_104464442 | 95 |
| 527 | 3300026095 | Ga0207676_11481873 | Ga0207676_114818732 | 95 |
| 528 | 3300026116 | Ga0207674_10561603 | Ga0207674_105616032 | 95 |
| 529 | 3300026142 | Ga0207698_11448018 | Ga0207698_114480182 | 95 |
| 530 | 3300026142 | Ga0207698_12685197 | Ga0207698_126851971 | 95 |
| 531 | 3300027907 | Ga0207428_10591147 | Ga0207428_105911471 | 95 |
| 532 | 3300027907 | Ga0207428_10907620 | Ga0207428_109076201 | 95 |
| 533 | 3300028380 | Ga0268265_11005754 | Ga0268265_110057542 | 95 |
| 534 | 3300028381 | Ga0268264_10758800 | Ga0268264_107588003 | 95 |
| 535 | 3300028556 | Ga0265337_1001383 | Ga0265337_10013834 | 95 |
| 536 | 3300028556 | Ga0265337_1006315 | Ga0265337_10063154 | 95 |
| 537 | 3300028556 | Ga0265337_1052382 | Ga0265337_10523822 | 95 |
| 538 | 3300028556 | Ga0265337_1143152 | Ga0265337_11431521 | 95 |
| 539 | 3300028556 | Ga0265337_1171205 | Ga0265337_11712051 | 95 |
| 540 | 3300028558 | Ga0265326_10009649 | Ga0265326_100096493 | 95 |
| 541 | 3300028558 | Ga0265326_10075678 | Ga0265326_100756781 | 95 |
| 542 | 3300028558 | Ga0265326_10089624 | Ga0265326_100896243 | 95 |
| 543 | 3300028563 | Ga0265319_1000181 | Ga0265319_100018134 | 95 |
| 544 | 3300028563 | Ga0265319_1015277 | Ga0265319_10152773 | 95 |
| 545 | 3300028563 | Ga0265319_1149123 | Ga0265319_11491232 | 95 |
| 546 | 3300028563 | Ga0265319_1204408 | Ga0265319_12044082 | 95 |
| 547 | 3300028573 | Ga0265334_10006539 | Ga0265334_100065396 | 95 |
| 548 | 3300028573 | Ga0265334_10015224 | Ga0265334_100152242 | 95 |
| 549 | 3300028573 | Ga0265334_10051809 | Ga0265334_100518092 | 95 |
| 550 | 3300028573 | Ga0265334_10297102 | Ga0265334_102971022 | 95 |
| 551 | 3300028573 | Ga0265334_10303957 | Ga0265334_103039571 | 95 |
| 552 | 3300028577 | Ga0265318_10137394 | Ga0265318_101373942 | 95 |
| 553 | 3300028653 | Ga0265323_10000052 | Ga0265323_100000525 | 95 |
| 554 | 3300028653 | Ga0265323_10013603 | Ga0265323_100136033 | 95 |
| 555 | 3300028653 | Ga0265323_10213367 | Ga0265323_102133672 | 95 |
| 556 | 3300028654 | Ga0265322_10183055 | Ga0265322_101830552 | 95 |
| 557 | 3300028654 | Ga0265322_10240408 | Ga0265322_102404081 | 95 |
| 558 | 3300028666 | Ga0265336_10001439 | Ga0265336_100014396 | 95 |
| 559 | 3300028666 | Ga0265336_10039863 | Ga0265336_100398632 | 95 |
| 560 | 3300028666 | Ga0265336_10183919 | Ga0265336_101839192 | 95 |
| 561 | 3300028800 | Ga0265338_10000338 | Ga0265338_100003386 | 95 |
| 562 | 3300028800 | Ga0265338_10000702 | Ga0265338_1000070245 | 95 |
| 563 | 3300028800 | Ga0265338_10001650 | Ga0265338_1000165010 | 95 |
| 564 | 3300028800 | Ga0265338_10003512 | Ga0265338_100035126 | 95 |
| 565 | 3300028800 | Ga0265338_10004217 | Ga0265338_100042172 | 95 |
| 566 | 3300028800 | Ga0265338_10005093 | Ga0265338_100050938 | 95 |
| 567 | 3300028800 | Ga0265338_10007121 | Ga0265338_100071214 | 95 |
