F480172

General Info

Members Datasets Scaffolds Average Seq Length
773 356 762 366

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10014347|Ga0265327_100143471
Length 427
Sequence MKFNQGIGGAFHRPLVAQCPQPAAHQGRLAGTEVAFERDDGISGRAGPDLSRKQSTERQRGGLVGKVQGQGMMVRMHDRDWAALAAQIKDWGRALGFDAVGIAGIDLAAAEAGLDAWLAAGCHGEMDYMARHGTKRARPAELVPGTTSVIVARLNYLPDRSEPARPELGPPAAISRYAQGRDYHKLLRSRLQKLAERIAAEVGPYGHRVFTDSAPVMEVALAAQAGLGWRGKHTLLLSRDAGSWFFLGEIFTDLPLPADPPTAEHCGTCRTCIDACPTAAIVAPYRVDARRCISYLTIELKGSIPLELRPLIGNRVYGCDDCQLYCPWNRHAPRTREEDFAVRHGLDQATLIELFAWSPAEFEAKLAGSAIRRIGFERWLRNLAVGLGNAPTTAEVVTALAAKCDHPAALVREHVAWALARHGITPP

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
217 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
221 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
356 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 0.26
Rhizoplane 2.46
Rhizosphere 88.62
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000113 3300002773 Bacteria 56427
2 JGI25150J39212_1000548 3300002774 Bacteria 15195
3 JGI25150J39212_1000864 3300002774 Bacteria 10074
4 JGI25159J45721_1002871 3300002987 Bacteria 6314
5 rootL2_10004459 3300003322 Bacteria 10209
6 JGI25161J50226_1000555 3300003374 Bacteria 15898
7 JGI25161J50226_1000906 3300003374 Bacteria 10674
8 Ga0055526_1002983 3300003771 Bacteria 11083
9 Ga0055537_1001054 3300003773 Bacteria 12373
10 Ga0055524_1000029 3300003775 Bacteria 201332
11 Ga0055524_1002327 3300003775 Bacteria 9887
12 Ga0055524_1002530 3300003775 Bacteria 9361
13 Ga0055534_1003065 3300003784 Bacteria 5456
14 Ga0055528_1010403 3300003790 Bacteria 3784
15 Ga0055530_10003244 3300003791 Bacteria 9487
16 Ga0055531_10001264 3300003794 Bacteria 19144
17 Ga0055543_1000334 3300004625 Bacteria 32185
18 Ga0065165_1001090 3300005262 Bacteria 32306
19 Ga0070676_10000107 3300005328 Bacteria 30114
20 Ga0070676_10003461 3300005328 Bacteria 8228
21 Ga0070676_10013290 3300005328 Bacteria 4510
22 Ga0070670_100152800 3300005331 Bacteria 1998
23 Ga0068869_100010636 3300005334 Bacteria 6007
24 Ga0068869_100012816 3300005334 Bacteria 5548
25 Ga0070666_10003198 3300005335 Bacteria 9959
26 Ga0070666_10003557 3300005335 Bacteria 9445
27 Ga0070666_10077392 3300005335 Bacteria 2270
28 Ga0070680_100124342 3300005336 Bacteria 2155
29 Ga0070680_100207513 3300005336 Bacteria 1652
30 Ga0068868_100008667 3300005338 Bacteria 7282
31 Ga0068868_100012033 3300005338 Bacteria 6316
32 Ga0070689_100000324 3300005340 Bacteria 27871
33 Ga0070661_100000621 3300005344 Bacteria 26402
34 Ga0070661_100003328 3300005344 Bacteria 11098
35 Ga0070661_100023740 3300005344 Bacteria 4398
36 Ga0070661_100071191 3300005344 Bacteria 2559
37 Ga0070692_10041255 3300005345 Bacteria 2364
38 Ga0070668_100001276 3300005347 Bacteria 17996
39 Ga0070668_100027814 3300005347 Bacteria 4292
40 Ga0070668_100050868 3300005347 Bacteria 3191
41 Ga0070669_100002313 3300005353 Bacteria 13790
42 Ga0070675_100002082 3300005354 Bacteria 14809
43 Ga0070675_100090488 3300005354 Bacteria 2563
44 Ga0070675_100296208 3300005354 Bacteria 1424
45 Ga0070671_100004990 3300005355 Bacteria 10575
46 Ga0070671_100010840 3300005355 Bacteria 7313
47 Ga0070671_100027394 3300005355 Bacteria 4691
48 Ga0070674_100181481 3300005356 Bacteria 1612
49 Ga0070673_100000602 3300005364 Bacteria 19619
50 Ga0070673_100008381 3300005364 Bacteria 6871
51 Ga0070673_100282195 3300005364 Bacteria 1457
52 Ga0070673_100337348 3300005364 Bacteria 1335
53 Ga0070688_100000276 3300005365 Bacteria 26672
54 Ga0070659_100035259 3300005366 Bacteria 3895
55 Ga0070659_100061803 3300005366 Bacteria 2960
56 Ga0070667_100003566 3300005367 Bacteria 13255
57 Ga0070667_100005842 3300005367 Bacteria 10264
58 Ga0070667_100027843 3300005367 Bacteria 4703
59 Ga0070667_100032956 3300005367 Bacteria 4324
60 Ga0070667_100165442 3300005367 Bacteria 1950
61 Ga0070667_100412363 3300005367 Bacteria 1231
62 Ga0070714_100012621 3300005435 Bacteria 6748
63 Ga0070714_100143121 3300005435 Bacteria 2148
64 Ga0070713_100021966 3300005436 Bacteria 4922
65 Ga0070713_100024627 3300005436 Bacteria 4691
66 Ga0070710_10021867 3300005437 Bacteria 3338
67 Ga0070678_100001759 3300005456 Bacteria 11666
68 Ga0070678_100002666 3300005456 Bacteria 9833
69 Ga0070678_100002838 3300005456 Bacteria 9583
70 Ga0070662_100014149 3300005457 Bacteria 5324
71 Ga0070662_100100624 3300005457 Bacteria 2187
72 Ga0070681_10018253 3300005458 Bacteria 7011
73 Ga0068867_100002278 3300005459 Bacteria 13498
74 Ga0068867_100044294 3300005459 Bacteria 3260
75 Ga0068867_100044424 3300005459 Bacteria 3255
76 Ga0070685_10000522 3300005466 Bacteria 21790
77 Ga0070706_100143519 3300005467 Bacteria 2229
78 Ga0070706_100226532 3300005467 Bacteria 1745
79 Ga0070707_100043109 3300005468 Bacteria 4319
80 Ga0070707_100100381 3300005468 Bacteria 2804
81 Ga0070698_100162997 3300005471 Bacteria 2173
82 Ga0070679_100023077 3300005530 Bacteria 6087
83 Ga0070679_100070385 3300005530 Bacteria 3490
84 Ga0070684_100020484 3300005535 Bacteria 5488
85 Ga0070684_100344842 3300005535 Bacteria 1369
86 Ga0068853_100037973 3300005539 Bacteria 4101
87 Ga0068853_100101207 3300005539 Bacteria 2548
88 Ga0070672_100002742 3300005543 Bacteria 11279
89 Ga0070672_100005080 3300005543 Bacteria 8683
90 Ga0070672_100156469 3300005543 Bacteria 1888
91 Ga0070696_100055544 3300005546 Bacteria 2761
92 Ga0070693_100001181 3300005547 Bacteria 11742
93 Ga0070665_100004484 3300005548 Bacteria 14665
94 Ga0070665_100006836 3300005548 Bacteria 11601
95 Ga0070665_100007950 3300005548 Bacteria 10751
96 Ga0070665_100090348 3300005548 Bacteria 3068
97 Ga0070704_100080364 3300005549 Bacteria 2397
98 Ga0068855_100013893 3300005563 Bacteria 9711
99 Ga0068855_100137369 3300005563 Bacteria 2788
100 Ga0070664_100028009 3300005564 Bacteria 4685
101 Ga0070664_100029736 3300005564 Bacteria 4556
102 Ga0070664_100069702 3300005564 Bacteria 3009
103 Ga0070664_100100081 3300005564 Bacteria 2520
104 Ga0068857_100001177 3300005577 Bacteria 20436
105 Ga0068854_100017889 3300005578 Bacteria 4751
106 Ga0068854_100021411 3300005578 Bacteria 4387
107 Ga0068856_100003663 3300005614 Bacteria 15416
108 Ga0068856_100007456 3300005614 Bacteria 10676
109 Ga0068856_100214436 3300005614 Bacteria 1940
110 Ga0068852_100013259 3300005616 Bacteria 6302
111 Ga0068859_100003388 3300005617 Bacteria 16219
112 Ga0068859_100010910 3300005617 Bacteria 9146
113 Ga0068859_100048271 3300005617 Bacteria 4276
114 Ga0068859_100251527 3300005617 Bacteria 1858
115 Ga0068859_100396157 3300005617 Bacteria 1476
116 Ga0068866_10003152 3300005718 Bacteria 6791
117 Ga0068866_10092601 3300005718 Bacteria 1649
118 Ga0068861_100137085 3300005719 Bacteria 1992
119 Ga0068870_10014204 3300005840 Bacteria 3758
120 Ga0068863_100003151 3300005841 Bacteria 16283
121 Ga0068863_100004647 3300005841 Bacteria 13535
122 Ga0068863_100014308 3300005841 Bacteria 7643
123 Ga0068863_100063693 3300005841 Bacteria 3487
124 Ga0068863_100080390 3300005841 Bacteria 3087
125 Ga0068863_100142057 3300005841 Bacteria 2295
126 Ga0068863_100192639 3300005841 Bacteria 1959
127 Ga0068858_100008645 3300005842 Bacteria 9778
128 Ga0068858_100341337 3300005842 Bacteria 1433
129 Ga0068860_100001042 3300005843 Bacteria 30514
130 Ga0068860_100011703 3300005843 Bacteria 8648
131 Ga0068860_100048910 3300005843 Bacteria 4029
132 Ga0068860_100087016 3300005843 Bacteria 2974
133 Ga0081455_10053216 3300005937 Bacteria 3459
134 Ga0081539_10019043 3300005985 Bacteria 4722
135 Ga0070715_10002475 3300006163 Bacteria 5678
136 Ga0070716_100018632 3300006173 Bacteria 3619
137 Ga0070716_100021395 3300006173 Bacteria 3408
138 Ga0070712_100001985 3300006175 Bacteria 12527
139 Ga0097621_100004146 3300006237 Bacteria 10054
140 Ga0097621_100023190 3300006237 Bacteria 4828
141 Ga0068871_100008300 3300006358 Bacteria 7465
142 Ga0068871_100008690 3300006358 Bacteria 7307
143 Ga0068871_100060324 3300006358 Bacteria 3094
144 Ga0075433_10012647 3300006852 Bacteria 6827
145 Ga0075434_100029350 3300006871 Bacteria 5409
146 Ga0075434_100189521 3300006871 Bacteria 2077
147 Ga0068865_100005451 3300006881 Bacteria 7720
148 Ga0068865_100193812 3300006881 Bacteria 1573
149 Ga0097620_100003388 3300006931 Bacteria 16219
150 Ga0097620_100010910 3300006931 Bacteria 9146
151 Ga0097620_100048271 3300006931 Bacteria 4276
152 Ga0097620_100251506 3300006931 Bacteria 1858
153 Ga0097620_100396163 3300006931 Bacteria 1476
154 Ga0099826_10000003 3300006948 Bacteria 1067817
155 Ga0075435_100004089 3300007076 Bacteria 9989
156 Ga0105240_10098901 3300009093 Bacteria 3552
157 Ga0111539_10182477 3300009094 Bacteria 2451
158 Ga0105245_10025250 3300009098 Bacteria 5224
159 Ga0105245_10033683 3300009098 Bacteria 4540
160 Ga0105245_10378575 3300009098 Bacteria 1409
161 Ga0105247_10053300 3300009101 Bacteria 2495
162 Ga0105243_10051158 3300009148 Bacteria 3266
163 Ga0105241_10062893 3300009174 Bacteria 2862
164 Ga0105241_10208763 3300009174 Bacteria 1635
165 Ga0105242_10025334 3300009176 Bacteria 4694
166 Ga0105242_10185494 3300009176 Bacteria 1838
167 Ga0105242_10326519 3300009176 Bacteria 1409
168 Ga0105248_10002431 3300009177 Bacteria 20666
169 Ga0105248_10057770 3300009177 Bacteria 4356
170 Ga0105248_10063113 3300009177 Bacteria 4158
171 Ga0105248_10368971 3300009177 Bacteria 1616
172 Ga0105237_10084853 3300009545 Bacteria 3157
173 Ga0105238_10002149 3300009551 Bacteria 19936
174 Ga0105238_10329535 3300009551 Bacteria 1513
175 Ga0105239_10373046 3300010375 Bacteria 1613
176 Ga0105246_10181677 3300011119 Bacteria 1620
177 Ga0157373_10093554 3300013100 Bacteria 2117
178 Ga0157371_10000001 3300013102 Bacteria 1162285
179 Ga0157370_10007756 3300013104 Bacteria 11632
180 Ga0157370_10013200 3300013104 Bacteria 8520
181 Ga0157370_10017646 3300013104 Bacteria 7196
182 Ga0157369_10052212 3300013105 Bacteria 4424
183 Ga0157374_10007182 3300013296 Bacteria 9487
184 Ga0157374_10032379 3300013296 Bacteria 4760
185 Ga0157378_10037889 3300013297 Bacteria 4273
186 Ga0157378_10062677 3300013297 Bacteria 3320
187 Ga0157378_10063396 3300013297 Bacteria 3302
188 Ga0163162_10001893 3300013306 Bacteria 19713
189 Ga0163162_10013715 3300013306 Bacteria 7916
190 Ga0163162_10048939 3300013306 Bacteria 4236
191 Ga0157372_10007100 3300013307 Bacteria 11937
192 Ga0157372_10018755 3300013307 Bacteria 7444
193 Ga0157375_10000680 3300013308 Bacteria 30126
194 Ga0157375_10007795 3300013308 Bacteria 9368
195 Ga0157375_10016875 3300013308 Bacteria 6574
196 Ga0157375_10062019 3300013308 Bacteria 3714
197 Ga0157375_10203656 3300013308 Bacteria 2135
198 Ga0157375_10298001 3300013308 Bacteria 1776
199 Ga0157375_10679246 3300013308 Bacteria 1184
200 Ga0163163_10001966 3300014325 Bacteria 17372
201 Ga0163163_10079290 3300014325 Bacteria 3282
202 Ga0163163_10131313 3300014325 Bacteria 2545
203 Ga0163163_10357302 3300014325 Bacteria 1517
204 Ga0157377_10001594 3300014745 Bacteria 9864
205 Ga0157379_10001435 3300014968 Bacteria 19567
206 Ga0157379_10040584 3300014968 Bacteria 4154
207 Ga0157379_10062427 3300014968 Bacteria 3332
208 Ga0157379_10125083 3300014968 Bacteria 2314
209 Ga0157376_10005137 3300014969 Bacteria 9126
210 Ga0157376_10010909 3300014969 Bacteria 6673
211 Ga0157376_10020601 3300014969 Bacteria 5106
212 Ga0157376_10024255 3300014969 Bacteria 4758
213 Ga0163161_10086346 3300017792 Bacteria 2316
214 Ga0213872_10001092 3300021361 Bacteria 18625
215 Ga0213872_10001185 3300021361 Bacteria 17711
216 Ga0213872_10003823 3300021361 Bacteria 8202
217 Ga0209436_100782 3300025208 Bacteria 13164
218 Ga0209436_101271 3300025208 Bacteria 9049
219 Ga0209563_100015 3300025230 Bacteria 879901
220 Ga0207425_1000006 3300025245 Bacteria 808854
221 Ga0207425_1000136 3300025245 Bacteria 65594
222 Ga0207425_1000533 3300025245 Bacteria 23036
223 Ga0209677_104532 3300025253 Bacteria 3970
224 Ga0209148_1000310 3300025254 Bacteria 69517
225 Ga0209129_1000090 3300025258 Bacteria 175755
226 Ga0209565_1000382 3300025263 Bacteria 37853
227 Ga0209565_1000431 3300025263 Bacteria 33753
228 Ga0209565_1003896 3300025263 Bacteria 4691
229 Ga0209565_1005709 3300025263 Bacteria 3586
230 Ga0209673_1018787 3300025273 Bacteria 2502
231 Ga0209130_1000809 3300025284 Bacteria 26504
232 Ga0209130_1000987 3300025284 Bacteria 22203
