F480304

General Info

Members Datasets Scaffolds Average Seq Length
776 339 1552 124

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10717526|Ga0111539_107175262
Length 146
Sequence MAGFGAEDDAHRGAPAADTRRDAMDWKLELVAVPVTDVDRAKAFYVDRVGFHADHDHRVNGQLRFVQLTPPGSACSIAMGTGVSPMTPGSLQGLQLVVADIEAARAELADRGVAVSDVQDFDWGRFVFFSDPDGNGWAVQEIPARQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
191 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
194 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
195 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
196 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
197 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
335 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
336 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
337 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
338 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
339 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.77
Nodule 0.13
Rhizoplane 7.35
Rhizosphere 84.02
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10717526 3300009094 Bacteria 1164
2 JGI24737J22298_10061964 3300001990 Bacteria 1124
3 JGI24735J21928_10040230 3300002067 Bacteria 1365
4 JGI25406J46586_10020334 3300003203 Bacteria 2687
5 JGI25165J46597_1000130 3300003214 Bacteria 127000
6 JGI25407J50210_10003381 3300003373 Bacteria 3810
7 JGI25407J50210_10027822 3300003373 Bacteria 1467
8 Ga0065715_10627088 3300005293 Unclassified 692
9 Ga0070658_10720697 3300005327 Bacteria 866
10 Ga0070683_100666304 3300005329 Bacteria 996
11 Ga0070683_100936801 3300005329 Bacteria 831
12 Ga0070683_101483621 3300005329 Bacteria 652
13 Ga0070690_101252317 3300005330 Bacteria 593
14 Ga0070677_10667912 3300005333 Bacteria 582
15 Ga0068869_100627056 3300005334 Bacteria 911
16 Ga0068869_100907065 3300005334 Bacteria 763
17 Ga0070680_100922845 3300005336 Bacteria 753
18 Ga0070682_100086968 3300005337 Bacteria 2037
19 Ga0070682_100166181 3300005337 Bacteria 1529
20 Ga0070682_101614618 3300005337 Bacteria 561
21 Ga0068868_100460396 3300005338 Bacteria 1108
22 Ga0070660_101334749 3300005339 Bacteria 609
23 Ga0070689_100617700 3300005340 Bacteria 940
24 Ga0070689_101135803 3300005340 Bacteria 699
25 Ga0070692_10288680 3300005345 Bacteria 997
26 Ga0070668_101139821 3300005347 Bacteria 705
27 Ga0070675_100401588 3300005354 Bacteria 1223
28 Ga0070675_100743264 3300005354 Bacteria 895
29 Ga0070671_100174162 3300005355 Bacteria 1820
30 Ga0070674_100032516 3300005356 Bacteria 3464
31 Ga0070674_101886452 3300005356 Bacteria 543
32 Ga0070673_100181963 3300005364 Bacteria 1800
33 Ga0070673_101608990 3300005364 Bacteria 614
34 Ga0070659_101046051 3300005366 Bacteria 718
35 Ga0070659_101101492 3300005366 Bacteria 700
36 Ga0070659_101333347 3300005366 Bacteria 637
37 Ga0070714_100120218 3300005435 Bacteria 2336
38 Ga0070714_100193114 3300005435 Bacteria 1859
39 Ga0070714_100297117 3300005435 Bacteria 1504
40 Ga0070714_101524833 3300005435 Bacteria 653
41 Ga0070713_100073771 3300005436 Bacteria 2889
42 Ga0070713_100210601 3300005436 Bacteria 1760
43 Ga0070710_10032837 3300005437 Bacteria 2814
44 Ga0070701_10018615 3300005438 Bacteria 3267
45 Ga0070701_10382193 3300005438 Bacteria 888
46 Ga0070711_100116144 3300005439 Unclassified 1972
47 Ga0070711_100308544 3300005439 Bacteria 1260
48 Ga0070705_100140919 3300005440 Bacteria 1587
49 Ga0070705_100664865 3300005440 Bacteria 814
50 Ga0070700_101120627 3300005441 Bacteria 653
51 Ga0070708_100448768 3300005445 Bacteria 1217
52 Ga0070663_100094525 3300005455 Bacteria 2220
53 Ga0070663_100900719 3300005455 Bacteria 764
54 Ga0070678_100003259 3300005456 Bacteria 9019
55 Ga0070678_100377844 3300005456 Bacteria 1225
56 Ga0070678_102261115 3300005456 Bacteria 516
57 Ga0070678_102305568 3300005456 Bacteria 511
58 Ga0070662_100049283 3300005457 Bacteria 3037
59 Ga0070662_100049615 3300005457 Bacteria 3027
60 Ga0070662_100351823 3300005457 Bacteria 1207
61 Ga0070706_100020757 3300005467 Archaea 6049
62 Ga0070707_100000131 3300005468 Bacteria 70101
63 Ga0070707_100008018 3300005468 Bacteria 9813
64 Ga0070698_100083370 3300005471 Bacteria 3186
65 Ga0070698_100146923 3300005471 Bacteria 2306
66 Ga0070698_100188041 3300005471 Bacteria 2003
67 Ga0070699_100020982 3300005518 Bacteria 5632
68 Ga0070679_100597521 3300005530 Bacteria 1047
69 Ga0070684_101060894 3300005535 Bacteria 761
70 Ga0070684_101545039 3300005535 Bacteria 626
71 Ga0070697_100000060 3300005536 Bacteria 86138
72 Ga0070672_100715290 3300005543 Bacteria 877
73 Ga0070695_101495406 3300005545 Bacteria 562
74 Ga0070696_100816336 3300005546 Bacteria 769
75 Ga0070693_100445106 3300005547 Bacteria 908
76 Ga0070693_100613217 3300005547 Bacteria 787
77 Ga0070665_100173246 3300005548 Bacteria 2159
78 Ga0070665_100575569 3300005548 Bacteria 1139
79 Ga0070665_100906238 3300005548 Bacteria 894
80 Ga0068855_100085381 3300005563 Bacteria 3652
81 Ga0068855_100395426 3300005563 Bacteria 1516
82 Ga0070664_100301641 3300005564 Bacteria 1448
83 Ga0068856_100024160 3300005614 Bacteria 5913
84 Ga0068856_100351721 3300005614 Bacteria 1492
85 Ga0068856_100723296 3300005614 Bacteria 1016
86 Ga0070702_100042481 3300005615 Bacteria 2557
87 Ga0070702_100325972 3300005615 Bacteria 1072
88 Ga0070702_100533551 3300005615 Bacteria 868
89 Ga0068864_100753419 3300005618 Bacteria 954
90 Ga0068864_101486860 3300005618 Bacteria 680
91 Ga0068866_10004722 3300005718 Bacteria 5589
92 Ga0068866_10479210 3300005718 Bacteria 819
93 Ga0068861_100039646 3300005719 Bacteria 3517
94 Ga0068861_100905131 3300005719 Bacteria 836
95 Ga0081455_10045424 3300005937 Bacteria 3822
96 Ga0081455_10085605 3300005937 Bacteria 2570
97 Ga0081538_10000441 3300005981 Bacteria 46694
98 Ga0081538_10000723 3300005981 Bacteria 35973
99 Ga0081538_10027389 3300005981 Bacteria 3953
100 Ga0081538_10041551 3300005981 Bacteria 2917
101 Ga0081538_10081164 3300005981 Bacteria 1726
102 Ga0081538_10130359 3300005981 Bacteria 1183
103 Ga0081538_10137008 3300005981 Bacteria 1137
104 Ga0081539_10009917 3300005985 Bacteria 7854
105 Ga0070717_10003866 3300006028 Bacteria 10769
106 Ga0070717_10060680 3300006028 Bacteria 3132
107 Ga0070717_11924817 3300006028 Bacteria 533
108 Ga0075365_10025327 3300006038 Bacteria 3754
109 Ga0075365_10041102 3300006038 Bacteria 3019
110 Ga0075368_10003727 3300006042 Bacteria 5114
111 Ga0075363_100135597 3300006048 Bacteria 1383
112 Ga0075363_100187959 3300006048 Bacteria 1177
113 Ga0075364_10010779 3300006051 Bacteria 5530
114 Ga0075364_10160152 3300006051 Bacteria 1519
115 Ga0075364_10209592 3300006051 Bacteria 1321
116 Ga0075364_11246622 3300006051 Bacteria 504
117 Ga0075432_10118908 3300006058 Bacteria 991
118 Ga0070712_100018136 3300006175 Bacteria 4566
119 Ga0070712_100335008 3300006175 Bacteria 1234
120 Ga0075362_10003266 3300006177 Bacteria 5635
121 Ga0075367_10066048 3300006178 Bacteria 2167
122 Ga0075367_10096888 3300006178 Bacteria 1799
123 Ga0075366_10010023 3300006195 Bacteria 5310
124 Ga0097621_100121333 3300006237 Bacteria 2217
125 Ga0097621_100815711 3300006237 Bacteria 865
126 Ga0097621_100951291 3300006237 Bacteria 802
127 Ga0075370_10489527 3300006353 Unclassified 742
128 Ga0075370_10540009 3300006353 Bacteria 705