| 568 | 3300028800 | Ga0265338_10008472 | Ga0265338_100084725 | 95 |
| 569 | 3300028800 | Ga0265338_10010207 | Ga0265338_1001020711 | 95 |
| 570 | 3300028800 | Ga0265338_10010911 | Ga0265338_100109117 | 95 |
| 571 | 3300028800 | Ga0265338_10019439 | Ga0265338_100194392 | 95 |
| 572 | 3300028800 | Ga0265338_10032343 | Ga0265338_100323435 | 95 |
| 573 | 3300028800 | Ga0265338_10037899 | Ga0265338_100378993 | 95 |
| 574 | 3300028800 | Ga0265338_10117457 | Ga0265338_101174572 | 95 |
| 575 | 3300028800 | Ga0265338_10125810 | Ga0265338_101258104 | 95 |
| 576 | 3300028800 | Ga0265338_10182385 | Ga0265338_101823852 | 95 |
| 577 | 3300028800 | Ga0265338_10210658 | Ga0265338_102106583 | 95 |
| 578 | 3300028800 | Ga0265338_10316521 | Ga0265338_103165211 | 95 |
| 579 | 3300028800 | Ga0265338_10342561 | Ga0265338_103425611 | 95 |
| 580 | 3300028800 | Ga0265338_10371018 | Ga0265338_103710182 | 95 |
| 581 | 3300028800 | Ga0265338_10585774 | Ga0265338_105857742 | 95 |
| 582 | 3300028800 | Ga0265338_11110602 | Ga0265338_111106021 | 95 |
| 583 | 3300029957 | Ga0265324_10023976 | Ga0265324_100239762 | 95 |
| 584 | 3300029957 | Ga0265324_10041314 | Ga0265324_100413142 | 95 |
| 585 | 3300029957 | Ga0265324_10062512 | Ga0265324_100625122 | 95 |
| 586 | 3300029957 | Ga0265324_10079037 | Ga0265324_100790373 | 95 |
| 587 | 3300029957 | Ga0265324_10153587 | Ga0265324_101535871 | 95 |
| 588 | 3300031235 | Ga0265330_10408638 | Ga0265330_104086382 | 95 |
| 589 | 3300031238 | Ga0265332_10326449 | Ga0265332_103264492 | 95 |
| 590 | 3300031240 | Ga0265320_10001101 | Ga0265320_100011013 | 95 |
| 591 | 3300031240 | Ga0265320_10004269 | Ga0265320_100042693 | 95 |
| 592 | 3300031240 | Ga0265320_10034090 | Ga0265320_100340902 | 95 |
| 593 | 3300031240 | Ga0265320_10049012 | Ga0265320_100490124 | 95 |
| 594 | 3300031240 | Ga0265320_10069884 | Ga0265320_100698842 | 95 |
| 595 | 3300031240 | Ga0265320_10089976 | Ga0265320_100899762 | 95 |
| 596 | 3300031240 | Ga0265320_10169678 | Ga0265320_101696783 | 95 |
| 597 | 3300031240 | Ga0265320_10187693 | Ga0265320_101876932 | 95 |
| 598 | 3300031240 | Ga0265320_10194022 | Ga0265320_101940221 | 95 |
| 599 | 3300031240 | Ga0265320_10531722 | Ga0265320_105317221 | 95 |
| 600 | 3300031241 | Ga0265325_10144680 | Ga0265325_101446801 | 95 |
| 601 | 3300031241 | Ga0265325_10198542 | Ga0265325_101985421 | 95 |
| 602 | 3300031242 | Ga0265329_10060872 | Ga0265329_100608721 | 95 |
| 603 | 3300031242 | Ga0265329_10172257 | Ga0265329_101722572 | 95 |
| 604 | 3300031247 | Ga0265340_10001821 | Ga0265340_100018216 | 95 |
| 605 | 3300031247 | Ga0265340_10008513 | Ga0265340_100085136 | 95 |
| 606 | 3300031247 | Ga0265340_10041784 | Ga0265340_100417842 | 95 |
| 607 | 3300031247 | Ga0265340_10098528 | Ga0265340_100985283 | 95 |
| 608 | 3300031247 | Ga0265340_10249798 | Ga0265340_102497982 | 95 |