233 Ga0209130_1001171 3300025284 Bacteria 18835
234 Ga0209675_1001081 3300025291 Bacteria 16789
235 Ga0209675_1003168 3300025291 Bacteria 7989
236 Ga0209564_1000639 3300025295 Bacteria 53129
237 Ga0209564_1000888 3300025295 Bacteria 39497
238 Ga0209758_1000047 3300025297 Bacteria 360971
239 Ga0209050_1000469 3300025298 Bacteria 71511
240 Ga0209256_1000013 3300025299 Bacteria 689442
241 Ga0209256_1000863 3300025299 Bacteria 37690
242 Ga0209256_1001470 3300025299 Bacteria 24150
243 Ga0209256_1002052 3300025299 Bacteria 17852
244 Ga0207426_1003550 3300025302 Bacteria 8317
245 Ga0209257_1000010 3300025304 Bacteria 1158682
246 Ga0207697_10041735 3300025315 Bacteria 1884
247 Ga0207656_10083419 3300025321 Bacteria 1440
248 Ga0207682_10001976 3300025893 Bacteria 9293
249 Ga0207692_10083892 3300025898 Bacteria 1711
250 Ga0207710_10009425 3300025900 Bacteria 4109
251 Ga0207680_10011911 3300025903 Bacteria 4414
252 Ga0207680_10012261 3300025903 Bacteria 4361
253 Ga0207680_10037482 3300025903 Bacteria 2799
254 Ga0207699_10099341 3300025906 Bacteria 1843
255 Ga0207645_10003275 3300025907 Bacteria 12356
256 Ga0207645_10008319 3300025907 Bacteria 7246
257 Ga0207645_10044740 3300025907 Bacteria 2832
258 Ga0207643_10014363 3300025908 Bacteria 4299
259 Ga0207684_10158545 3300025910 Bacteria 1948
260 Ga0207684_10218732 3300025910 Bacteria 1644
261 Ga0207707_10005481 3300025912 Bacteria 11094
262 Ga0207707_10066753 3300025912 Bacteria 3133
263 Ga0207707_10247706 3300025912 Bacteria 1548
264 Ga0207695_10051661 3300025913 Bacteria 4313
265 Ga0207693_10000069 3300025915 Bacteria 90103
266 Ga0207693_10010112 3300025915 Bacteria 7664
267 Ga0207663_10016917 3300025916 Bacteria 4054
268 Ga0207657_10002525 3300025919 Bacteria 19797
269 Ga0207657_10005841 3300025919 Bacteria 12824
270 Ga0207649_10001721 3300025920 Bacteria 12585
271 Ga0207649_10016228 3300025920 Bacteria 4195
272 Ga0207652_10031116 3300025921 Bacteria 4479
273 Ga0207681_10011715 3300025923 Bacteria 5391
274 Ga0207694_10010599 3300025924 Bacteria 6959
275 Ga0207650_10103022 3300025925 Bacteria 2200
276 Ga0207659_10006585 3300025926 Bacteria 7131
277 Ga0207659_10072840 3300025926 Bacteria 2513
278 Ga0207687_10000293 3300025927 Bacteria 34325
279 Ga0207687_10039735 3300025927 Bacteria 3222
280 Ga0207700_10009271 3300025928 Bacteria 6139
281 Ga0207664_10003067 3300025929 Bacteria 11098
282 Ga0207664_10014597 3300025929 Bacteria 5679
283 Ga0207644_10005822 3300025931 Bacteria 8027
284 Ga0207644_10009304 3300025931 Bacteria 6449
285 Ga0207644_10105130 3300025931 Bacteria 2126
286 Ga0207644_10180688 3300025931 Bacteria 1653
287 Ga0207690_10023825 3300025932 Bacteria 3826
288 Ga0207690_10046036 3300025932 Bacteria 2887
289 Ga0207706_10018899 3300025933 Bacteria 6198
290 Ga0207706_10021848 3300025933 Bacteria 5744
291 Ga0207706_10123685 3300025933 Bacteria 2275
292 Ga0207686_10000118 3300025934 Bacteria 64531
293 Ga0207709_10023056 3300025935 Bacteria 3539
294 Ga0207670_10127164 3300025936 Bacteria 1861
295 Ga0207669_10051692 3300025937 Bacteria 2463
296 Ga0207704_10002824 3300025938 Bacteria 7835
297 Ga0207665_10007491 3300025939 Bacteria 7212
298 Ga0207665_10250328 3300025939 Bacteria 1309
299 Ga0207691_10000629 3300025940 Bacteria 34886
300 Ga0207691_10000958 3300025940 Bacteria 28614
301 Ga0207691_10004119 3300025940 Bacteria 14122
302 Ga0207691_10060041 3300025940 Bacteria 3456
303 Ga0207711_10000515 3300025941 Bacteria 39690
304 Ga0207711_10023802 3300025941 Bacteria 5127
305 Ga0207711_10028362 3300025941 Bacteria 4710
306 Ga0207689_10000498 3300025942 Bacteria 37073
307 Ga0207689_10006485 3300025942 Bacteria 10340
308 Ga0207689_10012237 3300025942 Bacteria 7340
309 Ga0207689_10012711 3300025942 Bacteria 7192
310 Ga0207689_10023713 3300025942 Bacteria 5147
311 Ga0207661_10023513 3300025944 Bacteria 4658
312 Ga0207679_10057962 3300025945 Bacteria 2867
313 Ga0207679_10060966 3300025945 Bacteria 2806
314 Ga0207679_10169594 3300025945 Bacteria 1795
315 Ga0207667_10015818 3300025949 Bacteria 8550
316 Ga0207651_10000266 3300025960 Bacteria 22298
317 Ga0207651_10115177 3300025960 Bacteria 2027
318 Ga0207668_10010545 3300025972 Bacteria 5587
319 Ga0207668_10057547 3300025972 Bacteria 2712
320 Ga0207668_10079086 3300025972 Bacteria 2377
321 Ga0207668_10214681 3300025972 Bacteria 1541
322 Ga0207640_10020026 3300025981 Bacteria 3965
323 Ga0207658_10004266 3300025986 Bacteria 9958
324 Ga0207658_10037542 3300025986 Bacteria 3482
325 Ga0207658_10161284 3300025986 Bacteria 1838
326 Ga0207658_10212515 3300025986 Bacteria 1622
327 Ga0207677_10040107 3300026023 Bacteria 3084
328 Ga0207703_10003276 3300026035 Bacteria 13582
329 Ga0207703_10040050 3300026035 Bacteria 3748
330 Ga0207703_10074130 3300026035 Bacteria 2817
331 Ga0207703_10077334 3300026035 Bacteria 2762
332 Ga0207639_10077121 3300026041 Bacteria 2626
333 Ga0207639_10091416 3300026041 Bacteria 2437
334 Ga0207678_10059780 3300026067 Bacteria 3279
335 Ga0207702_10016803 3300026078 Bacteria 6057
336 Ga0207702_10033862 3300026078 Bacteria 4269
337 Ga0207641_10006628 3300026088 Bacteria 9721
338 Ga0207641_10009041 3300026088 Bacteria 8231
339 Ga0207641_10361212 3300026088 Bacteria 1386
340 Ga0207648_10000364 3300026089 Bacteria 49697
341 Ga0207648_10034776 3300026089 Bacteria 4441
342 Ga0207648_10037375 3300026089 Bacteria 4277
343 Ga0207676_10005594 3300026095 Bacteria 8892
344 Ga0207676_10019043 3300026095 Bacteria 5001
345 Ga0207674_10000912 3300026116 Bacteria 38502
346 Ga0207674_10008221 3300026116 Bacteria 12092
347 Ga0207674_10055401 3300026116 Bacteria 4031
348 Ga0207675_100018434 3300026118 Bacteria 6508
349 Ga0207675_100148701 3300026118 Bacteria 2228
350 Ga0207683_10000076 3300026121 Bacteria 77762
351 Ga0207683_10000827 3300026121 Bacteria 28309
352 Ga0207683_10004135 3300026121 Bacteria 12553
353 Ga0207683_10014462 3300026121 Bacteria 6719
354 Ga0207683_10137580 3300026121 Bacteria 2199
355 Ga0207683_10157259 3300026121 Bacteria 2053
356 Ga0207698_10053414 3300026142 Bacteria 3101
357 Ga0209983_1020523 3300027665 Bacteria 1377
358 Ga0209282_1000002 3300027666 Bacteria 1067825
359 Ga0209971_1003092 3300027682 Bacteria 3974
360 Ga0209974_10027642 3300027876 Bacteria 1877
361 Ga0268266_10005997 3300028379 Bacteria 11215
362 Ga0268266_10006981 3300028379 Bacteria 10268
363 Ga0268266_10074223 3300028379 Bacteria 2953
364 Ga0268266_10085071 3300028379 Bacteria 2763
365 Ga0268265_10040194 3300028380 Bacteria 3453
366 Ga0268265_10102735 3300028380 Bacteria 2313
367 Ga0268265_10381849 3300028380 Bacteria 1296
368 Ga0268264_10003641 3300028381 Bacteria 13257
369 Ga0268264_10023627 3300028381 Bacteria 5013
370 Ga0268264_10075879 3300028381 Bacteria 2859
371 Ga0268264_10185800 3300028381 Bacteria 1891
372 Ga0316182_1171920 3300030745 Bacteria 2500
373 Ga0265330_10063427 3300031235 Bacteria 1606
374 Ga0265332_10005253 3300031238 Bacteria 5988
375 Ga0265331_10000872 3300031250 Bacteria 24581
376 Ga0265327_10000529 3300031251 Bacteria 65835
377 Ga0265327_10014347 3300031251 Bacteria 5190
378 Ga0265316_10000144 3300031344 Bacteria 77758
379 Ga0265316_10039329 3300031344 Bacteria 3799
380 Ga0307408_100001016 3300031548 Bacteria 21585
381 Ga0307408_100003907 3300031548 Bacteria 10153
382 Ga0316575_10045402 3300031665 Bacteria 1745
383 Ga0265314_10000811 3300031711 Bacteria 37090
384 Ga0265342_10003272 3300031712 Bacteria 13427
385 Ga0307413_10171327 3300031824 Bacteria 1537
386 Ga0307409_100221153 3300031995 Bacteria 1710
387 Ga0373934_0002330 3300035086 Bacteria 6986
388 Ga0373923_0002548 3300035111 Bacteria 5633
389 Ga0373954_0000591 3300035118 Bacteria 13766
390 Ga0373956_0040685 3300035119 Bacteria 2062
391 Ga0373955_0007635 3300035172 Bacteria 4981
392 Ga0373933_0005650 3300035724 Bacteria 6811
393 Ga0373937_0001546 3300036401 Bacteria 19330
394 Ga0373937_0008259 3300036401 Bacteria 9038
395 Ga0373937_0033468 3300036401 Bacteria 4667
396 Ga0373937_0137352 3300036401 Bacteria 2286
397 Ga0373937_0281903 3300036401 Bacteria 1569
398 Ga0395899_0017364 3300037312 Bacteria 5482
399 Ga0395899_0062812 3300037312 Bacteria 2734
400 Ga0395899_0210202 3300037312 Bacteria 1352
401 Ga0395900_0000729 3300037418 Bacteria 43752
402 Ga0395900_0001738 3300037418 Bacteria 25108
403 Ga0395900_0054721 3300037418 Bacteria 4109
404 Ga0395900_0100316 3300037418 Bacteria 2974
405 Ga0395900_0178042 3300037418 Bacteria 2162
406 Ga0395900_0238447 3300037418 Bacteria 1825
407 Ga0395900_0275412 3300037418 Bacteria 1676
408 Ga0395905_0008422 3300037471 Bacteria 10170
409 Ga0395905_0011242 3300037471 Bacteria 8654
410 Ga0395901_0000073 3300038443 Bacteria 139769
411 Ga0395901_0004488 3300038443 Bacteria 14071
412 Ga0395901_0160201 3300038443 Bacteria 2363
413 Ga0400490_16042 3300038726 Bacteria 1718
414 Ga0400491_18994 3300038727 Bacteria 7133
415 Ga0436361_0230232 3300039447 Bacteria 2691
416 Ga0436361_0678432 3300039447 Bacteria 1835
417 Ga0436361_0738173 3300039447 Bacteria 11067
418 Ga0436361_0752198 3300039447 Bacteria 2538
419 Ga0436361_1160248 3300039447 Bacteria 17738
420 Ga0439449_0030812 3300042007 Bacteria 1999
421 Ga0450911_003384 3300042115 Bacteria 2829
422 Ga0450904_001328 3300042139 Bacteria 3603
423 Ga0451577_0042616 3300042876 Bacteria 4070
424 Ga0451577_0072552 3300042876 Bacteria 3071
425 Ga0466969_0072842 3300044656 Bacteria 1649
426 Ga0466972_0000029 3300044658 Bacteria 165236
427 Ga0453683_0084461 3300044673 Bacteria 1989
428 Ga0466965_0005670 3300044683 Bacteria 5634
429 Ga0466965_0093759 3300044683 Bacteria 1529
430 Ga0466966_0001386 3300044684 Bacteria 15586
431 Ga0466966_0080082 3300044684 Bacteria 2035
432 Ga0466966_0097680 3300044684 Bacteria 1819
433 Ga0466966_0098183 3300044684 Bacteria 1813
434 Ga0466961_0084665 3300044693 Bacteria 2005
435 Ga0466964_0018828 3300044706 Bacteria 2651
436 Ga0453684_0002403 3300044712 Bacteria 45636
437 Ga0453684_0129521 3300044712 Bacteria 3030
438 Ga0453684_0352154 3300044712 Bacteria 1660
439 Ga0453684_0367409 3300044712 Bacteria 1618
440 Ga0451576_0020622 3300045051 Bacteria 7173
441 Ga0451576_0037615 3300045051 Bacteria 5126
442 Ga0451576_0125455 3300045051 Bacteria 2675
443 Ga0451576_0294653 3300045051 Bacteria 1696
444 Ga0466958_0081165 3300045836 Bacteria 1995
445 Ga0495617_000002 3300046452 Bacteria 710121
446 Ga0495617_000098 3300046452 Bacteria 62441
447 Ga0495617_025237 3300046452 Bacteria 2004
448 Ga0495627_000006 3300046453 Bacteria 581750
449 Ga0495627_000339 3300046453 Bacteria 44178
450 Ga0495603_0078446 3300046455 Bacteria 1937
451 Ga0495603_0108741 3300046455 Bacteria 1618
452 Ga0495590_0001878 3300046457 Bacteria 8883
453 Ga0495590_0007854 3300046457 Bacteria 4093
454 Ga0495590_0049102 3300046457 Bacteria 1472
455 Ga0495629_0029456 3300046459 Bacteria 3892
456 Ga0495629_0127824 3300046459 Bacteria 1770
457 Ga0495629_0204444 3300046459 Bacteria 1365
458 Ga0495638_0031063 3300046460 Bacteria 3434
459 Ga0495651_0061157 3300046462 Bacteria 2882
460 Ga0495653_0013215 3300046463 Bacteria 6730
461 Ga0495653_0020412 3300046463 Bacteria 5371
462 Ga0495653_0031535 3300046463 Bacteria 4212
463 Ga0495653_0065887 3300046463 Bacteria 2725
464 Ga0495650_0000399 3300046471 Bacteria 72364
465 Ga0495650_0000407 3300046471 Bacteria 70819
466 Ga0495650_0003026 3300046471 Bacteria 12688
467 Ga0495582_0002672 3300046473 Bacteria 9950
468 Ga0495582_0027009 3300046473 Bacteria 3146
469 Ga0495605_0000085 3300046474 Bacteria 121011
470 Ga0495605_0000108 3300046474 Bacteria 104865
471 Ga0495605_0032125 3300046474 Bacteria 2675
472 Ga0495664_0127335 3300046477 Bacteria 1541
473 Ga0495584_0000282 3300046491 Bacteria 35813
474 Ga0495584_0006912 3300046491 Bacteria 5929
475 Ga0495584_0009798 3300046491 Bacteria 4929
476 Ga0495584_0019049 3300046491 Bacteria 3485
477 Ga0495584_0021515 3300046491 Bacteria 3275
478 Ga0495584_0033124 3300046491 Bacteria 2613
479 Ga0495584_0054183 3300046491 Bacteria 2018
480 Ga0495585_0000004 3300046492 Bacteria 348260
481 Ga0495585_0000298 3300046492 Bacteria 49916
482 Ga0495585_0003086 3300046492 Bacteria 11458
483 Ga0495585_0009766 3300046492 Bacteria 5742
484 Ga0495585_0080973 3300046492 Bacteria 1759
485 Ga0495594_0007794 3300046499 Bacteria 5507