129 Ga0075370_10688845 3300006353 Bacteria 621
130 Ga0068871_100007036 3300006358 Bacteria 8013
131 Ga0075428_100001658 3300006844 Bacteria 23704
132 Ga0075428_101139667 3300006844 Bacteria 823
133 Ga0075430_100004254 3300006846 Bacteria 12090
134 Ga0075430_100005650 3300006846 Bacteria 10563
135 Ga0075430_100230234 3300006846 Bacteria 1537
136 Ga0075431_100002060 3300006847 Bacteria 19211
137 Ga0075429_100001429 3300006880 Bacteria 19601
138 Ga0075429_100274583 3300006880 Bacteria 1476
139 Ga0075435_100738600 3300007076 Bacteria 856
140 Ga0105240_12783950 3300009093 Bacteria 503
141 Ga0111539_10013780 3300009094 Bacteria 10100
142 Ga0111539_10019017 3300009094 Bacteria 8491
143 Ga0111539_11188702 3300009094 Bacteria 886
144 Ga0111539_11747209 3300009094 Bacteria 721
145 Ga0111539_13017687 3300009094 Bacteria 544
146 Ga0105245_10404772 3300009098 Bacteria 1365
147 Ga0105245_10428225 3300009098 Bacteria 1328
148 Ga0105245_10797757 3300009098 Bacteria 982
149 Ga0105245_11159937 3300009098 Bacteria 820
150 Ga0105245_11587217 3300009098 Bacteria 706
151 Ga0105245_11860457 3300009098 Bacteria 655
152 Ga0114129_10005888 3300009147 Bacteria 17362
153 Ga0114129_10762568 3300009147 Bacteria 1238
154 Ga0114129_11430500 3300009147 Bacteria 852
155 Ga0114129_12787376 3300009147 Bacteria 581
156 Ga0105243_10004973 3300009148 Bacteria 10422
157 Ga0105243_10093178 3300009148 Bacteria 2485
158 Ga0105243_10177954 3300009148 Bacteria 1847
159 Ga0105243_10375821 3300009148 Bacteria 1313
160 Ga0105243_10436777 3300009148 Bacteria 1225
161 Ga0105243_10550552 3300009148 Bacteria 1102
162 Ga0105243_11219231 3300009148 Bacteria 766
163 Ga0105243_11767790 3300009148 Bacteria 649
164 Ga0105241_10167788 3300009174 Bacteria 1810
165 Ga0105241_12195560 3300009174 Bacteria 547
166 Ga0105242_10013553 3300009176 Bacteria 6306
167 Ga0105248_10069035 3300009177 Bacteria 3968
168 Ga0105248_11489743 3300009177 Bacteria 766
169 Ga0105248_12310465 3300009177 Bacteria 612
170 Ga0105237_11409300 3300009545 Bacteria 703
171 Ga0105237_11457285 3300009545 Bacteria 691
172 Ga0105238_11407905 3300009551 Bacteria 724
173 Ga0105249_10004029 3300009553 Bacteria 12679
174 Ga0105249_10075368 3300009553 Bacteria 3124
175 Ga0105249_10776101 3300009553 Bacteria 1021
176 Ga0105239_10094860 3300010375 Bacteria 3296
177 Ga0105239_10098384 3300010375 Bacteria 3234
178 Ga0105239_10166669 3300010375 Bacteria 2464
179 Ga0105239_11113826 3300010375 Bacteria 909
180 Ga0105246_10254183 3300011119 Bacteria 1396
181 Ga0105246_10718168 3300011119 Bacteria 878
182 Ga0105246_11112786 3300011119 Bacteria 722
183 Ga0105246_11491718 3300011119 Bacteria 635
184 Ga0157339_1054154 3300012505 Bacteria 539
185 Ga0157370_10000318 3300013104 Bacteria 60585
186 Ga0157370_10330375 3300013104 Bacteria 1406
187 Ga0157369_10004035 3300013105 Bacteria 17401
188 Ga0157369_11255595 3300013105 Bacteria 755
189 Ga0157374_10008864 3300013296 Bacteria 8614
190 Ga0157374_11885874 3300013296 Bacteria 623
191 Ga0157374_12170003 3300013296 Bacteria 582
192 Ga0157378_10082218 3300013297 Bacteria 2912
193 Ga0163162_10022697 3300013306 Bacteria 6187
194 Ga0163162_10552593 3300013306 Bacteria 1280
195 Ga0163162_11299074 3300013306 Bacteria 827
196 Ga0163162_11479460 3300013306 Bacteria 773
197 Ga0163162_12746894 3300013306 Bacteria 567
198 Ga0157372_10505872 3300013307 Bacteria 1409
199 Ga0157372_12755837 3300013307 Bacteria 564
200 Ga0157375_10320648 3300013308 Bacteria 1714
201 Ga0157375_10525759 3300013308 Bacteria 1346
202 Ga0157375_10604518 3300013308 Bacteria 1255
203 Ga0157375_10844670 3300013308 Bacteria 1062
204 Ga0157375_12096935 3300013308 Bacteria 673
205 Ga0163163_10226291 3300014325 Bacteria 1919
206 Ga0163163_10322381 3300014325 Bacteria 1599
207 Ga0163163_10503623 3300014325 Bacteria 1273
208 Ga0163163_12630033 3300014325 Bacteria 561
209 Ga0157380_10078282 3300014326 Bacteria 2697
210 Ga0157380_10793579 3300014326 Bacteria 963
211 Ga0182008_10073268 3300014497 Bacteria 1685
212 Ga0157377_10626234 3300014745 Bacteria 771
213 Ga0157377_11218145 3300014745 Bacteria 584
214 Ga0157379_10004562 3300014968 Bacteria 11881
215 Ga0157379_11566727 3300014968 Bacteria 642
216 Ga0157379_12351233 3300014968 Bacteria 531
217 Ga0157376_11074462 3300014969 Bacteria 830
218 Ga0157376_12838977 3300014969 Bacteria 524
219 Ga0163161_10174512 3300017792 Bacteria 1645
220 Ga0163161_10502764 3300017792 Bacteria 987
221 Ga0213874_10047100 3300021377 Bacteria 1310
222 Ga0213874_10128489 3300021377 Bacteria 868
223 Ga0213876_10017284 3300021384 Bacteria 3808
224 Ga0213876_10028556 3300021384 Bacteria 2941
225 Ga0213876_10148609 3300021384 Bacteria 1246
226 Ga0213876_10302848 3300021384 Bacteria 850
227 Ga0213876_10308623 3300021384 Bacteria 841
228 Ga0213875_10108058 3300021388 Bacteria 1298
229 Ga0207427_100649 3300025231 Bacteria 16841
230 Ga0209026_1008985 3300025250 Bacteria 2017
231 Ga0209233_1000003 3300025261 Bacteria 1607366
232 Ga0209455_1024475 3300025272 Bacteria 1114
233 Ga0207682_10335944 3300025893 Bacteria 711
234 Ga0207692_10183350 3300025898 Viruses 1221
235 Ga0207692_10561371 3300025898 Bacteria 730
236 Ga0207692_10794303 3300025898 Bacteria 619
237 Ga0207642_10005615 3300025899 Bacteria 4106
238 Ga0207642_10907566 3300025899 Bacteria 565
239 Ga0207710_10346743 3300025900 Bacteria 756
240 Ga0207688_10520217 3300025901 Bacteria 746
241 Ga0207680_10015574 3300025903 Bacteria 3971
242 Ga0207680_10991407 3300025903 Bacteria 602
243 Ga0207680_11084645 3300025903 Bacteria 573
244 Ga0207647_10092083 3300025904 Bacteria 1807
245 Ga0207685_10854587 3300025905 Bacteria 504
246 Ga0207699_11364271 3300025906 Bacteria 525
247 Ga0207643_10812363 3300025908 Bacteria 606
248 Ga0207693_10013533 3300025915 Bacteria 6575
249 Ga0207693_10306518 3300025915 Bacteria 1243
250 Ga0207663_10148674 3300025916 Bacteria 1641
251 Ga0207662_11184955 3300025918 Bacteria 543
252 Ga0207646_10000135 3300025922 Bacteria 100459
253 Ga0207646_10009332 3300025922 Bacteria 9701
254 Ga0207659_10173195 3300025926 Bacteria 1704
255 Ga0207687_10288042 3300025927 Bacteria 1319
256 Ga0207687_10405292 3300025927 Bacteria 1122
257 Ga0207687_11612839 3300025927 Bacteria 557
258 Ga0207700_10433494 3300025928 Bacteria 1156
259 Ga0207700_10487108 3300025928 Bacteria 1090
260 Ga0207664_10151545 3300025929 Bacteria 1970
261 Ga0207664_10184417 3300025929 Bacteria 1793
262 Ga0207664_10811245 3300025929 Bacteria 842
263 Ga0207644_10359661 3300025931 Bacteria 1184
264 Ga0207644_11278851 3300025931 Bacteria 617
265 Ga0207706_10007624 3300025933 Bacteria 10007
266 Ga0207706_10190766 3300025933 Bacteria 1799
267 Ga0207706_10993908 3300025933 Bacteria 705
268 Ga0207706_11011259 3300025933 Bacteria 698
269 Ga0207686_10011162 3300025934 Bacteria 4911
270 Ga0207686_10729354 3300025934 Bacteria 790
271 Ga0207709_10016532 3300025935 Bacteria 4102
272 Ga0207709_10127924 3300025935 Bacteria 1726
273 Ga0207709_10203290 3300025935 Bacteria 1416
274 Ga0207670_10454900 3300025936 Bacteria 1033
275 Ga0207670_10931544 3300025936 Bacteria 729
276 Ga0207670_11182886 3300025936 Bacteria 647
277 Ga0207669_10112638 3300025937 Bacteria 1827
278 Ga0207669_10137831 3300025937 Bacteria 1689
279 Ga0207669_11599094 3300025937 Bacteria 556