| 609 | 3300031247 | Ga0265340_10445668 | Ga0265340_104456682 | 95 |
| 610 | 3300031247 | Ga0265340_10455733 | Ga0265340_104557331 | 95 |
| 611 | 3300031249 | Ga0265339_10047272 | Ga0265339_100472723 | 95 |
| 612 | 3300031249 | Ga0265339_10081811 | Ga0265339_100818111 | 95 |
| 613 | 3300031249 | Ga0265339_10376364 | Ga0265339_103763642 | 95 |
| 614 | 3300031251 | Ga0265327_10001304 | Ga0265327_100013048 | 95 |
| 615 | 3300031344 | Ga0265316_10019145 | Ga0265316_100191458 | 95 |
| 616 | 3300031344 | Ga0265316_10054200 | Ga0265316_100542005 | 95 |
| 617 | 3300031344 | Ga0265316_10081759 | Ga0265316_100817593 | 95 |
| 618 | 3300031344 | Ga0265316_10109663 | Ga0265316_101096632 | 95 |
| 619 | 3300031344 | Ga0265316_10110646 | Ga0265316_101106461 | 95 |
| 620 | 3300031344 | Ga0265316_10539635 | Ga0265316_105396352 | 95 |
| 621 | 3300031344 | Ga0265316_10683884 | Ga0265316_106838842 | 95 |
| 622 | 3300031344 | Ga0265316_10929551 | Ga0265316_109295512 | 95 |
| 623 | 3300031344 | Ga0265316_11041543 | Ga0265316_110415431 | 95 |
| 624 | 3300031595 | Ga0265313_10025647 | Ga0265313_100256472 | 95 |
| 625 | 3300031595 | Ga0265313_10045617 | Ga0265313_100456173 | 95 |
| 626 | 3300031595 | Ga0265313_10110582 | Ga0265313_101105823 | 95 |
| 627 | 3300031595 | Ga0265313_10346521 | Ga0265313_103465211 | 95 |
| 628 | 3300031711 | Ga0265314_10022822 | Ga0265314_100228225 | 95 |
| 629 | 3300031711 | Ga0265314_10184840 | Ga0265314_101848403 | 95 |
| 630 | 3300031712 | Ga0265342_10114022 | Ga0265342_101140223 | 95 |
| 631 | 3300031712 | Ga0265342_10210320 | Ga0265342_102103202 | 95 |
| 632 | 3300031712 | Ga0265342_10522955 | Ga0265342_105229552 | 95 |
| 633 | 3300031712 | Ga0265342_10649859 | Ga0265342_106498591 | 95 |
| 634 | 3300035083 | Ga0373926_0227530 | Ga0373926_0227530_225_512 | 95 |
| 635 | 3300035111 | Ga0373923_0106057 | Ga0373923_0106057_431_718 | 95 |
| 636 | 3300035113 | Ga0373936_0133561 | Ga0373936_0133561_736_1023 | 95 |
| 637 | 3300035116 | Ga0373945_0130270 | Ga0373945_0130270_289_576 | 95 |
| 638 | 3300035116 | Ga0373945_0205207 | Ga0373945_0205207_72_359 | 95 |
| 639 | 3300035117 | Ga0373953_0044513 | Ga0373953_0044513_1018_1314 | 95 |
| 640 | 3300035117 | Ga0373953_0441775 | Ga0373953_0441775_140_427 | 95 |
| 641 | 3300035118 | Ga0373954_0004196 | Ga0373954_0004196_1990_2286 | 95 |
| 642 | 3300035118 | Ga0373954_0033971 | Ga0373954_0033971_1098_1385 | 95 |
| 643 | 3300035119 | Ga0373956_0013538 | Ga0373956_0013538_152_448 | 95 |
| 644 | 3300035119 | Ga0373956_0038253 | Ga0373956_0038253_417_704 | 95 |
| 645 | 3300035119 | Ga0373956_0635901 | Ga0373956_0635901_76_363 | 95 |
| 646 | 3300035170 | Ga0373943_0459057 | Ga0373943_0459057_371_658 | 95 |
| 647 | 3300035171 | Ga0373946_0063792 | Ga0373946_0063792_828_1115 | 95 |
| 648 | 3300035172 | Ga0373955_0128784 | Ga0373955_0128784_1052_1348 | 95 |