486 Ga0495594_0084929 3300046499 Bacteria 1770
487 Ga0495594_0121179 3300046499 Bacteria 1478
488 Ga0495596_0000186 3300046500 Bacteria 43253
489 Ga0495596_0000902 3300046500 Bacteria 17794
490 Ga0495596_0001640 3300046500 Bacteria 12712
491 Ga0495596_0002100 3300046500 Bacteria 10926
492 Ga0495596_0005393 3300046500 Bacteria 6048
493 Ga0495596_0010283 3300046500 Bacteria 4079
494 Ga0495607_0006643 3300046501 Bacteria 8106
495 Ga0495607_0007031 3300046501 Bacteria 7825
496 Ga0495607_0045014 3300046501 Bacteria 2598
497 Ga0495583_0006161 3300046506 Bacteria 7897
498 Ga0495583_0014707 3300046506 Bacteria 4300
499 Ga0495606_0006538 3300046507 Bacteria 10721
500 Ga0495606_0012422 3300046507 Bacteria 6829
501 Ga0495606_0014238 3300046507 Bacteria 6221
502 Ga0495606_0042577 3300046507 Bacteria 3035
503 Ga0495606_0081425 3300046507 Bacteria 2012
504 Ga0495616_0000145 3300046513 Bacteria 62415
505 Ga0495616_0007566 3300046513 Bacteria 6501
506 Ga0495616_0025320 3300046513 Bacteria 3171
507 Ga0495616_0077996 3300046513 Bacteria 1589
508 Ga0495628_0000275 3300046516 Bacteria 46071
509 Ga0495630_0018018 3300046517 Bacteria 5181
510 Ga0495631_0000109 3300046518 Bacteria 54778
511 Ga0495631_0002244 3300046518 Bacteria 11096
512 Ga0495631_0002690 3300046518 Bacteria 9878
513 Ga0495631_0021398 3300046518 Bacteria 3012
514 Ga0495631_0041667 3300046518 Bacteria 2031
515 Ga0495631_0055728 3300046518 Bacteria 1722
516 Ga0495632_0000470 3300046519 Bacteria 38273
517 Ga0495632_0027304 3300046519 Bacteria 2991
518 Ga0495637_0060519 3300046520 Bacteria 1554
519 Ga0495643_0000233 3300046522 Bacteria 84175
520 Ga0495643_0000681 3300046522 Bacteria 39588
521 Ga0495643_0021507 3300046522 Bacteria 3699
522 Ga0495643_0023173 3300046522 Bacteria 3531
523 Ga0495643_0045648 3300046522 Bacteria 2378
524 Ga0495643_0050656 3300046522 Bacteria 2236
525 Ga0495643_0053901 3300046522 Bacteria 2154
526 Ga0495644_0016225 3300046523 Bacteria 2851
527 Ga0495644_0019176 3300046523 Bacteria 2611
528 Ga0495648_0000044 3300046524 Bacteria 175587
529 Ga0495648_0000220 3300046524 Bacteria 65480
530 Ga0495648_0001128 3300046524 Bacteria 27039
531 Ga0495648_0017295 3300046524 Bacteria 5161
532 Ga0495648_0024967 3300046524 Bacteria 4056
533 Ga0495666_0008005 3300046526 Bacteria 5293
534 Ga0495642_0000075 3300046528 Bacteria 58959
535 Ga0495642_0003143 3300046528 Bacteria 6552
536 Ga0495642_0005798 3300046528 Bacteria 4735
537 Ga0495642_0006468 3300046528 Bacteria 4494
538 Ga0495652_0019949 3300046529 Bacteria 5961
539 Ga0495652_0111872 3300046529 Bacteria 2195
540 Ga0495654_0005012 3300046530 Bacteria 7773
541 Ga0495654_0033510 3300046530 Bacteria 2599
542 Ga0495665_0007097 3300046531 Bacteria 6046
543 Ga0495586_0001866 3300046535 Bacteria 11476
544 Ga0495586_0082876 3300046535 Bacteria 1764
545 Ga0495587_0002460 3300046536 Bacteria 12362
546 Ga0495587_0052723 3300046536 Bacteria 2399
547 Ga0495587_0153838 3300046536 Bacteria 1310
548 Ga0495609_0000002 3300046538 Bacteria 739816
549 Ga0495609_0000268 3300046538 Bacteria 48889
550 Ga0495609_0002590 3300046538 Bacteria 11010
551 Ga0495609_0003458 3300046538 Bacteria 9042
552 Ga0495621_0042894 3300046539 Bacteria 1594
553 Ga0495597_0000295 3300046542 Bacteria 44823
554 Ga0495597_0002788 3300046542 Bacteria 10748
555 Ga0495597_0005790 3300046542 Bacteria 6479
556 Ga0495597_0019635 3300046542 Bacteria 3158
557 Ga0495622_0008094 3300046557 Bacteria 4873
558 Ga0495622_0029803 3300046557 Bacteria 2549
559 Ga0495622_0039112 3300046557 Bacteria 2208
560 Ga0495622_0094619 3300046557 Bacteria 1371
561 Ga0495633_0003283 3300046558 Bacteria 10871
562 Ga0495633_0006965 3300046558 Bacteria 6607
563 Ga0495633_0011482 3300046558 Bacteria 4770
564 Ga0495633_0032470 3300046558 Bacteria 2522
565 Ga0495633_0067607 3300046558 Bacteria 1668
566 Ga0495633_0074119 3300046558 Bacteria 1586
567 Ga0495668_0000861 3300046616 Bacteria 34228
568 Ga0495668_0002828 3300046616 Bacteria 13802
569 Ga0495668_0015083 3300046616 Bacteria 4520
570 Ga0495668_0047233 3300046616 Bacteria 2390
571 Ga0495634_0004452 3300046642 Bacteria 10995
572 Ga0495611_0009166 3300046648 Bacteria 4179
573 Ga0495611_0017887 3300046648 Bacteria 3037
574 Ga0495611_0020432 3300046648 Bacteria 2850
575 Ga0495611_0145724 3300046648 Bacteria 1105
576 Ga0495625_0009361 3300046660 Bacteria 8203
577 Ga0495625_0048945 3300046660 Bacteria 3040
578 Ga0495625_0072038 3300046660 Bacteria 2424
579 Ga0495635_0008207 3300046663 Bacteria 7293
580 Ga0495635_0017503 3300046663 Bacteria 5004
581 Ga0495661_0000271 3300046665 Bacteria 59543
582 Ga0495661_0000669 3300046665 Bacteria 34300
583 Ga0495661_0001564 3300046665 Bacteria 18856
584 Ga0495661_0003697 3300046665 Bacteria 11237
585 Ga0495661_0003800 3300046665 Bacteria 11050
586 Ga0495661_0017201 3300046665 Bacteria 4776
587 Ga0495661_0020189 3300046665 Bacteria 4354
588 Ga0495661_0028461 3300046665 Bacteria 3576
589 Ga0495661_0030187 3300046665 Bacteria 3453
590 Ga0495661_0065299 3300046665 Bacteria 2144
591 Ga0495661_0067912 3300046665 Bacteria 2092
592 Ga0495661_0073882 3300046665 Bacteria 1985
593 Ga0495588_0000135 3300046674 Bacteria 117387
594 Ga0495588_0009117 3300046674 Bacteria 4576
595 Ga0495588_0018879 3300046674 Bacteria 3369
596 Ga0495588_0045558 3300046674 Bacteria 2248
597 Ga0495588_0226513 3300046674 Bacteria 986
598 Ga0495623_0001059 3300046679 Bacteria 18646
599 Ga0495623_0009068 3300046679 Bacteria 6453
600 Ga0495623_0009572 3300046679 Bacteria 6294
601 Ga0495647_0004915 3300046681 Bacteria 4373
602 Ga0495669_0000168 3300046684 Bacteria 41171
603 Ga0495669_0012842 3300046684 Bacteria 3566
604 Ga0495624_0008707 3300046690 Bacteria 7065
605 Ga0495670_0000350 3300046691 Bacteria 22012
606 Ga0495670_0001426 3300046691 Bacteria 11739
607 Ga0495670_0024724 3300046691 Bacteria 2969
608 Ga0495670_0043305 3300046691 Bacteria 2246
609 Ga0495671_0000613 3300046692 Bacteria 26136
610 Ga0495649_0001847 3300046694 Bacteria 15526
611 Ga0495649_0005677 3300046694 Bacteria 7874
612 Ga0495649_0051142 3300046694 Bacteria 2241
613 Ga0495589_0000030 3300046794 Bacteria 170254
614 Ga0495589_0000146 3300046794 Bacteria 65628
615 Ga0495589_0001037 3300046794 Bacteria 16738
616 Ga0495589_0005214 3300046794 Bacteria 6875
617 Ga0495589_0009346 3300046794 Bacteria 5098
618 Ga0495589_0051493 3300046794 Bacteria 2036
619 Ga0495589_0079407 3300046794 Bacteria 1596
620 Ga0495660_0000423 3300046810 Bacteria 35820
621 Ga0495660_0000542 3300046810 Bacteria 30925
622 Ga0495660_0013336 3300046810 Bacteria 4763
623 Ga0495660_0014527 3300046810 Bacteria 4554
624 Ga0495660_0015172 3300046810 Bacteria 4453
625 Ga0495660_0027757 3300046810 Bacteria 3200
626 Ga0495581_0001180 3300047315 Bacteria 14330
627 Ga0495581_0001368 3300047315 Bacteria 13499
628 Ga0495581_0030726 3300047315 Bacteria 3111
629 Ga0495581_0103505 3300047315 Bacteria 1654
630 Ga0495604_0005348 3300047317 Bacteria 10177
631 Ga0495604_0060979 3300047317 Bacteria 2886
632 Ga0495636_0005805 3300047318 Bacteria 4840
633 Ga0495636_0019175 3300047318 Bacteria 2748
634 Ga0495674_0171279 3300047319 Bacteria 1812
635 Ga0495672_0000060 3300047320 Bacteria 214547
636 Ga0495672_0000206 3300047320 Bacteria 84222
637 Ga0495672_0000351 3300047320 Bacteria 59020
638 Ga0495672_0000833 3300047320 Bacteria 32978
639 Ga0495676_0000105 3300047321 Bacteria 63429
640 Ga0495676_0020468 3300047321 Bacteria 5803
641 Ga0495676_0024587 3300047321 Bacteria 5211
642 Ga0495676_0069951 3300047321 Bacteria 2706
643 Ga0495680_0058986 3300047322 Bacteria 2964
644 Ga0495683_0008332 3300047323 Bacteria 5554
645 Ga0495683_0014614 3300047323 Bacteria 4091
646 Ga0495687_000047 3300047443 Bacteria 206452
647 Ga0495687_000088 3300047443 Bacteria 142499
648 Ga0495687_000166 3300047443 Bacteria 98891
649 Ga0495687_001101 3300047443 Bacteria 26384
650 Ga0495687_005231 3300047443 Bacteria 8361
651 Ga0495687_027410 3300047443 Bacteria 2666
652 Ga0495687_072804 3300047443 Bacteria 1371
653 Ga0495675_0002560 3300047444 Bacteria 10889
654 Ga0495675_0007503 3300047444 Bacteria 6719
655 Ga0495675_0042685 3300047444 Bacteria 2889
656 Ga0495677_0000044 3300047445 Bacteria 74340
657 Ga0495677_0001661 3300047445 Bacteria 8942
658 Ga0495677_0003879 3300047445 Bacteria 5778
659 Ga0495677_0004496 3300047445 Bacteria 5346
660 Ga0495677_0038320 3300047445 Bacteria 1751
661 Ga0495681_0000404 3300047470 Bacteria 33516
662 Ga0495681_0001516 3300047470 Bacteria 17343
663 Ga0495681_0010365 3300047470 Bacteria 5643
664 Ga0495681_0076773 3300047470 Bacteria 1501
665 Ga0495681_0078515 3300047470 Bacteria 1479
666 Ga0495681_0086115 3300047470 Bacteria 1394
667 Ga0495684_0043973 3300047471 Bacteria 3419
668 Ga0495686_0000334 3300047472 Bacteria 77666
669 Ga0495686_0108404 3300047472 Bacteria 1668
670 Ga0495593_0014254 3300047673 Bacteria 4520
671 Ga0495593_0026515 3300047673 Bacteria 3199
672 Ga0495593_0052278 3300047673 Bacteria 2159
673 Ga0495602_0014680 3300048088 Bacteria 7945
674 Ga0495602_0040487 3300048088 Bacteria 4271
675 Ga0495614_0007107 3300048089 Bacteria 4993
676 Ga0495614_0021545 3300048089 Bacteria 2782
677 Ga0495615_0026642 3300048090 Bacteria 1351
678 Ga0495626_0000006 3300048091 Bacteria 284977
679 Ga0495626_0000266 3300048091 Bacteria 59029
680 Ga0495626_0003317 3300048091 Bacteria 10385
681 Ga0495626_0009306 3300048091 Bacteria 5313
682 Ga0495626_0055109 3300048091 Bacteria 1824
683 Ga0496100_0072256 3300048903 Bacteria 2305
684 Ga0496101_0030633 3300048904 Bacteria 3774
685 Ga0496102_0000508 3300048905 Bacteria 42696
686 Ga0496103_0003005 3300048906 Bacteria 10418
687 Ga0496104_0002968 3300048907 Bacteria 14620
688 Ga0496104_0220740 3300048907 Bacteria 1808
689 Ga0496104_0303469 3300048907 Bacteria 1509
690 Ga0496105_0005675 3300048908 Bacteria 9500
691 Ga0496106_0009099 3300048909 Bacteria 7339
692 Ga0496107_0008400 3300048910 Bacteria 7146
693 Ga0496107_0056291 3300048910 Bacteria 2841
694 Ga0496107_0168955 3300048910 Bacteria 1622
695 Ga0496109_0036548 3300048912 Bacteria 4434
696 Ga0496109_0261427 3300048912 Bacteria 1630
697 Ga0496110_0000369 3300048913 Bacteria 30095
698 Ga0496110_0151998 3300048913 Bacteria 2096
699 Ga0496113_0010845 3300048916 Bacteria 6047
700 Ga0496113_0511846 3300048916 Bacteria 964
701 Ga0496114_0016406 3300048917 Bacteria 5968
702 Ga0496117_0011610 3300048920 Bacteria 7872
703 Ga0496118_0006655 3300048921 Bacteria 12612
704 Ga0496122_0003354 3300048925 Bacteria 21106
705 Ga0496122_0005566 3300048925 Bacteria 14917
706 Ga0496122_0046176 3300048925 Bacteria 3376
707 Ga0496123_0002554 3300048926 Bacteria 22188
708 Ga0496123_0004083 3300048926 Bacteria 15709
709 Ga0496124_0011069 3300048927 Bacteria 9055
710 Ga0496124_0086568 3300048927 Bacteria 2564
711 Ga0496124_0159427 3300048927 Bacteria 1760
712 Ga0495678_000013 3300049459 Bacteria 316375
713 Ga0495678_000339 3300049459 Bacteria 49120
714 Ga0495678_000770 3300049459 Bacteria 28951
715 Ga0495678_001879 3300049459 Bacteria 15276
716 Ga0495678_016577 3300049459 Bacteria 3364
717 Ga0495682_0030344 3300049460 Bacteria 2000
718 Ga0501031_0038542 3300049568 Bacteria 3119
719 Ga0501034_0102736 3300049571 Bacteria 2852
720 Ga0501034_0269173 3300049571 Bacteria 1645
721 Ga0501036_0015912 3300049572 Bacteria 6283
722 Ga0501036_0215968 3300049572 Bacteria 1611
723 Ga0501037_0077697 3300049573 Bacteria 2409
724 Ga0501039_0092038 3300049575 Bacteria 2363
725 Ga0501041_0024322 3300049577 Bacteria 3635
726 Ga0501041_0118101 3300049577 Bacteria 1647
727 Ga0501068_0023354 3300049584 Bacteria 3623
728 Ga0501070_0004115 3300049586 Bacteria 12509
729 Ga0501070_0025006 3300049586 Bacteria 5008
730 Ga0501071_0002455 3300049587 Bacteria 11259
731 Ga0501072_0002962 3300049588 Bacteria 12790
732 Ga0501072_0187622 3300049588 Bacteria 1649
733 Ga0501073_0074788 3300049589 Bacteria 2358
734 Ga0501074_0000199 3300049590 Bacteria 32705
735 Ga0501074_0109209 3300049590 Bacteria 1979
736 Ga0501075_0001610 3300049591 Bacteria 14794
737 Ga0501076_0001071 3300049592 Bacteria 17977
738 Ga0501076_0103579 3300049592 Bacteria 2296
739 Ga0501077_0064150 3300049593 Bacteria 2330
740 Ga0501227_000835 3300049665 Bacteria 6716
741 Ga0501079_0010809 3300049741 Bacteria 6951