280 Ga0207704_11425562 3300025938 Bacteria 594
281 Ga0207665_10047251 3300025939 Bacteria 2885
282 Ga0207711_10017828 3300025941 Bacteria 5899
283 Ga0207689_10259168 3300025942 Bacteria 1438
284 Ga0207661_10409065 3300025944 Bacteria 1231
285 Ga0207661_10495555 3300025944 Bacteria 1116
286 Ga0207661_10820502 3300025944 Bacteria 856
287 Ga0207679_10181895 3300025945 Bacteria 1740
288 Ga0207651_10819554 3300025960 Bacteria 826
289 Ga0207712_10004646 3300025961 Bacteria 8678
290 Ga0207712_11731532 3300025961 Bacteria 560
291 Ga0207712_11851949 3300025961 Bacteria 540
292 Ga0207668_10024316 3300025972 Bacteria 3908
293 Ga0207668_10508741 3300025972 Bacteria 1037
294 Ga0207668_11258677 3300025972 Bacteria 666
295 Ga0207668_12154851 3300025972 Bacteria 502
296 Ga0207677_10425844 3300026023 Bacteria 1132
297 Ga0207703_10490968 3300026035 Bacteria 1151
298 Ga0207703_11772001 3300026035 Bacteria 594
299 Ga0207639_11232639 3300026041 Bacteria 702
300 Ga0207678_10119914 3300026067 Bacteria 2245
301 Ga0207678_10880595 3300026067 Bacteria 791
302 Ga0207708_10554064 3300026075 Bacteria 970
303 Ga0207708_11073475 3300026075 Bacteria 701
304 Ga0207702_10005746 3300026078 Bacteria 10805
305 Ga0207702_10022576 3300026078 Bacteria 5217
306 Ga0207702_10661488 3300026078 Bacteria 1028
307 Ga0207702_11940484 3300026078 Bacteria 580
308 Ga0207641_11346411 3300026088 Bacteria 715
309 Ga0207648_10079988 3300026089 Bacteria 2851
310 Ga0207676_10546777 3300026095 Bacteria 1106
311 Ga0207676_11079626 3300026095 Bacteria 793
312 Ga0207675_100022203 3300026118 Bacteria 5909
313 Ga0207675_100994431 3300026118 Bacteria 857
314 Ga0207683_10000159 3300026121 Bacteria 57009
315 Ga0207683_10042244 3300026121 Bacteria 3982
316 Ga0207683_10293534 3300026121 Bacteria 1487
317 Ga0207698_11677201 3300026142 Bacteria 651
318 Ga0209813_10024546 3300027866 Bacteria 1725
319 Ga0207428_10014442 3300027907 Bacteria 6862
320 Ga0207428_10107070 3300027907 Bacteria 2154
321 Ga0207428_10496824 3300027907 Bacteria 886
322 Ga0207428_10621631 3300027907 Bacteria 777
323 Ga0268266_10439418 3300028379 Bacteria 1239
324 Ga0268266_11523427 3300028379 Bacteria 644
325 Ga0316182_1089038 3300030745 Bacteria 1721
326 Ga0307408_100686996 3300031548 Bacteria 919
327 Ga0307408_100824264 3300031548 Bacteria 844
328 Ga0307408_101986072 3300031548 Bacteria 559
329 Ga0307405_10006598 3300031731 Bacteria 5722
330 Ga0307405_10143689 3300031731 Bacteria 1668
331 Ga0307405_10572815 3300031731 Bacteria 917
332 Ga0307413_10073340 3300031824 Bacteria 2163
333 Ga0307413_10225768 3300031824 Bacteria 1371
334 Ga0307413_10345631 3300031824 Bacteria 1146
335 Ga0307410_10257896 3300031852 Bacteria 1358
336 Ga0307410_10420032 3300031852 Bacteria 1084
337 Ga0307410_11334445 3300031852 Bacteria 628
338 Ga0307406_10007801 3300031901 Bacteria 5952
339 Ga0307406_10127994 3300031901 Bacteria 1777
340 Ga0307406_10468192 3300031901 Bacteria 1015
341 Ga0307407_10001369 3300031903 Bacteria 8787
342 Ga0307407_10417070 3300031903 Bacteria 967
343 Ga0307407_10655868 3300031903 Bacteria 786
344 Ga0307407_11057410 3300031903 Bacteria 629
345 Ga0307409_100002665 3300031995 Bacteria 9397
346 Ga0307409_100129924 3300031995 Bacteria 2150
347 Ga0307409_100831551 3300031995 Bacteria 933
348 Ga0307409_101089187 3300031995 Bacteria 820
349 Ga0307416_100001372 3300032002 Bacteria 13152
350 Ga0307416_100006194 3300032002 Bacteria 7462
351 Ga0307416_100063256 3300032002 Bacteria 3029
352 Ga0307416_100469312 3300032002 Bacteria 1316
353 Ga0307414_10006228 3300032004 Bacteria 6635
354 Ga0307414_10751370 3300032004 Bacteria 886
355 Ga0307411_10006714 3300032005 Bacteria 5784
356 Ga0307411_10942518 3300032005 Bacteria 769
357 Ga0307411_11704584 3300032005 Bacteria 583
358 Ga0307415_100019321 3300032126 Bacteria 4135
359 Ga0307415_100102822 3300032126 Bacteria 2100
360 Ga0307415_100238297 3300032126 Bacteria 1470
361 Ga0307415_100271016 3300032126 Bacteria 1390
362 Ga0373940_0075500 3300035088 Bacteria 988
363 Ga0373956_0090442 3300035119 Bacteria 1412
364 Ga0373956_0317285 3300035119 Bacteria 743
365 Ga0395899_0000754 3300037312 Bacteria 32025
366 Ga0395899_0032351 3300037312 Bacteria 3929
367 Ga0395899_0059249 3300037312 Bacteria 2822
368 Ga0395899_0455595 3300037312 Bacteria 837
369 Ga0395900_0007956 3300037418 Bacteria 10911
370 Ga0395900_0041210 3300037418 Bacteria 4761
371 Ga0395900_0102949 3300037418 Bacteria 2933
372 Ga0395900_0211306 3300037418 Bacteria 1959
373 Ga0395898_0002320 3300037466 Bacteria 22735
374 Ga0395898_0142249 3300037466 Bacteria 2297
375 Ga0395898_0297298 3300037466 Bacteria 1540
376 Ga0395898_0715905 3300037466 Bacteria 943
377 Ga0395905_0266784 3300037471 Bacteria 1598
378 Ga0395905_0307197 3300037471 Bacteria 1474
379 Ga0395905_0951962 3300037471 Bacteria 762
380 Ga0395905_1619550 3300037471 Bacteria 552
381 Ga0436364_0342060 3300037853 Bacteria 1361
382 Ga0436364_0679275 3300037853 Bacteria 6069
383 Ga0436364_0804180 3300037853 Bacteria 539
384 Ga0436364_0943524 3300037853 Bacteria 1007
385 Ga0436364_1225191 3300037853 Bacteria 1031
386 Ga0395901_0022364 3300038443 Bacteria 6479
387 Ga0395901_0040115 3300038443 Bacteria 4848
388 Ga0395901_0179584 3300038443 Bacteria 2220
389 Ga0395901_0254033 3300038443 Bacteria 1831
390 Ga0436365_0256332 3300039437 Bacteria 2004
391 Ga0436365_0973085 3300039437 Bacteria 6600
392 Ga0436365_1021820 3300039437 Bacteria 2588
393 Ga0436365_1163245 3300039437 Bacteria 11993
394 Ga0436365_1486642 3300039437 Bacteria 1170
395 Ga0436363_0082938 3300039450 Bacteria 1447
396 Ga0436363_0089232 3300039450 Bacteria 4576
397 Ga0436363_1100460 3300039450 Bacteria 856
398 Ga0436363_1103227 3300039450 Bacteria 889
399 Ga0436363_1262636 3300039450 Bacteria 610
400 Ga0436363_1454041 3300039450 Bacteria 972
401 Ga0436362_0810807 3300039453 Bacteria 1124
402 Ga0451791_1329103 3300041451 Bacteria 647
403 Ga0451795_0403937 3300041456 Bacteria 534
404 Ga0451802_0914895 3300041460 Bacteria 740
405 Ga0451853_3029569 3300041512 Bacteria 983
406 Ga0439431_0265121 3300041997 Bacteria 512
407 Ga0439443_006413 3300042003 Bacteria 1609
408 Ga0439445_0027654 3300042004 Bacteria 1458
409 Ga0439448_0000109 3300042005 Bacteria 15021
410 Ga0439448_0024054 3300042005 Bacteria 1903
411 Ga0439450_006506 3300042008 Bacteria 2107
412 Ga0439451_003195 3300042009 Bacteria 3327
413 Ga0439451_073035 3300042009 Bacteria 687
414 Ga0439454_001833 3300042011 Bacteria 2132
415 Ga0439454_027583 3300042011 Bacteria 873
416 Ga0439454_044752 3300042011 Bacteria 733
417 Ga0439455_0027593 3300042012 Bacteria 1392
418 Ga0439455_0152897 3300042012 Bacteria 657
419 Ga0439463_000300 3300042016 Bacteria 13799
420 Ga0439463_035655 3300042016 Bacteria 1259
421 Ga0450913_001290 3300042117 Bacteria 1346
422 Ga0450900_000983 3300042136 Bacteria 2585
423 Ga0450905_038512 3300042142 Bacteria 754
424 Ga0450889_031823 3300042144 Bacteria 618
425 Ga0439444_0003660 3300042437 Bacteria 2184
426 Ga0439444_0010989 3300042437 Bacteria 1457
427 Ga0439459_0012780 3300042438 Bacteria 1500
428 Ga0439464_0029234 3300042439 Bacteria 1539
429 Ga0439464_0110431 3300042439 Bacteria 841
430 Ga0439460_0123526 3300042461 Bacteria 848
431 Ga0450916_001399 3300042530 Bacteria 2404