| 649 | 3300035172 | Ga0373955_0232990 | Ga0373955_0232990_764_1051 | 95 |
| 650 | 3300035172 | Ga0373955_0591537 | Ga0373955_0591537_132_428 | 95 |
| 651 | 3300035691 | Ga0373931_0307092 | Ga0373931_0307092_310_597 | 95 |
| 652 | 3300035692 | Ga0373935_0013383 | Ga0373935_0013383_4413_4700 | 95 |
| 653 | 3300035692 | Ga0373935_1099004 | Ga0373935_1099004_227_514 | 95 |
| 654 | 3300035695 | Ga0373927_0067607 | Ga0373927_0067607_1367_1654 | 95 |
| 655 | 3300035695 | Ga0373927_0279688 | Ga0373927_0279688_264_551 | 95 |
| 656 | 3300035695 | Ga0373927_0579089 | Ga0373927_0579089_51_338 | 95 |
| 657 | 3300035725 | Ga0373947_0203163 | Ga0373947_0203163_295_582 | 95 |
| 658 | 3300035725 | Ga0373947_0263440 | Ga0373947_0263440_310_597 | 95 |
| 659 | 3300035725 | Ga0373947_0483342 | Ga0373947_0483342_156_443 | 95 |
| 660 | 3300036401 | Ga0373937_0002559 | Ga0373937_0002559_7361_7657 | 95 |
| 661 | 3300036401 | Ga0373937_0219435 | Ga0373937_0219435_1224_1511 | 95 |
| 662 | 3300036401 | Ga0373937_0677862 | Ga0373937_0677862_154_441 | 95 |
| 663 | 3300036401 | Ga0373937_0682099 | Ga0373937_0682099_602_889 | 95 |
| 664 | 3300036401 | Ga0373937_1195331 | Ga0373937_1195331_351_638 | 95 |
| 665 | 3300036647 | Ga0316582_0493026 | Ga0316582_0493026_510_797 | 95 |
| 666 | 3300039450 | Ga0436363_0725337 | Ga0436363_0725337_211_498 | 95 |
| 667 | 3300041452 | Ga0451793_0122907 | Ga0451793_0122907_111_398 | 95 |
| 668 | 3300041486 | Ga0451807_0872394 | Ga0451807_0872394_22_309 | 95 |
| 669 | 3300041491 | Ga0451833_0913063 | Ga0451833_0913063_264_554 | 95 |
| 670 | 3300042876 | Ga0451577_0001767 | Ga0451577_0001767_15985_16272 | 95 |
| 671 | 3300042876 | Ga0451577_0005602 | Ga0451577_0005602_9603_9890 | 95 |
| 672 | 3300042876 | Ga0451577_0161865 | Ga0451577_0161865_918_1205 | 95 |
| 673 | 3300044673 | Ga0453683_0737386 | Ga0453683_0737386_44_331 | 95 |
| 674 | 3300044712 | Ga0453684_0000238 | Ga0453684_0000238_109614_109901 | 95 |
| 675 | 3300044712 | Ga0453684_0002796 | Ga0453684_0002796_31702_31989 | 95 |
| 676 | 3300044712 | Ga0453684_0040224 | Ga0453684_0040224_5011_5298 | 95 |
| 677 | 3300044712 | Ga0453684_0851306 | Ga0453684_0851306_138_428 | 95 |
| 678 | 3300044712 | Ga0453684_1576212 | Ga0453684_1576212_226_513 | 95 |
| 679 | 3300044712 | Ga0453684_2399320 | Ga0453684_2399320_96_383 | 95 |
| 680 | 3300045051 | Ga0451576_0061426 | Ga0451576_0061426_3122_3409 | 95 |
| 681 | 3300045051 | Ga0451576_0160484 | Ga0451576_0160484_300_590 | 95 |
| 682 | 3300045051 | Ga0451576_0227091 | Ga0451576_0227091_774_1061 | 95 |
| 683 | 3300045051 | Ga0451576_0234148 | Ga0451576_0234148_1192_1479 | 95 |
| 684 | 3300045051 | Ga0451576_0268955 | Ga0451576_0268955_403_690 | 95 |
| 685 | 3300045051 | Ga0451576_0510580 | Ga0451576_0510580_261_548 | 95 |
| 686 | 3300045051 | Ga0451576_0548984 | Ga0451576_0548984_730_1017 | 95 |