742 Ga0501079_0051354 3300049741 Bacteria 3183
743 Ga0501080_0025750 3300049742 Bacteria 5464
744 Ga0501080_0057418 3300049742 Bacteria 3623
745 Ga0501081_0010313 3300049743 Bacteria 6100
746 Ga0501083_0005240 3300049744 Bacteria 9169
747 Ga0501044_0258471 3300049823 Bacteria 1680
748 Ga0501044_0398524 3300049823 Bacteria 1289
749 Ga0501045_0013138 3300049824 Bacteria 5840
750 Ga0501045_0025249 3300049824 Bacteria 4270
751 Ga0501045_0067128 3300049824 Bacteria 2634
752 Ga0501045_0169203 3300049824 Bacteria 1628
753 nmdc:mga0k408_3537_c1 3300050493 Bacteria 8251
754 nmdc:mga08y16_225982_c1 3300050511 Bacteria 1937
755 nmdc:mga0a205_5608_c1 3300050515 Bacteria 7832
756 Ga0501084_0003320 3300054114 Bacteria 13013
757 Ga0501082_0014793 3300060353 Bacteria 6719
758 Ga0501082_0074299 3300060353 Bacteria 2928
759 Ga0466962_0029335 3300061719 Bacteria 2633
760 Ga0466962_0038544 3300061719 Bacteria 2289
761 Ga0530510_0002843 3300061734 Bacteria 11910
762 Ga0530510_0252343 3300061734 Bacteria 1315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_16042 Ga0400490_16042_431_1339 292
2 3300038727 Ga0400491_18994 Ga0400491_18994_4048_4956 292
3 3300047673 Ga0495593_0014254 Ga0495593_0014254_28_981 304
4 3300048916 Ga0496113_0511846 Ga0496113_0511846_19_954 304
5 3300046459 Ga0495629_0204444 Ga0495629_0204444_399_1355 305
6 3300046471 Ga0495650_0003026 Ga0495650_0003026_14_937 305
7 3300046500 Ga0495596_0010283 Ga0495596_0010283_3113_4051 305
8 3300046648 Ga0495611_0145724 Ga0495611_0145724_145_1089 306
9 3300046674 Ga0495588_0226513 Ga0495588_0226513_19_948 306
10 3300046558 Ga0495633_0067607 Ga0495633_0067607_19_978 308
11 3300047315 Ga0495581_0103505 Ga0495581_0103505_10_963 308
12 3300048090 Ga0495615_0026642 Ga0495615_0026642_335_1294 308
13 3300005367 Ga0070667_100003566 Ga0070667_1000035669 312
14 3300005456 Ga0070678_100002838 Ga0070678_1000028389 312
15 3300005548 Ga0070665_100004484 Ga0070665_1000044847 312
16 3300014969 Ga0157376_10024255 Ga0157376_100242553 312
17 3300025903 Ga0207680_10037482 Ga0207680_100374822 312
18 3300026089 Ga0207648_10034776 Ga0207648_100347764 312
19 3300026121 Ga0207683_10014462 Ga0207683_100144623 312
20 3300028379 Ga0268266_10005997 Ga0268266_100059977 312
21 3300005335 Ga0070666_10077392 Ga0070666_100773921 316
22 3300005364 Ga0070673_100282195 Ga0070673_1002821952 316
23 3300005459 Ga0068867_100044424 Ga0068867_1000444241 316
24 3300013308 Ga0157375_10298001 Ga0157375_102980012 316
25 3300048907 Ga0496104_0303469 Ga0496104_0303469_516_1496 318
26 3300025937 Ga0207669_10051692 Ga0207669_100516922 326
27 3300005564 Ga0070664_100100081 Ga0070664_1001000813 329
28 3300025945 Ga0207679_10057962 Ga0207679_100579623 329
29 3300046471 Ga0495650_0000399 Ga0495650_0000399_44074_45165 330
30 3300005344 Ga0070661_100003328 Ga0070661_1000033286 331
31 3300005458 Ga0070681_10018253 Ga0070681_100182532 331
32 3300005530 Ga0070679_100070385 Ga0070679_1000703852 331
33 3300005539 Ga0068853_100101207 Ga0068853_1001012072 331
34 3300005617 Ga0068859_100396157 Ga0068859_1003961572 331
35 3300006931 Ga0097620_100396163 Ga0097620_1003961632 331
36 3300009174 Ga0105241_10208763 Ga0105241_102087631 331
37 3300013307 Ga0157372_10007100 Ga0157372_100071006 331
38 3300025912 Ga0207707_10005481 Ga0207707_100054817 331
39 3300025920 Ga0207649_10016228 Ga0207649_100162283 331
40 3300025921 Ga0207652_10031116 Ga0207652_100311164 331
41 3300026041 Ga0207639_10077121 Ga0207639_100771212 331
42 3300037418 Ga0395900_0054721 Ga0395900_0054721_504_1622 332
43 3300037471 Ga0395905_0011242 Ga0395905_0011242_2372_3490 332
44 3300047321 Ga0495676_0024587 Ga0495676_0024587_1003_2028 334
45 3300005347 Ga0070668_100027814 Ga0070668_1000278143 335
46 3300006852 Ga0075433_10012647 Ga0075433_100126478 335
47 3300006871 Ga0075434_100029350 Ga0075434_1000293503 335
48 3300007076 Ga0075435_100004089 Ga0075435_1000040895 335
49 3300025972 Ga0207668_10010545 Ga0207668_100105456 335
50 3300028381 Ga0268264_10185800 Ga0268264_101858002 335
51 3300050515 nmdc:mga0a205_5608_c1 nmdc:mga0a205_5608_c1_5577_6671 335
52 3300011119 Ga0105246_10181677 Ga0105246_101816772 336
53 3300013308 Ga0157375_10203656 Ga0157375_102036562 336
54 3300021361 Ga0213872_10001092 Ga0213872_1000109218 336
55 3300005535 Ga0070684_100344842 Ga0070684_1003448421 339
56 3300036401 Ga0373937_0001546 Ga0373937_0001546_12902_13963 339
57 3300044712 Ga0453684_0352154 Ga0453684_0352154_533_1591 340
58 3300005617 Ga0068859_100251527 Ga0068859_1002515272 341
59 3300006931 Ga0097620_100251506 Ga0097620_1002515062 341
60 3300049586 Ga0501070_0004115 Ga0501070_0004115_2498_3565 341
61 3300049588 Ga0501072_0187622 Ga0501072_0187622_390_1457 341
62 3300049589 Ga0501073_0074788 Ga0501073_0074788_729_1796 341
63 3300049590 Ga0501074_0000199 Ga0501074_0000199_6887_7954 341
64 3300049741 Ga0501079_0051354 Ga0501079_0051354_721_1788 341
65 3300049742 Ga0501080_0057418 Ga0501080_0057418_1956_3023 341
66 3300049744 Ga0501083_0005240 Ga0501083_0005240_5606_6673 341
67 3300049823 Ga0501044_0258471 Ga0501044_0258471_302_1369 341
68 3300060353 Ga0501082_0074299 Ga0501082_0074299_266_1333 341
69 3300005355 Ga0070671_100010840 Ga0070671_1000108405 342
70 3300005367 Ga0070667_100165442 Ga0070667_1001654422 342
71 3300005841 Ga0068863_100063693 Ga0068863_1000636933 342
72 3300005937 Ga0081455_10053216 Ga0081455_100532162 342
73 3300005985 Ga0081539_10019043 Ga0081539_100190432 342
74 3300009177 Ga0105248_10057770 Ga0105248_100577703 342
75 3300013308 Ga0157375_10062019 Ga0157375_100620192 342
76 3300014968 Ga0157379_10125083 Ga0157379_101250833 342
77 3300025931 Ga0207644_10005822 Ga0207644_100058225 342
78 3300025941 Ga0207711_10028362 Ga0207711_100283624 342
79 3300025986 Ga0207658_10212515 Ga0207658_102125152 342
80 3300027665 Ga0209983_1020523 Ga0209983_10205232 342
81 3300027682 Ga0209971_1003092 Ga0209971_10030923 342
82 3300027876 Ga0209974_10027642 Ga0209974_100276422 342
83 3300028380 Ga0268265_10381849 Ga0268265_103818491 342
84 3300031251 Ga0265327_10000529 Ga0265327_1000052951 342
85 3300042876 Ga0451577_0042616 Ga0451577_0042616_1336_2394 342
86 3300044712 Ga0453684_0367409 Ga0453684_0367409_114_1235 342
87 3300045051 Ga0451576_0037615 Ga0451576_0037615_1399_2487 342
88 3300049571 Ga0501034_0102736 Ga0501034_0102736_1048_2109 342
89 iso_pu_bacteria 2547132103 2547374305 342
90 3300031665 Ga0316575_10045402 Ga0316575_100454022 343
91 3300039447 Ga0436361_1160248 Ga0436361_1160248_15660_16742 343
92 3300042876 Ga0451577_0072552 Ga0451577_0072552_1896_2945 343
93 3300044673 Ga0453683_0084461 Ga0453683_0084461_771_1868 343
94 3300044712 Ga0453684_0002403 Ga0453684_0002403_44039_45088 343
95 3300044712 Ga0453684_0129521 Ga0453684_0129521_87_1139 343
96 3300045051 Ga0451576_0020622 Ga0451576_0020622_549_1598 343
97 3300045051 Ga0451576_0125455 Ga0451576_0125455_1424_2500 343
98 3300005331 Ga0070670_100152800 Ga0070670_1001528002 344
99 3300005334 Ga0068869_100012816 Ga0068869_1000128164 344
100 3300005335 Ga0070666_10003198 Ga0070666_100031983 344
101 3300005336 Ga0070680_100207513 Ga0070680_1002075132 344
102 3300005338 Ga0068868_100012033 Ga0068868_1000120335 344
103 3300005340 Ga0070689_100000324 Ga0070689_1000003242 344
104 3300005344 Ga0070661_100023740 Ga0070661_1000237402 344
105 3300005345 Ga0070692_10041255 Ga0070692_100412551 344
106 3300005355 Ga0070671_100027394 Ga0070671_1000273945 344
107 3300005364 Ga0070673_100000602 Ga0070673_1000006025 344
108 3300005365 Ga0070688_100000276 Ga0070688_1000002767 344
109 3300005367 Ga0070667_100027843 Ga0070667_1000278433 344
110 3300005435 Ga0070714_100143121 Ga0070714_1001431212 344
111 3300005436 Ga0070713_100021966 Ga0070713_1000219664 344
112 3300005436 Ga0070713_100024627 Ga0070713_1000246275 344
113 3300005437 Ga0070710_10021867 Ga0070710_100218672 344
114 3300005456 Ga0070678_100001759 Ga0070678_1000017593 344
115 3300005457 Ga0070662_100014149 Ga0070662_1000141493 344
116 3300005466 Ga0070685_10000522 Ga0070685_1000052220 344
117 3300005468 Ga0070707_100043109 Ga0070707_1000431096 344
118 3300005543 Ga0070672_100156469 Ga0070672_1001564692 344
119 3300005546 Ga0070696_100055544 Ga0070696_1000555442 344
120 3300005547 Ga0070693_100001181 Ga0070693_1000011815 344
121 3300005548 Ga0070665_100006836 Ga0070665_10000683611 344
122 3300005578 Ga0068854_100017889 Ga0068854_1000178894 344
123 3300005614 Ga0068856_100214436 Ga0068856_1002144362 344
124 3300005617 Ga0068859_100003388 Ga0068859_1000033885 344
125 3300005718 Ga0068866_10003152 Ga0068866_100031524 344
126 3300005840 Ga0068870_10014204 Ga0068870_100142043 344
127 3300005841 Ga0068863_100003151 Ga0068863_1000031516 344
128 3300005843 Ga0068860_100048910 Ga0068860_1000489103 344
129 3300005843 Ga0068860_100087016 Ga0068860_1000870162 344
130 3300006163 Ga0070715_10002475 Ga0070715_100024754 344
131 3300006173 Ga0070716_100018632 Ga0070716_1000186322 344
132 3300006173 Ga0070716_100021395 Ga0070716_1000213951 344
133 3300006175 Ga0070712_100001985 Ga0070712_1000019852 344
134 3300006237 Ga0097621_100004146 Ga0097621_10000414610 344
135 3300006358 Ga0068871_100008690 Ga0068871_1000086905 344
136 3300006931 Ga0097620_100003388 Ga0097620_1000033885 344
137 3300009098 Ga0105245_10025250 Ga0105245_100252504 344
138 3300009098 Ga0105245_10033683 Ga0105245_100336834 344
139 3300009101 Ga0105247_10053300 Ga0105247_100533002 344
140 3300009174 Ga0105241_10062893 Ga0105241_100628932 344
141 3300009176 Ga0105242_10025334 Ga0105242_100253344 344
142 3300009177 Ga0105248_10063113 Ga0105248_100631134 344
143 3300009545 Ga0105237_10084853 Ga0105237_100848533 344
144 3300013296 Ga0157374_10032379 Ga0157374_100323794 344
145 3300013297 Ga0157378_10037889 Ga0157378_100378894 344
146 3300013297 Ga0157378_10063396 Ga0157378_100633964 344
147 3300013306 Ga0163162_10013715 Ga0163162_100137155 344
148 3300013306 Ga0163162_10048939 Ga0163162_100489394 344
149 3300013308 Ga0157375_10007795 Ga0157375_100077956 344
150 3300014325 Ga0163163_10001966 Ga0163163_100019665 344
151 3300014745 Ga0157377_10001594 Ga0157377_100015945 344
152 3300014968 Ga0157379_10040584 Ga0157379_100405842 344
153 3300014969 Ga0157376_10005137 Ga0157376_100051373 344
154 3300014969 Ga0157376_10020601 Ga0157376_100206014 344
155 3300017792 Ga0163161_10086346 Ga0163161_100863462 344
156 3300025898 Ga0207692_10083892 Ga0207692_100838922 344
157 3300025900 Ga0207710_10009425 Ga0207710_100094251 344
158 3300025903 Ga0207680_10011911 Ga0207680_100119113 344
159 3300025906 Ga0207699_10099341 Ga0207699_100993412 344
160 3300025907 Ga0207645_10044740 Ga0207645_100447403 344
161 3300025908 Ga0207643_10014363 Ga0207643_100143633 344
162 3300025912 Ga0207707_10066753 Ga0207707_100667533 344
163 3300025915 Ga0207693_10000069 Ga0207693_1000006962 344
164 3300025915 Ga0207693_10010112 Ga0207693_100101127 344
165 3300025916 Ga0207663_10016917 Ga0207663_100169173 344
166 3300025919 Ga0207657_10002525 Ga0207657_100025259 344
167 3300025925 Ga0207650_10103022 Ga0207650_101030222 344
168 3300025927 Ga0207687_10000293 Ga0207687_1000029329 344
169 3300025928 Ga0207700_10009271 Ga0207700_100092712 344
170 3300025929 Ga0207664_10003067 Ga0207664_100030673 344
171 3300025931 Ga0207644_10009304 Ga0207644_100093044 344
172 3300025931 Ga0207644_10180688 Ga0207644_101806882 344
173 3300025933 Ga0207706_10018899 Ga0207706_100188995 344
174 3300025934 Ga0207686_10000118 Ga0207686_1000011811 344
175 3300025936 Ga0207670_10127164 Ga0207670_101271642 344
176 3300025939 Ga0207665_10007491 Ga0207665_100074912 344
177 3300025939 Ga0207665_10250328 Ga0207665_102503281 344
178 3300025940 Ga0207691_10060041 Ga0207691_100600412 344
179 3300025941 Ga0207711_10000515 Ga0207711_100005159 344
180 3300025942 Ga0207689_10012237 Ga0207689_100122376 344
181 3300025942 Ga0207689_10012711 Ga0207689_100127116 344
182 3300025960 Ga0207651_10000266 Ga0207651_100002668 344
183 3300025981 Ga0207640_10020026 Ga0207640_100200263 344
184 3300025986 Ga0207658_10037542 Ga0207658_100375423 344
185 3300025986 Ga0207658_10161284 Ga0207658_101612842 344
186 3300026023 Ga0207677_10040107 Ga0207677_100401074 344
187 3300026035 Ga0207703_10003276 Ga0207703_1000327610 344