432 Ga0439440_0000071 3300042993 Bacteria 12687
433 Ga0439440_0104889 3300042993 Bacteria 772
434 Ga0466969_0012982 3300044656 Bacteria 4387
435 Ga0466969_0504335 3300044656 Bacteria 552
436 Ga0466965_0206599 3300044683 Bacteria 1043
437 Ga0466966_0101602 3300044684 Bacteria 1778
438 Ga0466966_0224283 3300044684 Bacteria 1134
439 Ga0466961_0319873 3300044693 Bacteria 946
440 Ga0466963_0002776 3300044694 Bacteria 9869
441 Ga0466963_0571975 3300044694 Bacteria 798
442 Ga0466964_0404617 3300044706 Bacteria 714
443 Ga0466971_0678211 3300044719 Bacteria 517
444 Ga0466968_0009109 3300044735 Bacteria 3815
445 Ga0466968_0071717 3300044735 Bacteria 1509
446 Ga0466970_0038561 3300044765 Bacteria 2534
447 Ga0466970_0055165 3300044765 Bacteria 2122
448 Ga0466957_0162836 3300044842 Bacteria 1449
449 Ga0466957_0182098 3300044842 Bacteria 1372
450 Ga0466960_0039345 3300044901 Bacteria 2230
451 Ga0466960_0461748 3300044901 Bacteria 739
452 Ga0466959_0022177 3300045049 Bacteria 4691
453 Ga0466959_0052042 3300045049 Bacteria 3000
454 Ga0466959_0111901 3300045049 Bacteria 1948
455 Ga0466959_0248794 3300045049 Bacteria 1226
456 Ga0466958_0018628 3300045836 Bacteria 4032
457 Ga0466958_0048354 3300045836 Bacteria 2570
458 Ga0466958_0380934 3300045836 Bacteria 909
459 Ga0466967_0002689 3300045976 Bacteria 11226
460 Ga0466967_0009758 3300045976 Bacteria 7154
461 Ga0466967_0016417 3300045976 Bacteria 5839
462 Ga0466967_0301969 3300045976 Bacteria 1540
463 Ga0466967_0443567 3300045976 Bacteria 1268
464 Ga0495592_0621780 3300046454 Bacteria 657
465 Ga0495603_0093027 3300046455 Bacteria 1762
466 Ga0495603_0593214 3300046455 Bacteria 634
467 Ga0495641_0266095 3300046461 Bacteria 771
468 Ga0495651_0038014 3300046462 Bacteria 3748
469 Ga0495653_0040472 3300046463 Unclassified 3642
470 Ga0495653_0135009 3300046463 Bacteria 1742
471 Ga0495605_0317860 3300046474 Bacteria 657
472 Ga0495639_0345368 3300046475 Unclassified 747
473 Ga0495664_0104011 3300046477 Unclassified 1712
474 Ga0495584_0153736 3300046491 Bacteria 1169
475 Ga0495596_0301635 3300046500 Bacteria 623
476 Ga0495607_0209841 3300046501 Bacteria 959
477 Ga0495607_0347928 3300046501 Bacteria 685
478 Ga0495608_0037857 3300046511 Bacteria 3242
479 Ga0495608_0681126 3300046511 Bacteria 613
480 Ga0495608_0932228 3300046511 Bacteria 507
481 Ga0495644_0156405 3300046523 Bacteria 873
482 Ga0495642_0145564 3300046528 Bacteria 1024
483 Ga0495652_0049583 3300046529 Bacteria 3594
484 Ga0495665_0463921 3300046531 Bacteria 640
485 Ga0495640_0082362 3300046533 Unclassified 2137
486 Ga0495587_0188634 3300046536 Unclassified 1168
487 Ga0495598_0024343 3300046537 Bacteria 1641
488 Ga0495633_0243572 3300046558 Bacteria 821
489 Ga0495667_0010799 3300046559 Bacteria 6174
490 Ga0495667_0254785 3300046559 Bacteria 1117
491 Ga0495656_0077431 3300046615 Bacteria 1492
492 Ga0495656_0101810 3300046615 Bacteria 1330
493 Ga0495656_0309063 3300046615 Bacteria 812
494 Ga0495668_0145844 3300046616 Bacteria 1296
495 Ga0495668_0813359 3300046616 Bacteria 518
496 Ga0495634_0047971 3300046642 Bacteria 2877
497 Ga0495635_0093573 3300046663 Unclassified 2055
498 Ga0495657_0055379 3300046675 Unclassified 2646
499 Ga0495599_0237310 3300046678 Bacteria 1112
500 Ga0495623_0353444 3300046679 Bacteria 800
501 Ga0495646_0206413 3300046680 Bacteria 1068
502 Ga0495647_0015363 3300046681 Bacteria 2682
503 Ga0495613_0258745 3300046689 Unclassified 1213
504 Ga0495624_0411985 3300046690 Bacteria 811
505 Ga0495671_0239459 3300046692 Bacteria 877
506 Ga0495600_0011377 3300046809 Bacteria 5544
507 Ga0495600_0284534 3300046809 Bacteria 1046
508 Ga0495581_0720307 3300047315 Bacteria 575
509 Ga0495604_0087270 3300047317 Bacteria 2324
510 Ga0495636_0458792 3300047318 Bacteria 613
511 Ga0495674_0269181 3300047319 Unclassified 1398
512 Ga0495674_0510027 3300047319 Bacteria 961
513 Ga0495674_0955844 3300047319 Bacteria 659
514 Ga0495674_1279597 3300047319 Bacteria 551
515 Ga0495680_0023455 3300047322 Bacteria 5130
516 Ga0495680_0480844 3300047322 Bacteria 846
517 Ga0495677_0101052 3300047445 Bacteria 1092
518 Ga0495681_0103368 3300047470 Bacteria 1243
519 Ga0495602_0312527 3300048088 Unclassified 1146
520 Ga0496100_0654051 3300048903 Bacteria 818
521 Ga0496101_0001697 3300048904 Bacteria 13190
522 Ga0496101_0031125 3300048904 Bacteria 3748
523 Ga0496101_0124202 3300048904 Bacteria 1954
524 Ga0496101_0160665 3300048904 Bacteria 1723
525 Ga0496101_0557949 3300048904 Bacteria 906
526 Ga0496103_0066589 3300048906 Bacteria 2248
527 Ga0496104_0000458 3300048907 Bacteria 35160
528 Ga0496104_0033593 3300048907 Bacteria 4781
529 Ga0496104_0117384 3300048907 Bacteria 2554
530 Ga0496104_0157540 3300048907 Bacteria 2179
531 Ga0496104_0435650 3300048907 Bacteria 1223
532 Ga0496104_0502046 3300048907 Bacteria 1124
533 Ga0496104_0800433 3300048907 Bacteria 849
534 Ga0496105_0000105 3300048908 Bacteria 56991
535 Ga0496105_0753907 3300048908 Bacteria 743
536 Ga0496106_0007642 3300048909 Bacteria 7995
537 Ga0496106_0092813 3300048909 Bacteria 2332
538 Ga0496107_0004437 3300048910 Bacteria 9511
539 Ga0496107_0105179 3300048910 Bacteria 2072
540 Ga0496108_0006247 3300048911 Bacteria 9648
541 Ga0496108_0013791 3300048911 Bacteria 6592
542 Ga0496108_0207679 3300048911 Bacteria 1700
543 Ga0496108_0298056 3300048911 Bacteria 1404
544 Ga0496109_0000298 3300048912 Bacteria 46751
545 Ga0496109_0030941 3300048912 Bacteria 4799
546 Ga0496109_0035992 3300048912 Bacteria 4469
547 Ga0496109_0419679 3300048912 Bacteria 1264
548 Ga0496109_1294545 3300048912 Bacteria 665
549 Ga0496110_0000644 3300048913 Bacteria 23907
550 Ga0496110_0053528 3300048913 Bacteria 3549
551 Ga0496110_0092550 3300048913 Bacteria 2706
552 Ga0496110_0166436 3300048913 Bacteria 1999
553 Ga0496110_0460109 3300048913 Bacteria 1159
554 Ga0496110_0489565 3300048913 Bacteria 1120
555 Ga0496110_1807806 3300048913 Bacteria 521
556 Ga0496111_0009478 3300048914 Bacteria 6502
557 Ga0496111_0041754 3300048914 Bacteria 3292
558 Ga0496112_0061821 3300048915 Bacteria 3693
559 Ga0496112_0511180 3300048915 Bacteria 1136
560 Ga0496112_0631148 3300048915 Bacteria 1002
561 Ga0496113_0033051 3300048916 Bacteria 3764
562 Ga0496113_0099697 3300048916 Bacteria 2250
563 Ga0496113_1139250 3300048916 Bacteria 611
564 Ga0496113_1456558 3300048916 Bacteria 529
565 Ga0496114_0000952 3300048917 Bacteria 21669
566 Ga0496114_0034719 3300048917 Bacteria 4162
567 Ga0496114_0039680 3300048917 Bacteria 3896
568 Ga0496114_0381567 3300048917 Bacteria 1248
569 Ga0496114_0545020 3300048917 Bacteria 1025
570 Ga0496114_0797376 3300048917 Bacteria 823
571 Ga0496115_0270284 3300048918 Bacteria 1397
572 Ga0496115_0337741 3300048918 Bacteria 1230
573 Ga0496115_0542649 3300048918 Bacteria 930
574 Ga0501031_0005436 3300049568 Bacteria 8293
575 Ga0501031_0007069 3300049568 Bacteria 7322
576 Ga0501031_0033308 3300049568 Bacteria 3360
577 Ga0501031_0371580 3300049568 Bacteria 925
578 Ga0501032_0014840 3300049569 Bacteria 5513
579 Ga0501032_0127300 3300049569 Bacteria 1682
580 Ga0501032_0404654 3300049569 Bacteria 876
581 Ga0501033_0003024 3300049570 Bacteria 14013
582 Ga0501033_0029275 3300049570 Bacteria 4138
583 Ga0501033_0034425 3300049570 Bacteria 3800