| 687 | 3300045051 | Ga0451576_0767631 | Ga0451576_0767631_272_559 | 95 |
| 688 | 3300045051 | Ga0451576_0831077 | Ga0451576_0831077_544_831 | 95 |
| 689 | 3300045051 | Ga0451576_0883735 | Ga0451576_0883735_558_845 | 95 |
| 690 | 3300045051 | Ga0451576_1197883 | Ga0451576_1197883_35_322 | 95 |
| 691 | 3300045051 | Ga0451576_1336329 | Ga0451576_1336329_225_512 | 95 |
| 692 | 3300045051 | Ga0451576_1350323 | Ga0451576_1350323_320_607 | 95 |
| 693 | 3300045051 | Ga0451576_1430121 | Ga0451576_1430121_38_325 | 95 |
| 694 | 3300045051 | Ga0451576_1692506 | Ga0451576_1692506_348_644 | 95 |
| 695 | 3300046454 | Ga0495592_0000027 | Ga0495592_0000027_91428_91715 | 95 |
| 696 | 3300046459 | Ga0495629_0032554 | Ga0495629_0032554_3339_3635 | 95 |
| 697 | 3300046459 | Ga0495629_0669747 | Ga0495629_0669747_213_500 | 95 |
| 698 | 3300046462 | Ga0495651_0517804 | Ga0495651_0517804_381_668 | 95 |
| 699 | 3300046473 | Ga0495582_0029874 | Ga0495582_0029874_2481_2768 | 95 |
| 700 | 3300046476 | Ga0495662_0033947 | Ga0495662_0033947_189_476 | 95 |
| 701 | 3300046476 | Ga0495662_0669998 | Ga0495662_0669998_101_388 | 95 |
| 702 | 3300046477 | Ga0495664_0065077 | Ga0495664_0065077_752_1039 | 95 |
| 703 | 3300046499 | Ga0495594_0319076 | Ga0495594_0319076_430_717 | 95 |
| 704 | 3300046511 | Ga0495608_0370576 | Ga0495608_0370576_99_386 | 95 |
| 705 | 3300046514 | Ga0495618_0000627 | Ga0495618_0000627_5087_5383 | 95 |
| 706 | 3300046516 | Ga0495628_0284490 | Ga0495628_0284490_692_979 | 95 |
| 707 | 3300046516 | Ga0495628_0630651 | Ga0495628_0630651_156_452 | 95 |
| 708 | 3300046516 | Ga0495628_0654555 | Ga0495628_0654555_66_353 | 95 |
| 709 | 3300046517 | Ga0495630_0000094 | Ga0495630_0000094_3485_3772 | 95 |
| 710 | 3300046517 | Ga0495630_0430978 | Ga0495630_0430978_234_521 | 95 |
| 711 | 3300046517 | Ga0495630_0473504 | Ga0495630_0473504_592_879 | 95 |
| 712 | 3300046517 | Ga0495630_0489449 | Ga0495630_0489449_195_485 | 95 |
| 713 | 3300046517 | Ga0495630_0564692 | Ga0495630_0564692_235_531 | 95 |
| 714 | 3300046526 | Ga0495666_0018485 | Ga0495666_0018485_2478_2765 | 95 |
| 715 | 3300046526 | Ga0495666_0284874 | Ga0495666_0284874_244_531 | 95 |
| 716 | 3300046529 | Ga0495652_0365927 | Ga0495652_0365927_203_490 | 95 |
| 717 | 3300046531 | Ga0495665_0328917 | Ga0495665_0328917_403_690 | 95 |
| 718 | 3300046533 | Ga0495640_0182592 | Ga0495640_0182592_231_527 | 95 |
| 719 | 3300046533 | Ga0495640_0203140 | Ga0495640_0203140_79_366 | 95 |
| 720 | 3300046535 | Ga0495586_0000110 | Ga0495586_0000110_3278_3565 | 95 |
| 721 | 3300046535 | Ga0495586_0000435 | Ga0495586_0000435_14981_15277 | 95 |
| 722 | 3300046535 | Ga0495586_0000958 | Ga0495586_0000958_6766_7053 | 95 |
| 723 | 3300046535 | Ga0495586_0553280 | Ga0495586_0553280_197_484 | 95 |
| 724 | 3300046536 | Ga0495587_0141923 | Ga0495587_0141923_317_604 | 95 |