188 3300026078 Ga0207702_10033862 Ga0207702_100338623 344
189 3300026088 Ga0207641_10006628 Ga0207641_100066285 344
190 3300026095 Ga0207676_10005594 Ga0207676_100055945 344
191 3300026116 Ga0207674_10008221 Ga0207674_100082215 344
192 3300026121 Ga0207683_10000827 Ga0207683_1000082721 344
193 3300026142 Ga0207698_10053414 Ga0207698_100534142 344
194 3300028379 Ga0268266_10006981 Ga0268266_100069815 344
195 3300028381 Ga0268264_10003641 Ga0268264_100036413 344
196 3300028381 Ga0268264_10023627 Ga0268264_100236273 344
197 3300035086 Ga0373934_0002330 Ga0373934_0002330_2121_3233 344
198 3300035111 Ga0373923_0002548 Ga0373923_0002548_2064_3176 344
199 3300035118 Ga0373954_0000591 Ga0373954_0000591_8653_9765 344
200 3300035119 Ga0373956_0040685 Ga0373956_0040685_98_1210 344
201 3300035172 Ga0373955_0007635 Ga0373955_0007635_1524_2636 344
202 3300035724 Ga0373933_0005650 Ga0373933_0005650_3748_4860 344
203 3300036401 Ga0373937_0008259 Ga0373937_0008259_4972_6078 344
204 3300036401 Ga0373937_0033468 Ga0373937_0033468_2951_4063 344
205 3300046455 Ga0495603_0078446 Ga0495603_0078446_635_1741 344
206 3300046459 Ga0495629_0029456 Ga0495629_0029456_1472_2578 344
207 3300046473 Ga0495582_0002672 Ga0495582_0002672_4668_5774 344
208 3300046477 Ga0495664_0127335 Ga0495664_0127335_399_1511 344
209 3300046535 Ga0495586_0082876 Ga0495586_0082876_516_1628 344
210 3300046536 Ga0495587_0052723 Ga0495587_0052723_1083_2195 344
211 3300046539 Ga0495621_0042894 Ga0495621_0042894_190_1302 344
212 3300046663 Ga0495635_0017503 Ga0495635_0017503_748_1854 344
213 3300046679 Ga0495623_0009068 Ga0495623_0009068_556_1668 344
214 3300046681 Ga0495647_0004915 Ga0495647_0004915_1545_2651 344
215 3300047315 Ga0495581_0001180 Ga0495581_0001180_7609_8715 344
216 3300047319 Ga0495674_0171279 Ga0495674_0171279_484_1596 344
217 3300047471 Ga0495684_0043973 Ga0495684_0043973_303_1409 344
218 3300047673 Ga0495593_0026515 Ga0495593_0026515_1325_2431 344
219 3300048089 Ga0495614_0007107 Ga0495614_0007107_1406_2512 344
220 3300048907 Ga0496104_0002968 Ga0496104_0002968_2346_3458 344
221 3300048908 Ga0496105_0005675 Ga0496105_0005675_4520_5632 344
222 3300048910 Ga0496107_0168955 Ga0496107_0168955_36_1148 344
223 3300048917 Ga0496114_0016406 Ga0496114_0016406_1805_2917 344
224 3300048926 Ga0496123_0004083 Ga0496123_0004083_6914_8005 344
225 3300049568 Ga0501031_0038542 Ga0501031_0038542_711_1790 344
226 3300049571 Ga0501034_0269173 Ga0501034_0269173_141_1244 344
227 3300049572 Ga0501036_0015912 Ga0501036_0015912_2717_3796 344
228 3300049577 Ga0501041_0024322 Ga0501041_0024322_1643_2722 344
229 3300049577 Ga0501041_0118101 Ga0501041_0118101_459_1538 344
230 3300049584 Ga0501068_0023354 Ga0501068_0023354_1995_3074 344
231 3300049587 Ga0501071_0002455 Ga0501071_0002455_1217_2296 344
232 3300049588 Ga0501072_0002962 Ga0501072_0002962_7547_8626 344
233 3300049591 Ga0501075_0001610 Ga0501075_0001610_12914_13993 344
234 3300049592 Ga0501076_0001071 Ga0501076_0001071_14747_15826 344
235 3300049593 Ga0501077_0064150 Ga0501077_0064150_936_2015 344
236 3300049741 Ga0501079_0010809 Ga0501079_0010809_2319_3398 344
237 3300049742 Ga0501080_0025750 Ga0501080_0025750_3273_4352 344
238 3300049743 Ga0501081_0010313 Ga0501081_0010313_1820_2899 344
239 3300049823 Ga0501044_0398524 Ga0501044_0398524_150_1229 344
240 3300049824 Ga0501045_0025249 Ga0501045_0025249_1652_2731 344
241 3300049824 Ga0501045_0067128 Ga0501045_0067128_1431_2510 344
242 3300050493 nmdc:mga0k408_3537_c1 nmdc:mga0k408_3537_c1_6898_7989 344
243 3300054114 Ga0501084_0003320 Ga0501084_0003320_320_1399 344
244 3300060353 Ga0501082_0014793 Ga0501082_0014793_4650_5729 344
245 3300061734 Ga0530510_0002843 Ga0530510_0002843_3550_4629 344
246 iso_pu_bacteria 2891633521 2891636063 344
247 3300005328 Ga0070676_10003461 Ga0070676_100034616 345
248 3300005334 Ga0068869_100010636 Ga0068869_1000106364 345
249 3300005335 Ga0070666_10003557 Ga0070666_100035576 345
250 3300005338 Ga0068868_100008667 Ga0068868_1000086673 345
251 3300005347 Ga0070668_100001276 Ga0070668_1000012764 345
252 3300005353 Ga0070669_100002313 Ga0070669_1000023138 345
253 3300005354 Ga0070675_100002082 Ga0070675_1000020823 345
254 3300005355 Ga0070671_100004990 Ga0070671_1000049904 345
255 3300005364 Ga0070673_100008381 Ga0070673_1000083814 345
256 3300005367 Ga0070667_100005842 Ga0070667_1000058427 345
257 3300005456 Ga0070678_100002666 Ga0070678_1000026664 345
258 3300005459 Ga0068867_100002278 Ga0068867_1000022786 345
259 3300005543 Ga0070672_100005080 Ga0070672_1000050804 345
260 3300005548 Ga0070665_100007950 Ga0070665_1000079504 345
261 3300005617 Ga0068859_100010910 Ga0068859_1000109108 345
262 3300005841 Ga0068863_100014308 Ga0068863_1000143086 345
263 3300005842 Ga0068858_100008645 Ga0068858_1000086454 345
264 3300005843 Ga0068860_100001042 Ga0068860_10000104214 345
265 3300006237 Ga0097621_100023190 Ga0097621_1000231903 345
266 3300006358 Ga0068871_100008300 Ga0068871_1000083004 345
267 3300006881 Ga0068865_100005451 Ga0068865_1000054514 345
268 3300006931 Ga0097620_100010910 Ga0097620_1000109108 345
269 3300009177 Ga0105248_10002431 Ga0105248_1000243119 345
270 3300013296 Ga0157374_10007182 Ga0157374_100071826 345
271 3300013297 Ga0157378_10062677 Ga0157378_100626772 345
272 3300013306 Ga0163162_10001893 Ga0163162_1000189316 345
273 3300013308 Ga0157375_10016875 Ga0157375_100168754 345
274 3300014325 Ga0163163_10131313 Ga0163163_101313133 345
275 3300014968 Ga0157379_10001435 Ga0157379_1000143518 345
276 3300014969 Ga0157376_10010909 Ga0157376_100109095 345
277 3300025903 Ga0207680_10012261 Ga0207680_100122613 345
278 3300025907 Ga0207645_10003275 Ga0207645_100032755 345
279 3300025912 Ga0207707_10247706 Ga0207707_102477061 345
280 3300025923 Ga0207681_10011715 Ga0207681_100117152 345
281 3300025926 Ga0207659_10006585 Ga0207659_100065855 345
282 3300025931 Ga0207644_10105130 Ga0207644_101051302 345
283 3300025938 Ga0207704_10002824 Ga0207704_100028246 345
284 3300025940 Ga0207691_10000629 Ga0207691_1000062917 345
285 3300025941 Ga0207711_10023802 Ga0207711_100238023 345
286 3300025942 Ga0207689_10006485 Ga0207689_100064856 345
287 3300025972 Ga0207668_10057547 Ga0207668_100575472 345
288 3300025986 Ga0207658_10004266 Ga0207658_100042664 345
289 3300026035 Ga0207703_10040050 Ga0207703_100400503 345
290 3300026088 Ga0207641_10009041 Ga0207641_100090415 345
291 3300026089 Ga0207648_10000364 Ga0207648_1000036419 345
292 3300026095 Ga0207676_10019043 Ga0207676_100190433 345
293 3300026121 Ga0207683_10000076 Ga0207683_1000007665 345
294 3300028379 Ga0268266_10074223 Ga0268266_100742233 345
295 3300028380 Ga0268265_10040194 Ga0268265_100401942 345
296 3300028381 Ga0268264_10075879 Ga0268264_100758792 345
297 3300031824 Ga0307413_10171327 Ga0307413_101713272 345
298 3300048912 Ga0496109_0036548 Ga0496109_0036548_1817_2917 345
299 3300048920 Ga0496117_0011610 Ga0496117_0011610_3044_4141 345
300 3300048921 Ga0496118_0006655 Ga0496118_0006655_8880_9977 345
301 3300049573 Ga0501037_0077697 Ga0501037_0077697_1097_2206 345
302 3300049824 Ga0501045_0169203 Ga0501045_0169203_351_1460 345
303 3300005344 Ga0070661_100000621 Ga0070661_1000006218 346
304 3300005347 Ga0070668_100050868 Ga0070668_1000508683 346
305 3300005354 Ga0070675_100090488 Ga0070675_1000904882 346
306 3300005366 Ga0070659_100035259 Ga0070659_1000352594 346
307 3300005367 Ga0070667_100032956 Ga0070667_1000329562 346
308 3300005367 Ga0070667_100412363 Ga0070667_1004123631 346
309 3300005435 Ga0070714_100012621 Ga0070714_1000126214 346
310 3300005457 Ga0070662_100100624 Ga0070662_1001006241 346
311 3300005459 Ga0068867_100044294 Ga0068867_1000442942 346
312 3300005467 Ga0070706_100143519 Ga0070706_1001435191 346
313 3300005530 Ga0070679_100023077 Ga0070679_1000230777 346
314 3300005535 Ga0070684_100020484 Ga0070684_1000204847 346
315 3300005539 Ga0068853_100037973 Ga0068853_1000379733 346
316 3300005543 Ga0070672_100002742 Ga0070672_1000027423 346
317 3300005563 Ga0068855_100013893 Ga0068855_1000138937 346
318 3300005564 Ga0070664_100028009 Ga0070664_1000280096 346
319 3300005564 Ga0070664_100069702 Ga0070664_1000697023 346
320 3300005577 Ga0068857_100001177 Ga0068857_1000011779 346
321 3300005578 Ga0068854_100021411 Ga0068854_1000214114 346
322 3300005614 Ga0068856_100003663 Ga0068856_1000036633 346
323 3300005614 Ga0068856_100007456 Ga0068856_1000074564 346
324 3300005616 Ga0068852_100013259 Ga0068852_1000132592 346
325 3300005841 Ga0068863_100004647 Ga0068863_10000464712 346
326 3300005841 Ga0068863_100080390 Ga0068863_1000803903 346
327 3300005843 Ga0068860_100011703 Ga0068860_1000117039 346
328 3300009551 Ga0105238_10002149 Ga0105238_1000214915 346
329 3300013100 Ga0157373_10093554 Ga0157373_100935543 346
330 3300013104 Ga0157370_10017646 Ga0157370_100176464 346
331 3300013105 Ga0157369_10052212 Ga0157369_100522123 346
332 3300013307 Ga0157372_10018755 Ga0157372_100187557 346
333 3300013308 Ga0157375_10000680 Ga0157375_100006803 346
334 3300013308 Ga0157375_10679246 Ga0157375_106792461 346
335 3300014325 Ga0163163_10079290 Ga0163163_100792903 346
336 3300014325 Ga0163163_10357302 Ga0163163_103573021 346
337 3300025321 Ga0207656_10083419 Ga0207656_100834192 346
338 3300025910 Ga0207684_10218732 Ga0207684_102187321 346
339 3300025913 Ga0207695_10051661 Ga0207695_100516613 346
340 3300025920 Ga0207649_10001721 Ga0207649_1000172110 346
341 3300025924 Ga0207694_10010599 Ga0207694_100105997 346
342 3300025926 Ga0207659_10072840 Ga0207659_100728403 346
343 3300025929 Ga0207664_10014597 Ga0207664_100145975 346
344 3300025932 Ga0207690_10046036 Ga0207690_100460363 346
345 3300025933 Ga0207706_10123685 Ga0207706_101236852 346
346 3300025940 Ga0207691_10000958 Ga0207691_1000095826 346
347 3300025940 Ga0207691_10004119 Ga0207691_1000411910 346
348 3300025944 Ga0207661_10023513 Ga0207661_100235134 346
349 3300025945 Ga0207679_10060966 Ga0207679_100609663 346
350 3300025949 Ga0207667_10015818 Ga0207667_100158188 346
351 3300025972 Ga0207668_10079086 Ga0207668_100790863 346
352 3300025972 Ga0207668_10214681 Ga0207668_102146812 346
353 3300026041 Ga0207639_10091416 Ga0207639_100914163 346
354 3300026067 Ga0207678_10059780 Ga0207678_100597801 346
355 3300026078 Ga0207702_10016803 Ga0207702_100168035 346
356 3300026088 Ga0207641_10361212 Ga0207641_103612122 346
357 3300026116 Ga0207674_10000912 Ga0207674_1000091242 346
358 3300026121 Ga0207683_10137580 Ga0207683_101375802 346
359 3300028379 Ga0268266_10085071 Ga0268266_100850712 346
360 3300028380 Ga0268265_10102735 Ga0268265_101027353 346
361 3300031995 Ga0307409_100221153 Ga0307409_1002211532 346
362 3300036401 Ga0373937_0137352 Ga0373937_0137352_674_1771 346
363 3300036401 Ga0373937_0281903 Ga0373937_0281903_226_1368 346
364 3300037418 Ga0395900_0178042 Ga0395900_0178042_128_1219 346
365 3300037418 Ga0395900_0238447 Ga0395900_0238447_564_1694 346
366 3300038443 Ga0395901_0004488 Ga0395901_0004488_139_1230 346
367 3300045051 Ga0451576_0294653 Ga0451576_0294653_526_1605 346
368 3300046462 Ga0495651_0061157 Ga0495651_0061157_1472_2611 346
369 3300046516 Ga0495628_0000275 Ga0495628_0000275_606_1745 346
370 3300049586 Ga0501070_0025006 Ga0501070_0025006_3472_4554 346
371 3300049590 Ga0501074_0109209 Ga0501074_0109209_584_1666 346
372 3300031344 Ga0265316_10000144 Ga0265316_1000014452 347
373 3300037312 Ga0395899_0017364 Ga0395899_0017364_700_1830 347
374 3300044684 Ga0466966_0001386 Ga0466966_0001386_410_1501 347
375 3300049572 Ga0501036_0215968 Ga0501036_0215968_35_1150 347
376 3300005328 Ga0070676_10000107 Ga0070676_100001072 348
377 3300025254 Ga0209148_1000310 Ga0209148_100031059 348
378 3300045836 Ga0466958_0081165 Ga0466958_0081165_409_1503 348
379 3300046463 Ga0495653_0065887 Ga0495653_0065887_804_1910 348
380 3300046491 Ga0495584_0000282 Ga0495584_0000282_18072_19163 348
381 3300046529 Ga0495652_0111872 Ga0495652_0111872_40_1146 348
382 3300046536 Ga0495587_0002460 Ga0495587_0002460_485_1591 348
383 3300046557 Ga0495622_0094619 Ga0495622_0094619_13_1119 348
384 3300046674 Ga0495588_0045558 Ga0495588_0045558_1070_2176 348
385 3300047673 Ga0495593_0052278 Ga0495593_0052278_91_1197 348
386 3300048088 Ga0495602_0040487 Ga0495602_0040487_2615_3721 348