584 Ga0501033_0095955 3300049570 Bacteria 2167
585 Ga0501034_0139727 3300049571 Bacteria 2402
586 Ga0501034_0268119 3300049571 Bacteria 1649
587 Ga0501034_0378657 3300049571 Bacteria 1340
588 Ga0501036_0024270 3300049572 Bacteria 5111
589 Ga0501036_0035743 3300049572 Bacteria 4203
590 Ga0501036_0069425 3300049572 Bacteria 2980
591 Ga0501036_0174495 3300049572 Bacteria 1810
592 Ga0501036_0799348 3300049572 Bacteria 777
593 Ga0501037_0008185 3300049573 Bacteria 7665
594 Ga0501037_0104647 3300049573 Bacteria 2040
595 Ga0501038_0003860 3300049574 Bacteria 13931
596 Ga0501038_0302340 3300049574 Unclassified 1255
597 Ga0501038_0336437 3300049574 Bacteria 1178
598 Ga0501039_0033991 3300049575 Bacteria 3933
599 Ga0501039_0057484 3300049575 Bacteria 3012
600 Ga0501039_0130223 3300049575 Bacteria 1974
601 Ga0501039_0183099 3300049575 Bacteria 1647
602 Ga0501039_0197052 3300049575 Bacteria 1583
603 Ga0501040_0000294 3300049576 Bacteria 29102
604 Ga0501040_0049098 3300049576 Bacteria 2885
605 Ga0501040_0114299 3300049576 Bacteria 1889
606 Ga0501040_0322659 3300049576 Bacteria 1105
607 Ga0501041_0002801 3300049577 Bacteria 9960
608 Ga0501041_0358014 3300049577 Unclassified 922
609 Ga0501041_1042474 3300049577 Bacteria 526
610 Ga0501042_0002916 3300049578 Bacteria 10618
611 Ga0501042_0021478 3300049578 Bacteria 4499
612 Ga0501042_0089222 3300049578 Bacteria 2212
613 Ga0501042_0092158 3300049578 Bacteria 2175
614 Ga0501042_0615676 3300049578 Unclassified 789
615 Ga0501042_0648624 3300049578 Bacteria 767
616 Ga0501043_0028794 3300049579 Bacteria 4361
617 Ga0501043_0168478 3300049579 Bacteria 1709
618 Ga0501046_0004131 3300049580 Bacteria 13232
619 Ga0501046_0005463 3300049580 Bacteria 11365
620 Ga0501046_0007034 3300049580 Bacteria 9912
621 Ga0501046_0199198 3300049580 Bacteria 1490
622 Ga0501047_0055502 3300049581 Bacteria 3830
623 Ga0501047_0117153 3300049581 Bacteria 2545
624 Ga0501047_0135900 3300049581 Bacteria 2339
625 Ga0501047_0216632 3300049581 Bacteria 1771
626 Ga0501048_0023272 3300049582 Bacteria 4530
627 Ga0501048_0030606 3300049582 Bacteria 3894
628 Ga0501048_0062025 3300049582 Bacteria 2646
629 Ga0501048_0261899 3300049582 Bacteria 1228
630 Ga0501048_0454291 3300049582 Bacteria 918
631 Ga0501048_0644747 3300049582 Unclassified 760
632 Ga0501067_0315209 3300049583 Bacteria 871
633 Ga0501068_0001358 3300049584 Bacteria 12976
634 Ga0501068_0016279 3300049584 Bacteria 4285
635 Ga0501068_0061500 3300049584 Bacteria 2282
636 Ga0501068_0622400 3300049584 Bacteria 704
637 Ga0501069_0002413 3300049585 Bacteria 9501
638 Ga0501069_0235018 3300049585 Bacteria 1067
639 Ga0501069_0484484 3300049585 Bacteria 737
640 Ga0501069_0700129 3300049585 Bacteria 611
641 Ga0501070_0017431 3300049586 Bacteria 6029
642 Ga0501070_0034319 3300049586 Bacteria 4242
643 Ga0501070_0095095 3300049586 Bacteria 2465
644 Ga0501070_0231523 3300049586 Unclassified 1514
645 Ga0501071_0038752 3300049587 Bacteria 3406
646 Ga0501071_0150098 3300049587 Unclassified 1738
647 Ga0501071_0186124 3300049587 Bacteria 1556
648 Ga0501071_0284068 3300049587 Bacteria 1252
649 Ga0501071_0563675 3300049587 Bacteria 875
650 Ga0501072_0058818 3300049588 Bacteria 3029
651 Ga0501072_0115994 3300049588 Bacteria 2133
652 Ga0501072_0123375 3300049588 Unclassified 2064
653 Ga0501072_0632355 3300049588 Bacteria 843
654 Ga0501072_1291914 3300049588 Bacteria 566
655 Ga0501073_0000015 3300049589 Bacteria 157300
656 Ga0501073_0004766 3300049589 Bacteria 10179
657 Ga0501073_0078764 3300049589 Bacteria 2293
658 Ga0501074_0118916 3300049590 Bacteria 1889
659 Ga0501074_0158998 3300049590 Bacteria 1614
660 Ga0501074_0324458 3300049590 Bacteria 1093
661 Ga0501074_0336835 3300049590 Bacteria 1071
662 Ga0501074_0429524 3300049590 Bacteria 937
663 Ga0501074_0734822 3300049590 Unclassified 696
664 Ga0501075_0004810 3300049591 Bacteria 9188
665 Ga0501075_0015526 3300049591 Bacteria 5466
666 Ga0501075_0319804 3300049591 Bacteria 1182
667 Ga0501075_0518082 3300049591 Bacteria 910
668 Ga0501075_0592196 3300049591 Bacteria 846
669 Ga0501075_1227261 3300049591 Bacteria 569
670 Ga0501076_0004393 3300049592 Bacteria 10022
671 Ga0501076_0034176 3300049592 Bacteria 3972
672 Ga0501076_0095261 3300049592 Bacteria 2397
673 Ga0501076_0238392 3300049592 Bacteria 1488
674 Ga0501076_0341826 3300049592 Bacteria 1228
675 Ga0501076_0578025 3300049592 Bacteria 927
676 Ga0501077_0000312 3300049593 Bacteria 28963
677 Ga0501077_0018803 3300049593 Bacteria 4371
678 Ga0501079_0000242 3300049741 Bacteria 32983
679 Ga0501079_0195856 3300049741 Bacteria 1577
680 Ga0501079_0285089 3300049741 Unclassified 1291
681 Ga0501079_0554733 3300049741 Bacteria 903
682 Ga0501080_0010205 3300049742 Bacteria 8588
683 Ga0501080_0025558 3300049742 Bacteria 5482
684 Ga0501080_0137028 3300049742 Bacteria 2265
685 Ga0501080_0430663 3300049742 Bacteria 1184
686 Ga0501080_0471369 3300049742 Bacteria 1124
687 Ga0501080_1051295 3300049742 Bacteria 704
688 Ga0501081_0002051 3300049743 Bacteria 12564
689 Ga0501081_0003708 3300049743 Bacteria 9784
690 Ga0501081_0004277 3300049743 Bacteria 9149
691 Ga0501081_0014832 3300049743 Bacteria 5142
692 Ga0501083_0002239 3300049744 Bacteria 13224
693 Ga0501083_0063726 3300049744 Bacteria 2458
694 Ga0501083_0105334 3300049744 Bacteria 1857
695 Ga0501035_0004259 3300049822 Bacteria 13581
696 Ga0501035_0060539 3300049822 Bacteria 3370
697 Ga0501035_0191282 3300049822 Bacteria 1759
698 Ga0501035_1249456 3300049822 Unclassified 574
699 Ga0501035_1365169 3300049822 Bacteria 544
700 Ga0501044_0112561 3300049823 Bacteria 2729
701 Ga0501044_0216272 3300049823 Bacteria 1868
702 Ga0501044_0365039 3300049823 Bacteria 1361
703 Ga0501044_0594060 3300049823 Bacteria 1001
704 Ga0501044_1332484 3300049823 Bacteria 584
705 Ga0501045_0005270 3300049824 Bacteria 8950
706 Ga0501045_0016753 3300049824 Bacteria 5206
707 Ga0501045_0018995 3300049824 Bacteria 4895
708 Ga0501045_0139530 3300049824 Bacteria 1802
709 Ga0501045_0662786 3300049824 Bacteria 771
710 nmdc:mga03683_13083_c1 3300050489 Bacteria 3047
711 nmdc:mga03n38_99602_c1 3300050490 Bacteria 1400
712 nmdc:mga00v17_138077_c1 3300050491 Bacteria 1562
713 nmdc:mga00v17_8860_c1 3300050491 Bacteria 5424
714 nmdc:mga0yw44_113316_c1 3300050492 Bacteria 1740
715 nmdc:mga0yw44_266487_c1 3300050492 Bacteria 1143
716 nmdc:mga0k408_116709_c1 3300050493 Bacteria 1579
717 nmdc:mga06z11_121697_c1 3300050494 Bacteria 1456
718 nmdc:mga06z11_236067_c1 3300050494 Bacteria 1073
719 nmdc:mga06z11_87349_c1 3300050494 Bacteria 1686
720 nmdc:mga04h51_29299_c1 3300050495 Bacteria 1723
721 nmdc:mga07m45_333867_c1 3300050496 Bacteria 881
722 nmdc:mga07m45_456316_c1 3300050496 Unclassified 741
723 nmdc:mga05p37_1106327_c1 3300050507 Bacteria 829
724 nmdc:mga05p37_17348_c1 3300050507 Bacteria 8685
725 nmdc:mga05p37_38492_c1 3300050507 Bacteria 5867
726 nmdc:mga05p37_52144_c1 3300050507 Bacteria 5031
727 nmdc:mga09592_1090872_c1 3300050508 Bacteria 664
728 nmdc:mga09592_22506_c1 3300050508 Bacteria 5202
729 nmdc:mga09592_313954_c1 3300050508 Bacteria 1358
730 nmdc:mga09592_3911_c1 3300050508 Bacteria 11998
731 nmdc:mga09592_562392_c1 3300050508 Bacteria 979
732 nmdc:mga0qj67_20968_c1 3300050509 Bacteria 5009
733 nmdc:mga0qj67_37838_c1 3300050509 Bacteria 3783