| 725 | 3300046536 | Ga0495587_0380778 | Ga0495587_0380778_269_556 | 95 |
| 726 | 3300046539 | Ga0495621_0253232 | Ga0495621_0253232_286_573 | 95 |
| 727 | 3300046543 | Ga0495645_0019475 | Ga0495645_0019475_1248_1535 | 95 |
| 728 | 3300046543 | Ga0495645_0431152 | Ga0495645_0431152_331_618 | 95 |
| 729 | 3300046543 | Ga0495645_0507110 | Ga0495645_0507110_204_491 | 95 |
| 730 | 3300046559 | Ga0495667_0579554 | Ga0495667_0579554_259_546 | 95 |
| 731 | 3300046559 | Ga0495667_0769166 | Ga0495667_0769166_167_454 | 95 |
| 732 | 3300046559 | Ga0495667_0834387 | Ga0495667_0834387_10_297 | 95 |
| 733 | 3300046642 | Ga0495634_0009163 | Ga0495634_0009163_4191_4487 | 95 |
| 734 | 3300046642 | Ga0495634_0043769 | Ga0495634_0043769_302_589 | 95 |
| 735 | 3300046642 | Ga0495634_0293434 | Ga0495634_0293434_419_706 | 95 |
| 736 | 3300046674 | Ga0495588_0324818 | Ga0495588_0324818_406_693 | 95 |
| 737 | 3300046675 | Ga0495657_0733890 | Ga0495657_0733890_83_370 | 95 |
| 738 | 3300046678 | Ga0495599_0258696 | Ga0495599_0258696_561_848 | 95 |
| 739 | 3300046678 | Ga0495599_0520511 | Ga0495599_0520511_65_352 | 95 |
| 740 | 3300046680 | Ga0495646_0226172 | Ga0495646_0226172_100_387 | 95 |
| 741 | 3300046681 | Ga0495647_0388136 | Ga0495647_0388136_284_571 | 95 |
| 742 | 3300046681 | Ga0495647_0428119 | Ga0495647_0428119_196_483 | 95 |
| 743 | 3300046683 | Ga0495658_0421644 | Ga0495658_0421644_363_650 | 95 |
| 744 | 3300046683 | Ga0495658_0991879 | Ga0495658_0991879_18_305 | 95 |
| 745 | 3300046684 | Ga0495669_0104660 | Ga0495669_0104660_686_973 | 95 |
| 746 | 3300046689 | Ga0495613_0014339 | Ga0495613_0014339_439_735 | 95 |
| 747 | 3300046689 | Ga0495613_0264686 | Ga0495613_0264686_858_1145 | 95 |
| 748 | 3300046689 | Ga0495613_0476844 | Ga0495613_0476844_50_337 | 95 |
| 749 | 3300046689 | Ga0495613_1039756 | Ga0495613_1039756_65_352 | 95 |
| 750 | 3300047317 | Ga0495604_1035080 | Ga0495604_1035080_50_337 | 95 |
| 751 | 3300047318 | Ga0495636_0309781 | Ga0495636_0309781_147_434 | 95 |
| 752 | 3300047319 | Ga0495674_0038375 | Ga0495674_0038375_2853_3140 | 95 |
| 753 | 3300047319 | Ga0495674_0699378 | Ga0495674_0699378_258_548 | 95 |
| 754 | 3300047321 | Ga0495676_0105139 | Ga0495676_0105139_1637_1924 | 95 |
| 755 | 3300047322 | Ga0495680_0024214 | Ga0495680_0024214_4592_4888 | 95 |
| 756 | 3300047471 | Ga0495684_0054808 | Ga0495684_0054808_2492_2779 | 95 |
| 757 | 3300047471 | Ga0495684_0406021 | Ga0495684_0406021_399_695 | 95 |
| 758 | 3300047471 | Ga0495684_0667817 | Ga0495684_0667817_54_341 | 95 |
| 759 | 3300048909 | Ga0496106_0201388 | Ga0496106_0201388_664_951 | 95 |
| 760 | 3300048910 | Ga0496107_0181400 | Ga0496107_0181400_387_674 | 95 |
| 761 | 3300048918 | Ga0496115_0117239 | Ga0496115_0117239_568_855 | 95 |
| 762 | 3300049571 | Ga0501034_0558255 | Ga0501034_0558255_234_521 | 95 |