387 3300005328 Ga0070676_10013290 Ga0070676_100132903 349
388 3300005344 Ga0070661_100071191 Ga0070661_1000711913 349
389 3300005356 Ga0070674_100181481 Ga0070674_1001814812 349
390 3300005549 Ga0070704_100080364 Ga0070704_1000803642 349
391 3300005564 Ga0070664_100029736 Ga0070664_1000297362 349
392 3300005718 Ga0068866_10092601 Ga0068866_100926012 349
393 3300005719 Ga0068861_100137085 Ga0068861_1001370852 349
394 3300005841 Ga0068863_100192639 Ga0068863_1001926392 349
395 3300006358 Ga0068871_100060324 Ga0068871_1000603243 349
396 3300006881 Ga0068865_100193812 Ga0068865_1001938122 349
397 3300009094 Ga0111539_10182477 Ga0111539_101824773 349
398 3300009148 Ga0105243_10051158 Ga0105243_100511582 349
399 3300009176 Ga0105242_10185494 Ga0105242_101854941 349
400 3300009177 Ga0105248_10368971 Ga0105248_103689712 349
401 3300014968 Ga0157379_10062427 Ga0157379_100624273 349
402 3300025315 Ga0207697_10041735 Ga0207697_100417352 349
403 3300025893 Ga0207682_10001976 Ga0207682_100019765 349
404 3300025907 Ga0207645_10008319 Ga0207645_100083195 349
405 3300025933 Ga0207706_10021848 Ga0207706_100218484 349
406 3300025935 Ga0207709_10023056 Ga0207709_100230563 349
407 3300025942 Ga0207689_10023713 Ga0207689_100237132 349
408 3300026035 Ga0207703_10077334 Ga0207703_100773343 349
409 3300026116 Ga0207674_10055401 Ga0207674_100554013 349
410 3300026118 Ga0207675_100018434 Ga0207675_1000184345 349
411 3300026121 Ga0207683_10004135 Ga0207683_100041355 349
412 3300031235 Ga0265330_10063427 Ga0265330_100634271 349
413 3300031238 Ga0265332_10005253 Ga0265332_100052536 349
414 3300031250 Ga0265331_10000872 Ga0265331_1000087215 349
415 3300031344 Ga0265316_10039329 Ga0265316_100393294 349
416 3300031711 Ga0265314_10000811 Ga0265314_1000081113 349
417 3300031712 Ga0265342_10003272 Ga0265342_100032723 349
418 3300046501 Ga0495607_0007031 Ga0495607_0007031_4533_5627 349
419 3300046519 Ga0495632_0000470 Ga0495632_0000470_8867_10021 349
420 3300046665 Ga0495661_0000669 Ga0495661_0000669_26931_28025 349
421 3300046684 Ga0495669_0012842 Ga0495669_0012842_1888_2988 349
422 3300048909 Ga0496106_0009099 Ga0496106_0009099_1307_2431 349
423 3300048910 Ga0496107_0008400 Ga0496107_0008400_1439_2563 349
424 3300050511 nmdc:mga08y16_225982_c1 nmdc:mga08y16_225982_c1_810_1907 349
425 3300005354 Ga0070675_100296208 Ga0070675_1002962081 350
426 3300005364 Ga0070673_100337348 Ga0070673_1003373481 350
427 3300005617 Ga0068859_100048271 Ga0068859_1000482714 350
428 3300005841 Ga0068863_100142057 Ga0068863_1001420572 350
429 3300005842 Ga0068858_100341337 Ga0068858_1003413372 350
430 3300006931 Ga0097620_100048271 Ga0097620_1000482714 350
431 3300009098 Ga0105245_10378575 Ga0105245_103785751 350
432 3300009176 Ga0105242_10326519 Ga0105242_103265191 350
433 3300010375 Ga0105239_10373046 Ga0105239_103730462 350
434 3300013104 Ga0157370_10013200 Ga0157370_100132002 350
435 3300025927 Ga0207687_10039735 Ga0207687_100397353 350
436 3300025942 Ga0207689_10000498 Ga0207689_1000049823 350
437 3300025960 Ga0207651_10115177 Ga0207651_101151771 350
438 3300026035 Ga0207703_10074130 Ga0207703_100741302 350
439 3300026089 Ga0207648_10037375 Ga0207648_100373755 350
440 3300026118 Ga0207675_100148701 Ga0207675_1001487012 350
441 3300026121 Ga0207683_10157259 Ga0207683_101572593 350
442 3300042115 Ga0450911_003384 Ga0450911_003384_1312_2403 350
443 3300047443 Ga0495687_072804 Ga0495687_072804_30_1124 350
444 3300048927 Ga0496124_0011069 Ga0496124_0011069_3799_4977 350
445 3300005336 Ga0070680_100124342 Ga0070680_1001243423 351
446 3300005467 Ga0070706_100226532 Ga0070706_1002265322 351
447 3300005468 Ga0070707_100100381 Ga0070707_1001003813 351
448 3300005471 Ga0070698_100162997 Ga0070698_1001629972 351
449 3300006871 Ga0075434_100189521 Ga0075434_1001895212 351
450 3300009093 Ga0105240_10098901 Ga0105240_100989013 351
451 3300025910 Ga0207684_10158545 Ga0207684_101585452 351
452 3300046452 Ga0495617_025237 Ga0495617_025237_408_1547 351
453 3300046513 Ga0495616_0000145 Ga0495616_0000145_27854_28960 351
454 3300046538 Ga0495609_0000002 Ga0495609_0000002_98563_99669 351
455 3300046557 Ga0495622_0008094 Ga0495622_0008094_1544_2662 351
456 3300046665 Ga0495661_0000271 Ga0495661_0000271_23813_24919 351
457 3300046690 Ga0495624_0008707 Ga0495624_0008707_3971_5089 351
458 3300046794 Ga0495589_0000030 Ga0495589_0000030_119121_120227 351
459 3300047315 Ga0495581_0030726 Ga0495581_0030726_1906_3024 351
460 3300047443 Ga0495687_000047 Ga0495687_000047_119123_120229 351
461 3300047445 Ga0495677_0000044 Ga0495677_0000044_49422_50528 351
462 3300048091 Ga0495626_0000266 Ga0495626_0000266_23813_24919 351
463 3300009551 Ga0105238_10329535 Ga0105238_103295352 352
464 3300013104 Ga0157370_10007756 Ga0157370_100077569 352
465 3300037418 Ga0395900_0275412 Ga0395900_0275412_290_1396 352
466 3300038443 Ga0395901_0160201 Ga0395901_0160201_830_1936 352
467 3300042007 Ga0439449_0030812 Ga0439449_0030812_166_1272 352
468 iso_pu_bacteria 2643221556 2643797852 352
469 iso_pu_bacteria 2643221684 2644473032 352
470 iso_pu_bacteria 8047673197 8047677854 352
471 3300005548 Ga0070665_100090348 Ga0070665_1000903482 353
472 3300038443 Ga0395901_0000073 Ga0395901_0000073_128842_129948 354
473 3300049575 Ga0501039_0092038 Ga0501039_0092038_709_1827 354
474 3300049592 Ga0501076_0103579 Ga0501076_0103579_883_1995 354
475 3300049824 Ga0501045_0013138 Ga0501045_0013138_3195_4313 354
476 3300061734 Ga0530510_0252343 Ga0530510_0252343_139_1257 354
477 3300031251 Ga0265327_10014347 Ga0265327_100143471 355
478 3300046491 Ga0495584_0006912 Ga0495584_0006912_3373_4464 355
479 3300003322 rootL2_10004459 rootL2_1000445911 356
480 3300044683 Ga0466965_0093759 Ga0466965_0093759_183_1286 356
481 3300044684 Ga0466966_0098183 Ga0466966_0098183_291_1382 356
482 3300044693 Ga0466961_0084665 Ga0466961_0084665_839_1933 356
483 3300046457 Ga0495590_0049102 Ga0495590_0049102_165_1256 356
484 3300046474 Ga0495605_0000085 Ga0495605_0000085_96902_97993 356
485 3300046501 Ga0495607_0006643 Ga0495607_0006643_603_1694 356
486 3300046522 Ga0495643_0053901 Ga0495643_0053901_597_1688 356
487 3300046674 Ga0495588_0000135 Ga0495588_0000135_30455_31546 356
488 3300046694 Ga0495649_0005677 Ga0495649_0005677_1789_2880 356
489 3300046794 Ga0495589_0000146 Ga0495589_0000146_52537_53628 356
490 3300046810 Ga0495660_0000423 Ga0495660_0000423_28303_29394 356
491 3300046810 Ga0495660_0013336 Ga0495660_0013336_1316_2407 356
492 3300047320 Ga0495672_0000833 Ga0495672_0000833_29319_30410 356
493 3300047323 Ga0495683_0014614 Ga0495683_0014614_1451_2542 356
494 3300047443 Ga0495687_001101 Ga0495687_001101_18063_19154 356
495 3300047445 Ga0495677_0004496 Ga0495677_0004496_373_1464 356
496 3300048091 Ga0495626_0000006 Ga0495626_0000006_246646_247737 356
497 3300048925 Ga0496122_0005566 Ga0496122_0005566_5178_6281 356
498 3300048925 Ga0496122_0046176 Ga0496122_0046176_843_1934 356
499 3300048927 Ga0496124_0159427 Ga0496124_0159427_368_1471 356
500 3300049459 Ga0495678_016577 Ga0495678_016577_2219_3307 356
501 3300061719 Ga0466962_0029335 Ga0466962_0029335_1315_2418 356
502 iso_pu_bacteria 2808606418 2809144341 356
503 3300044656 Ga0466969_0072842 Ga0466969_0072842_193_1287 357
504 3300044684 Ga0466966_0097680 Ga0466966_0097680_498_1592 357
505 3300046499 Ga0495594_0007794 Ga0495594_0007794_1902_3005 357
506 3300047472 Ga0495686_0000334 Ga0495686_0000334_41949_43037 357
507 iso_pu_bacteria 2857553236 2857556508 357
508 iso_pu_bacteria 2857558681 2857561133 357
509 3300042139 Ga0450904_001328 Ga0450904_001328_2052_3134 358
510 3300044658 Ga0466972_0000029 Ga0466972_0000029_150256_151338 358
511 3300046474 Ga0495605_0032125 Ga0495605_0032125_1420_2520 358
512 3300046491 Ga0495584_0033124 Ga0495584_0033124_1019_2119 358
513 3300046501 Ga0495607_0045014 Ga0495607_0045014_279_1379 358
514 3300046557 Ga0495622_0029803 Ga0495622_0029803_823_1932 358
515 3300046660 Ga0495625_0048945 Ga0495625_0048945_798_1898 358
516 3300046674 Ga0495588_0009117 Ga0495588_0009117_1170_2279 358
517 3300046694 Ga0495649_0051142 Ga0495649_0051142_595_1695 358
518 3300047321 Ga0495676_0000105 Ga0495676_0000105_8762_9871 358
519 3300048091 Ga0495626_0055109 Ga0495626_0055109_427_1527 358
520 3300005563 Ga0068855_100137369 Ga0068855_1001373692 359
521 3300025230 Ga0209563_100015 Ga0209563_100015366 359
522 3300025253 Ga0209677_104532 Ga0209677_1045324 359
523 3300037312 Ga0395899_0210202 Ga0395899_0210202_71_1183 359
524 3300037418 Ga0395900_0001738 Ga0395900_0001738_3349_4461 359
525 3300046463 Ga0495653_0020412 Ga0495653_0020412_1628_2746 359
526 3300046535 Ga0495586_0001866 Ga0495586_0001866_2820_3938 359
527 3300046663 Ga0495635_0008207 Ga0495635_0008207_3698_4816 359
528 3300047317 Ga0495604_0005348 Ga0495604_0005348_1761_2879 359
529 3300047317 Ga0495604_0060979 Ga0495604_0060979_1167_2270 359
530 3300047322 Ga0495680_0058986 Ga0495680_0058986_78_1196 359
531 3300047444 Ga0495675_0002560 Ga0495675_0002560_9536_10642 359
532 3300048089 Ga0495614_0021545 Ga0495614_0021545_1615_2733 359
533 3300061719 Ga0466962_0038544 Ga0466962_0038544_154_1281 359
534 3300005366 Ga0070659_100061803 Ga0070659_1000618032 360
535 3300013102 Ga0157371_10000001 Ga0157371_10000001836 360
536 3300025919 Ga0207657_10005841 Ga0207657_1000584110 360
537 3300025932 Ga0207690_10023825 Ga0207690_100238253 360
538 3300025945 Ga0207679_10169594 Ga0207679_101695942 360
539 3300030745 Ga0316182_1171920 Ga0316182_11719202 360
540 3300044683 Ga0466965_0005670 Ga0466965_0005670_298_1389 360
541 3300044684 Ga0466966_0080082 Ga0466966_0080082_769_1872 360
542 3300044706 Ga0466964_0018828 Ga0466964_0018828_1369_2460 360
543 3300046455 Ga0495603_0108741 Ga0495603_0108741_393_1502 360
544 3300046457 Ga0495590_0007854 Ga0495590_0007854_950_2059 360
545 3300046459 Ga0495629_0127824 Ga0495629_0127824_28_1134 360
546 3300046463 Ga0495653_0013215 Ga0495653_0013215_3465_4589 360
547 3300046471 Ga0495650_0000407 Ga0495650_0000407_18914_20029 360
548 3300046473 Ga0495582_0027009 Ga0495582_0027009_1733_2848 360
549 3300046491 Ga0495584_0009798 Ga0495584_0009798_2202_3305 360
550 3300046491 Ga0495584_0019049 Ga0495584_0019049_1126_2241 360
551 3300046491 Ga0495584_0054183 Ga0495584_0054183_749_1864 360
552 3300046492 Ga0495585_0000298 Ga0495585_0000298_5481_6596 360
553 3300046492 Ga0495585_0080973 Ga0495585_0080973_220_1335 360
554 3300046499 Ga0495594_0084929 Ga0495594_0084929_28_1134 360
555 3300046500 Ga0495596_0000902 Ga0495596_0000902_10302_11417 360
556 3300046500 Ga0495596_0001640 Ga0495596_0001640_9042_10148 360
557 3300046500 Ga0495596_0005393 Ga0495596_0005393_2573_3688 360
558 3300046507 Ga0495606_0006538 Ga0495606_0006538_9027_10127 360
559 3300046507 Ga0495606_0012422 Ga0495606_0012422_3363_4478 360
560 3300046507 Ga0495606_0042577 Ga0495606_0042577_32_1168 360
561 3300046507 Ga0495606_0081425 Ga0495606_0081425_162_1271 360
562 3300046517 Ga0495630_0018018 Ga0495630_0018018_3679_4788 360
563 3300046518 Ga0495631_0021398 Ga0495631_0021398_1447_2583 360
564 3300046518 Ga0495631_0041667 Ga0495631_0041667_154_1269 360
565 3300046524 Ga0495648_0001128 Ga0495648_0001128_9558_10673 360
566 3300046528 Ga0495642_0005798 Ga0495642_0005798_3283_4389 360
567 3300046536 Ga0495587_0153838 Ga0495587_0153838_69_1178 360
568 3300046538 Ga0495609_0003458 Ga0495609_0003458_4178_5293 360
569 3300046557 Ga0495622_0039112 Ga0495622_0039112_929_2044 360
570 3300046558 Ga0495633_0006965 Ga0495633_0006965_3949_5064 360
571 3300046558 Ga0495633_0032470 Ga0495633_0032470_679_1794 360
572 3300046558 Ga0495633_0074119 Ga0495633_0074119_144_1250 360
573 3300046616 Ga0495668_0047233 Ga0495668_0047233_913_2019 360
574 3300046648 Ga0495611_0009166 Ga0495611_0009166_2658_3761 360
575 3300046648 Ga0495611_0020432 Ga0495611_0020432_1214_2329 360
576 3300046665 Ga0495661_0017201 Ga0495661_0017201_29_1144 360
577 3300046665 Ga0495661_0067912 Ga0495661_0067912_350_1456 360
578 3300046674 Ga0495588_0018879 Ga0495588_0018879_792_1880 360
579 3300046679 Ga0495623_0009572 Ga0495623_0009572_4437_5537 360
580 3300046684 Ga0495669_0000168 Ga0495669_0000168_15423_16529 360
581 3300046691 Ga0495670_0001426 Ga0495670_0001426_3812_4927 360
582 3300046691 Ga0495670_0024724 Ga0495670_0024724_15_1130 360
583 3300046691 Ga0495670_0043305 Ga0495670_0043305_350_1456 360
584 3300046794 Ga0495589_0009346 Ga0495589_0009346_3707_4822 360
585 3300046794 Ga0495589_0051493 Ga0495589_0051493_23_1138 360
586 3300046794 Ga0495589_0079407 Ga0495589_0079407_325_1431 360
587 3300047315 Ga0495581_0001368 Ga0495581_0001368_4398_5504 360
588 3300047318 Ga0495636_0005805 Ga0495636_0005805_512_1615 360
589 3300047318 Ga0495636_0019175 Ga0495636_0019175_1449_2564 360
590 3300047320 Ga0495672_0000351 Ga0495672_0000351_50829_51944 360
591 3300047321 Ga0495676_0020468 Ga0495676_0020468_2577_3692 360
592 3300047321 Ga0495676_0069951 Ga0495676_0069951_107_1222 360
593 3300047323 Ga0495683_0008332 Ga0495683_0008332_1226_2341 360
594 3300047444 Ga0495675_0042685 Ga0495675_0042685_530_1714 360
595 3300047445 Ga0495677_0038320 Ga0495677_0038320_138_1241 360
596 3300047470 Ga0495681_0078515 Ga0495681_0078515_188_1291 360
597 3300048091 Ga0495626_0003317 Ga0495626_0003317_2962_4077 360
598 3300048927 Ga0496124_0086568 Ga0496124_0086568_1215_2315 360
599 3300049459 Ga0495678_000770 Ga0495678_000770_23397_24497 360
600 3300003775 Ga0055524_1000029 Ga0055524_1000029113 361
601 3300006948 Ga0099826_10000003 Ga0099826_10000003491 361
602 3300021361 Ga0213872_10001185 Ga0213872_100011857 361
603 3300021361 Ga0213872_10003823 Ga0213872_100038236 361
604 3300025263 Ga0209565_1005709 Ga0209565_10057092 361
605 3300025299 Ga0209256_1000013 Ga0209256_100001390 361
606 3300027666 Ga0209282_1000002 Ga0209282_1000002507 361
607 3300039447 Ga0436361_0230232 Ga0436361_0230232_947_2038 361
608 3300039447 Ga0436361_0678432 Ga0436361_0678432_91_1179 361
609 3300039447 Ga0436361_0738173 Ga0436361_0738173_9865_10977 361
610 3300039447 Ga0436361_0752198 Ga0436361_0752198_184_1272 361
611 3300046452 Ga0495617_000002 Ga0495617_000002_308713_309807 361
612 3300046453 Ga0495627_000006 Ga0495627_000006_375137_376225 361
613 3300046457 Ga0495590_0001878 Ga0495590_0001878_934_2040 361
614 3300046463 Ga0495653_0031535 Ga0495653_0031535_616_1737 361
615 3300046474 Ga0495605_0000108 Ga0495605_0000108_72313_73407 361
616 3300046492 Ga0495585_0003086 Ga0495585_0003086_1541_2656 361
617 3300046499 Ga0495594_0121179 Ga0495594_0121179_73_1194 361
618 3300046500 Ga0495596_0000186 Ga0495596_0000186_36733_37854 361
619 3300046506 Ga0495583_0006161 Ga0495583_0006161_3950_5056 361
620 3300046507 Ga0495606_0014238 Ga0495606_0014238_4816_5904 361
621 3300046513 Ga0495616_0025320 Ga0495616_0025320_955_2061 361
622 3300046513 Ga0495616_0077996 Ga0495616_0077996_307_1428 361
623 3300046518 Ga0495631_0000109 Ga0495631_0000109_26448_27554 361
624 3300046518 Ga0495631_0002690 Ga0495631_0002690_98_1213 361
625 3300046518 Ga0495631_0055728 Ga0495631_0055728_230_1351 361
626 3300046519 Ga0495632_0027304 Ga0495632_0027304_1086_2207 361
627 3300046520 Ga0495637_0060519 Ga0495637_0060519_73_1179 361
628 3300046522 Ga0495643_0000233 Ga0495643_0000233_1862_2950 361
629 3300046522 Ga0495643_0000681 Ga0495643_0000681_22473_23561 361
630 3300046522 Ga0495643_0021507 Ga0495643_0021507_212_1315 361
631 3300046522 Ga0495643_0045648 Ga0495643_0045648_1251_2357 361
632 3300046522 Ga0495643_0050656 Ga0495643_0050656_145_1233 361
633 3300046523 Ga0495644_0019176 Ga0495644_0019176_305_1426 361
634 3300046524 Ga0495648_0000220 Ga0495648_0000220_35947_37041 361
635 3300046524 Ga0495648_0017295 Ga0495648_0017295_131_1237 361
636 3300046524 Ga0495648_0024967 Ga0495648_0024967_1266_2354 361
637 3300046526 Ga0495666_0008005 Ga0495666_0008005_3744_4865 361
638 3300046528 Ga0495642_0006468 Ga0495642_0006468_1023_2126 361
639 3300046529 Ga0495652_0019949 Ga0495652_0019949_3573_4694 361
640 3300046530 Ga0495654_0005012 Ga0495654_0005012_2530_3636 361
641 3300046531 Ga0495665_0007097 Ga0495665_0007097_1273_2394 361
642 3300046538 Ga0495609_0002590 Ga0495609_0002590_1888_2976 361
643 3300046542 Ga0495597_0000295 Ga0495597_0000295_37077_38165 361
644 3300046542 Ga0495597_0002788 Ga0495597_0002788_1881_2969 361
645 3300046542 Ga0495597_0005790 Ga0495597_0005790_1912_3006 361
646 3300046558 Ga0495633_0003283 Ga0495633_0003283_4259_5374 361
647 3300046558 Ga0495633_0011482 Ga0495633_0011482_788_1909 361
648 3300046616 Ga0495668_0000861 Ga0495668_0000861_6559_7665 361
649 3300046616 Ga0495668_0002828 Ga0495668_0002828_7886_8980 361
650 3300046642 Ga0495634_0004452 Ga0495634_0004452_3714_4835 361
651 3300046648 Ga0495611_0017887 Ga0495611_0017887_1032_2147 361
652 3300046660 Ga0495625_0009361 Ga0495625_0009361_3492_4598 361
653 3300046660 Ga0495625_0072038 Ga0495625_0072038_1106_2227 361
654 3300046665 Ga0495661_0001564 Ga0495661_0001564_9103_10218 361
655 3300046665 Ga0495661_0003697 Ga0495661_0003697_6668_7771 361
656 3300046665 Ga0495661_0003800 Ga0495661_0003800_4554_5660 361
657 3300046665 Ga0495661_0028461 Ga0495661_0028461_1073_2179 361
658 3300046665 Ga0495661_0030187 Ga0495661_0030187_516_1610 361
659 3300046665 Ga0495661_0065299 Ga0495661_0065299_517_1638 361
660 3300046665 Ga0495661_0073882 Ga0495661_0073882_17_1138 361
661 3300046679 Ga0495623_0001059 Ga0495623_0001059_15729_16850 361
662 3300046691 Ga0495670_0000350 Ga0495670_0000350_8986_10101 361
663 3300046694 Ga0495649_0001847 Ga0495649_0001847_5060_6148 361
664 3300046794 Ga0495589_0001037 Ga0495589_0001037_11692_12786 361
665 3300046794 Ga0495589_0005214 Ga0495589_0005214_1677_2771 361
666 3300046810 Ga0495660_0000542 Ga0495660_0000542_20355_21443 361
667 3300046810 Ga0495660_0014527 Ga0495660_0014527_3120_4226 361
668 3300046810 Ga0495660_0015172 Ga0495660_0015172_1168_2274 361
669 3300046810 Ga0495660_0027757 Ga0495660_0027757_27_1115 361
670 3300047320 Ga0495672_0000206 Ga0495672_0000206_81278_82366 361
671 3300047443 Ga0495687_000088 Ga0495687_000088_7227_8339 361
672 3300047443 Ga0495687_027410 Ga0495687_027410_869_1972 361
673 3300047444 Ga0495675_0007503 Ga0495675_0007503_1873_2994 361
674 3300047445 Ga0495677_0001661 Ga0495677_0001661_4758_5873 361
675 3300047470 Ga0495681_0001516 Ga0495681_0001516_8670_9785 361
676 3300047470 Ga0495681_0010365 Ga0495681_0010365_2603_3691 361
677 3300047470 Ga0495681_0076773 Ga0495681_0076773_363_1484 361
678 3300048088 Ga0495602_0014680 Ga0495602_0014680_3514_4635 361
679 3300048091 Ga0495626_0009306 Ga0495626_0009306_2423_3544 361
680 3300048903 Ga0496100_0072256 Ga0496100_0072256_322_1428 361
681 3300048904 Ga0496101_0030633 Ga0496101_0030633_2482_3588 361
682 3300048906 Ga0496103_0003005 Ga0496103_0003005_5553_6683 361
683 3300048907 Ga0496104_0220740 Ga0496104_0220740_521_1681 361
684 3300048910 Ga0496107_0056291 Ga0496107_0056291_1191_2297 361
685 3300048912 Ga0496109_0261427 Ga0496109_0261427_306_1412 361
686 3300048913 Ga0496110_0000369 Ga0496110_0000369_27967_29073 361
687 3300048913 Ga0496110_0151998 Ga0496110_0151998_14_1120 361
688 3300048916 Ga0496113_0010845 Ga0496113_0010845_1113_2219 361
689 3300048925 Ga0496122_0003354 Ga0496122_0003354_7478_8584 361
690 3300048926 Ga0496123_0002554 Ga0496123_0002554_12635_13741 361
691 3300049459 Ga0495678_000013 Ga0495678_000013_114305_115393 361
692 3300049459 Ga0495678_000339 Ga0495678_000339_1860_2948 361
693 3300049459 Ga0495678_001879 Ga0495678_001879_449_1555 361
694 3300049460 Ga0495682_0030344 Ga0495682_0030344_11_1117 361
695 3300049665 Ga0501227_000835 Ga0501227_000835_4689_5786 361
696 3300046452 Ga0495617_000098 Ga0495617_000098_3605_4759 362
697 3300046492 Ga0495585_0000004 Ga0495585_0000004_184712_185866 362
698 3300046524 Ga0495648_0000044 Ga0495648_0000044_96840_97994 362
699 3300037418 Ga0395900_0000729 Ga0395900_0000729_28494_29666 363
700 3300046491 Ga0495584_0021515 Ga0495584_0021515_476_1597 363
701 3300037312 Ga0395899_0062812 Ga0395899_0062812_1336_2451 364
702 3300037418 Ga0395900_0100316 Ga0395900_0100316_827_1930 364
703 3300046453 Ga0495627_000339 Ga0495627_000339_14618_15721 364
704 3300046500 Ga0495596_0002100 Ga0495596_0002100_5978_7081 364
705 3300046506 Ga0495583_0014707 Ga0495583_0014707_2129_3232 364
706 3300046513 Ga0495616_0007566 Ga0495616_0007566_1096_2199 364
707 3300046518 Ga0495631_0002244 Ga0495631_0002244_6561_7664 364
708 3300046522 Ga0495643_0023173 Ga0495643_0023173_528_1637 364
709 3300046523 Ga0495644_0016225 Ga0495644_0016225_1376_2479 364
710 3300046528 Ga0495642_0000075 Ga0495642_0000075_5979_7082 364
711 3300046530 Ga0495654_0033510 Ga0495654_0033510_208_1311 364
712 3300046692 Ga0495671_0000613 Ga0495671_0000613_10615_11718 364
713 3300047443 Ga0495687_000166 Ga0495687_000166_97572_98678 364
714 3300047445 Ga0495677_0003879 Ga0495677_0003879_1089_2192 364
715 3300047470 Ga0495681_0000404 Ga0495681_0000404_28322_29425 364
716 3300047472 Ga0495686_0108404 Ga0495686_0108404_343_1446 364
717 3300048905 Ga0496102_0000508 Ga0496102_0000508_39661_40764 364
718 3300037471 Ga0395905_0008422 Ga0395905_0008422_7832_8968 365
719 3300046538 Ga0495609_0000268 Ga0495609_0000268_24075_25241 366
720 3300046492 Ga0495585_0009766 Ga0495585_0009766_4160_5323 368
721 3300046528 Ga0495642_0003143 Ga0495642_0003143_2568_3731 368
722 3300046542 Ga0495597_0019635 Ga0495597_0019635_652_1815 368
723 3300046616 Ga0495668_0015083 Ga0495668_0015083_143_1306 368
724 3300046665 Ga0495661_0020189 Ga0495661_0020189_2457_3620 368
725 3300047470 Ga0495681_0086115 Ga0495681_0086115_205_1368 368
726 iso_pu_bacteria 2643221554 2643788594 368
727 iso_pu_bacteria 2643221638 2644213379 368
728 3300046460 Ga0495638_0031063 Ga0495638_0031063_880_2076 369
729 3300047320 Ga0495672_0000060 Ga0495672_0000060_29567_30751 369
730 3300002773 JGI25152J39213_1000113 JGI25152J39213_100011331 371
731 3300002774 JGI25150J39212_1000548 JGI25150J39212_10005485 371
732 3300002774 JGI25150J39212_1000864 JGI25150J39212_10008642 371
733 3300002987 JGI25159J45721_1002871 JGI25159J45721_10028713 371
734 3300003374 JGI25161J50226_1000555 JGI25161J50226_10005557 371
735 3300003374 JGI25161J50226_1000906 JGI25161J50226_10009067 371
736 3300003771 Ga0055526_1002983 Ga0055526_10029836 371
737 3300003773 Ga0055537_1001054 Ga0055537_10010546 371
738 3300003775 Ga0055524_1002327 Ga0055524_10023279 371
739 3300003775 Ga0055524_1002530 Ga0055524_10025304 371
740 3300003784 Ga0055534_1003065 Ga0055534_10030653 371
741 3300003790 Ga0055528_1010403 Ga0055528_10104033 371
742 3300003791 Ga0055530_10003244 Ga0055530_100032444 371
743 3300003794 Ga0055531_10001264 Ga0055531_100012642 371
744 3300004625 Ga0055543_1000334 Ga0055543_100033416 371
745 3300005262 Ga0065165_1001090 Ga0065165_100109016 371
746 3300025208 Ga0209436_100782 Ga0209436_10078210 371
747 3300025208 Ga0209436_101271 Ga0209436_1012715 371
748 3300025245 Ga0207425_1000006 Ga0207425_1000006140 371
749 3300025245 Ga0207425_1000136 Ga0207425_100013635 371
750 3300025245 Ga0207425_1000533 Ga0207425_10005334 371
751 3300025258 Ga0209129_1000090 Ga0209129_1000090140 371
752 3300025263 Ga0209565_1000382 Ga0209565_100038221 371
753 3300025263 Ga0209565_1000431 Ga0209565_100043115 371
754 3300025263 Ga0209565_1003896 Ga0209565_10038962 371
755 3300025273 Ga0209673_1018787 Ga0209673_10187873 371
756 3300025284 Ga0209130_1000809 Ga0209130_100080911 371
757 3300025284 Ga0209130_1000987 Ga0209130_100098710 371
758 3300025284 Ga0209130_1001171 Ga0209130_10011712 371
759 3300025291 Ga0209675_1001081 Ga0209675_10010814 371
760 3300025291 Ga0209675_1003168 Ga0209675_10031683 371
761 3300025295 Ga0209564_1000639 Ga0209564_100063914 371
762 3300025295 Ga0209564_1000888 Ga0209564_100088823 371
763 3300025297 Ga0209758_1000047 Ga0209758_1000047200 371
764 3300025298 Ga0209050_1000469 Ga0209050_100046942 371
765 3300025299 Ga0209256_1000863 Ga0209256_100086333 371
766 3300025299 Ga0209256_1001470 Ga0209256_100147011 371
767 3300025299 Ga0209256_1002052 Ga0209256_10020522 371
768 3300025302 Ga0207426_1003550 Ga0207426_10035504 371
769 3300025304 Ga0209257_1000010 Ga0209257_1000010687 371
770 3300031548 Ga0307408_100001016 Ga0307408_1000010166 371
771 3300031548 Ga0307408_100003907 Ga0307408_10000390710 371
772 3300047443 Ga0495687_005231 Ga0495687_005231_4097_5239 371
773 iso_pu_bacteria 2643221603 2644027905 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13484

Fer4_16

4Fe-4S double cluster binding domain

265

329

0.99

PF08331

QueG_DUF1730

Epoxyqueuosine reductase QueG, DUF1730

136

213

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t8y-assembly1.cif.gz_A structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.8976 20 370
5t8y-assembly1.cif.gz_A structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.8189 20 370
5d0b-assembly2.cif.gz_B crystal structure of epoxyqueuosine reductase with a trna-tyr epoxyqueuosine-modified trna stem loop 0.7991 20 370
5t8y-assembly2.cif.gz_B structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.7933 20 370
4k92-assembly2.cif.gz_B a cryptic tog domain with a distinct architecture underlies clasp-dependent bipolar spindle formation 0.7784 320 370
ID Description Score Start End Superfamily
af_K7L292_1_124_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8842 320 370 1.25.10.10
af_P0CL83_5_173_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8656 321 370 1.25.10.10
af_Q54CL0_46_602_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8521 295 370 1.25.10.10
af_Q8I701_33_189_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8294 295 370 1.25.10.10
af_A0A1D6H7Y0_14_292_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8165 321 370 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A5F0LUD1-F1-model_v4 Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) 0.9851 18 371 GO:0005737
GO:0006400
GO:0008616
GO:0031419
GO:0046872
GO:0051539
GO:0052693
AF-A0A223PEC3-F1-model_v4 Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) 0.9846 18 371 GO:0005737
GO:0006400
GO:0008616
GO:0031419
GO:0046872
GO:0051539
GO:0052693
AF-A0A515DHD9-F1-model_v4 Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) 0.9825 20 369 GO:0005737
GO:0006400
GO:0008616
GO:0031419
GO:0046872
GO:0051539
GO:0052693
AF-A0A0U3DAP3-F1-model_v4 Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) 0.9807 20 371 GO:0005737
GO:0006400
GO:0008616
GO:0031419
GO:0046872
GO:0051539
GO:0052693
AF-A0A377RRE3-F1-model_v4 Epoxyqueuosine reductase (EC 1.1.-.-) 0.9798 172 370 GO:0008033
GO:0008616
GO:0046872
GO:0051539
GO:0052693

Feature Viewer

pLDDT pTM Quality
92.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map