734 nmdc:mga0qj67_867798_c1 3300050509 Bacteria 712
735 nmdc:mga06r32_2062339_c1 3300050510 Bacteria 504
736 nmdc:mga06r32_408509_c1 3300050510 Bacteria 1339
737 nmdc:mga06r32_9247_c1 3300050510 Bacteria 8883
738 nmdc:mga08y16_38608_c1 3300050511 Bacteria 5013
739 nmdc:mga08y16_50914_c1 3300050511 Bacteria 4334
740 nmdc:mga08y16_815472_c1 3300050511 Bacteria 925
741 nmdc:mga08y16_94663_c1 3300050511 Bacteria 3111
742 nmdc:mga08y16_972582_c1 3300050511 Bacteria 830
743 nmdc:mga0n895_246102_c1 3300050512 Bacteria 1815
744 nmdc:mga0n895_820776_c1 3300050512 Bacteria 919
745 nmdc:mga0a205_16959_c1 3300050515 Bacteria 6818
746 nmdc:mga0a205_53194_c1 3300050515 Bacteria 3908
747 nmdc:mga0sz30_160184_c1 3300050516 Bacteria 997
748 Ga0495601_0236371 3300053077 Bacteria 1193
749 Ga0495601_0750485 3300053077 Bacteria 621
750 Ga0495601_0880556 3300053077 Bacteria 566
751 Ga0495612_0145696 3300053078 Bacteria 1029
752 Ga0495595_0103172 3300053084 Bacteria 1378
753 Ga0495619_0231410 3300053085 Bacteria 1280
754 Ga0495619_0234705 3300053085 Bacteria 1271
755 Ga0495619_0733472 3300053085 Bacteria 671
756 Ga0495619_1047394 3300053085 Bacteria 544
757 Ga0500568_0000011 3300053139 Bacteria 248947
758 Ga0500616_0000251 3300053153 Bacteria 83237
759 Ga0501084_0012958 3300054114 Bacteria 6904
760 Ga0501084_0015434 3300054114 Bacteria 6334
761 Ga0501084_0018059 3300054114 Bacteria 5875
762 Ga0501084_0195025 3300054114 Unclassified 1709
763 Ga0501082_0005629 3300060353 Bacteria 10874
764 Ga0501082_0020406 3300060353 Bacteria 5713
765 Ga0501082_0027467 3300060353 Bacteria 4899
766 Ga0501082_0047130 3300060353 Bacteria 3714
767 Ga0466962_0154360 3300061719 Bacteria 1114
768 Ga0466962_0570102 3300061719 Bacteria 576
769 Ga0530510_0000457 3300061734 Bacteria 26487
770 Ga0530510_0026507 3300061734 Bacteria 4149
771 2644180750 2643221631 Bacteria 8168043
772 2739363635 2738543034 Bacteria 6084756
773 2811847724 2808606982 Bacteria 7791042
774 2816422971 2816332119 Bacteria 8120218
775 2874124427 2874123672 Bacteria 7238285
776 2919053713 2919051321 Bacteria 4210889
777 Ga0111539_10717526
778 JGI24737J22298_10061964
779 JGI24735J21928_10040230
780 JGI25406J46586_10020334
781 JGI25165J46597_1000130
782 JGI25407J50210_10003381
783 JGI25407J50210_10027822
784 Ga0065715_10627088
785 Ga0070658_10720697
786 Ga0070683_100666304
787 Ga0070683_100936801
788 Ga0070683_101483621
789 Ga0070690_101252317
790 Ga0070677_10667912
791 Ga0068869_100627056
792 Ga0068869_100907065
793 Ga0070680_100922845
794 Ga0070682_100086968
795 Ga0070682_100166181
796 Ga0070682_101614618
797 Ga0068868_100460396
798 Ga0070660_101334749
799 Ga0070689_100617700
800 Ga0070689_101135803
801 Ga0070692_10288680
802 Ga0070668_101139821
803 Ga0070675_100401588
804 Ga0070675_100743264
805 Ga0070671_100174162
806 Ga0070674_100032516
807 Ga0070674_101886452
808 Ga0070673_100181963
809 Ga0070673_101608990
810 Ga0070659_101046051
811 Ga0070659_101101492
812 Ga0070659_101333347
813 Ga0070714_100120218
814 Ga0070714_100193114
815 Ga0070714_100297117
816 Ga0070714_101524833
817 Ga0070713_100073771
818 Ga0070713_100210601
819 Ga0070710_10032837
820 Ga0070701_10018615
821 Ga0070701_10382193
822 Ga0070711_100116144
823 Ga0070711_100308544
824 Ga0070705_100140919
825 Ga0070705_100664865
826 Ga0070700_101120627
827 Ga0070708_100448768
828 Ga0070663_100094525
829 Ga0070663_100900719
830 Ga0070678_100003259
831 Ga0070678_100377844
832 Ga0070678_102261115
833 Ga0070678_102305568
834 Ga0070662_100049283
835 Ga0070662_100049615
836 Ga0070662_100351823
837 Ga0070706_100020757
838 Ga0070707_100000131
839 Ga0070707_100008018
840 Ga0070698_100083370
841 Ga0070698_100146923
842 Ga0070698_100188041
843 Ga0070699_100020982
844 Ga0070679_100597521
845 Ga0070684_101060894
846 Ga0070684_101545039
847 Ga0070697_100000060
848 Ga0070672_100715290
849 Ga0070695_101495406
850 Ga0070696_100816336
851 Ga0070693_100445106
852 Ga0070693_100613217
853 Ga0070665_100173246
854 Ga0070665_100575569
855 Ga0070665_100906238
856 Ga0068855_100085381
857 Ga0068855_100395426
858 Ga0070664_100301641
859 Ga0068856_100024160
860 Ga0068856_100351721
861 Ga0068856_100723296
862 Ga0070702_100042481
863 Ga0070702_100325972
864 Ga0070702_100533551
865 Ga0068864_100753419
866 Ga0068864_101486860
867 Ga0068866_10004722
868 Ga0068866_10479210
869 Ga0068861_100039646
870 Ga0068861_100905131
871 Ga0081455_10045424
872 Ga0081455_10085605
873 Ga0081538_10000441
874 Ga0081538_10000723
875 Ga0081538_10027389
876 Ga0081538_10041551
877 Ga0081538_10081164
878 Ga0081538_10130359
879 Ga0081538_10137008
880 Ga0081539_10009917
881 Ga0070717_10003866
882 Ga0070717_10060680
883 Ga0070717_11924817
884 Ga0075365_10025327
885 Ga0075365_10041102
886 Ga0075368_10003727
887 Ga0075363_100135597
888 Ga0075363_100187959
889 Ga0075364_10010779
890 Ga0075364_10160152
891 Ga0075364_10209592
892 Ga0075364_11246622
893 Ga0075432_10118908
894 Ga0070712_100018136
895 Ga0070712_100335008
896 Ga0075362_10003266
897 Ga0075367_10066048
898 Ga0075367_10096888
899 Ga0075366_10010023
900 Ga0097621_100121333
901 Ga0097621_100815711
902 Ga0097621_100951291
903 Ga0075370_10489527
904 Ga0075370_10540009
905 Ga0075370_10688845
906 Ga0068871_100007036
907 Ga0075428_100001658
908 Ga0075428_101139667
909 Ga0075430_100004254
910 Ga0075430_100005650
911 Ga0075430_100230234
912 Ga0075431_100002060
913 Ga0075429_100001429
914 Ga0075429_100274583
915 Ga0075435_100738600
916 Ga0105240_12783950
917 Ga0111539_10013780
918 Ga0111539_10019017
919 Ga0111539_11188702
920 Ga0111539_11747209
921 Ga0111539_13017687
922 Ga0105245_10404772
923 Ga0105245_10428225
924 Ga0105245_10797757
925 Ga0105245_11159937
926 Ga0105245_11587217
927 Ga0105245_11860457
928 Ga0114129_10005888
929 Ga0114129_10762568
930 Ga0114129_11430500
931 Ga0114129_12787376
932 Ga0105243_10004973
933 Ga0105243_10093178
934 Ga0105243_10177954
935 Ga0105243_10375821
936 Ga0105243_10436777
937 Ga0105243_10550552
938 Ga0105243_11219231
939 Ga0105243_11767790
940 Ga0105241_10167788
941 Ga0105241_12195560
942 Ga0105242_10013553
943 Ga0105248_10069035
944 Ga0105248_11489743
945 Ga0105248_12310465
946 Ga0105237_11409300
947 Ga0105237_11457285
948 Ga0105238_11407905
949 Ga0105249_10004029
950 Ga0105249_10075368
951 Ga0105249_10776101
952 Ga0105239_10094860
953 Ga0105239_10098384
954 Ga0105239_10166669
955 Ga0105239_11113826
956 Ga0105246_10254183
957 Ga0105246_10718168
958 Ga0105246_11112786
959 Ga0105246_11491718
960 Ga0157339_1054154
961 Ga0157370_10000318
962 Ga0157370_10330375
963 Ga0157369_10004035
964 Ga0157369_11255595
965 Ga0157374_10008864
966 Ga0157374_11885874
967 Ga0157374_12170003
968 Ga0157378_10082218
969 Ga0163162_10022697
970 Ga0163162_10552593
971 Ga0163162_11299074
972 Ga0163162_11479460
973 Ga0163162_12746894
974 Ga0157372_10505872
975 Ga0157372_12755837
976 Ga0157375_10320648
977 Ga0157375_10525759
978 Ga0157375_10604518
979 Ga0157375_10844670
980 Ga0157375_12096935
981 Ga0163163_10226291
982 Ga0163163_10322381
983 Ga0163163_10503623
984 Ga0163163_12630033
985 Ga0157380_10078282
986 Ga0157380_10793579
987 Ga0182008_10073268
988 Ga0157377_10626234
989 Ga0157377_11218145
990 Ga0157379_10004562
991 Ga0157379_11566727
992 Ga0157379_12351233
993 Ga0157376_11074462
994 Ga0157376_12838977
995 Ga0163161_10174512
996 Ga0163161_10502764
997 Ga0213874_10047100
998 Ga0213874_10128489
999 Ga0213876_10017284
1000 Ga0213876_10028556
1001 Ga0213876_10148609
1002 Ga0213876_10302848
1003 Ga0213876_10308623
1004 Ga0213875_10108058
1005 Ga0207427_100649
1006 Ga0209026_1008985
1007 Ga0209233_1000003
1008 Ga0209455_1024475
1009 Ga0207682_10335944
1010 Ga0207692_10183350
1011 Ga0207692_10561371
1012 Ga0207692_10794303
1013 Ga0207642_10005615
1014 Ga0207642_10907566
1015 Ga0207710_10346743
1016 Ga0207688_10520217
1017 Ga0207680_10015574
1018 Ga0207680_10991407
1019 Ga0207680_11084645
1020 Ga0207647_10092083
1021 Ga0207685_10854587
1022 Ga0207699_11364271
1023 Ga0207643_10812363
1024 Ga0207693_10013533
1025 Ga0207693_10306518
1026 Ga0207663_10148674
1027 Ga0207662_11184955
1028 Ga0207646_10000135
1029 Ga0207646_10009332
1030 Ga0207659_10173195
1031 Ga0207687_10288042
1032 Ga0207687_10405292
1033 Ga0207687_11612839
1034 Ga0207700_10433494
1035 Ga0207700_10487108
1036 Ga0207664_10151545
1037 Ga0207664_10184417
1038 Ga0207664_10811245
1039 Ga0207644_10359661
1040 Ga0207644_11278851
1041 Ga0207706_10007624
1042 Ga0207706_10190766
1043 Ga0207706_10993908
1044 Ga0207706_11011259
1045 Ga0207686_10011162
1046 Ga0207686_10729354
1047 Ga0207709_10016532
1048 Ga0207709_10127924
1049 Ga0207709_10203290
1050 Ga0207670_10454900
1051 Ga0207670_10931544
1052 Ga0207670_11182886
1053 Ga0207669_10112638
1054 Ga0207669_10137831
1055 Ga0207669_11599094
1056 Ga0207704_11425562
1057 Ga0207665_10047251
1058 Ga0207711_10017828
1059 Ga0207689_10259168
1060 Ga0207661_10409065
1061 Ga0207661_10495555
1062 Ga0207661_10820502
1063 Ga0207679_10181895
1064 Ga0207651_10819554
1065 Ga0207712_10004646
1066 Ga0207712_11731532
1067 Ga0207712_11851949
1068 Ga0207668_10024316
1069 Ga0207668_10508741
1070 Ga0207668_11258677
1071 Ga0207668_12154851
1072 Ga0207677_10425844
1073 Ga0207703_10490968
1074 Ga0207703_11772001
1075 Ga0207639_11232639
1076 Ga0207678_10119914
1077 Ga0207678_10880595
1078 Ga0207708_10554064
1079 Ga0207708_11073475
1080 Ga0207702_10005746
1081 Ga0207702_10022576
1082 Ga0207702_10661488
1083 Ga0207702_11940484
1084 Ga0207641_11346411
1085 Ga0207648_10079988
1086 Ga0207676_10546777
1087 Ga0207676_11079626
1088 Ga0207675_100022203
1089 Ga0207675_100994431
1090 Ga0207683_10000159
1091 Ga0207683_10042244
1092 Ga0207683_10293534
1093 Ga0207698_11677201
1094 Ga0209813_10024546
1095 Ga0207428_10014442
1096 Ga0207428_10107070
1097 Ga0207428_10496824
1098 Ga0207428_10621631
1099 Ga0268266_10439418
1100 Ga0268266_11523427
1101 Ga0316182_1089038
1102 Ga0307408_100686996
1103 Ga0307408_100824264
1104 Ga0307408_101986072
1105 Ga0307405_10006598
1106 Ga0307405_10143689
1107 Ga0307405_10572815
1108 Ga0307413_10073340
1109 Ga0307413_10225768
1110 Ga0307413_10345631
1111 Ga0307410_10257896
1112 Ga0307410_10420032
1113 Ga0307410_11334445
1114 Ga0307406_10007801
1115 Ga0307406_10127994
1116 Ga0307406_10468192
1117 Ga0307407_10001369
1118 Ga0307407_10417070
1119 Ga0307407_10655868
1120 Ga0307407_11057410
1121 Ga0307409_100002665
1122 Ga0307409_100129924
1123 Ga0307409_100831551
1124 Ga0307409_101089187
1125 Ga0307416_100001372
1126 Ga0307416_100006194
1127 Ga0307416_100063256
1128 Ga0307416_100469312
1129 Ga0307414_10006228
1130 Ga0307414_10751370
1131 Ga0307411_10006714
1132 Ga0307411_10942518
1133 Ga0307411_11704584
1134 Ga0307415_100019321
1135 Ga0307415_100102822
1136 Ga0307415_100238297
1137 Ga0307415_100271016
1138 Ga0373940_0075500
1139 Ga0373956_0090442
1140 Ga0373956_0317285
1141 Ga0395899_0000754
1142 Ga0395899_0032351
1143 Ga0395899_0059249
1144 Ga0395899_0455595
1145 Ga0395900_0007956
1146 Ga0395900_0041210
1147 Ga0395900_0102949
1148 Ga0395900_0211306
1149 Ga0395898_0002320
1150 Ga0395898_0142249
1151 Ga0395898_0297298
1152 Ga0395898_0715905
1153 Ga0395905_0266784
1154 Ga0395905_0307197
1155 Ga0395905_0951962
1156 Ga0395905_1619550
1157 Ga0436364_0342060
1158 Ga0436364_0679275
1159 Ga0436364_0804180
1160 Ga0436364_0943524
1161 Ga0436364_1225191
1162 Ga0395901_0022364
1163 Ga0395901_0040115
1164 Ga0395901_0179584
1165 Ga0395901_0254033
1166 Ga0436365_0256332
1167 Ga0436365_0973085
1168 Ga0436365_1021820
1169 Ga0436365_1163245
1170 Ga0436365_1486642
1171 Ga0436363_0082938
1172 Ga0436363_0089232
1173 Ga0436363_1100460
1174 Ga0436363_1103227
1175 Ga0436363_1262636
1176 Ga0436363_1454041
1177 Ga0436362_0810807
1178 Ga0451791_1329103
1179 Ga0451795_0403937
1180 Ga0451802_0914895
1181 Ga0451853_3029569
1182 Ga0439431_0265121
1183 Ga0439443_006413
1184 Ga0439445_0027654
1185 Ga0439448_0000109
1186 Ga0439448_0024054
1187 Ga0439450_006506
1188 Ga0439451_003195
1189 Ga0439451_073035
1190 Ga0439454_001833
1191 Ga0439454_027583
1192 Ga0439454_044752
1193 Ga0439455_0027593
1194 Ga0439455_0152897
1195 Ga0439463_000300
1196 Ga0439463_035655
1197 Ga0450913_001290
1198 Ga0450900_000983
1199 Ga0450905_038512
1200 Ga0450889_031823
1201 Ga0439444_0003660
1202 Ga0439444_0010989
1203 Ga0439459_0012780
1204 Ga0439464_0029234
1205 Ga0439464_0110431
1206 Ga0439460_0123526
1207 Ga0450916_001399
1208 Ga0439440_0000071
1209 Ga0439440_0104889
1210 Ga0466969_0012982
1211 Ga0466969_0504335
1212 Ga0466965_0206599
1213 Ga0466966_0101602
1214 Ga0466966_0224283
1215 Ga0466961_0319873
1216 Ga0466963_0002776
1217 Ga0466963_0571975
1218 Ga0466964_0404617
1219 Ga0466971_0678211
1220 Ga0466968_0009109
1221 Ga0466968_0071717
1222 Ga0466970_0038561
1223 Ga0466970_0055165
1224 Ga0466957_0162836
1225 Ga0466957_0182098
1226 Ga0466960_0039345
1227 Ga0466960_0461748
1228 Ga0466959_0022177
1229 Ga0466959_0052042
1230 Ga0466959_0111901
1231 Ga0466959_0248794
1232 Ga0466958_0018628
1233 Ga0466958_0048354
1234 Ga0466958_0380934
1235 Ga0466967_0002689
1236 Ga0466967_0009758
1237 Ga0466967_0016417
1238 Ga0466967_0301969
1239 Ga0466967_0443567
1240 Ga0495592_0621780
1241 Ga0495603_0093027
1242 Ga0495603_0593214
1243 Ga0495641_0266095
1244 Ga0495651_0038014
1245 Ga0495653_0040472
1246 Ga0495653_0135009
1247 Ga0495605_0317860
1248 Ga0495639_0345368
1249 Ga0495664_0104011
1250 Ga0495584_0153736
1251 Ga0495596_0301635
1252 Ga0495607_0209841
1253 Ga0495607_0347928
1254 Ga0495608_0037857
1255 Ga0495608_0681126
1256 Ga0495608_0932228
1257 Ga0495644_0156405
1258 Ga0495642_0145564
1259 Ga0495652_0049583
1260 Ga0495665_0463921
1261 Ga0495640_0082362
1262 Ga0495587_0188634
1263 Ga0495598_0024343
1264 Ga0495633_0243572
1265 Ga0495667_0010799
1266 Ga0495667_0254785
1267 Ga0495656_0077431
1268 Ga0495656_0101810
1269 Ga0495656_0309063
1270 Ga0495668_0145844
1271 Ga0495668_0813359
1272 Ga0495634_0047971
1273 Ga0495635_0093573
1274 Ga0495657_0055379
1275 Ga0495599_0237310
1276 Ga0495623_0353444
1277 Ga0495646_0206413
1278 Ga0495647_0015363
1279 Ga0495613_0258745
1280 Ga0495624_0411985
1281 Ga0495671_0239459
1282 Ga0495600_0011377
1283 Ga0495600_0284534
1284 Ga0495581_0720307
1285 Ga0495604_0087270
1286 Ga0495636_0458792
1287 Ga0495674_0269181
1288 Ga0495674_0510027
1289 Ga0495674_0955844
1290 Ga0495674_1279597
1291 Ga0495680_0023455
1292 Ga0495680_0480844
1293 Ga0495677_0101052
1294 Ga0495681_0103368
1295 Ga0495602_0312527
1296 Ga0496100_0654051
1297 Ga0496101_0001697
1298 Ga0496101_0031125
1299 Ga0496101_0124202
1300 Ga0496101_0160665
1301 Ga0496101_0557949
1302 Ga0496103_0066589
1303 Ga0496104_0000458
1304 Ga0496104_0033593
1305 Ga0496104_0117384
1306 Ga0496104_0157540
1307 Ga0496104_0435650
1308 Ga0496104_0502046
1309 Ga0496104_0800433
1310 Ga0496105_0000105
1311 Ga0496105_0753907
1312 Ga0496106_0007642
1313 Ga0496106_0092813
1314 Ga0496107_0004437
1315 Ga0496107_0105179
1316 Ga0496108_0006247
1317 Ga0496108_0013791
1318 Ga0496108_0207679
1319 Ga0496108_0298056
1320 Ga0496109_0000298
1321 Ga0496109_0030941
1322 Ga0496109_0035992
1323 Ga0496109_0419679
1324 Ga0496109_1294545
1325 Ga0496110_0000644
1326 Ga0496110_0053528
1327 Ga0496110_0092550
1328 Ga0496110_0166436
1329 Ga0496110_0460109
1330 Ga0496110_0489565
1331 Ga0496110_1807806
1332 Ga0496111_0009478
1333 Ga0496111_0041754
1334 Ga0496112_0061821
1335 Ga0496112_0511180
1336 Ga0496112_0631148
1337 Ga0496113_0033051
1338 Ga0496113_0099697
1339 Ga0496113_1139250
1340 Ga0496113_1456558
1341 Ga0496114_0000952
1342 Ga0496114_0034719
1343 Ga0496114_0039680
1344 Ga0496114_0381567
1345 Ga0496114_0545020
1346 Ga0496114_0797376
1347 Ga0496115_0270284
1348 Ga0496115_0337741
1349 Ga0496115_0542649
1350 Ga0501031_0005436
1351 Ga0501031_0007069
1352 Ga0501031_0033308
1353 Ga0501031_0371580
1354 Ga0501032_0014840
1355 Ga0501032_0127300
1356 Ga0501032_0404654
1357 Ga0501033_0003024
1358 Ga0501033_0029275
1359 Ga0501033_0034425
1360 Ga0501033_0095955
1361 Ga0501034_0139727
1362 Ga0501034_0268119
1363 Ga0501034_0378657
1364 Ga0501036_0024270
1365 Ga0501036_0035743
1366 Ga0501036_0069425
1367 Ga0501036_0174495
1368 Ga0501036_0799348
1369 Ga0501037_0008185
1370 Ga0501037_0104647
1371 Ga0501038_0003860
1372 Ga0501038_0302340
1373 Ga0501038_0336437
1374 Ga0501039_0033991
1375 Ga0501039_0057484
1376 Ga0501039_0130223
1377 Ga0501039_0183099
1378 Ga0501039_0197052
1379 Ga0501040_0000294
1380 Ga0501040_0049098
1381 Ga0501040_0114299
1382 Ga0501040_0322659
1383 Ga0501041_0002801
1384 Ga0501041_0358014
1385 Ga0501041_1042474
1386 Ga0501042_0002916
1387 Ga0501042_0021478
1388 Ga0501042_0089222
1389 Ga0501042_0092158
1390 Ga0501042_0615676
1391 Ga0501042_0648624
1392 Ga0501043_0028794
1393 Ga0501043_0168478
1394 Ga0501046_0004131
1395 Ga0501046_0005463
1396 Ga0501046_0007034
1397 Ga0501046_0199198
1398 Ga0501047_0055502
1399 Ga0501047_0117153
1400 Ga0501047_0135900
1401 Ga0501047_0216632
1402 Ga0501048_0023272
1403 Ga0501048_0030606
1404 Ga0501048_0062025
1405 Ga0501048_0261899
1406 Ga0501048_0454291
1407 Ga0501048_0644747
1408 Ga0501067_0315209
1409 Ga0501068_0001358
1410 Ga0501068_0016279
1411 Ga0501068_0061500
1412 Ga0501068_0622400
1413 Ga0501069_0002413
1414 Ga0501069_0235018
1415 Ga0501069_0484484
1416 Ga0501069_0700129
1417 Ga0501070_0017431
1418 Ga0501070_0034319
1419 Ga0501070_0095095
1420 Ga0501070_0231523
1421 Ga0501071_0038752
1422 Ga0501071_0150098
1423 Ga0501071_0186124
1424 Ga0501071_0284068
1425 Ga0501071_0563675
1426 Ga0501072_0058818
1427 Ga0501072_0115994
1428 Ga0501072_0123375
1429 Ga0501072_0632355
1430 Ga0501072_1291914
1431 Ga0501073_0000015
1432 Ga0501073_0004766
1433 Ga0501073_0078764
1434 Ga0501074_0118916
1435 Ga0501074_0158998
1436 Ga0501074_0324458
1437 Ga0501074_0336835
1438 Ga0501074_0429524
1439 Ga0501074_0734822
1440 Ga0501075_0004810
1441 Ga0501075_0015526
1442 Ga0501075_0319804
1443 Ga0501075_0518082
1444 Ga0501075_0592196
1445 Ga0501075_1227261
1446 Ga0501076_0004393
1447 Ga0501076_0034176
1448 Ga0501076_0095261
1449 Ga0501076_0238392
1450 Ga0501076_0341826
1451 Ga0501076_0578025
1452 Ga0501077_0000312
1453 Ga0501077_0018803
1454 Ga0501079_0000242
1455 Ga0501079_0195856
1456 Ga0501079_0285089
1457 Ga0501079_0554733
1458 Ga0501080_0010205
1459 Ga0501080_0025558
1460 Ga0501080_0137028
1461 Ga0501080_0430663
1462 Ga0501080_0471369
1463 Ga0501080_1051295
1464 Ga0501081_0002051
1465 Ga0501081_0003708
1466 Ga0501081_0004277
1467 Ga0501081_0014832
1468 Ga0501083_0002239
1469 Ga0501083_0063726
1470 Ga0501083_0105334
1471 Ga0501035_0004259
1472 Ga0501035_0060539
1473 Ga0501035_0191282
1474 Ga0501035_1249456
1475 Ga0501035_1365169
1476 Ga0501044_0112561
1477 Ga0501044_0216272
1478 Ga0501044_0365039
1479 Ga0501044_0594060
1480 Ga0501044_1332484
1481 Ga0501045_0005270
1482 Ga0501045_0016753
1483 Ga0501045_0018995
1484 Ga0501045_0139530
1485 Ga0501045_0662786
1486 nmdc:mga03683_13083_c1
1487 nmdc:mga03n38_99602_c1
1488 nmdc:mga00v17_138077_c1
1489 nmdc:mga00v17_8860_c1
1490 nmdc:mga0yw44_113316_c1
1491 nmdc:mga0yw44_266487_c1
1492 nmdc:mga0k408_116709_c1
1493 nmdc:mga06z11_121697_c1
1494 nmdc:mga06z11_236067_c1
1495 nmdc:mga06z11_87349_c1
1496 nmdc:mga04h51_29299_c1
1497 nmdc:mga07m45_333867_c1
1498 nmdc:mga07m45_456316_c1
1499 nmdc:mga05p37_1106327_c1
1500 nmdc:mga05p37_17348_c1
1501 nmdc:mga05p37_38492_c1
1502 nmdc:mga05p37_52144_c1
1503 nmdc:mga09592_1090872_c1
1504 nmdc:mga09592_22506_c1
1505 nmdc:mga09592_313954_c1
1506 nmdc:mga09592_3911_c1
1507 nmdc:mga09592_562392_c1
1508 nmdc:mga0qj67_20968_c1
1509 nmdc:mga0qj67_37838_c1
1510 nmdc:mga0qj67_867798_c1
1511 nmdc:mga06r32_2062339_c1
1512 nmdc:mga06r32_408509_c1
1513 nmdc:mga06r32_9247_c1
1514 nmdc:mga08y16_38608_c1
1515 nmdc:mga08y16_50914_c1
1516 nmdc:mga08y16_815472_c1
1517 nmdc:mga08y16_94663_c1
1518 nmdc:mga08y16_972582_c1
1519 nmdc:mga0n895_246102_c1
1520 nmdc:mga0n895_820776_c1
1521 nmdc:mga0a205_16959_c1
1522 nmdc:mga0a205_53194_c1
1523 nmdc:mga0sz30_160184_c1
1524 Ga0495601_0236371
1525 Ga0495601_0750485
1526 Ga0495601_0880556
1527 Ga0495612_0145696
1528 Ga0495595_0103172
1529 Ga0495619_0231410
1530 Ga0495619_0234705
1531 Ga0495619_0733472
1532 Ga0495619_1047394
1533 Ga0500568_0000011
1534 Ga0500616_0000251
1535 Ga0501084_0012958
1536 Ga0501084_0015434
1537 Ga0501084_0018059
1538 Ga0501084_0195025
1539 Ga0501082_0005629
1540 Ga0501082_0020406
1541 Ga0501082_0027467
1542 Ga0501082_0047130
1543 Ga0466962_0154360
1544 Ga0466962_0570102
1545 Ga0530510_0000457
1546 Ga0530510_0026507
1547 2644180750
1548 2739363635
1549 2811847724
1550 2816422971
1551 2874124427
1552 2919053713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

139

0.92

PF19581

Glyoxalase_7

Glyoxalase superfamily protein

19

142

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8894 1 119
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8689 1 119
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8687 5 117
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8586 1 117
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8586 3 116
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8671 5 117 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8601 5 117 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8203 2 59 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8191 5 116 3.10.180.10
af_Q2FY61_1_123_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8096 5 116 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y9LTR2-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9957 4 119 GO:0016829
AF-A0A0Q9UH98-F1-model_v4 Glyoxalase 0.9854 2 119
AF-A0A3A5MHH8-F1-model_v4 Glyoxalase 0.9846 1 119
AF-A0A0Q5ASF3-F1-model_v4 Glyoxalase 0.9814 2 122
AF-A0A841CYW5-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9808 3 116 GO:0016829
GO:0051213

Map