| 763 | 3300049571 | Ga0501034_1376486 | Ga0501034_1376486_55_342 | 95 |
| 764 | 3300049572 | Ga0501036_1361048 | Ga0501036_1361048_150_437 | 95 |
| 765 | 3300049575 | Ga0501039_0869117 | Ga0501039_0869117_99_386 | 95 |
| 766 | 3300049686 | Ga0501257_199329 | Ga0501257_199329_31_321 | 95 |
| 767 | 3300049689 | Ga0501260_055282 | Ga0501260_055282_159_446 | 95 |
| 768 | 3300049772 | Ga0501275_050451 | Ga0501275_050451_13_303 | 95 |
| 769 | 3300050511 | nmdc:mga08y16_644868_c1 | nmdc:mga08y16_644868_c1_415_702 | 95 |
| 770 | 3300050511 | nmdc:mga08y16_859334_c1 | nmdc:mga08y16_859334_c1_195_482 | 95 |
| 771 | 3300050512 | nmdc:mga0n895_1902941_c1 | nmdc:mga0n895_1902941_c1_203_490 | 95 |
| 772 | 3300050514 | nmdc:mga08x19_257704_c1 | nmdc:mga08x19_257704_c1_731_1018 | 95 |
| 773 | 3300053077 | Ga0495601_0273052 | Ga0495601_0273052_75_362 | 95 |
| 774 | 3300053077 | Ga0495601_0280829 | Ga0495601_0280829_130_417 | 95 |
| 775 | 3300053098 | Ga0500650_0267547 | Ga0500650_0267547_420_707 | 95 |
| 776 | 3300053119 | Ga0500595_153345 | Ga0500595_153345_197_484 | 95 |
| 777 | 3300053153 | Ga0500616_0118612 | Ga0500616_0118612_33_320 | 95 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vd7-assembly1.cif.gz_A | toxin - antitoxin complex from salmonella enterica serovar typhimurium | 0.7262 | 2 | 86 |
| 3ub1-assembly2.cif.gz_B | ntf2 like protein involved in plasmid conjugation | 0.7167 | 45 | 77 |
| 5g3l-assembly1.cif.gz_H | escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar | 0.6664 | 55 | 78 |
| 4ttz-assembly1.cif.gz_C | n-terminal domain of c. reinhardtii sas-6 homolog bld12p variant g94e f145w q147k (nn26) | 0.6637 | 34 | 79 |
| 7vd7-assembly1.cif.gz_A | toxin - antitoxin complex from salmonella enterica serovar typhimurium | 0.6593 | 2 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q22071_294_406_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.7959 | 45 | 74 | 2.40.128.630 |
| af_Q8IDM8_1_363_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7465 | 42 | 77 | 2.130.10.10 |
| af_P40395_458_862_2.130.10.110 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain | 0.697 | 43 | 79 | 2.130.10.110 |
| af_E9QFZ1_2430_2658_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6839 | 45 | 77 | 2.130.10.10 |
| af_A0A0R4ICS1_30_455_2.130.10.130 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal | 0.6792 | 41 | 78 | 2.130.10.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538NX32-F1-model_v4 | BrnT family toxin | 0.8984 | 1 | 95 |
|
| AF-A0A520QR87-F1-model_v4 | BrnT family toxin | 0.8976 | 1 | 93 |
|
| AF-A0A3A4V243-F1-model_v4 | BrnT family toxin | 0.8829 | 12 | 87 |
|
| AF-A0A832HW20-F1-model_v4 | BrnT family toxin | 0.8823 | 1 | 95 |
|
| AF-A0A520QR87-F1-model_v4 | BrnT family toxin | 0.879 | 1 | 93 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar