F480172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 773 | 356 | 762 | 366 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10014347|Ga0265327_100143471 |
| Length | 427 |
| Sequence | MKFNQGIGGAFHRPLVAQCPQPAAHQGRLAGTEVAFERDDGISGRAGPDLSRKQSTERQRGGLVGKVQGQGMMVRMHDRDWAALAAQIKDWGRALGFDAVGIAGIDLAAAEAGLDAWLAAGCHGEMDYMARHGTKRARPAELVPGTTSVIVARLNYLPDRSEPARPELGPPAAISRYAQGRDYHKLLRSRLQKLAERIAAEVGPYGHRVFTDSAPVMEVALAAQAGLGWRGKHTLLLSRDAGSWFFLGEIFTDLPLPADPPTAEHCGTCRTCIDACPTAAIVAPYRVDARRCISYLTIELKGSIPLELRPLIGNRVYGCDDCQLYCPWNRHAPRTREEDFAVRHGLDQATLIELFAWSPAEFEAKLAGSAIRRIGFERWLRNLAVGLGNAPTTAEVVTALAAKCDHPAALVREHVAWALARHGITPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 3 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 4 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 5 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 8 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 9 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 10 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 217 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 221 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 356 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.08 |
| Nodule | 0.26 |
| Rhizoplane | 2.46 |
| Rhizosphere | 88.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000113 | 3300002773 | Bacteria | 56427 |
| 2 | JGI25150J39212_1000548 | 3300002774 | Bacteria | 15195 |
| 3 | JGI25150J39212_1000864 | 3300002774 | Bacteria | 10074 |
| 4 | JGI25159J45721_1002871 | 3300002987 | Bacteria | 6314 |
| 5 | rootL2_10004459 | 3300003322 | Bacteria | 10209 |
| 6 | JGI25161J50226_1000555 | 3300003374 | Bacteria | 15898 |
| 7 | JGI25161J50226_1000906 | 3300003374 | Bacteria | 10674 |
| 8 | Ga0055526_1002983 | 3300003771 | Bacteria | 11083 |
| 9 | Ga0055537_1001054 | 3300003773 | Bacteria | 12373 |
| 10 | Ga0055524_1000029 | 3300003775 | Bacteria | 201332 |
| 11 | Ga0055524_1002327 | 3300003775 | Bacteria | 9887 |
| 12 | Ga0055524_1002530 | 3300003775 | Bacteria | 9361 |
| 13 | Ga0055534_1003065 | 3300003784 | Bacteria | 5456 |
| 14 | Ga0055528_1010403 | 3300003790 | Bacteria | 3784 |
| 15 | Ga0055530_10003244 | 3300003791 | Bacteria | 9487 |
| 16 | Ga0055531_10001264 | 3300003794 | Bacteria | 19144 |
| 17 | Ga0055543_1000334 | 3300004625 | Bacteria | 32185 |
| 18 | Ga0065165_1001090 | 3300005262 | Bacteria | 32306 |
| 19 | Ga0070676_10000107 | 3300005328 | Bacteria | 30114 |
| 20 | Ga0070676_10003461 | 3300005328 | Bacteria | 8228 |
| 21 | Ga0070676_10013290 | 3300005328 | Bacteria | 4510 |
| 22 | Ga0070670_100152800 | 3300005331 | Bacteria | 1998 |
| 23 | Ga0068869_100010636 | 3300005334 | Bacteria | 6007 |
| 24 | Ga0068869_100012816 | 3300005334 | Bacteria | 5548 |
| 25 | Ga0070666_10003198 | 3300005335 | Bacteria | 9959 |
| 26 | Ga0070666_10003557 | 3300005335 | Bacteria | 9445 |
| 27 | Ga0070666_10077392 | 3300005335 | Bacteria | 2270 |
| 28 | Ga0070680_100124342 | 3300005336 | Bacteria | 2155 |
| 29 | Ga0070680_100207513 | 3300005336 | Bacteria | 1652 |
| 30 | Ga0068868_100008667 | 3300005338 | Bacteria | 7282 |
| 31 | Ga0068868_100012033 | 3300005338 | Bacteria | 6316 |
| 32 | Ga0070689_100000324 | 3300005340 | Bacteria | 27871 |
| 33 | Ga0070661_100000621 | 3300005344 | Bacteria | 26402 |
| 34 | Ga0070661_100003328 | 3300005344 | Bacteria | 11098 |
| 35 | Ga0070661_100023740 | 3300005344 | Bacteria | 4398 |
| 36 | Ga0070661_100071191 | 3300005344 | Bacteria | 2559 |
| 37 | Ga0070692_10041255 | 3300005345 | Bacteria | 2364 |
| 38 | Ga0070668_100001276 | 3300005347 | Bacteria | 17996 |
| 39 | Ga0070668_100027814 | 3300005347 | Bacteria | 4292 |
| 40 | Ga0070668_100050868 | 3300005347 | Bacteria | 3191 |
| 41 | Ga0070669_100002313 | 3300005353 | Bacteria | 13790 |
| 42 | Ga0070675_100002082 | 3300005354 | Bacteria | 14809 |
| 43 | Ga0070675_100090488 | 3300005354 | Bacteria | 2563 |
| 44 | Ga0070675_100296208 | 3300005354 | Bacteria | 1424 |
| 45 | Ga0070671_100004990 | 3300005355 | Bacteria | 10575 |
| 46 | Ga0070671_100010840 | 3300005355 | Bacteria | 7313 |
| 47 | Ga0070671_100027394 | 3300005355 | Bacteria | 4691 |
| 48 | Ga0070674_100181481 | 3300005356 | Bacteria | 1612 |
| 49 | Ga0070673_100000602 | 3300005364 | Bacteria | 19619 |
| 50 | Ga0070673_100008381 | 3300005364 | Bacteria | 6871 |
| 51 | Ga0070673_100282195 | 3300005364 | Bacteria | 1457 |
| 52 | Ga0070673_100337348 | 3300005364 | Bacteria | 1335 |
| 53 | Ga0070688_100000276 | 3300005365 | Bacteria | 26672 |
| 54 | Ga0070659_100035259 | 3300005366 | Bacteria | 3895 |
| 55 | Ga0070659_100061803 | 3300005366 | Bacteria | 2960 |
| 56 | Ga0070667_100003566 | 3300005367 | Bacteria | 13255 |
| 57 | Ga0070667_100005842 | 3300005367 | Bacteria | 10264 |
| 58 | Ga0070667_100027843 | 3300005367 | Bacteria | 4703 |
| 59 | Ga0070667_100032956 | 3300005367 | Bacteria | 4324 |
| 60 | Ga0070667_100165442 | 3300005367 | Bacteria | 1950 |
| 61 | Ga0070667_100412363 | 3300005367 | Bacteria | 1231 |
| 62 | Ga0070714_100012621 | 3300005435 | Bacteria | 6748 |
| 63 | Ga0070714_100143121 | 3300005435 | Bacteria | 2148 |
| 64 | Ga0070713_100021966 | 3300005436 | Bacteria | 4922 |
| 65 | Ga0070713_100024627 | 3300005436 | Bacteria | 4691 |
| 66 | Ga0070710_10021867 | 3300005437 | Bacteria | 3338 |
| 67 | Ga0070678_100001759 | 3300005456 | Bacteria | 11666 |
| 68 | Ga0070678_100002666 | 3300005456 | Bacteria | 9833 |
| 69 | Ga0070678_100002838 | 3300005456 | Bacteria | 9583 |
| 70 | Ga0070662_100014149 | 3300005457 | Bacteria | 5324 |
| 71 | Ga0070662_100100624 | 3300005457 | Bacteria | 2187 |
| 72 | Ga0070681_10018253 | 3300005458 | Bacteria | 7011 |
| 73 | Ga0068867_100002278 | 3300005459 | Bacteria | 13498 |
| 74 | Ga0068867_100044294 | 3300005459 | Bacteria | 3260 |
| 75 | Ga0068867_100044424 | 3300005459 | Bacteria | 3255 |
| 76 | Ga0070685_10000522 | 3300005466 | Bacteria | 21790 |
| 77 | Ga0070706_100143519 | 3300005467 | Bacteria | 2229 |
| 78 | Ga0070706_100226532 | 3300005467 | Bacteria | 1745 |
| 79 | Ga0070707_100043109 | 3300005468 | Bacteria | 4319 |
| 80 | Ga0070707_100100381 | 3300005468 | Bacteria | 2804 |
| 81 | Ga0070698_100162997 | 3300005471 | Bacteria | 2173 |
| 82 | Ga0070679_100023077 | 3300005530 | Bacteria | 6087 |
| 83 | Ga0070679_100070385 | 3300005530 | Bacteria | 3490 |
| 84 | Ga0070684_100020484 | 3300005535 | Bacteria | 5488 |
| 85 | Ga0070684_100344842 | 3300005535 | Bacteria | 1369 |
| 86 | Ga0068853_100037973 | 3300005539 | Bacteria | 4101 |
| 87 | Ga0068853_100101207 | 3300005539 | Bacteria | 2548 |
| 88 | Ga0070672_100002742 | 3300005543 | Bacteria | 11279 |
| 89 | Ga0070672_100005080 | 3300005543 | Bacteria | 8683 |
| 90 | Ga0070672_100156469 | 3300005543 | Bacteria | 1888 |
| 91 | Ga0070696_100055544 | 3300005546 | Bacteria | 2761 |
| 92 | Ga0070693_100001181 | 3300005547 | Bacteria | 11742 |
| 93 | Ga0070665_100004484 | 3300005548 | Bacteria | 14665 |
| 94 | Ga0070665_100006836 | 3300005548 | Bacteria | 11601 |
| 95 | Ga0070665_100007950 | 3300005548 | Bacteria | 10751 |
| 96 | Ga0070665_100090348 | 3300005548 | Bacteria | 3068 |
| 97 | Ga0070704_100080364 | 3300005549 | Bacteria | 2397 |
| 98 | Ga0068855_100013893 | 3300005563 | Bacteria | 9711 |
| 99 | Ga0068855_100137369 | 3300005563 | Bacteria | 2788 |
| 100 | Ga0070664_100028009 | 3300005564 | Bacteria | 4685 |
| 101 | Ga0070664_100029736 | 3300005564 | Bacteria | 4556 |
| 102 | Ga0070664_100069702 | 3300005564 | Bacteria | 3009 |
| 103 | Ga0070664_100100081 | 3300005564 | Bacteria | 2520 |
| 104 | Ga0068857_100001177 | 3300005577 | Bacteria | 20436 |
| 105 | Ga0068854_100017889 | 3300005578 | Bacteria | 4751 |
| 106 | Ga0068854_100021411 | 3300005578 | Bacteria | 4387 |
| 107 | Ga0068856_100003663 | 3300005614 | Bacteria | 15416 |
| 108 | Ga0068856_100007456 | 3300005614 | Bacteria | 10676 |
| 109 | Ga0068856_100214436 | 3300005614 | Bacteria | 1940 |
| 110 | Ga0068852_100013259 | 3300005616 | Bacteria | 6302 |
| 111 | Ga0068859_100003388 | 3300005617 | Bacteria | 16219 |
| 112 | Ga0068859_100010910 | 3300005617 | Bacteria | 9146 |
| 113 | Ga0068859_100048271 | 3300005617 | Bacteria | 4276 |
| 114 | Ga0068859_100251527 | 3300005617 | Bacteria | 1858 |
| 115 | Ga0068859_100396157 | 3300005617 | Bacteria | 1476 |
| 116 | Ga0068866_10003152 | 3300005718 | Bacteria | 6791 |
| 117 | Ga0068866_10092601 | 3300005718 | Bacteria | 1649 |
| 118 | Ga0068861_100137085 | 3300005719 | Bacteria | 1992 |
| 119 | Ga0068870_10014204 | 3300005840 | Bacteria | 3758 |
| 120 | Ga0068863_100003151 | 3300005841 | Bacteria | 16283 |
| 121 | Ga0068863_100004647 | 3300005841 | Bacteria | 13535 |
| 122 | Ga0068863_100014308 | 3300005841 | Bacteria | 7643 |
| 123 | Ga0068863_100063693 | 3300005841 | Bacteria | 3487 |
| 124 | Ga0068863_100080390 | 3300005841 | Bacteria | 3087 |
| 125 | Ga0068863_100142057 | 3300005841 | Bacteria | 2295 |
| 126 | Ga0068863_100192639 | 3300005841 | Bacteria | 1959 |
| 127 | Ga0068858_100008645 | 3300005842 | Bacteria | 9778 |
| 128 | Ga0068858_100341337 | 3300005842 | Bacteria | 1433 |
| 129 | Ga0068860_100001042 | 3300005843 | Bacteria | 30514 |
| 130 | Ga0068860_100011703 | 3300005843 | Bacteria | 8648 |
| 131 | Ga0068860_100048910 | 3300005843 | Bacteria | 4029 |
| 132 | Ga0068860_100087016 | 3300005843 | Bacteria | 2974 |
| 133 | Ga0081455_10053216 | 3300005937 | Bacteria | 3459 |
| 134 | Ga0081539_10019043 | 3300005985 | Bacteria | 4722 |
| 135 | Ga0070715_10002475 | 3300006163 | Bacteria | 5678 |
| 136 | Ga0070716_100018632 | 3300006173 | Bacteria | 3619 |
| 137 | Ga0070716_100021395 | 3300006173 | Bacteria | 3408 |
| 138 | Ga0070712_100001985 | 3300006175 | Bacteria | 12527 |
| 139 | Ga0097621_100004146 | 3300006237 | Bacteria | 10054 |
| 140 | Ga0097621_100023190 | 3300006237 | Bacteria | 4828 |
| 141 | Ga0068871_100008300 | 3300006358 | Bacteria | 7465 |
| 142 | Ga0068871_100008690 | 3300006358 | Bacteria | 7307 |
| 143 | Ga0068871_100060324 | 3300006358 | Bacteria | 3094 |
| 144 | Ga0075433_10012647 | 3300006852 | Bacteria | 6827 |
| 145 | Ga0075434_100029350 | 3300006871 | Bacteria | 5409 |
| 146 | Ga0075434_100189521 | 3300006871 | Bacteria | 2077 |
| 147 | Ga0068865_100005451 | 3300006881 | Bacteria | 7720 |
| 148 | Ga0068865_100193812 | 3300006881 | Bacteria | 1573 |
| 149 | Ga0097620_100003388 | 3300006931 | Bacteria | 16219 |
| 150 | Ga0097620_100010910 | 3300006931 | Bacteria | 9146 |
| 151 | Ga0097620_100048271 | 3300006931 | Bacteria | 4276 |
| 152 | Ga0097620_100251506 | 3300006931 | Bacteria | 1858 |
| 153 | Ga0097620_100396163 | 3300006931 | Bacteria | 1476 |
| 154 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 155 | Ga0075435_100004089 | 3300007076 | Bacteria | 9989 |
| 156 | Ga0105240_10098901 | 3300009093 | Bacteria | 3552 |
| 157 | Ga0111539_10182477 | 3300009094 | Bacteria | 2451 |
| 158 | Ga0105245_10025250 | 3300009098 | Bacteria | 5224 |
| 159 | Ga0105245_10033683 | 3300009098 | Bacteria | 4540 |
| 160 | Ga0105245_10378575 | 3300009098 | Bacteria | 1409 |
| 161 | Ga0105247_10053300 | 3300009101 | Bacteria | 2495 |
| 162 | Ga0105243_10051158 | 3300009148 | Bacteria | 3266 |
| 163 | Ga0105241_10062893 | 3300009174 | Bacteria | 2862 |
| 164 | Ga0105241_10208763 | 3300009174 | Bacteria | 1635 |
| 165 | Ga0105242_10025334 | 3300009176 | Bacteria | 4694 |
| 166 | Ga0105242_10185494 | 3300009176 | Bacteria | 1838 |
| 167 | Ga0105242_10326519 | 3300009176 | Bacteria | 1409 |
| 168 | Ga0105248_10002431 | 3300009177 | Bacteria | 20666 |
| 169 | Ga0105248_10057770 | 3300009177 | Bacteria | 4356 |
| 170 | Ga0105248_10063113 | 3300009177 | Bacteria | 4158 |
| 171 | Ga0105248_10368971 | 3300009177 | Bacteria | 1616 |
| 172 | Ga0105237_10084853 | 3300009545 | Bacteria | 3157 |
| 173 | Ga0105238_10002149 | 3300009551 | Bacteria | 19936 |
| 174 | Ga0105238_10329535 | 3300009551 | Bacteria | 1513 |
| 175 | Ga0105239_10373046 | 3300010375 | Bacteria | 1613 |
| 176 | Ga0105246_10181677 | 3300011119 | Bacteria | 1620 |
| 177 | Ga0157373_10093554 | 3300013100 | Bacteria | 2117 |
| 178 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 179 | Ga0157370_10007756 | 3300013104 | Bacteria | 11632 |
| 180 | Ga0157370_10013200 | 3300013104 | Bacteria | 8520 |
| 181 | Ga0157370_10017646 | 3300013104 | Bacteria | 7196 |
| 182 | Ga0157369_10052212 | 3300013105 | Bacteria | 4424 |
| 183 | Ga0157374_10007182 | 3300013296 | Bacteria | 9487 |
| 184 | Ga0157374_10032379 | 3300013296 | Bacteria | 4760 |
| 185 | Ga0157378_10037889 | 3300013297 | Bacteria | 4273 |
| 186 | Ga0157378_10062677 | 3300013297 | Bacteria | 3320 |
| 187 | Ga0157378_10063396 | 3300013297 | Bacteria | 3302 |
| 188 | Ga0163162_10001893 | 3300013306 | Bacteria | 19713 |
| 189 | Ga0163162_10013715 | 3300013306 | Bacteria | 7916 |
| 190 | Ga0163162_10048939 | 3300013306 | Bacteria | 4236 |
| 191 | Ga0157372_10007100 | 3300013307 | Bacteria | 11937 |
| 192 | Ga0157372_10018755 | 3300013307 | Bacteria | 7444 |
| 193 | Ga0157375_10000680 | 3300013308 | Bacteria | 30126 |
| 194 | Ga0157375_10007795 | 3300013308 | Bacteria | 9368 |
| 195 | Ga0157375_10016875 | 3300013308 | Bacteria | 6574 |
| 196 | Ga0157375_10062019 | 3300013308 | Bacteria | 3714 |
| 197 | Ga0157375_10203656 | 3300013308 | Bacteria | 2135 |
| 198 | Ga0157375_10298001 | 3300013308 | Bacteria | 1776 |
| 199 | Ga0157375_10679246 | 3300013308 | Bacteria | 1184 |
| 200 | Ga0163163_10001966 | 3300014325 | Bacteria | 17372 |
| 201 | Ga0163163_10079290 | 3300014325 | Bacteria | 3282 |
| 202 | Ga0163163_10131313 | 3300014325 | Bacteria | 2545 |
| 203 | Ga0163163_10357302 | 3300014325 | Bacteria | 1517 |
| 204 | Ga0157377_10001594 | 3300014745 | Bacteria | 9864 |
| 205 | Ga0157379_10001435 | 3300014968 | Bacteria | 19567 |
| 206 | Ga0157379_10040584 | 3300014968 | Bacteria | 4154 |
| 207 | Ga0157379_10062427 | 3300014968 | Bacteria | 3332 |
| 208 | Ga0157379_10125083 | 3300014968 | Bacteria | 2314 |
| 209 | Ga0157376_10005137 | 3300014969 | Bacteria | 9126 |
| 210 | Ga0157376_10010909 | 3300014969 | Bacteria | 6673 |
| 211 | Ga0157376_10020601 | 3300014969 | Bacteria | 5106 |
| 212 | Ga0157376_10024255 | 3300014969 | Bacteria | 4758 |
| 213 | Ga0163161_10086346 | 3300017792 | Bacteria | 2316 |
| 214 | Ga0213872_10001092 | 3300021361 | Bacteria | 18625 |
| 215 | Ga0213872_10001185 | 3300021361 | Bacteria | 17711 |
| 216 | Ga0213872_10003823 | 3300021361 | Bacteria | 8202 |
| 217 | Ga0209436_100782 | 3300025208 | Bacteria | 13164 |
| 218 | Ga0209436_101271 | 3300025208 | Bacteria | 9049 |
| 219 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 220 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 221 | Ga0207425_1000136 | 3300025245 | Bacteria | 65594 |
| 222 | Ga0207425_1000533 | 3300025245 | Bacteria | 23036 |
| 223 | Ga0209677_104532 | 3300025253 | Bacteria | 3970 |
| 224 | Ga0209148_1000310 | 3300025254 | Bacteria | 69517 |
| 225 | Ga0209129_1000090 | 3300025258 | Bacteria | 175755 |
| 226 | Ga0209565_1000382 | 3300025263 | Bacteria | 37853 |
| 227 | Ga0209565_1000431 | 3300025263 | Bacteria | 33753 |
| 228 | Ga0209565_1003896 | 3300025263 | Bacteria | 4691 |
| 229 | Ga0209565_1005709 | 3300025263 | Bacteria | 3586 |
| 230 | Ga0209673_1018787 | 3300025273 | Bacteria | 2502 |
| 231 | Ga0209130_1000809 | 3300025284 | Bacteria | 26504 |
| 232 | Ga0209130_1000987 | 3300025284 | Bacteria | 22203 |
| 233 | Ga0209130_1001171 | 3300025284 | Bacteria | 18835 |
| 234 | Ga0209675_1001081 | 3300025291 | Bacteria | 16789 |
| 235 | Ga0209675_1003168 | 3300025291 | Bacteria | 7989 |
| 236 | Ga0209564_1000639 | 3300025295 | Bacteria | 53129 |
| 237 | Ga0209564_1000888 | 3300025295 | Bacteria | 39497 |
| 238 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 239 | Ga0209050_1000469 | 3300025298 | Bacteria | 71511 |
| 240 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 241 | Ga0209256_1000863 | 3300025299 | Bacteria | 37690 |
| 242 | Ga0209256_1001470 | 3300025299 | Bacteria | 24150 |
| 243 | Ga0209256_1002052 | 3300025299 | Bacteria | 17852 |
| 244 | Ga0207426_1003550 | 3300025302 | Bacteria | 8317 |
| 245 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 246 | Ga0207697_10041735 | 3300025315 | Bacteria | 1884 |
| 247 | Ga0207656_10083419 | 3300025321 | Bacteria | 1440 |
| 248 | Ga0207682_10001976 | 3300025893 | Bacteria | 9293 |
| 249 | Ga0207692_10083892 | 3300025898 | Bacteria | 1711 |
| 250 | Ga0207710_10009425 | 3300025900 | Bacteria | 4109 |
| 251 | Ga0207680_10011911 | 3300025903 | Bacteria | 4414 |
| 252 | Ga0207680_10012261 | 3300025903 | Bacteria | 4361 |
| 253 | Ga0207680_10037482 | 3300025903 | Bacteria | 2799 |
| 254 | Ga0207699_10099341 | 3300025906 | Bacteria | 1843 |
| 255 | Ga0207645_10003275 | 3300025907 | Bacteria | 12356 |
| 256 | Ga0207645_10008319 | 3300025907 | Bacteria | 7246 |
| 257 | Ga0207645_10044740 | 3300025907 | Bacteria | 2832 |
| 258 | Ga0207643_10014363 | 3300025908 | Bacteria | 4299 |
| 259 | Ga0207684_10158545 | 3300025910 | Bacteria | 1948 |
| 260 | Ga0207684_10218732 | 3300025910 | Bacteria | 1644 |
| 261 | Ga0207707_10005481 | 3300025912 | Bacteria | 11094 |
| 262 | Ga0207707_10066753 | 3300025912 | Bacteria | 3133 |
| 263 | Ga0207707_10247706 | 3300025912 | Bacteria | 1548 |
| 264 | Ga0207695_10051661 | 3300025913 | Bacteria | 4313 |
| 265 | Ga0207693_10000069 | 3300025915 | Bacteria | 90103 |
| 266 | Ga0207693_10010112 | 3300025915 | Bacteria | 7664 |
| 267 | Ga0207663_10016917 | 3300025916 | Bacteria | 4054 |
| 268 | Ga0207657_10002525 | 3300025919 | Bacteria | 19797 |
| 269 | Ga0207657_10005841 | 3300025919 | Bacteria | 12824 |
| 270 | Ga0207649_10001721 | 3300025920 | Bacteria | 12585 |
| 271 | Ga0207649_10016228 | 3300025920 | Bacteria | 4195 |
| 272 | Ga0207652_10031116 | 3300025921 | Bacteria | 4479 |
| 273 | Ga0207681_10011715 | 3300025923 | Bacteria | 5391 |
| 274 | Ga0207694_10010599 | 3300025924 | Bacteria | 6959 |
| 275 | Ga0207650_10103022 | 3300025925 | Bacteria | 2200 |
| 276 | Ga0207659_10006585 | 3300025926 | Bacteria | 7131 |
| 277 | Ga0207659_10072840 | 3300025926 | Bacteria | 2513 |
| 278 | Ga0207687_10000293 | 3300025927 | Bacteria | 34325 |
| 279 | Ga0207687_10039735 | 3300025927 | Bacteria | 3222 |
| 280 | Ga0207700_10009271 | 3300025928 | Bacteria | 6139 |
| 281 | Ga0207664_10003067 | 3300025929 | Bacteria | 11098 |
| 282 | Ga0207664_10014597 | 3300025929 | Bacteria | 5679 |
| 283 | Ga0207644_10005822 | 3300025931 | Bacteria | 8027 |
| 284 | Ga0207644_10009304 | 3300025931 | Bacteria | 6449 |
| 285 | Ga0207644_10105130 | 3300025931 | Bacteria | 2126 |
| 286 | Ga0207644_10180688 | 3300025931 | Bacteria | 1653 |
| 287 | Ga0207690_10023825 | 3300025932 | Bacteria | 3826 |
| 288 | Ga0207690_10046036 | 3300025932 | Bacteria | 2887 |
| 289 | Ga0207706_10018899 | 3300025933 | Bacteria | 6198 |
| 290 | Ga0207706_10021848 | 3300025933 | Bacteria | 5744 |
| 291 | Ga0207706_10123685 | 3300025933 | Bacteria | 2275 |
| 292 | Ga0207686_10000118 | 3300025934 | Bacteria | 64531 |
| 293 | Ga0207709_10023056 | 3300025935 | Bacteria | 3539 |
| 294 | Ga0207670_10127164 | 3300025936 | Bacteria | 1861 |
| 295 | Ga0207669_10051692 | 3300025937 | Bacteria | 2463 |
| 296 | Ga0207704_10002824 | 3300025938 | Bacteria | 7835 |
| 297 | Ga0207665_10007491 | 3300025939 | Bacteria | 7212 |
| 298 | Ga0207665_10250328 | 3300025939 | Bacteria | 1309 |
| 299 | Ga0207691_10000629 | 3300025940 | Bacteria | 34886 |
| 300 | Ga0207691_10000958 | 3300025940 | Bacteria | 28614 |
| 301 | Ga0207691_10004119 | 3300025940 | Bacteria | 14122 |
| 302 | Ga0207691_10060041 | 3300025940 | Bacteria | 3456 |
| 303 | Ga0207711_10000515 | 3300025941 | Bacteria | 39690 |
| 304 | Ga0207711_10023802 | 3300025941 | Bacteria | 5127 |
| 305 | Ga0207711_10028362 | 3300025941 | Bacteria | 4710 |
| 306 | Ga0207689_10000498 | 3300025942 | Bacteria | 37073 |
| 307 | Ga0207689_10006485 | 3300025942 | Bacteria | 10340 |
| 308 | Ga0207689_10012237 | 3300025942 | Bacteria | 7340 |
| 309 | Ga0207689_10012711 | 3300025942 | Bacteria | 7192 |
| 310 | Ga0207689_10023713 | 3300025942 | Bacteria | 5147 |
| 311 | Ga0207661_10023513 | 3300025944 | Bacteria | 4658 |
| 312 | Ga0207679_10057962 | 3300025945 | Bacteria | 2867 |
| 313 | Ga0207679_10060966 | 3300025945 | Bacteria | 2806 |
| 314 | Ga0207679_10169594 | 3300025945 | Bacteria | 1795 |
| 315 | Ga0207667_10015818 | 3300025949 | Bacteria | 8550 |
| 316 | Ga0207651_10000266 | 3300025960 | Bacteria | 22298 |
| 317 | Ga0207651_10115177 | 3300025960 | Bacteria | 2027 |
| 318 | Ga0207668_10010545 | 3300025972 | Bacteria | 5587 |
| 319 | Ga0207668_10057547 | 3300025972 | Bacteria | 2712 |
| 320 | Ga0207668_10079086 | 3300025972 | Bacteria | 2377 |
| 321 | Ga0207668_10214681 | 3300025972 | Bacteria | 1541 |
| 322 | Ga0207640_10020026 | 3300025981 | Bacteria | 3965 |
| 323 | Ga0207658_10004266 | 3300025986 | Bacteria | 9958 |
| 324 | Ga0207658_10037542 | 3300025986 | Bacteria | 3482 |
| 325 | Ga0207658_10161284 | 3300025986 | Bacteria | 1838 |
| 326 | Ga0207658_10212515 | 3300025986 | Bacteria | 1622 |
| 327 | Ga0207677_10040107 | 3300026023 | Bacteria | 3084 |
| 328 | Ga0207703_10003276 | 3300026035 | Bacteria | 13582 |
| 329 | Ga0207703_10040050 | 3300026035 | Bacteria | 3748 |
| 330 | Ga0207703_10074130 | 3300026035 | Bacteria | 2817 |
| 331 | Ga0207703_10077334 | 3300026035 | Bacteria | 2762 |
| 332 | Ga0207639_10077121 | 3300026041 | Bacteria | 2626 |
| 333 | Ga0207639_10091416 | 3300026041 | Bacteria | 2437 |
| 334 | Ga0207678_10059780 | 3300026067 | Bacteria | 3279 |
| 335 | Ga0207702_10016803 | 3300026078 | Bacteria | 6057 |
| 336 | Ga0207702_10033862 | 3300026078 | Bacteria | 4269 |
| 337 | Ga0207641_10006628 | 3300026088 | Bacteria | 9721 |
| 338 | Ga0207641_10009041 | 3300026088 | Bacteria | 8231 |
| 339 | Ga0207641_10361212 | 3300026088 | Bacteria | 1386 |
| 340 | Ga0207648_10000364 | 3300026089 | Bacteria | 49697 |
| 341 | Ga0207648_10034776 | 3300026089 | Bacteria | 4441 |
| 342 | Ga0207648_10037375 | 3300026089 | Bacteria | 4277 |
| 343 | Ga0207676_10005594 | 3300026095 | Bacteria | 8892 |
| 344 | Ga0207676_10019043 | 3300026095 | Bacteria | 5001 |
| 345 | Ga0207674_10000912 | 3300026116 | Bacteria | 38502 |
| 346 | Ga0207674_10008221 | 3300026116 | Bacteria | 12092 |
| 347 | Ga0207674_10055401 | 3300026116 | Bacteria | 4031 |
| 348 | Ga0207675_100018434 | 3300026118 | Bacteria | 6508 |
| 349 | Ga0207675_100148701 | 3300026118 | Bacteria | 2228 |
| 350 | Ga0207683_10000076 | 3300026121 | Bacteria | 77762 |
| 351 | Ga0207683_10000827 | 3300026121 | Bacteria | 28309 |
| 352 | Ga0207683_10004135 | 3300026121 | Bacteria | 12553 |
| 353 | Ga0207683_10014462 | 3300026121 | Bacteria | 6719 |
| 354 | Ga0207683_10137580 | 3300026121 | Bacteria | 2199 |
| 355 | Ga0207683_10157259 | 3300026121 | Bacteria | 2053 |
| 356 | Ga0207698_10053414 | 3300026142 | Bacteria | 3101 |
| 357 | Ga0209983_1020523 | 3300027665 | Bacteria | 1377 |
| 358 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 359 | Ga0209971_1003092 | 3300027682 | Bacteria | 3974 |
| 360 | Ga0209974_10027642 | 3300027876 | Bacteria | 1877 |
| 361 | Ga0268266_10005997 | 3300028379 | Bacteria | 11215 |
| 362 | Ga0268266_10006981 | 3300028379 | Bacteria | 10268 |
| 363 | Ga0268266_10074223 | 3300028379 | Bacteria | 2953 |
| 364 | Ga0268266_10085071 | 3300028379 | Bacteria | 2763 |
| 365 | Ga0268265_10040194 | 3300028380 | Bacteria | 3453 |
| 366 | Ga0268265_10102735 | 3300028380 | Bacteria | 2313 |
| 367 | Ga0268265_10381849 | 3300028380 | Bacteria | 1296 |
| 368 | Ga0268264_10003641 | 3300028381 | Bacteria | 13257 |
| 369 | Ga0268264_10023627 | 3300028381 | Bacteria | 5013 |
| 370 | Ga0268264_10075879 | 3300028381 | Bacteria | 2859 |
| 371 | Ga0268264_10185800 | 3300028381 | Bacteria | 1891 |
| 372 | Ga0316182_1171920 | 3300030745 | Bacteria | 2500 |
| 373 | Ga0265330_10063427 | 3300031235 | Bacteria | 1606 |
| 374 | Ga0265332_10005253 | 3300031238 | Bacteria | 5988 |
| 375 | Ga0265331_10000872 | 3300031250 | Bacteria | 24581 |
| 376 | Ga0265327_10000529 | 3300031251 | Bacteria | 65835 |
| 377 | Ga0265327_10014347 | 3300031251 | Bacteria | 5190 |
| 378 | Ga0265316_10000144 | 3300031344 | Bacteria | 77758 |
| 379 | Ga0265316_10039329 | 3300031344 | Bacteria | 3799 |
| 380 | Ga0307408_100001016 | 3300031548 | Bacteria | 21585 |
| 381 | Ga0307408_100003907 | 3300031548 | Bacteria | 10153 |
| 382 | Ga0316575_10045402 | 3300031665 | Bacteria | 1745 |
| 383 | Ga0265314_10000811 | 3300031711 | Bacteria | 37090 |
| 384 | Ga0265342_10003272 | 3300031712 | Bacteria | 13427 |
| 385 | Ga0307413_10171327 | 3300031824 | Bacteria | 1537 |
| 386 | Ga0307409_100221153 | 3300031995 | Bacteria | 1710 |
| 387 | Ga0373934_0002330 | 3300035086 | Bacteria | 6986 |
| 388 | Ga0373923_0002548 | 3300035111 | Bacteria | 5633 |
| 389 | Ga0373954_0000591 | 3300035118 | Bacteria | 13766 |
| 390 | Ga0373956_0040685 | 3300035119 | Bacteria | 2062 |
| 391 | Ga0373955_0007635 | 3300035172 | Bacteria | 4981 |
| 392 | Ga0373933_0005650 | 3300035724 | Bacteria | 6811 |
| 393 | Ga0373937_0001546 | 3300036401 | Bacteria | 19330 |
| 394 | Ga0373937_0008259 | 3300036401 | Bacteria | 9038 |
| 395 | Ga0373937_0033468 | 3300036401 | Bacteria | 4667 |
| 396 | Ga0373937_0137352 | 3300036401 | Bacteria | 2286 |
| 397 | Ga0373937_0281903 | 3300036401 | Bacteria | 1569 |
| 398 | Ga0395899_0017364 | 3300037312 | Bacteria | 5482 |
| 399 | Ga0395899_0062812 | 3300037312 | Bacteria | 2734 |
| 400 | Ga0395899_0210202 | 3300037312 | Bacteria | 1352 |
| 401 | Ga0395900_0000729 | 3300037418 | Bacteria | 43752 |
| 402 | Ga0395900_0001738 | 3300037418 | Bacteria | 25108 |
| 403 | Ga0395900_0054721 | 3300037418 | Bacteria | 4109 |
| 404 | Ga0395900_0100316 | 3300037418 | Bacteria | 2974 |
| 405 | Ga0395900_0178042 | 3300037418 | Bacteria | 2162 |
| 406 | Ga0395900_0238447 | 3300037418 | Bacteria | 1825 |
| 407 | Ga0395900_0275412 | 3300037418 | Bacteria | 1676 |
| 408 | Ga0395905_0008422 | 3300037471 | Bacteria | 10170 |
| 409 | Ga0395905_0011242 | 3300037471 | Bacteria | 8654 |
| 410 | Ga0395901_0000073 | 3300038443 | Bacteria | 139769 |
| 411 | Ga0395901_0004488 | 3300038443 | Bacteria | 14071 |
| 412 | Ga0395901_0160201 | 3300038443 | Bacteria | 2363 |
| 413 | Ga0400490_16042 | 3300038726 | Bacteria | 1718 |
| 414 | Ga0400491_18994 | 3300038727 | Bacteria | 7133 |
| 415 | Ga0436361_0230232 | 3300039447 | Bacteria | 2691 |
| 416 | Ga0436361_0678432 | 3300039447 | Bacteria | 1835 |
| 417 | Ga0436361_0738173 | 3300039447 | Bacteria | 11067 |
| 418 | Ga0436361_0752198 | 3300039447 | Bacteria | 2538 |
| 419 | Ga0436361_1160248 | 3300039447 | Bacteria | 17738 |
| 420 | Ga0439449_0030812 | 3300042007 | Bacteria | 1999 |
| 421 | Ga0450911_003384 | 3300042115 | Bacteria | 2829 |
| 422 | Ga0450904_001328 | 3300042139 | Bacteria | 3603 |
| 423 | Ga0451577_0042616 | 3300042876 | Bacteria | 4070 |
| 424 | Ga0451577_0072552 | 3300042876 | Bacteria | 3071 |
| 425 | Ga0466969_0072842 | 3300044656 | Bacteria | 1649 |
| 426 | Ga0466972_0000029 | 3300044658 | Bacteria | 165236 |
| 427 | Ga0453683_0084461 | 3300044673 | Bacteria | 1989 |
| 428 | Ga0466965_0005670 | 3300044683 | Bacteria | 5634 |
| 429 | Ga0466965_0093759 | 3300044683 | Bacteria | 1529 |
| 430 | Ga0466966_0001386 | 3300044684 | Bacteria | 15586 |
| 431 | Ga0466966_0080082 | 3300044684 | Bacteria | 2035 |
| 432 | Ga0466966_0097680 | 3300044684 | Bacteria | 1819 |
| 433 | Ga0466966_0098183 | 3300044684 | Bacteria | 1813 |
| 434 | Ga0466961_0084665 | 3300044693 | Bacteria | 2005 |
| 435 | Ga0466964_0018828 | 3300044706 | Bacteria | 2651 |
| 436 | Ga0453684_0002403 | 3300044712 | Bacteria | 45636 |
| 437 | Ga0453684_0129521 | 3300044712 | Bacteria | 3030 |
| 438 | Ga0453684_0352154 | 3300044712 | Bacteria | 1660 |
| 439 | Ga0453684_0367409 | 3300044712 | Bacteria | 1618 |
| 440 | Ga0451576_0020622 | 3300045051 | Bacteria | 7173 |
| 441 | Ga0451576_0037615 | 3300045051 | Bacteria | 5126 |
| 442 | Ga0451576_0125455 | 3300045051 | Bacteria | 2675 |
| 443 | Ga0451576_0294653 | 3300045051 | Bacteria | 1696 |
| 444 | Ga0466958_0081165 | 3300045836 | Bacteria | 1995 |
| 445 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 446 | Ga0495617_000098 | 3300046452 | Bacteria | 62441 |
| 447 | Ga0495617_025237 | 3300046452 | Bacteria | 2004 |
| 448 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 449 | Ga0495627_000339 | 3300046453 | Bacteria | 44178 |
| 450 | Ga0495603_0078446 | 3300046455 | Bacteria | 1937 |
| 451 | Ga0495603_0108741 | 3300046455 | Bacteria | 1618 |
| 452 | Ga0495590_0001878 | 3300046457 | Bacteria | 8883 |
| 453 | Ga0495590_0007854 | 3300046457 | Bacteria | 4093 |
| 454 | Ga0495590_0049102 | 3300046457 | Bacteria | 1472 |
| 455 | Ga0495629_0029456 | 3300046459 | Bacteria | 3892 |
| 456 | Ga0495629_0127824 | 3300046459 | Bacteria | 1770 |
| 457 | Ga0495629_0204444 | 3300046459 | Bacteria | 1365 |
| 458 | Ga0495638_0031063 | 3300046460 | Bacteria | 3434 |
| 459 | Ga0495651_0061157 | 3300046462 | Bacteria | 2882 |
| 460 | Ga0495653_0013215 | 3300046463 | Bacteria | 6730 |
| 461 | Ga0495653_0020412 | 3300046463 | Bacteria | 5371 |
| 462 | Ga0495653_0031535 | 3300046463 | Bacteria | 4212 |
| 463 | Ga0495653_0065887 | 3300046463 | Bacteria | 2725 |
| 464 | Ga0495650_0000399 | 3300046471 | Bacteria | 72364 |
| 465 | Ga0495650_0000407 | 3300046471 | Bacteria | 70819 |
| 466 | Ga0495650_0003026 | 3300046471 | Bacteria | 12688 |
| 467 | Ga0495582_0002672 | 3300046473 | Bacteria | 9950 |
| 468 | Ga0495582_0027009 | 3300046473 | Bacteria | 3146 |
| 469 | Ga0495605_0000085 | 3300046474 | Bacteria | 121011 |
| 470 | Ga0495605_0000108 | 3300046474 | Bacteria | 104865 |
| 471 | Ga0495605_0032125 | 3300046474 | Bacteria | 2675 |
| 472 | Ga0495664_0127335 | 3300046477 | Bacteria | 1541 |
| 473 | Ga0495584_0000282 | 3300046491 | Bacteria | 35813 |
| 474 | Ga0495584_0006912 | 3300046491 | Bacteria | 5929 |
| 475 | Ga0495584_0009798 | 3300046491 | Bacteria | 4929 |
| 476 | Ga0495584_0019049 | 3300046491 | Bacteria | 3485 |
| 477 | Ga0495584_0021515 | 3300046491 | Bacteria | 3275 |
| 478 | Ga0495584_0033124 | 3300046491 | Bacteria | 2613 |
| 479 | Ga0495584_0054183 | 3300046491 | Bacteria | 2018 |
| 480 | Ga0495585_0000004 | 3300046492 | Bacteria | 348260 |
| 481 | Ga0495585_0000298 | 3300046492 | Bacteria | 49916 |
| 482 | Ga0495585_0003086 | 3300046492 | Bacteria | 11458 |
| 483 | Ga0495585_0009766 | 3300046492 | Bacteria | 5742 |
| 484 | Ga0495585_0080973 | 3300046492 | Bacteria | 1759 |
| 485 | Ga0495594_0007794 | 3300046499 | Bacteria | 5507 |
| 486 | Ga0495594_0084929 | 3300046499 | Bacteria | 1770 |
| 487 | Ga0495594_0121179 | 3300046499 | Bacteria | 1478 |
| 488 | Ga0495596_0000186 | 3300046500 | Bacteria | 43253 |
| 489 | Ga0495596_0000902 | 3300046500 | Bacteria | 17794 |
| 490 | Ga0495596_0001640 | 3300046500 | Bacteria | 12712 |
| 491 | Ga0495596_0002100 | 3300046500 | Bacteria | 10926 |
| 492 | Ga0495596_0005393 | 3300046500 | Bacteria | 6048 |
| 493 | Ga0495596_0010283 | 3300046500 | Bacteria | 4079 |
| 494 | Ga0495607_0006643 | 3300046501 | Bacteria | 8106 |
| 495 | Ga0495607_0007031 | 3300046501 | Bacteria | 7825 |
| 496 | Ga0495607_0045014 | 3300046501 | Bacteria | 2598 |
| 497 | Ga0495583_0006161 | 3300046506 | Bacteria | 7897 |
| 498 | Ga0495583_0014707 | 3300046506 | Bacteria | 4300 |
| 499 | Ga0495606_0006538 | 3300046507 | Bacteria | 10721 |
| 500 | Ga0495606_0012422 | 3300046507 | Bacteria | 6829 |
| 501 | Ga0495606_0014238 | 3300046507 | Bacteria | 6221 |
| 502 | Ga0495606_0042577 | 3300046507 | Bacteria | 3035 |
| 503 | Ga0495606_0081425 | 3300046507 | Bacteria | 2012 |
| 504 | Ga0495616_0000145 | 3300046513 | Bacteria | 62415 |
| 505 | Ga0495616_0007566 | 3300046513 | Bacteria | 6501 |
| 506 | Ga0495616_0025320 | 3300046513 | Bacteria | 3171 |
| 507 | Ga0495616_0077996 | 3300046513 | Bacteria | 1589 |
| 508 | Ga0495628_0000275 | 3300046516 | Bacteria | 46071 |
| 509 | Ga0495630_0018018 | 3300046517 | Bacteria | 5181 |
| 510 | Ga0495631_0000109 | 3300046518 | Bacteria | 54778 |
| 511 | Ga0495631_0002244 | 3300046518 | Bacteria | 11096 |
| 512 | Ga0495631_0002690 | 3300046518 | Bacteria | 9878 |
| 513 | Ga0495631_0021398 | 3300046518 | Bacteria | 3012 |
| 514 | Ga0495631_0041667 | 3300046518 | Bacteria | 2031 |
| 515 | Ga0495631_0055728 | 3300046518 | Bacteria | 1722 |
| 516 | Ga0495632_0000470 | 3300046519 | Bacteria | 38273 |
| 517 | Ga0495632_0027304 | 3300046519 | Bacteria | 2991 |
| 518 | Ga0495637_0060519 | 3300046520 | Bacteria | 1554 |
| 519 | Ga0495643_0000233 | 3300046522 | Bacteria | 84175 |
| 520 | Ga0495643_0000681 | 3300046522 | Bacteria | 39588 |
| 521 | Ga0495643_0021507 | 3300046522 | Bacteria | 3699 |
| 522 | Ga0495643_0023173 | 3300046522 | Bacteria | 3531 |
| 523 | Ga0495643_0045648 | 3300046522 | Bacteria | 2378 |
| 524 | Ga0495643_0050656 | 3300046522 | Bacteria | 2236 |
| 525 | Ga0495643_0053901 | 3300046522 | Bacteria | 2154 |
| 526 | Ga0495644_0016225 | 3300046523 | Bacteria | 2851 |
| 527 | Ga0495644_0019176 | 3300046523 | Bacteria | 2611 |
| 528 | Ga0495648_0000044 | 3300046524 | Bacteria | 175587 |
| 529 | Ga0495648_0000220 | 3300046524 | Bacteria | 65480 |
| 530 | Ga0495648_0001128 | 3300046524 | Bacteria | 27039 |
| 531 | Ga0495648_0017295 | 3300046524 | Bacteria | 5161 |
| 532 | Ga0495648_0024967 | 3300046524 | Bacteria | 4056 |
| 533 | Ga0495666_0008005 | 3300046526 | Bacteria | 5293 |
| 534 | Ga0495642_0000075 | 3300046528 | Bacteria | 58959 |
| 535 | Ga0495642_0003143 | 3300046528 | Bacteria | 6552 |
| 536 | Ga0495642_0005798 | 3300046528 | Bacteria | 4735 |
| 537 | Ga0495642_0006468 | 3300046528 | Bacteria | 4494 |
| 538 | Ga0495652_0019949 | 3300046529 | Bacteria | 5961 |
| 539 | Ga0495652_0111872 | 3300046529 | Bacteria | 2195 |
| 540 | Ga0495654_0005012 | 3300046530 | Bacteria | 7773 |
| 541 | Ga0495654_0033510 | 3300046530 | Bacteria | 2599 |
| 542 | Ga0495665_0007097 | 3300046531 | Bacteria | 6046 |
| 543 | Ga0495586_0001866 | 3300046535 | Bacteria | 11476 |
| 544 | Ga0495586_0082876 | 3300046535 | Bacteria | 1764 |
| 545 | Ga0495587_0002460 | 3300046536 | Bacteria | 12362 |
| 546 | Ga0495587_0052723 | 3300046536 | Bacteria | 2399 |
| 547 | Ga0495587_0153838 | 3300046536 | Bacteria | 1310 |
| 548 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 549 | Ga0495609_0000268 | 3300046538 | Bacteria | 48889 |
| 550 | Ga0495609_0002590 | 3300046538 | Bacteria | 11010 |
| 551 | Ga0495609_0003458 | 3300046538 | Bacteria | 9042 |
| 552 | Ga0495621_0042894 | 3300046539 | Bacteria | 1594 |
| 553 | Ga0495597_0000295 | 3300046542 | Bacteria | 44823 |
| 554 | Ga0495597_0002788 | 3300046542 | Bacteria | 10748 |
| 555 | Ga0495597_0005790 | 3300046542 | Bacteria | 6479 |
| 556 | Ga0495597_0019635 | 3300046542 | Bacteria | 3158 |
| 557 | Ga0495622_0008094 | 3300046557 | Bacteria | 4873 |
| 558 | Ga0495622_0029803 | 3300046557 | Bacteria | 2549 |
| 559 | Ga0495622_0039112 | 3300046557 | Bacteria | 2208 |
| 560 | Ga0495622_0094619 | 3300046557 | Bacteria | 1371 |
| 561 | Ga0495633_0003283 | 3300046558 | Bacteria | 10871 |
| 562 | Ga0495633_0006965 | 3300046558 | Bacteria | 6607 |
| 563 | Ga0495633_0011482 | 3300046558 | Bacteria | 4770 |
| 564 | Ga0495633_0032470 | 3300046558 | Bacteria | 2522 |
| 565 | Ga0495633_0067607 | 3300046558 | Bacteria | 1668 |
| 566 | Ga0495633_0074119 | 3300046558 | Bacteria | 1586 |
| 567 | Ga0495668_0000861 | 3300046616 | Bacteria | 34228 |
| 568 | Ga0495668_0002828 | 3300046616 | Bacteria | 13802 |
| 569 | Ga0495668_0015083 | 3300046616 | Bacteria | 4520 |
| 570 | Ga0495668_0047233 | 3300046616 | Bacteria | 2390 |
| 571 | Ga0495634_0004452 | 3300046642 | Bacteria | 10995 |
| 572 | Ga0495611_0009166 | 3300046648 | Bacteria | 4179 |
| 573 | Ga0495611_0017887 | 3300046648 | Bacteria | 3037 |
| 574 | Ga0495611_0020432 | 3300046648 | Bacteria | 2850 |
| 575 | Ga0495611_0145724 | 3300046648 | Bacteria | 1105 |
| 576 | Ga0495625_0009361 | 3300046660 | Bacteria | 8203 |
| 577 | Ga0495625_0048945 | 3300046660 | Bacteria | 3040 |
| 578 | Ga0495625_0072038 | 3300046660 | Bacteria | 2424 |
| 579 | Ga0495635_0008207 | 3300046663 | Bacteria | 7293 |
| 580 | Ga0495635_0017503 | 3300046663 | Bacteria | 5004 |
| 581 | Ga0495661_0000271 | 3300046665 | Bacteria | 59543 |
| 582 | Ga0495661_0000669 | 3300046665 | Bacteria | 34300 |
| 583 | Ga0495661_0001564 | 3300046665 | Bacteria | 18856 |
| 584 | Ga0495661_0003697 | 3300046665 | Bacteria | 11237 |
| 585 | Ga0495661_0003800 | 3300046665 | Bacteria | 11050 |
| 586 | Ga0495661_0017201 | 3300046665 | Bacteria | 4776 |
| 587 | Ga0495661_0020189 | 3300046665 | Bacteria | 4354 |
| 588 | Ga0495661_0028461 | 3300046665 | Bacteria | 3576 |
| 589 | Ga0495661_0030187 | 3300046665 | Bacteria | 3453 |
| 590 | Ga0495661_0065299 | 3300046665 | Bacteria | 2144 |
| 591 | Ga0495661_0067912 | 3300046665 | Bacteria | 2092 |
| 592 | Ga0495661_0073882 | 3300046665 | Bacteria | 1985 |
| 593 | Ga0495588_0000135 | 3300046674 | Bacteria | 117387 |
| 594 | Ga0495588_0009117 | 3300046674 | Bacteria | 4576 |
| 595 | Ga0495588_0018879 | 3300046674 | Bacteria | 3369 |
| 596 | Ga0495588_0045558 | 3300046674 | Bacteria | 2248 |
| 597 | Ga0495588_0226513 | 3300046674 | Bacteria | 986 |
| 598 | Ga0495623_0001059 | 3300046679 | Bacteria | 18646 |
| 599 | Ga0495623_0009068 | 3300046679 | Bacteria | 6453 |
| 600 | Ga0495623_0009572 | 3300046679 | Bacteria | 6294 |
| 601 | Ga0495647_0004915 | 3300046681 | Bacteria | 4373 |
| 602 | Ga0495669_0000168 | 3300046684 | Bacteria | 41171 |
| 603 | Ga0495669_0012842 | 3300046684 | Bacteria | 3566 |
| 604 | Ga0495624_0008707 | 3300046690 | Bacteria | 7065 |
| 605 | Ga0495670_0000350 | 3300046691 | Bacteria | 22012 |
| 606 | Ga0495670_0001426 | 3300046691 | Bacteria | 11739 |
| 607 | Ga0495670_0024724 | 3300046691 | Bacteria | 2969 |
| 608 | Ga0495670_0043305 | 3300046691 | Bacteria | 2246 |
| 609 | Ga0495671_0000613 | 3300046692 | Bacteria | 26136 |
| 610 | Ga0495649_0001847 | 3300046694 | Bacteria | 15526 |
| 611 | Ga0495649_0005677 | 3300046694 | Bacteria | 7874 |
| 612 | Ga0495649_0051142 | 3300046694 | Bacteria | 2241 |
| 613 | Ga0495589_0000030 | 3300046794 | Bacteria | 170254 |
| 614 | Ga0495589_0000146 | 3300046794 | Bacteria | 65628 |
| 615 | Ga0495589_0001037 | 3300046794 | Bacteria | 16738 |
| 616 | Ga0495589_0005214 | 3300046794 | Bacteria | 6875 |
| 617 | Ga0495589_0009346 | 3300046794 | Bacteria | 5098 |
| 618 | Ga0495589_0051493 | 3300046794 | Bacteria | 2036 |
| 619 | Ga0495589_0079407 | 3300046794 | Bacteria | 1596 |
| 620 | Ga0495660_0000423 | 3300046810 | Bacteria | 35820 |
| 621 | Ga0495660_0000542 | 3300046810 | Bacteria | 30925 |
| 622 | Ga0495660_0013336 | 3300046810 | Bacteria | 4763 |
| 623 | Ga0495660_0014527 | 3300046810 | Bacteria | 4554 |
| 624 | Ga0495660_0015172 | 3300046810 | Bacteria | 4453 |
| 625 | Ga0495660_0027757 | 3300046810 | Bacteria | 3200 |
| 626 | Ga0495581_0001180 | 3300047315 | Bacteria | 14330 |
| 627 | Ga0495581_0001368 | 3300047315 | Bacteria | 13499 |
| 628 | Ga0495581_0030726 | 3300047315 | Bacteria | 3111 |
| 629 | Ga0495581_0103505 | 3300047315 | Bacteria | 1654 |
| 630 | Ga0495604_0005348 | 3300047317 | Bacteria | 10177 |
| 631 | Ga0495604_0060979 | 3300047317 | Bacteria | 2886 |
| 632 | Ga0495636_0005805 | 3300047318 | Bacteria | 4840 |
| 633 | Ga0495636_0019175 | 3300047318 | Bacteria | 2748 |
| 634 | Ga0495674_0171279 | 3300047319 | Bacteria | 1812 |
| 635 | Ga0495672_0000060 | 3300047320 | Bacteria | 214547 |
| 636 | Ga0495672_0000206 | 3300047320 | Bacteria | 84222 |
| 637 | Ga0495672_0000351 | 3300047320 | Bacteria | 59020 |
| 638 | Ga0495672_0000833 | 3300047320 | Bacteria | 32978 |
| 639 | Ga0495676_0000105 | 3300047321 | Bacteria | 63429 |
| 640 | Ga0495676_0020468 | 3300047321 | Bacteria | 5803 |
| 641 | Ga0495676_0024587 | 3300047321 | Bacteria | 5211 |
| 642 | Ga0495676_0069951 | 3300047321 | Bacteria | 2706 |
| 643 | Ga0495680_0058986 | 3300047322 | Bacteria | 2964 |
| 644 | Ga0495683_0008332 | 3300047323 | Bacteria | 5554 |
| 645 | Ga0495683_0014614 | 3300047323 | Bacteria | 4091 |
| 646 | Ga0495687_000047 | 3300047443 | Bacteria | 206452 |
| 647 | Ga0495687_000088 | 3300047443 | Bacteria | 142499 |
| 648 | Ga0495687_000166 | 3300047443 | Bacteria | 98891 |
| 649 | Ga0495687_001101 | 3300047443 | Bacteria | 26384 |
| 650 | Ga0495687_005231 | 3300047443 | Bacteria | 8361 |
| 651 | Ga0495687_027410 | 3300047443 | Bacteria | 2666 |
| 652 | Ga0495687_072804 | 3300047443 | Bacteria | 1371 |
| 653 | Ga0495675_0002560 | 3300047444 | Bacteria | 10889 |
| 654 | Ga0495675_0007503 | 3300047444 | Bacteria | 6719 |
| 655 | Ga0495675_0042685 | 3300047444 | Bacteria | 2889 |
| 656 | Ga0495677_0000044 | 3300047445 | Bacteria | 74340 |
| 657 | Ga0495677_0001661 | 3300047445 | Bacteria | 8942 |
| 658 | Ga0495677_0003879 | 3300047445 | Bacteria | 5778 |
| 659 | Ga0495677_0004496 | 3300047445 | Bacteria | 5346 |
| 660 | Ga0495677_0038320 | 3300047445 | Bacteria | 1751 |
| 661 | Ga0495681_0000404 | 3300047470 | Bacteria | 33516 |
| 662 | Ga0495681_0001516 | 3300047470 | Bacteria | 17343 |
| 663 | Ga0495681_0010365 | 3300047470 | Bacteria | 5643 |
| 664 | Ga0495681_0076773 | 3300047470 | Bacteria | 1501 |
| 665 | Ga0495681_0078515 | 3300047470 | Bacteria | 1479 |
| 666 | Ga0495681_0086115 | 3300047470 | Bacteria | 1394 |
| 667 | Ga0495684_0043973 | 3300047471 | Bacteria | 3419 |
| 668 | Ga0495686_0000334 | 3300047472 | Bacteria | 77666 |
| 669 | Ga0495686_0108404 | 3300047472 | Bacteria | 1668 |
| 670 | Ga0495593_0014254 | 3300047673 | Bacteria | 4520 |
| 671 | Ga0495593_0026515 | 3300047673 | Bacteria | 3199 |
| 672 | Ga0495593_0052278 | 3300047673 | Bacteria | 2159 |
| 673 | Ga0495602_0014680 | 3300048088 | Bacteria | 7945 |
| 674 | Ga0495602_0040487 | 3300048088 | Bacteria | 4271 |
| 675 | Ga0495614_0007107 | 3300048089 | Bacteria | 4993 |
| 676 | Ga0495614_0021545 | 3300048089 | Bacteria | 2782 |
| 677 | Ga0495615_0026642 | 3300048090 | Bacteria | 1351 |
| 678 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 679 | Ga0495626_0000266 | 3300048091 | Bacteria | 59029 |
| 680 | Ga0495626_0003317 | 3300048091 | Bacteria | 10385 |
| 681 | Ga0495626_0009306 | 3300048091 | Bacteria | 5313 |
| 682 | Ga0495626_0055109 | 3300048091 | Bacteria | 1824 |
| 683 | Ga0496100_0072256 | 3300048903 | Bacteria | 2305 |
| 684 | Ga0496101_0030633 | 3300048904 | Bacteria | 3774 |
| 685 | Ga0496102_0000508 | 3300048905 | Bacteria | 42696 |
| 686 | Ga0496103_0003005 | 3300048906 | Bacteria | 10418 |
| 687 | Ga0496104_0002968 | 3300048907 | Bacteria | 14620 |
| 688 | Ga0496104_0220740 | 3300048907 | Bacteria | 1808 |
| 689 | Ga0496104_0303469 | 3300048907 | Bacteria | 1509 |
| 690 | Ga0496105_0005675 | 3300048908 | Bacteria | 9500 |
| 691 | Ga0496106_0009099 | 3300048909 | Bacteria | 7339 |
| 692 | Ga0496107_0008400 | 3300048910 | Bacteria | 7146 |
| 693 | Ga0496107_0056291 | 3300048910 | Bacteria | 2841 |
| 694 | Ga0496107_0168955 | 3300048910 | Bacteria | 1622 |
| 695 | Ga0496109_0036548 | 3300048912 | Bacteria | 4434 |
| 696 | Ga0496109_0261427 | 3300048912 | Bacteria | 1630 |
| 697 | Ga0496110_0000369 | 3300048913 | Bacteria | 30095 |
| 698 | Ga0496110_0151998 | 3300048913 | Bacteria | 2096 |
| 699 | Ga0496113_0010845 | 3300048916 | Bacteria | 6047 |
| 700 | Ga0496113_0511846 | 3300048916 | Bacteria | 964 |
| 701 | Ga0496114_0016406 | 3300048917 | Bacteria | 5968 |
| 702 | Ga0496117_0011610 | 3300048920 | Bacteria | 7872 |
| 703 | Ga0496118_0006655 | 3300048921 | Bacteria | 12612 |
| 704 | Ga0496122_0003354 | 3300048925 | Bacteria | 21106 |
| 705 | Ga0496122_0005566 | 3300048925 | Bacteria | 14917 |
| 706 | Ga0496122_0046176 | 3300048925 | Bacteria | 3376 |
| 707 | Ga0496123_0002554 | 3300048926 | Bacteria | 22188 |
| 708 | Ga0496123_0004083 | 3300048926 | Bacteria | 15709 |
| 709 | Ga0496124_0011069 | 3300048927 | Bacteria | 9055 |
| 710 | Ga0496124_0086568 | 3300048927 | Bacteria | 2564 |
| 711 | Ga0496124_0159427 | 3300048927 | Bacteria | 1760 |
| 712 | Ga0495678_000013 | 3300049459 | Bacteria | 316375 |
| 713 | Ga0495678_000339 | 3300049459 | Bacteria | 49120 |
| 714 | Ga0495678_000770 | 3300049459 | Bacteria | 28951 |
| 715 | Ga0495678_001879 | 3300049459 | Bacteria | 15276 |
| 716 | Ga0495678_016577 | 3300049459 | Bacteria | 3364 |
| 717 | Ga0495682_0030344 | 3300049460 | Bacteria | 2000 |
| 718 | Ga0501031_0038542 | 3300049568 | Bacteria | 3119 |
| 719 | Ga0501034_0102736 | 3300049571 | Bacteria | 2852 |
| 720 | Ga0501034_0269173 | 3300049571 | Bacteria | 1645 |
| 721 | Ga0501036_0015912 | 3300049572 | Bacteria | 6283 |
| 722 | Ga0501036_0215968 | 3300049572 | Bacteria | 1611 |
| 723 | Ga0501037_0077697 | 3300049573 | Bacteria | 2409 |
| 724 | Ga0501039_0092038 | 3300049575 | Bacteria | 2363 |
| 725 | Ga0501041_0024322 | 3300049577 | Bacteria | 3635 |
| 726 | Ga0501041_0118101 | 3300049577 | Bacteria | 1647 |
| 727 | Ga0501068_0023354 | 3300049584 | Bacteria | 3623 |
| 728 | Ga0501070_0004115 | 3300049586 | Bacteria | 12509 |
| 729 | Ga0501070_0025006 | 3300049586 | Bacteria | 5008 |
| 730 | Ga0501071_0002455 | 3300049587 | Bacteria | 11259 |
| 731 | Ga0501072_0002962 | 3300049588 | Bacteria | 12790 |
| 732 | Ga0501072_0187622 | 3300049588 | Bacteria | 1649 |
| 733 | Ga0501073_0074788 | 3300049589 | Bacteria | 2358 |
| 734 | Ga0501074_0000199 | 3300049590 | Bacteria | 32705 |
| 735 | Ga0501074_0109209 | 3300049590 | Bacteria | 1979 |
| 736 | Ga0501075_0001610 | 3300049591 | Bacteria | 14794 |
| 737 | Ga0501076_0001071 | 3300049592 | Bacteria | 17977 |
| 738 | Ga0501076_0103579 | 3300049592 | Bacteria | 2296 |
| 739 | Ga0501077_0064150 | 3300049593 | Bacteria | 2330 |
| 740 | Ga0501227_000835 | 3300049665 | Bacteria | 6716 |
| 741 | Ga0501079_0010809 | 3300049741 | Bacteria | 6951 |
| 742 | Ga0501079_0051354 | 3300049741 | Bacteria | 3183 |
| 743 | Ga0501080_0025750 | 3300049742 | Bacteria | 5464 |
| 744 | Ga0501080_0057418 | 3300049742 | Bacteria | 3623 |
| 745 | Ga0501081_0010313 | 3300049743 | Bacteria | 6100 |
| 746 | Ga0501083_0005240 | 3300049744 | Bacteria | 9169 |
| 747 | Ga0501044_0258471 | 3300049823 | Bacteria | 1680 |
| 748 | Ga0501044_0398524 | 3300049823 | Bacteria | 1289 |
| 749 | Ga0501045_0013138 | 3300049824 | Bacteria | 5840 |
| 750 | Ga0501045_0025249 | 3300049824 | Bacteria | 4270 |
| 751 | Ga0501045_0067128 | 3300049824 | Bacteria | 2634 |
| 752 | Ga0501045_0169203 | 3300049824 | Bacteria | 1628 |
| 753 | nmdc:mga0k408_3537_c1 | 3300050493 | Bacteria | 8251 |
| 754 | nmdc:mga08y16_225982_c1 | 3300050511 | Bacteria | 1937 |
| 755 | nmdc:mga0a205_5608_c1 | 3300050515 | Bacteria | 7832 |
| 756 | Ga0501084_0003320 | 3300054114 | Bacteria | 13013 |
| 757 | Ga0501082_0014793 | 3300060353 | Bacteria | 6719 |
| 758 | Ga0501082_0074299 | 3300060353 | Bacteria | 2928 |
| 759 | Ga0466962_0029335 | 3300061719 | Bacteria | 2633 |
| 760 | Ga0466962_0038544 | 3300061719 | Bacteria | 2289 |
| 761 | Ga0530510_0002843 | 3300061734 | Bacteria | 11910 |
| 762 | Ga0530510_0252343 | 3300061734 | Bacteria | 1315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038726 | Ga0400490_16042 | Ga0400490_16042_431_1339 | 292 |
| 2 | 3300038727 | Ga0400491_18994 | Ga0400491_18994_4048_4956 | 292 |
| 3 | 3300047673 | Ga0495593_0014254 | Ga0495593_0014254_28_981 | 304 |
| 4 | 3300048916 | Ga0496113_0511846 | Ga0496113_0511846_19_954 | 304 |
| 5 | 3300046459 | Ga0495629_0204444 | Ga0495629_0204444_399_1355 | 305 |
| 6 | 3300046471 | Ga0495650_0003026 | Ga0495650_0003026_14_937 | 305 |
| 7 | 3300046500 | Ga0495596_0010283 | Ga0495596_0010283_3113_4051 | 305 |
| 8 | 3300046648 | Ga0495611_0145724 | Ga0495611_0145724_145_1089 | 306 |
| 9 | 3300046674 | Ga0495588_0226513 | Ga0495588_0226513_19_948 | 306 |
| 10 | 3300046558 | Ga0495633_0067607 | Ga0495633_0067607_19_978 | 308 |
| 11 | 3300047315 | Ga0495581_0103505 | Ga0495581_0103505_10_963 | 308 |
| 12 | 3300048090 | Ga0495615_0026642 | Ga0495615_0026642_335_1294 | 308 |
| 13 | 3300005367 | Ga0070667_100003566 | Ga0070667_1000035669 | 312 |
| 14 | 3300005456 | Ga0070678_100002838 | Ga0070678_1000028389 | 312 |
| 15 | 3300005548 | Ga0070665_100004484 | Ga0070665_1000044847 | 312 |
| 16 | 3300014969 | Ga0157376_10024255 | Ga0157376_100242553 | 312 |
| 17 | 3300025903 | Ga0207680_10037482 | Ga0207680_100374822 | 312 |
| 18 | 3300026089 | Ga0207648_10034776 | Ga0207648_100347764 | 312 |
| 19 | 3300026121 | Ga0207683_10014462 | Ga0207683_100144623 | 312 |
| 20 | 3300028379 | Ga0268266_10005997 | Ga0268266_100059977 | 312 |
| 21 | 3300005335 | Ga0070666_10077392 | Ga0070666_100773921 | 316 |
| 22 | 3300005364 | Ga0070673_100282195 | Ga0070673_1002821952 | 316 |
| 23 | 3300005459 | Ga0068867_100044424 | Ga0068867_1000444241 | 316 |
| 24 | 3300013308 | Ga0157375_10298001 | Ga0157375_102980012 | 316 |
| 25 | 3300048907 | Ga0496104_0303469 | Ga0496104_0303469_516_1496 | 318 |
| 26 | 3300025937 | Ga0207669_10051692 | Ga0207669_100516922 | 326 |
| 27 | 3300005564 | Ga0070664_100100081 | Ga0070664_1001000813 | 329 |
| 28 | 3300025945 | Ga0207679_10057962 | Ga0207679_100579623 | 329 |
| 29 | 3300046471 | Ga0495650_0000399 | Ga0495650_0000399_44074_45165 | 330 |
| 30 | 3300005344 | Ga0070661_100003328 | Ga0070661_1000033286 | 331 |
| 31 | 3300005458 | Ga0070681_10018253 | Ga0070681_100182532 | 331 |
| 32 | 3300005530 | Ga0070679_100070385 | Ga0070679_1000703852 | 331 |
| 33 | 3300005539 | Ga0068853_100101207 | Ga0068853_1001012072 | 331 |
| 34 | 3300005617 | Ga0068859_100396157 | Ga0068859_1003961572 | 331 |
| 35 | 3300006931 | Ga0097620_100396163 | Ga0097620_1003961632 | 331 |
| 36 | 3300009174 | Ga0105241_10208763 | Ga0105241_102087631 | 331 |
| 37 | 3300013307 | Ga0157372_10007100 | Ga0157372_100071006 | 331 |
| 38 | 3300025912 | Ga0207707_10005481 | Ga0207707_100054817 | 331 |
| 39 | 3300025920 | Ga0207649_10016228 | Ga0207649_100162283 | 331 |
| 40 | 3300025921 | Ga0207652_10031116 | Ga0207652_100311164 | 331 |
| 41 | 3300026041 | Ga0207639_10077121 | Ga0207639_100771212 | 331 |
| 42 | 3300037418 | Ga0395900_0054721 | Ga0395900_0054721_504_1622 | 332 |
| 43 | 3300037471 | Ga0395905_0011242 | Ga0395905_0011242_2372_3490 | 332 |
| 44 | 3300047321 | Ga0495676_0024587 | Ga0495676_0024587_1003_2028 | 334 |
| 45 | 3300005347 | Ga0070668_100027814 | Ga0070668_1000278143 | 335 |
| 46 | 3300006852 | Ga0075433_10012647 | Ga0075433_100126478 | 335 |
| 47 | 3300006871 | Ga0075434_100029350 | Ga0075434_1000293503 | 335 |
| 48 | 3300007076 | Ga0075435_100004089 | Ga0075435_1000040895 | 335 |
| 49 | 3300025972 | Ga0207668_10010545 | Ga0207668_100105456 | 335 |
| 50 | 3300028381 | Ga0268264_10185800 | Ga0268264_101858002 | 335 |
| 51 | 3300050515 | nmdc:mga0a205_5608_c1 | nmdc:mga0a205_5608_c1_5577_6671 | 335 |
| 52 | 3300011119 | Ga0105246_10181677 | Ga0105246_101816772 | 336 |
| 53 | 3300013308 | Ga0157375_10203656 | Ga0157375_102036562 | 336 |
| 54 | 3300021361 | Ga0213872_10001092 | Ga0213872_1000109218 | 336 |
| 55 | 3300005535 | Ga0070684_100344842 | Ga0070684_1003448421 | 339 |
| 56 | 3300036401 | Ga0373937_0001546 | Ga0373937_0001546_12902_13963 | 339 |
| 57 | 3300044712 | Ga0453684_0352154 | Ga0453684_0352154_533_1591 | 340 |
| 58 | 3300005617 | Ga0068859_100251527 | Ga0068859_1002515272 | 341 |
| 59 | 3300006931 | Ga0097620_100251506 | Ga0097620_1002515062 | 341 |
| 60 | 3300049586 | Ga0501070_0004115 | Ga0501070_0004115_2498_3565 | 341 |
| 61 | 3300049588 | Ga0501072_0187622 | Ga0501072_0187622_390_1457 | 341 |
| 62 | 3300049589 | Ga0501073_0074788 | Ga0501073_0074788_729_1796 | 341 |
| 63 | 3300049590 | Ga0501074_0000199 | Ga0501074_0000199_6887_7954 | 341 |
| 64 | 3300049741 | Ga0501079_0051354 | Ga0501079_0051354_721_1788 | 341 |
| 65 | 3300049742 | Ga0501080_0057418 | Ga0501080_0057418_1956_3023 | 341 |
| 66 | 3300049744 | Ga0501083_0005240 | Ga0501083_0005240_5606_6673 | 341 |
| 67 | 3300049823 | Ga0501044_0258471 | Ga0501044_0258471_302_1369 | 341 |
| 68 | 3300060353 | Ga0501082_0074299 | Ga0501082_0074299_266_1333 | 341 |
| 69 | 3300005355 | Ga0070671_100010840 | Ga0070671_1000108405 | 342 |
| 70 | 3300005367 | Ga0070667_100165442 | Ga0070667_1001654422 | 342 |
| 71 | 3300005841 | Ga0068863_100063693 | Ga0068863_1000636933 | 342 |
| 72 | 3300005937 | Ga0081455_10053216 | Ga0081455_100532162 | 342 |
| 73 | 3300005985 | Ga0081539_10019043 | Ga0081539_100190432 | 342 |
| 74 | 3300009177 | Ga0105248_10057770 | Ga0105248_100577703 | 342 |
| 75 | 3300013308 | Ga0157375_10062019 | Ga0157375_100620192 | 342 |
| 76 | 3300014968 | Ga0157379_10125083 | Ga0157379_101250833 | 342 |
| 77 | 3300025931 | Ga0207644_10005822 | Ga0207644_100058225 | 342 |
| 78 | 3300025941 | Ga0207711_10028362 | Ga0207711_100283624 | 342 |
| 79 | 3300025986 | Ga0207658_10212515 | Ga0207658_102125152 | 342 |
| 80 | 3300027665 | Ga0209983_1020523 | Ga0209983_10205232 | 342 |
| 81 | 3300027682 | Ga0209971_1003092 | Ga0209971_10030923 | 342 |
| 82 | 3300027876 | Ga0209974_10027642 | Ga0209974_100276422 | 342 |
| 83 | 3300028380 | Ga0268265_10381849 | Ga0268265_103818491 | 342 |
| 84 | 3300031251 | Ga0265327_10000529 | Ga0265327_1000052951 | 342 |
| 85 | 3300042876 | Ga0451577_0042616 | Ga0451577_0042616_1336_2394 | 342 |
| 86 | 3300044712 | Ga0453684_0367409 | Ga0453684_0367409_114_1235 | 342 |
| 87 | 3300045051 | Ga0451576_0037615 | Ga0451576_0037615_1399_2487 | 342 |
| 88 | 3300049571 | Ga0501034_0102736 | Ga0501034_0102736_1048_2109 | 342 |
| 89 | iso_pu_bacteria | 2547132103 | 2547374305 | 342 |
| 90 | 3300031665 | Ga0316575_10045402 | Ga0316575_100454022 | 343 |
| 91 | 3300039447 | Ga0436361_1160248 | Ga0436361_1160248_15660_16742 | 343 |
| 92 | 3300042876 | Ga0451577_0072552 | Ga0451577_0072552_1896_2945 | 343 |
| 93 | 3300044673 | Ga0453683_0084461 | Ga0453683_0084461_771_1868 | 343 |
| 94 | 3300044712 | Ga0453684_0002403 | Ga0453684_0002403_44039_45088 | 343 |
| 95 | 3300044712 | Ga0453684_0129521 | Ga0453684_0129521_87_1139 | 343 |
| 96 | 3300045051 | Ga0451576_0020622 | Ga0451576_0020622_549_1598 | 343 |
| 97 | 3300045051 | Ga0451576_0125455 | Ga0451576_0125455_1424_2500 | 343 |
| 98 | 3300005331 | Ga0070670_100152800 | Ga0070670_1001528002 | 344 |
| 99 | 3300005334 | Ga0068869_100012816 | Ga0068869_1000128164 | 344 |
| 100 | 3300005335 | Ga0070666_10003198 | Ga0070666_100031983 | 344 |
| 101 | 3300005336 | Ga0070680_100207513 | Ga0070680_1002075132 | 344 |
| 102 | 3300005338 | Ga0068868_100012033 | Ga0068868_1000120335 | 344 |
| 103 | 3300005340 | Ga0070689_100000324 | Ga0070689_1000003242 | 344 |
| 104 | 3300005344 | Ga0070661_100023740 | Ga0070661_1000237402 | 344 |
| 105 | 3300005345 | Ga0070692_10041255 | Ga0070692_100412551 | 344 |
| 106 | 3300005355 | Ga0070671_100027394 | Ga0070671_1000273945 | 344 |
| 107 | 3300005364 | Ga0070673_100000602 | Ga0070673_1000006025 | 344 |
| 108 | 3300005365 | Ga0070688_100000276 | Ga0070688_1000002767 | 344 |
| 109 | 3300005367 | Ga0070667_100027843 | Ga0070667_1000278433 | 344 |
| 110 | 3300005435 | Ga0070714_100143121 | Ga0070714_1001431212 | 344 |
| 111 | 3300005436 | Ga0070713_100021966 | Ga0070713_1000219664 | 344 |
| 112 | 3300005436 | Ga0070713_100024627 | Ga0070713_1000246275 | 344 |
| 113 | 3300005437 | Ga0070710_10021867 | Ga0070710_100218672 | 344 |
| 114 | 3300005456 | Ga0070678_100001759 | Ga0070678_1000017593 | 344 |
| 115 | 3300005457 | Ga0070662_100014149 | Ga0070662_1000141493 | 344 |
| 116 | 3300005466 | Ga0070685_10000522 | Ga0070685_1000052220 | 344 |
| 117 | 3300005468 | Ga0070707_100043109 | Ga0070707_1000431096 | 344 |
| 118 | 3300005543 | Ga0070672_100156469 | Ga0070672_1001564692 | 344 |
| 119 | 3300005546 | Ga0070696_100055544 | Ga0070696_1000555442 | 344 |
| 120 | 3300005547 | Ga0070693_100001181 | Ga0070693_1000011815 | 344 |
| 121 | 3300005548 | Ga0070665_100006836 | Ga0070665_10000683611 | 344 |
| 122 | 3300005578 | Ga0068854_100017889 | Ga0068854_1000178894 | 344 |
| 123 | 3300005614 | Ga0068856_100214436 | Ga0068856_1002144362 | 344 |
| 124 | 3300005617 | Ga0068859_100003388 | Ga0068859_1000033885 | 344 |
| 125 | 3300005718 | Ga0068866_10003152 | Ga0068866_100031524 | 344 |
| 126 | 3300005840 | Ga0068870_10014204 | Ga0068870_100142043 | 344 |
| 127 | 3300005841 | Ga0068863_100003151 | Ga0068863_1000031516 | 344 |
| 128 | 3300005843 | Ga0068860_100048910 | Ga0068860_1000489103 | 344 |
| 129 | 3300005843 | Ga0068860_100087016 | Ga0068860_1000870162 | 344 |
| 130 | 3300006163 | Ga0070715_10002475 | Ga0070715_100024754 | 344 |
| 131 | 3300006173 | Ga0070716_100018632 | Ga0070716_1000186322 | 344 |
| 132 | 3300006173 | Ga0070716_100021395 | Ga0070716_1000213951 | 344 |
| 133 | 3300006175 | Ga0070712_100001985 | Ga0070712_1000019852 | 344 |
| 134 | 3300006237 | Ga0097621_100004146 | Ga0097621_10000414610 | 344 |
| 135 | 3300006358 | Ga0068871_100008690 | Ga0068871_1000086905 | 344 |
| 136 | 3300006931 | Ga0097620_100003388 | Ga0097620_1000033885 | 344 |
| 137 | 3300009098 | Ga0105245_10025250 | Ga0105245_100252504 | 344 |
| 138 | 3300009098 | Ga0105245_10033683 | Ga0105245_100336834 | 344 |
| 139 | 3300009101 | Ga0105247_10053300 | Ga0105247_100533002 | 344 |
| 140 | 3300009174 | Ga0105241_10062893 | Ga0105241_100628932 | 344 |
| 141 | 3300009176 | Ga0105242_10025334 | Ga0105242_100253344 | 344 |
| 142 | 3300009177 | Ga0105248_10063113 | Ga0105248_100631134 | 344 |
| 143 | 3300009545 | Ga0105237_10084853 | Ga0105237_100848533 | 344 |
| 144 | 3300013296 | Ga0157374_10032379 | Ga0157374_100323794 | 344 |
| 145 | 3300013297 | Ga0157378_10037889 | Ga0157378_100378894 | 344 |
| 146 | 3300013297 | Ga0157378_10063396 | Ga0157378_100633964 | 344 |
| 147 | 3300013306 | Ga0163162_10013715 | Ga0163162_100137155 | 344 |
| 148 | 3300013306 | Ga0163162_10048939 | Ga0163162_100489394 | 344 |
| 149 | 3300013308 | Ga0157375_10007795 | Ga0157375_100077956 | 344 |
| 150 | 3300014325 | Ga0163163_10001966 | Ga0163163_100019665 | 344 |
| 151 | 3300014745 | Ga0157377_10001594 | Ga0157377_100015945 | 344 |
| 152 | 3300014968 | Ga0157379_10040584 | Ga0157379_100405842 | 344 |
| 153 | 3300014969 | Ga0157376_10005137 | Ga0157376_100051373 | 344 |
| 154 | 3300014969 | Ga0157376_10020601 | Ga0157376_100206014 | 344 |
| 155 | 3300017792 | Ga0163161_10086346 | Ga0163161_100863462 | 344 |
| 156 | 3300025898 | Ga0207692_10083892 | Ga0207692_100838922 | 344 |
| 157 | 3300025900 | Ga0207710_10009425 | Ga0207710_100094251 | 344 |
| 158 | 3300025903 | Ga0207680_10011911 | Ga0207680_100119113 | 344 |
| 159 | 3300025906 | Ga0207699_10099341 | Ga0207699_100993412 | 344 |
| 160 | 3300025907 | Ga0207645_10044740 | Ga0207645_100447403 | 344 |
| 161 | 3300025908 | Ga0207643_10014363 | Ga0207643_100143633 | 344 |
| 162 | 3300025912 | Ga0207707_10066753 | Ga0207707_100667533 | 344 |
| 163 | 3300025915 | Ga0207693_10000069 | Ga0207693_1000006962 | 344 |
| 164 | 3300025915 | Ga0207693_10010112 | Ga0207693_100101127 | 344 |
| 165 | 3300025916 | Ga0207663_10016917 | Ga0207663_100169173 | 344 |
| 166 | 3300025919 | Ga0207657_10002525 | Ga0207657_100025259 | 344 |
| 167 | 3300025925 | Ga0207650_10103022 | Ga0207650_101030222 | 344 |
| 168 | 3300025927 | Ga0207687_10000293 | Ga0207687_1000029329 | 344 |
| 169 | 3300025928 | Ga0207700_10009271 | Ga0207700_100092712 | 344 |
| 170 | 3300025929 | Ga0207664_10003067 | Ga0207664_100030673 | 344 |
| 171 | 3300025931 | Ga0207644_10009304 | Ga0207644_100093044 | 344 |
| 172 | 3300025931 | Ga0207644_10180688 | Ga0207644_101806882 | 344 |
| 173 | 3300025933 | Ga0207706_10018899 | Ga0207706_100188995 | 344 |
| 174 | 3300025934 | Ga0207686_10000118 | Ga0207686_1000011811 | 344 |
| 175 | 3300025936 | Ga0207670_10127164 | Ga0207670_101271642 | 344 |
| 176 | 3300025939 | Ga0207665_10007491 | Ga0207665_100074912 | 344 |
| 177 | 3300025939 | Ga0207665_10250328 | Ga0207665_102503281 | 344 |
| 178 | 3300025940 | Ga0207691_10060041 | Ga0207691_100600412 | 344 |
| 179 | 3300025941 | Ga0207711_10000515 | Ga0207711_100005159 | 344 |
| 180 | 3300025942 | Ga0207689_10012237 | Ga0207689_100122376 | 344 |
| 181 | 3300025942 | Ga0207689_10012711 | Ga0207689_100127116 | 344 |
| 182 | 3300025960 | Ga0207651_10000266 | Ga0207651_100002668 | 344 |
| 183 | 3300025981 | Ga0207640_10020026 | Ga0207640_100200263 | 344 |
| 184 | 3300025986 | Ga0207658_10037542 | Ga0207658_100375423 | 344 |
| 185 | 3300025986 | Ga0207658_10161284 | Ga0207658_101612842 | 344 |
| 186 | 3300026023 | Ga0207677_10040107 | Ga0207677_100401074 | 344 |
| 187 | 3300026035 | Ga0207703_10003276 | Ga0207703_1000327610 | 344 |
| 188 | 3300026078 | Ga0207702_10033862 | Ga0207702_100338623 | 344 |
| 189 | 3300026088 | Ga0207641_10006628 | Ga0207641_100066285 | 344 |
| 190 | 3300026095 | Ga0207676_10005594 | Ga0207676_100055945 | 344 |
| 191 | 3300026116 | Ga0207674_10008221 | Ga0207674_100082215 | 344 |
| 192 | 3300026121 | Ga0207683_10000827 | Ga0207683_1000082721 | 344 |
| 193 | 3300026142 | Ga0207698_10053414 | Ga0207698_100534142 | 344 |
| 194 | 3300028379 | Ga0268266_10006981 | Ga0268266_100069815 | 344 |
| 195 | 3300028381 | Ga0268264_10003641 | Ga0268264_100036413 | 344 |
| 196 | 3300028381 | Ga0268264_10023627 | Ga0268264_100236273 | 344 |
| 197 | 3300035086 | Ga0373934_0002330 | Ga0373934_0002330_2121_3233 | 344 |
| 198 | 3300035111 | Ga0373923_0002548 | Ga0373923_0002548_2064_3176 | 344 |
| 199 | 3300035118 | Ga0373954_0000591 | Ga0373954_0000591_8653_9765 | 344 |
| 200 | 3300035119 | Ga0373956_0040685 | Ga0373956_0040685_98_1210 | 344 |
| 201 | 3300035172 | Ga0373955_0007635 | Ga0373955_0007635_1524_2636 | 344 |
| 202 | 3300035724 | Ga0373933_0005650 | Ga0373933_0005650_3748_4860 | 344 |
| 203 | 3300036401 | Ga0373937_0008259 | Ga0373937_0008259_4972_6078 | 344 |
| 204 | 3300036401 | Ga0373937_0033468 | Ga0373937_0033468_2951_4063 | 344 |
| 205 | 3300046455 | Ga0495603_0078446 | Ga0495603_0078446_635_1741 | 344 |
| 206 | 3300046459 | Ga0495629_0029456 | Ga0495629_0029456_1472_2578 | 344 |
| 207 | 3300046473 | Ga0495582_0002672 | Ga0495582_0002672_4668_5774 | 344 |
| 208 | 3300046477 | Ga0495664_0127335 | Ga0495664_0127335_399_1511 | 344 |
| 209 | 3300046535 | Ga0495586_0082876 | Ga0495586_0082876_516_1628 | 344 |
| 210 | 3300046536 | Ga0495587_0052723 | Ga0495587_0052723_1083_2195 | 344 |
| 211 | 3300046539 | Ga0495621_0042894 | Ga0495621_0042894_190_1302 | 344 |
| 212 | 3300046663 | Ga0495635_0017503 | Ga0495635_0017503_748_1854 | 344 |
| 213 | 3300046679 | Ga0495623_0009068 | Ga0495623_0009068_556_1668 | 344 |
| 214 | 3300046681 | Ga0495647_0004915 | Ga0495647_0004915_1545_2651 | 344 |
| 215 | 3300047315 | Ga0495581_0001180 | Ga0495581_0001180_7609_8715 | 344 |
| 216 | 3300047319 | Ga0495674_0171279 | Ga0495674_0171279_484_1596 | 344 |
| 217 | 3300047471 | Ga0495684_0043973 | Ga0495684_0043973_303_1409 | 344 |
| 218 | 3300047673 | Ga0495593_0026515 | Ga0495593_0026515_1325_2431 | 344 |
| 219 | 3300048089 | Ga0495614_0007107 | Ga0495614_0007107_1406_2512 | 344 |
| 220 | 3300048907 | Ga0496104_0002968 | Ga0496104_0002968_2346_3458 | 344 |
| 221 | 3300048908 | Ga0496105_0005675 | Ga0496105_0005675_4520_5632 | 344 |
| 222 | 3300048910 | Ga0496107_0168955 | Ga0496107_0168955_36_1148 | 344 |
| 223 | 3300048917 | Ga0496114_0016406 | Ga0496114_0016406_1805_2917 | 344 |
| 224 | 3300048926 | Ga0496123_0004083 | Ga0496123_0004083_6914_8005 | 344 |
| 225 | 3300049568 | Ga0501031_0038542 | Ga0501031_0038542_711_1790 | 344 |
| 226 | 3300049571 | Ga0501034_0269173 | Ga0501034_0269173_141_1244 | 344 |
| 227 | 3300049572 | Ga0501036_0015912 | Ga0501036_0015912_2717_3796 | 344 |
| 228 | 3300049577 | Ga0501041_0024322 | Ga0501041_0024322_1643_2722 | 344 |
| 229 | 3300049577 | Ga0501041_0118101 | Ga0501041_0118101_459_1538 | 344 |
| 230 | 3300049584 | Ga0501068_0023354 | Ga0501068_0023354_1995_3074 | 344 |
| 231 | 3300049587 | Ga0501071_0002455 | Ga0501071_0002455_1217_2296 | 344 |
| 232 | 3300049588 | Ga0501072_0002962 | Ga0501072_0002962_7547_8626 | 344 |
| 233 | 3300049591 | Ga0501075_0001610 | Ga0501075_0001610_12914_13993 | 344 |
| 234 | 3300049592 | Ga0501076_0001071 | Ga0501076_0001071_14747_15826 | 344 |
| 235 | 3300049593 | Ga0501077_0064150 | Ga0501077_0064150_936_2015 | 344 |
| 236 | 3300049741 | Ga0501079_0010809 | Ga0501079_0010809_2319_3398 | 344 |
| 237 | 3300049742 | Ga0501080_0025750 | Ga0501080_0025750_3273_4352 | 344 |
| 238 | 3300049743 | Ga0501081_0010313 | Ga0501081_0010313_1820_2899 | 344 |
| 239 | 3300049823 | Ga0501044_0398524 | Ga0501044_0398524_150_1229 | 344 |
| 240 | 3300049824 | Ga0501045_0025249 | Ga0501045_0025249_1652_2731 | 344 |
| 241 | 3300049824 | Ga0501045_0067128 | Ga0501045_0067128_1431_2510 | 344 |
| 242 | 3300050493 | nmdc:mga0k408_3537_c1 | nmdc:mga0k408_3537_c1_6898_7989 | 344 |
| 243 | 3300054114 | Ga0501084_0003320 | Ga0501084_0003320_320_1399 | 344 |
| 244 | 3300060353 | Ga0501082_0014793 | Ga0501082_0014793_4650_5729 | 344 |
| 245 | 3300061734 | Ga0530510_0002843 | Ga0530510_0002843_3550_4629 | 344 |
| 246 | iso_pu_bacteria | 2891633521 | 2891636063 | 344 |
| 247 | 3300005328 | Ga0070676_10003461 | Ga0070676_100034616 | 345 |
| 248 | 3300005334 | Ga0068869_100010636 | Ga0068869_1000106364 | 345 |
| 249 | 3300005335 | Ga0070666_10003557 | Ga0070666_100035576 | 345 |
| 250 | 3300005338 | Ga0068868_100008667 | Ga0068868_1000086673 | 345 |
| 251 | 3300005347 | Ga0070668_100001276 | Ga0070668_1000012764 | 345 |
| 252 | 3300005353 | Ga0070669_100002313 | Ga0070669_1000023138 | 345 |
| 253 | 3300005354 | Ga0070675_100002082 | Ga0070675_1000020823 | 345 |
| 254 | 3300005355 | Ga0070671_100004990 | Ga0070671_1000049904 | 345 |
| 255 | 3300005364 | Ga0070673_100008381 | Ga0070673_1000083814 | 345 |
| 256 | 3300005367 | Ga0070667_100005842 | Ga0070667_1000058427 | 345 |
| 257 | 3300005456 | Ga0070678_100002666 | Ga0070678_1000026664 | 345 |
| 258 | 3300005459 | Ga0068867_100002278 | Ga0068867_1000022786 | 345 |
| 259 | 3300005543 | Ga0070672_100005080 | Ga0070672_1000050804 | 345 |
| 260 | 3300005548 | Ga0070665_100007950 | Ga0070665_1000079504 | 345 |
| 261 | 3300005617 | Ga0068859_100010910 | Ga0068859_1000109108 | 345 |
| 262 | 3300005841 | Ga0068863_100014308 | Ga0068863_1000143086 | 345 |
| 263 | 3300005842 | Ga0068858_100008645 | Ga0068858_1000086454 | 345 |
| 264 | 3300005843 | Ga0068860_100001042 | Ga0068860_10000104214 | 345 |
| 265 | 3300006237 | Ga0097621_100023190 | Ga0097621_1000231903 | 345 |
| 266 | 3300006358 | Ga0068871_100008300 | Ga0068871_1000083004 | 345 |
| 267 | 3300006881 | Ga0068865_100005451 | Ga0068865_1000054514 | 345 |
| 268 | 3300006931 | Ga0097620_100010910 | Ga0097620_1000109108 | 345 |
| 269 | 3300009177 | Ga0105248_10002431 | Ga0105248_1000243119 | 345 |
| 270 | 3300013296 | Ga0157374_10007182 | Ga0157374_100071826 | 345 |
| 271 | 3300013297 | Ga0157378_10062677 | Ga0157378_100626772 | 345 |
| 272 | 3300013306 | Ga0163162_10001893 | Ga0163162_1000189316 | 345 |
| 273 | 3300013308 | Ga0157375_10016875 | Ga0157375_100168754 | 345 |
| 274 | 3300014325 | Ga0163163_10131313 | Ga0163163_101313133 | 345 |
| 275 | 3300014968 | Ga0157379_10001435 | Ga0157379_1000143518 | 345 |
| 276 | 3300014969 | Ga0157376_10010909 | Ga0157376_100109095 | 345 |
| 277 | 3300025903 | Ga0207680_10012261 | Ga0207680_100122613 | 345 |
| 278 | 3300025907 | Ga0207645_10003275 | Ga0207645_100032755 | 345 |
| 279 | 3300025912 | Ga0207707_10247706 | Ga0207707_102477061 | 345 |
| 280 | 3300025923 | Ga0207681_10011715 | Ga0207681_100117152 | 345 |
| 281 | 3300025926 | Ga0207659_10006585 | Ga0207659_100065855 | 345 |
| 282 | 3300025931 | Ga0207644_10105130 | Ga0207644_101051302 | 345 |
| 283 | 3300025938 | Ga0207704_10002824 | Ga0207704_100028246 | 345 |
| 284 | 3300025940 | Ga0207691_10000629 | Ga0207691_1000062917 | 345 |
| 285 | 3300025941 | Ga0207711_10023802 | Ga0207711_100238023 | 345 |
| 286 | 3300025942 | Ga0207689_10006485 | Ga0207689_100064856 | 345 |
| 287 | 3300025972 | Ga0207668_10057547 | Ga0207668_100575472 | 345 |
| 288 | 3300025986 | Ga0207658_10004266 | Ga0207658_100042664 | 345 |
| 289 | 3300026035 | Ga0207703_10040050 | Ga0207703_100400503 | 345 |
| 290 | 3300026088 | Ga0207641_10009041 | Ga0207641_100090415 | 345 |
| 291 | 3300026089 | Ga0207648_10000364 | Ga0207648_1000036419 | 345 |
| 292 | 3300026095 | Ga0207676_10019043 | Ga0207676_100190433 | 345 |
| 293 | 3300026121 | Ga0207683_10000076 | Ga0207683_1000007665 | 345 |
| 294 | 3300028379 | Ga0268266_10074223 | Ga0268266_100742233 | 345 |
| 295 | 3300028380 | Ga0268265_10040194 | Ga0268265_100401942 | 345 |
| 296 | 3300028381 | Ga0268264_10075879 | Ga0268264_100758792 | 345 |
| 297 | 3300031824 | Ga0307413_10171327 | Ga0307413_101713272 | 345 |
| 298 | 3300048912 | Ga0496109_0036548 | Ga0496109_0036548_1817_2917 | 345 |
| 299 | 3300048920 | Ga0496117_0011610 | Ga0496117_0011610_3044_4141 | 345 |
| 300 | 3300048921 | Ga0496118_0006655 | Ga0496118_0006655_8880_9977 | 345 |
| 301 | 3300049573 | Ga0501037_0077697 | Ga0501037_0077697_1097_2206 | 345 |
| 302 | 3300049824 | Ga0501045_0169203 | Ga0501045_0169203_351_1460 | 345 |
| 303 | 3300005344 | Ga0070661_100000621 | Ga0070661_1000006218 | 346 |
| 304 | 3300005347 | Ga0070668_100050868 | Ga0070668_1000508683 | 346 |
| 305 | 3300005354 | Ga0070675_100090488 | Ga0070675_1000904882 | 346 |
| 306 | 3300005366 | Ga0070659_100035259 | Ga0070659_1000352594 | 346 |
| 307 | 3300005367 | Ga0070667_100032956 | Ga0070667_1000329562 | 346 |
| 308 | 3300005367 | Ga0070667_100412363 | Ga0070667_1004123631 | 346 |
| 309 | 3300005435 | Ga0070714_100012621 | Ga0070714_1000126214 | 346 |
| 310 | 3300005457 | Ga0070662_100100624 | Ga0070662_1001006241 | 346 |
| 311 | 3300005459 | Ga0068867_100044294 | Ga0068867_1000442942 | 346 |
| 312 | 3300005467 | Ga0070706_100143519 | Ga0070706_1001435191 | 346 |
| 313 | 3300005530 | Ga0070679_100023077 | Ga0070679_1000230777 | 346 |
| 314 | 3300005535 | Ga0070684_100020484 | Ga0070684_1000204847 | 346 |
| 315 | 3300005539 | Ga0068853_100037973 | Ga0068853_1000379733 | 346 |
| 316 | 3300005543 | Ga0070672_100002742 | Ga0070672_1000027423 | 346 |
| 317 | 3300005563 | Ga0068855_100013893 | Ga0068855_1000138937 | 346 |
| 318 | 3300005564 | Ga0070664_100028009 | Ga0070664_1000280096 | 346 |
| 319 | 3300005564 | Ga0070664_100069702 | Ga0070664_1000697023 | 346 |
| 320 | 3300005577 | Ga0068857_100001177 | Ga0068857_1000011779 | 346 |
| 321 | 3300005578 | Ga0068854_100021411 | Ga0068854_1000214114 | 346 |
| 322 | 3300005614 | Ga0068856_100003663 | Ga0068856_1000036633 | 346 |
| 323 | 3300005614 | Ga0068856_100007456 | Ga0068856_1000074564 | 346 |
| 324 | 3300005616 | Ga0068852_100013259 | Ga0068852_1000132592 | 346 |
| 325 | 3300005841 | Ga0068863_100004647 | Ga0068863_10000464712 | 346 |
| 326 | 3300005841 | Ga0068863_100080390 | Ga0068863_1000803903 | 346 |
| 327 | 3300005843 | Ga0068860_100011703 | Ga0068860_1000117039 | 346 |
| 328 | 3300009551 | Ga0105238_10002149 | Ga0105238_1000214915 | 346 |
| 329 | 3300013100 | Ga0157373_10093554 | Ga0157373_100935543 | 346 |
| 330 | 3300013104 | Ga0157370_10017646 | Ga0157370_100176464 | 346 |
| 331 | 3300013105 | Ga0157369_10052212 | Ga0157369_100522123 | 346 |
| 332 | 3300013307 | Ga0157372_10018755 | Ga0157372_100187557 | 346 |
| 333 | 3300013308 | Ga0157375_10000680 | Ga0157375_100006803 | 346 |
| 334 | 3300013308 | Ga0157375_10679246 | Ga0157375_106792461 | 346 |
| 335 | 3300014325 | Ga0163163_10079290 | Ga0163163_100792903 | 346 |
| 336 | 3300014325 | Ga0163163_10357302 | Ga0163163_103573021 | 346 |
| 337 | 3300025321 | Ga0207656_10083419 | Ga0207656_100834192 | 346 |
| 338 | 3300025910 | Ga0207684_10218732 | Ga0207684_102187321 | 346 |
| 339 | 3300025913 | Ga0207695_10051661 | Ga0207695_100516613 | 346 |
| 340 | 3300025920 | Ga0207649_10001721 | Ga0207649_1000172110 | 346 |
| 341 | 3300025924 | Ga0207694_10010599 | Ga0207694_100105997 | 346 |
| 342 | 3300025926 | Ga0207659_10072840 | Ga0207659_100728403 | 346 |
| 343 | 3300025929 | Ga0207664_10014597 | Ga0207664_100145975 | 346 |
| 344 | 3300025932 | Ga0207690_10046036 | Ga0207690_100460363 | 346 |
| 345 | 3300025933 | Ga0207706_10123685 | Ga0207706_101236852 | 346 |
| 346 | 3300025940 | Ga0207691_10000958 | Ga0207691_1000095826 | 346 |
| 347 | 3300025940 | Ga0207691_10004119 | Ga0207691_1000411910 | 346 |
| 348 | 3300025944 | Ga0207661_10023513 | Ga0207661_100235134 | 346 |
| 349 | 3300025945 | Ga0207679_10060966 | Ga0207679_100609663 | 346 |
| 350 | 3300025949 | Ga0207667_10015818 | Ga0207667_100158188 | 346 |
| 351 | 3300025972 | Ga0207668_10079086 | Ga0207668_100790863 | 346 |
| 352 | 3300025972 | Ga0207668_10214681 | Ga0207668_102146812 | 346 |
| 353 | 3300026041 | Ga0207639_10091416 | Ga0207639_100914163 | 346 |
| 354 | 3300026067 | Ga0207678_10059780 | Ga0207678_100597801 | 346 |
| 355 | 3300026078 | Ga0207702_10016803 | Ga0207702_100168035 | 346 |
| 356 | 3300026088 | Ga0207641_10361212 | Ga0207641_103612122 | 346 |
| 357 | 3300026116 | Ga0207674_10000912 | Ga0207674_1000091242 | 346 |
| 358 | 3300026121 | Ga0207683_10137580 | Ga0207683_101375802 | 346 |
| 359 | 3300028379 | Ga0268266_10085071 | Ga0268266_100850712 | 346 |
| 360 | 3300028380 | Ga0268265_10102735 | Ga0268265_101027353 | 346 |
| 361 | 3300031995 | Ga0307409_100221153 | Ga0307409_1002211532 | 346 |
| 362 | 3300036401 | Ga0373937_0137352 | Ga0373937_0137352_674_1771 | 346 |
| 363 | 3300036401 | Ga0373937_0281903 | Ga0373937_0281903_226_1368 | 346 |
| 364 | 3300037418 | Ga0395900_0178042 | Ga0395900_0178042_128_1219 | 346 |
| 365 | 3300037418 | Ga0395900_0238447 | Ga0395900_0238447_564_1694 | 346 |
| 366 | 3300038443 | Ga0395901_0004488 | Ga0395901_0004488_139_1230 | 346 |
| 367 | 3300045051 | Ga0451576_0294653 | Ga0451576_0294653_526_1605 | 346 |
| 368 | 3300046462 | Ga0495651_0061157 | Ga0495651_0061157_1472_2611 | 346 |
| 369 | 3300046516 | Ga0495628_0000275 | Ga0495628_0000275_606_1745 | 346 |
| 370 | 3300049586 | Ga0501070_0025006 | Ga0501070_0025006_3472_4554 | 346 |
| 371 | 3300049590 | Ga0501074_0109209 | Ga0501074_0109209_584_1666 | 346 |
| 372 | 3300031344 | Ga0265316_10000144 | Ga0265316_1000014452 | 347 |
| 373 | 3300037312 | Ga0395899_0017364 | Ga0395899_0017364_700_1830 | 347 |
| 374 | 3300044684 | Ga0466966_0001386 | Ga0466966_0001386_410_1501 | 347 |
| 375 | 3300049572 | Ga0501036_0215968 | Ga0501036_0215968_35_1150 | 347 |
| 376 | 3300005328 | Ga0070676_10000107 | Ga0070676_100001072 | 348 |
| 377 | 3300025254 | Ga0209148_1000310 | Ga0209148_100031059 | 348 |
| 378 | 3300045836 | Ga0466958_0081165 | Ga0466958_0081165_409_1503 | 348 |
| 379 | 3300046463 | Ga0495653_0065887 | Ga0495653_0065887_804_1910 | 348 |
| 380 | 3300046491 | Ga0495584_0000282 | Ga0495584_0000282_18072_19163 | 348 |
| 381 | 3300046529 | Ga0495652_0111872 | Ga0495652_0111872_40_1146 | 348 |
| 382 | 3300046536 | Ga0495587_0002460 | Ga0495587_0002460_485_1591 | 348 |
| 383 | 3300046557 | Ga0495622_0094619 | Ga0495622_0094619_13_1119 | 348 |
| 384 | 3300046674 | Ga0495588_0045558 | Ga0495588_0045558_1070_2176 | 348 |
| 385 | 3300047673 | Ga0495593_0052278 | Ga0495593_0052278_91_1197 | 348 |
| 386 | 3300048088 | Ga0495602_0040487 | Ga0495602_0040487_2615_3721 | 348 |
| 387 | 3300005328 | Ga0070676_10013290 | Ga0070676_100132903 | 349 |
| 388 | 3300005344 | Ga0070661_100071191 | Ga0070661_1000711913 | 349 |
| 389 | 3300005356 | Ga0070674_100181481 | Ga0070674_1001814812 | 349 |
| 390 | 3300005549 | Ga0070704_100080364 | Ga0070704_1000803642 | 349 |
| 391 | 3300005564 | Ga0070664_100029736 | Ga0070664_1000297362 | 349 |
| 392 | 3300005718 | Ga0068866_10092601 | Ga0068866_100926012 | 349 |
| 393 | 3300005719 | Ga0068861_100137085 | Ga0068861_1001370852 | 349 |
| 394 | 3300005841 | Ga0068863_100192639 | Ga0068863_1001926392 | 349 |
| 395 | 3300006358 | Ga0068871_100060324 | Ga0068871_1000603243 | 349 |
| 396 | 3300006881 | Ga0068865_100193812 | Ga0068865_1001938122 | 349 |
| 397 | 3300009094 | Ga0111539_10182477 | Ga0111539_101824773 | 349 |
| 398 | 3300009148 | Ga0105243_10051158 | Ga0105243_100511582 | 349 |
| 399 | 3300009176 | Ga0105242_10185494 | Ga0105242_101854941 | 349 |
| 400 | 3300009177 | Ga0105248_10368971 | Ga0105248_103689712 | 349 |
| 401 | 3300014968 | Ga0157379_10062427 | Ga0157379_100624273 | 349 |
| 402 | 3300025315 | Ga0207697_10041735 | Ga0207697_100417352 | 349 |
| 403 | 3300025893 | Ga0207682_10001976 | Ga0207682_100019765 | 349 |
| 404 | 3300025907 | Ga0207645_10008319 | Ga0207645_100083195 | 349 |
| 405 | 3300025933 | Ga0207706_10021848 | Ga0207706_100218484 | 349 |
| 406 | 3300025935 | Ga0207709_10023056 | Ga0207709_100230563 | 349 |
| 407 | 3300025942 | Ga0207689_10023713 | Ga0207689_100237132 | 349 |
| 408 | 3300026035 | Ga0207703_10077334 | Ga0207703_100773343 | 349 |
| 409 | 3300026116 | Ga0207674_10055401 | Ga0207674_100554013 | 349 |
| 410 | 3300026118 | Ga0207675_100018434 | Ga0207675_1000184345 | 349 |
| 411 | 3300026121 | Ga0207683_10004135 | Ga0207683_100041355 | 349 |
| 412 | 3300031235 | Ga0265330_10063427 | Ga0265330_100634271 | 349 |
| 413 | 3300031238 | Ga0265332_10005253 | Ga0265332_100052536 | 349 |
| 414 | 3300031250 | Ga0265331_10000872 | Ga0265331_1000087215 | 349 |
| 415 | 3300031344 | Ga0265316_10039329 | Ga0265316_100393294 | 349 |
| 416 | 3300031711 | Ga0265314_10000811 | Ga0265314_1000081113 | 349 |
| 417 | 3300031712 | Ga0265342_10003272 | Ga0265342_100032723 | 349 |
| 418 | 3300046501 | Ga0495607_0007031 | Ga0495607_0007031_4533_5627 | 349 |
| 419 | 3300046519 | Ga0495632_0000470 | Ga0495632_0000470_8867_10021 | 349 |
| 420 | 3300046665 | Ga0495661_0000669 | Ga0495661_0000669_26931_28025 | 349 |
| 421 | 3300046684 | Ga0495669_0012842 | Ga0495669_0012842_1888_2988 | 349 |
| 422 | 3300048909 | Ga0496106_0009099 | Ga0496106_0009099_1307_2431 | 349 |
| 423 | 3300048910 | Ga0496107_0008400 | Ga0496107_0008400_1439_2563 | 349 |
| 424 | 3300050511 | nmdc:mga08y16_225982_c1 | nmdc:mga08y16_225982_c1_810_1907 | 349 |
| 425 | 3300005354 | Ga0070675_100296208 | Ga0070675_1002962081 | 350 |
| 426 | 3300005364 | Ga0070673_100337348 | Ga0070673_1003373481 | 350 |
| 427 | 3300005617 | Ga0068859_100048271 | Ga0068859_1000482714 | 350 |
| 428 | 3300005841 | Ga0068863_100142057 | Ga0068863_1001420572 | 350 |
| 429 | 3300005842 | Ga0068858_100341337 | Ga0068858_1003413372 | 350 |
| 430 | 3300006931 | Ga0097620_100048271 | Ga0097620_1000482714 | 350 |
| 431 | 3300009098 | Ga0105245_10378575 | Ga0105245_103785751 | 350 |
| 432 | 3300009176 | Ga0105242_10326519 | Ga0105242_103265191 | 350 |
| 433 | 3300010375 | Ga0105239_10373046 | Ga0105239_103730462 | 350 |
| 434 | 3300013104 | Ga0157370_10013200 | Ga0157370_100132002 | 350 |
| 435 | 3300025927 | Ga0207687_10039735 | Ga0207687_100397353 | 350 |
| 436 | 3300025942 | Ga0207689_10000498 | Ga0207689_1000049823 | 350 |
| 437 | 3300025960 | Ga0207651_10115177 | Ga0207651_101151771 | 350 |
| 438 | 3300026035 | Ga0207703_10074130 | Ga0207703_100741302 | 350 |
| 439 | 3300026089 | Ga0207648_10037375 | Ga0207648_100373755 | 350 |
| 440 | 3300026118 | Ga0207675_100148701 | Ga0207675_1001487012 | 350 |
| 441 | 3300026121 | Ga0207683_10157259 | Ga0207683_101572593 | 350 |
| 442 | 3300042115 | Ga0450911_003384 | Ga0450911_003384_1312_2403 | 350 |
| 443 | 3300047443 | Ga0495687_072804 | Ga0495687_072804_30_1124 | 350 |
| 444 | 3300048927 | Ga0496124_0011069 | Ga0496124_0011069_3799_4977 | 350 |
| 445 | 3300005336 | Ga0070680_100124342 | Ga0070680_1001243423 | 351 |
| 446 | 3300005467 | Ga0070706_100226532 | Ga0070706_1002265322 | 351 |
| 447 | 3300005468 | Ga0070707_100100381 | Ga0070707_1001003813 | 351 |
| 448 | 3300005471 | Ga0070698_100162997 | Ga0070698_1001629972 | 351 |
| 449 | 3300006871 | Ga0075434_100189521 | Ga0075434_1001895212 | 351 |
| 450 | 3300009093 | Ga0105240_10098901 | Ga0105240_100989013 | 351 |
| 451 | 3300025910 | Ga0207684_10158545 | Ga0207684_101585452 | 351 |
| 452 | 3300046452 | Ga0495617_025237 | Ga0495617_025237_408_1547 | 351 |
| 453 | 3300046513 | Ga0495616_0000145 | Ga0495616_0000145_27854_28960 | 351 |
| 454 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_98563_99669 | 351 |
| 455 | 3300046557 | Ga0495622_0008094 | Ga0495622_0008094_1544_2662 | 351 |
| 456 | 3300046665 | Ga0495661_0000271 | Ga0495661_0000271_23813_24919 | 351 |
| 457 | 3300046690 | Ga0495624_0008707 | Ga0495624_0008707_3971_5089 | 351 |
| 458 | 3300046794 | Ga0495589_0000030 | Ga0495589_0000030_119121_120227 | 351 |
| 459 | 3300047315 | Ga0495581_0030726 | Ga0495581_0030726_1906_3024 | 351 |
| 460 | 3300047443 | Ga0495687_000047 | Ga0495687_000047_119123_120229 | 351 |
| 461 | 3300047445 | Ga0495677_0000044 | Ga0495677_0000044_49422_50528 | 351 |
| 462 | 3300048091 | Ga0495626_0000266 | Ga0495626_0000266_23813_24919 | 351 |
| 463 | 3300009551 | Ga0105238_10329535 | Ga0105238_103295352 | 352 |
| 464 | 3300013104 | Ga0157370_10007756 | Ga0157370_100077569 | 352 |
| 465 | 3300037418 | Ga0395900_0275412 | Ga0395900_0275412_290_1396 | 352 |
| 466 | 3300038443 | Ga0395901_0160201 | Ga0395901_0160201_830_1936 | 352 |
| 467 | 3300042007 | Ga0439449_0030812 | Ga0439449_0030812_166_1272 | 352 |
| 468 | iso_pu_bacteria | 2643221556 | 2643797852 | 352 |
| 469 | iso_pu_bacteria | 2643221684 | 2644473032 | 352 |
| 470 | iso_pu_bacteria | 8047673197 | 8047677854 | 352 |
| 471 | 3300005548 | Ga0070665_100090348 | Ga0070665_1000903482 | 353 |
| 472 | 3300038443 | Ga0395901_0000073 | Ga0395901_0000073_128842_129948 | 354 |
| 473 | 3300049575 | Ga0501039_0092038 | Ga0501039_0092038_709_1827 | 354 |
| 474 | 3300049592 | Ga0501076_0103579 | Ga0501076_0103579_883_1995 | 354 |
| 475 | 3300049824 | Ga0501045_0013138 | Ga0501045_0013138_3195_4313 | 354 |
| 476 | 3300061734 | Ga0530510_0252343 | Ga0530510_0252343_139_1257 | 354 |
| 477 | 3300031251 | Ga0265327_10014347 | Ga0265327_100143471 | 355 |
| 478 | 3300046491 | Ga0495584_0006912 | Ga0495584_0006912_3373_4464 | 355 |
| 479 | 3300003322 | rootL2_10004459 | rootL2_1000445911 | 356 |
| 480 | 3300044683 | Ga0466965_0093759 | Ga0466965_0093759_183_1286 | 356 |
| 481 | 3300044684 | Ga0466966_0098183 | Ga0466966_0098183_291_1382 | 356 |
| 482 | 3300044693 | Ga0466961_0084665 | Ga0466961_0084665_839_1933 | 356 |
| 483 | 3300046457 | Ga0495590_0049102 | Ga0495590_0049102_165_1256 | 356 |
| 484 | 3300046474 | Ga0495605_0000085 | Ga0495605_0000085_96902_97993 | 356 |
| 485 | 3300046501 | Ga0495607_0006643 | Ga0495607_0006643_603_1694 | 356 |
| 486 | 3300046522 | Ga0495643_0053901 | Ga0495643_0053901_597_1688 | 356 |
| 487 | 3300046674 | Ga0495588_0000135 | Ga0495588_0000135_30455_31546 | 356 |
| 488 | 3300046694 | Ga0495649_0005677 | Ga0495649_0005677_1789_2880 | 356 |
| 489 | 3300046794 | Ga0495589_0000146 | Ga0495589_0000146_52537_53628 | 356 |
| 490 | 3300046810 | Ga0495660_0000423 | Ga0495660_0000423_28303_29394 | 356 |
| 491 | 3300046810 | Ga0495660_0013336 | Ga0495660_0013336_1316_2407 | 356 |
| 492 | 3300047320 | Ga0495672_0000833 | Ga0495672_0000833_29319_30410 | 356 |
| 493 | 3300047323 | Ga0495683_0014614 | Ga0495683_0014614_1451_2542 | 356 |
| 494 | 3300047443 | Ga0495687_001101 | Ga0495687_001101_18063_19154 | 356 |
| 495 | 3300047445 | Ga0495677_0004496 | Ga0495677_0004496_373_1464 | 356 |
| 496 | 3300048091 | Ga0495626_0000006 | Ga0495626_0000006_246646_247737 | 356 |
| 497 | 3300048925 | Ga0496122_0005566 | Ga0496122_0005566_5178_6281 | 356 |
| 498 | 3300048925 | Ga0496122_0046176 | Ga0496122_0046176_843_1934 | 356 |
| 499 | 3300048927 | Ga0496124_0159427 | Ga0496124_0159427_368_1471 | 356 |
| 500 | 3300049459 | Ga0495678_016577 | Ga0495678_016577_2219_3307 | 356 |
| 501 | 3300061719 | Ga0466962_0029335 | Ga0466962_0029335_1315_2418 | 356 |
| 502 | iso_pu_bacteria | 2808606418 | 2809144341 | 356 |
| 503 | 3300044656 | Ga0466969_0072842 | Ga0466969_0072842_193_1287 | 357 |
| 504 | 3300044684 | Ga0466966_0097680 | Ga0466966_0097680_498_1592 | 357 |
| 505 | 3300046499 | Ga0495594_0007794 | Ga0495594_0007794_1902_3005 | 357 |
| 506 | 3300047472 | Ga0495686_0000334 | Ga0495686_0000334_41949_43037 | 357 |
| 507 | iso_pu_bacteria | 2857553236 | 2857556508 | 357 |
| 508 | iso_pu_bacteria | 2857558681 | 2857561133 | 357 |
| 509 | 3300042139 | Ga0450904_001328 | Ga0450904_001328_2052_3134 | 358 |
| 510 | 3300044658 | Ga0466972_0000029 | Ga0466972_0000029_150256_151338 | 358 |
| 511 | 3300046474 | Ga0495605_0032125 | Ga0495605_0032125_1420_2520 | 358 |
| 512 | 3300046491 | Ga0495584_0033124 | Ga0495584_0033124_1019_2119 | 358 |
| 513 | 3300046501 | Ga0495607_0045014 | Ga0495607_0045014_279_1379 | 358 |
| 514 | 3300046557 | Ga0495622_0029803 | Ga0495622_0029803_823_1932 | 358 |
| 515 | 3300046660 | Ga0495625_0048945 | Ga0495625_0048945_798_1898 | 358 |
| 516 | 3300046674 | Ga0495588_0009117 | Ga0495588_0009117_1170_2279 | 358 |
| 517 | 3300046694 | Ga0495649_0051142 | Ga0495649_0051142_595_1695 | 358 |
| 518 | 3300047321 | Ga0495676_0000105 | Ga0495676_0000105_8762_9871 | 358 |
| 519 | 3300048091 | Ga0495626_0055109 | Ga0495626_0055109_427_1527 | 358 |
| 520 | 3300005563 | Ga0068855_100137369 | Ga0068855_1001373692 | 359 |
| 521 | 3300025230 | Ga0209563_100015 | Ga0209563_100015366 | 359 |
| 522 | 3300025253 | Ga0209677_104532 | Ga0209677_1045324 | 359 |
| 523 | 3300037312 | Ga0395899_0210202 | Ga0395899_0210202_71_1183 | 359 |
| 524 | 3300037418 | Ga0395900_0001738 | Ga0395900_0001738_3349_4461 | 359 |
| 525 | 3300046463 | Ga0495653_0020412 | Ga0495653_0020412_1628_2746 | 359 |
| 526 | 3300046535 | Ga0495586_0001866 | Ga0495586_0001866_2820_3938 | 359 |
| 527 | 3300046663 | Ga0495635_0008207 | Ga0495635_0008207_3698_4816 | 359 |
| 528 | 3300047317 | Ga0495604_0005348 | Ga0495604_0005348_1761_2879 | 359 |
| 529 | 3300047317 | Ga0495604_0060979 | Ga0495604_0060979_1167_2270 | 359 |
| 530 | 3300047322 | Ga0495680_0058986 | Ga0495680_0058986_78_1196 | 359 |
| 531 | 3300047444 | Ga0495675_0002560 | Ga0495675_0002560_9536_10642 | 359 |
| 532 | 3300048089 | Ga0495614_0021545 | Ga0495614_0021545_1615_2733 | 359 |
| 533 | 3300061719 | Ga0466962_0038544 | Ga0466962_0038544_154_1281 | 359 |
| 534 | 3300005366 | Ga0070659_100061803 | Ga0070659_1000618032 | 360 |
| 535 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001836 | 360 |
| 536 | 3300025919 | Ga0207657_10005841 | Ga0207657_1000584110 | 360 |
| 537 | 3300025932 | Ga0207690_10023825 | Ga0207690_100238253 | 360 |
| 538 | 3300025945 | Ga0207679_10169594 | Ga0207679_101695942 | 360 |
| 539 | 3300030745 | Ga0316182_1171920 | Ga0316182_11719202 | 360 |
| 540 | 3300044683 | Ga0466965_0005670 | Ga0466965_0005670_298_1389 | 360 |
| 541 | 3300044684 | Ga0466966_0080082 | Ga0466966_0080082_769_1872 | 360 |
| 542 | 3300044706 | Ga0466964_0018828 | Ga0466964_0018828_1369_2460 | 360 |
| 543 | 3300046455 | Ga0495603_0108741 | Ga0495603_0108741_393_1502 | 360 |
| 544 | 3300046457 | Ga0495590_0007854 | Ga0495590_0007854_950_2059 | 360 |
| 545 | 3300046459 | Ga0495629_0127824 | Ga0495629_0127824_28_1134 | 360 |
| 546 | 3300046463 | Ga0495653_0013215 | Ga0495653_0013215_3465_4589 | 360 |
| 547 | 3300046471 | Ga0495650_0000407 | Ga0495650_0000407_18914_20029 | 360 |
| 548 | 3300046473 | Ga0495582_0027009 | Ga0495582_0027009_1733_2848 | 360 |
| 549 | 3300046491 | Ga0495584_0009798 | Ga0495584_0009798_2202_3305 | 360 |
| 550 | 3300046491 | Ga0495584_0019049 | Ga0495584_0019049_1126_2241 | 360 |
| 551 | 3300046491 | Ga0495584_0054183 | Ga0495584_0054183_749_1864 | 360 |
| 552 | 3300046492 | Ga0495585_0000298 | Ga0495585_0000298_5481_6596 | 360 |
| 553 | 3300046492 | Ga0495585_0080973 | Ga0495585_0080973_220_1335 | 360 |
| 554 | 3300046499 | Ga0495594_0084929 | Ga0495594_0084929_28_1134 | 360 |
| 555 | 3300046500 | Ga0495596_0000902 | Ga0495596_0000902_10302_11417 | 360 |
| 556 | 3300046500 | Ga0495596_0001640 | Ga0495596_0001640_9042_10148 | 360 |
| 557 | 3300046500 | Ga0495596_0005393 | Ga0495596_0005393_2573_3688 | 360 |
| 558 | 3300046507 | Ga0495606_0006538 | Ga0495606_0006538_9027_10127 | 360 |
| 559 | 3300046507 | Ga0495606_0012422 | Ga0495606_0012422_3363_4478 | 360 |
| 560 | 3300046507 | Ga0495606_0042577 | Ga0495606_0042577_32_1168 | 360 |
| 561 | 3300046507 | Ga0495606_0081425 | Ga0495606_0081425_162_1271 | 360 |
| 562 | 3300046517 | Ga0495630_0018018 | Ga0495630_0018018_3679_4788 | 360 |
| 563 | 3300046518 | Ga0495631_0021398 | Ga0495631_0021398_1447_2583 | 360 |
| 564 | 3300046518 | Ga0495631_0041667 | Ga0495631_0041667_154_1269 | 360 |
| 565 | 3300046524 | Ga0495648_0001128 | Ga0495648_0001128_9558_10673 | 360 |
| 566 | 3300046528 | Ga0495642_0005798 | Ga0495642_0005798_3283_4389 | 360 |
| 567 | 3300046536 | Ga0495587_0153838 | Ga0495587_0153838_69_1178 | 360 |
| 568 | 3300046538 | Ga0495609_0003458 | Ga0495609_0003458_4178_5293 | 360 |
| 569 | 3300046557 | Ga0495622_0039112 | Ga0495622_0039112_929_2044 | 360 |
| 570 | 3300046558 | Ga0495633_0006965 | Ga0495633_0006965_3949_5064 | 360 |
| 571 | 3300046558 | Ga0495633_0032470 | Ga0495633_0032470_679_1794 | 360 |
| 572 | 3300046558 | Ga0495633_0074119 | Ga0495633_0074119_144_1250 | 360 |
| 573 | 3300046616 | Ga0495668_0047233 | Ga0495668_0047233_913_2019 | 360 |
| 574 | 3300046648 | Ga0495611_0009166 | Ga0495611_0009166_2658_3761 | 360 |
| 575 | 3300046648 | Ga0495611_0020432 | Ga0495611_0020432_1214_2329 | 360 |
| 576 | 3300046665 | Ga0495661_0017201 | Ga0495661_0017201_29_1144 | 360 |
| 577 | 3300046665 | Ga0495661_0067912 | Ga0495661_0067912_350_1456 | 360 |
| 578 | 3300046674 | Ga0495588_0018879 | Ga0495588_0018879_792_1880 | 360 |
| 579 | 3300046679 | Ga0495623_0009572 | Ga0495623_0009572_4437_5537 | 360 |
| 580 | 3300046684 | Ga0495669_0000168 | Ga0495669_0000168_15423_16529 | 360 |
| 581 | 3300046691 | Ga0495670_0001426 | Ga0495670_0001426_3812_4927 | 360 |
| 582 | 3300046691 | Ga0495670_0024724 | Ga0495670_0024724_15_1130 | 360 |
| 583 | 3300046691 | Ga0495670_0043305 | Ga0495670_0043305_350_1456 | 360 |
| 584 | 3300046794 | Ga0495589_0009346 | Ga0495589_0009346_3707_4822 | 360 |
| 585 | 3300046794 | Ga0495589_0051493 | Ga0495589_0051493_23_1138 | 360 |
| 586 | 3300046794 | Ga0495589_0079407 | Ga0495589_0079407_325_1431 | 360 |
| 587 | 3300047315 | Ga0495581_0001368 | Ga0495581_0001368_4398_5504 | 360 |
| 588 | 3300047318 | Ga0495636_0005805 | Ga0495636_0005805_512_1615 | 360 |
| 589 | 3300047318 | Ga0495636_0019175 | Ga0495636_0019175_1449_2564 | 360 |
| 590 | 3300047320 | Ga0495672_0000351 | Ga0495672_0000351_50829_51944 | 360 |
| 591 | 3300047321 | Ga0495676_0020468 | Ga0495676_0020468_2577_3692 | 360 |
| 592 | 3300047321 | Ga0495676_0069951 | Ga0495676_0069951_107_1222 | 360 |
| 593 | 3300047323 | Ga0495683_0008332 | Ga0495683_0008332_1226_2341 | 360 |
| 594 | 3300047444 | Ga0495675_0042685 | Ga0495675_0042685_530_1714 | 360 |
| 595 | 3300047445 | Ga0495677_0038320 | Ga0495677_0038320_138_1241 | 360 |
| 596 | 3300047470 | Ga0495681_0078515 | Ga0495681_0078515_188_1291 | 360 |
| 597 | 3300048091 | Ga0495626_0003317 | Ga0495626_0003317_2962_4077 | 360 |
| 598 | 3300048927 | Ga0496124_0086568 | Ga0496124_0086568_1215_2315 | 360 |
| 599 | 3300049459 | Ga0495678_000770 | Ga0495678_000770_23397_24497 | 360 |
| 600 | 3300003775 | Ga0055524_1000029 | Ga0055524_1000029113 | 361 |
| 601 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003491 | 361 |
| 602 | 3300021361 | Ga0213872_10001185 | Ga0213872_100011857 | 361 |
| 603 | 3300021361 | Ga0213872_10003823 | Ga0213872_100038236 | 361 |
| 604 | 3300025263 | Ga0209565_1005709 | Ga0209565_10057092 | 361 |
| 605 | 3300025299 | Ga0209256_1000013 | Ga0209256_100001390 | 361 |
| 606 | 3300027666 | Ga0209282_1000002 | Ga0209282_1000002507 | 361 |
| 607 | 3300039447 | Ga0436361_0230232 | Ga0436361_0230232_947_2038 | 361 |
| 608 | 3300039447 | Ga0436361_0678432 | Ga0436361_0678432_91_1179 | 361 |
| 609 | 3300039447 | Ga0436361_0738173 | Ga0436361_0738173_9865_10977 | 361 |
| 610 | 3300039447 | Ga0436361_0752198 | Ga0436361_0752198_184_1272 | 361 |
| 611 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_308713_309807 | 361 |
| 612 | 3300046453 | Ga0495627_000006 | Ga0495627_000006_375137_376225 | 361 |
| 613 | 3300046457 | Ga0495590_0001878 | Ga0495590_0001878_934_2040 | 361 |
| 614 | 3300046463 | Ga0495653_0031535 | Ga0495653_0031535_616_1737 | 361 |
| 615 | 3300046474 | Ga0495605_0000108 | Ga0495605_0000108_72313_73407 | 361 |
| 616 | 3300046492 | Ga0495585_0003086 | Ga0495585_0003086_1541_2656 | 361 |
| 617 | 3300046499 | Ga0495594_0121179 | Ga0495594_0121179_73_1194 | 361 |
| 618 | 3300046500 | Ga0495596_0000186 | Ga0495596_0000186_36733_37854 | 361 |
| 619 | 3300046506 | Ga0495583_0006161 | Ga0495583_0006161_3950_5056 | 361 |
| 620 | 3300046507 | Ga0495606_0014238 | Ga0495606_0014238_4816_5904 | 361 |
| 621 | 3300046513 | Ga0495616_0025320 | Ga0495616_0025320_955_2061 | 361 |
| 622 | 3300046513 | Ga0495616_0077996 | Ga0495616_0077996_307_1428 | 361 |
| 623 | 3300046518 | Ga0495631_0000109 | Ga0495631_0000109_26448_27554 | 361 |
| 624 | 3300046518 | Ga0495631_0002690 | Ga0495631_0002690_98_1213 | 361 |
| 625 | 3300046518 | Ga0495631_0055728 | Ga0495631_0055728_230_1351 | 361 |
| 626 | 3300046519 | Ga0495632_0027304 | Ga0495632_0027304_1086_2207 | 361 |
| 627 | 3300046520 | Ga0495637_0060519 | Ga0495637_0060519_73_1179 | 361 |
| 628 | 3300046522 | Ga0495643_0000233 | Ga0495643_0000233_1862_2950 | 361 |
| 629 | 3300046522 | Ga0495643_0000681 | Ga0495643_0000681_22473_23561 | 361 |
| 630 | 3300046522 | Ga0495643_0021507 | Ga0495643_0021507_212_1315 | 361 |
| 631 | 3300046522 | Ga0495643_0045648 | Ga0495643_0045648_1251_2357 | 361 |
| 632 | 3300046522 | Ga0495643_0050656 | Ga0495643_0050656_145_1233 | 361 |
| 633 | 3300046523 | Ga0495644_0019176 | Ga0495644_0019176_305_1426 | 361 |
| 634 | 3300046524 | Ga0495648_0000220 | Ga0495648_0000220_35947_37041 | 361 |
| 635 | 3300046524 | Ga0495648_0017295 | Ga0495648_0017295_131_1237 | 361 |
| 636 | 3300046524 | Ga0495648_0024967 | Ga0495648_0024967_1266_2354 | 361 |
| 637 | 3300046526 | Ga0495666_0008005 | Ga0495666_0008005_3744_4865 | 361 |
| 638 | 3300046528 | Ga0495642_0006468 | Ga0495642_0006468_1023_2126 | 361 |
| 639 | 3300046529 | Ga0495652_0019949 | Ga0495652_0019949_3573_4694 | 361 |
| 640 | 3300046530 | Ga0495654_0005012 | Ga0495654_0005012_2530_3636 | 361 |
| 641 | 3300046531 | Ga0495665_0007097 | Ga0495665_0007097_1273_2394 | 361 |
| 642 | 3300046538 | Ga0495609_0002590 | Ga0495609_0002590_1888_2976 | 361 |
| 643 | 3300046542 | Ga0495597_0000295 | Ga0495597_0000295_37077_38165 | 361 |
| 644 | 3300046542 | Ga0495597_0002788 | Ga0495597_0002788_1881_2969 | 361 |
| 645 | 3300046542 | Ga0495597_0005790 | Ga0495597_0005790_1912_3006 | 361 |
| 646 | 3300046558 | Ga0495633_0003283 | Ga0495633_0003283_4259_5374 | 361 |
| 647 | 3300046558 | Ga0495633_0011482 | Ga0495633_0011482_788_1909 | 361 |
| 648 | 3300046616 | Ga0495668_0000861 | Ga0495668_0000861_6559_7665 | 361 |
| 649 | 3300046616 | Ga0495668_0002828 | Ga0495668_0002828_7886_8980 | 361 |
| 650 | 3300046642 | Ga0495634_0004452 | Ga0495634_0004452_3714_4835 | 361 |
| 651 | 3300046648 | Ga0495611_0017887 | Ga0495611_0017887_1032_2147 | 361 |
| 652 | 3300046660 | Ga0495625_0009361 | Ga0495625_0009361_3492_4598 | 361 |
| 653 | 3300046660 | Ga0495625_0072038 | Ga0495625_0072038_1106_2227 | 361 |
| 654 | 3300046665 | Ga0495661_0001564 | Ga0495661_0001564_9103_10218 | 361 |
| 655 | 3300046665 | Ga0495661_0003697 | Ga0495661_0003697_6668_7771 | 361 |
| 656 | 3300046665 | Ga0495661_0003800 | Ga0495661_0003800_4554_5660 | 361 |
| 657 | 3300046665 | Ga0495661_0028461 | Ga0495661_0028461_1073_2179 | 361 |
| 658 | 3300046665 | Ga0495661_0030187 | Ga0495661_0030187_516_1610 | 361 |
| 659 | 3300046665 | Ga0495661_0065299 | Ga0495661_0065299_517_1638 | 361 |
| 660 | 3300046665 | Ga0495661_0073882 | Ga0495661_0073882_17_1138 | 361 |
| 661 | 3300046679 | Ga0495623_0001059 | Ga0495623_0001059_15729_16850 | 361 |
| 662 | 3300046691 | Ga0495670_0000350 | Ga0495670_0000350_8986_10101 | 361 |
| 663 | 3300046694 | Ga0495649_0001847 | Ga0495649_0001847_5060_6148 | 361 |
| 664 | 3300046794 | Ga0495589_0001037 | Ga0495589_0001037_11692_12786 | 361 |
| 665 | 3300046794 | Ga0495589_0005214 | Ga0495589_0005214_1677_2771 | 361 |
| 666 | 3300046810 | Ga0495660_0000542 | Ga0495660_0000542_20355_21443 | 361 |
| 667 | 3300046810 | Ga0495660_0014527 | Ga0495660_0014527_3120_4226 | 361 |
| 668 | 3300046810 | Ga0495660_0015172 | Ga0495660_0015172_1168_2274 | 361 |
| 669 | 3300046810 | Ga0495660_0027757 | Ga0495660_0027757_27_1115 | 361 |
| 670 | 3300047320 | Ga0495672_0000206 | Ga0495672_0000206_81278_82366 | 361 |
| 671 | 3300047443 | Ga0495687_000088 | Ga0495687_000088_7227_8339 | 361 |
| 672 | 3300047443 | Ga0495687_027410 | Ga0495687_027410_869_1972 | 361 |
| 673 | 3300047444 | Ga0495675_0007503 | Ga0495675_0007503_1873_2994 | 361 |
| 674 | 3300047445 | Ga0495677_0001661 | Ga0495677_0001661_4758_5873 | 361 |
| 675 | 3300047470 | Ga0495681_0001516 | Ga0495681_0001516_8670_9785 | 361 |
| 676 | 3300047470 | Ga0495681_0010365 | Ga0495681_0010365_2603_3691 | 361 |
| 677 | 3300047470 | Ga0495681_0076773 | Ga0495681_0076773_363_1484 | 361 |
| 678 | 3300048088 | Ga0495602_0014680 | Ga0495602_0014680_3514_4635 | 361 |
| 679 | 3300048091 | Ga0495626_0009306 | Ga0495626_0009306_2423_3544 | 361 |
| 680 | 3300048903 | Ga0496100_0072256 | Ga0496100_0072256_322_1428 | 361 |
| 681 | 3300048904 | Ga0496101_0030633 | Ga0496101_0030633_2482_3588 | 361 |
| 682 | 3300048906 | Ga0496103_0003005 | Ga0496103_0003005_5553_6683 | 361 |
| 683 | 3300048907 | Ga0496104_0220740 | Ga0496104_0220740_521_1681 | 361 |
| 684 | 3300048910 | Ga0496107_0056291 | Ga0496107_0056291_1191_2297 | 361 |
| 685 | 3300048912 | Ga0496109_0261427 | Ga0496109_0261427_306_1412 | 361 |
| 686 | 3300048913 | Ga0496110_0000369 | Ga0496110_0000369_27967_29073 | 361 |
| 687 | 3300048913 | Ga0496110_0151998 | Ga0496110_0151998_14_1120 | 361 |
| 688 | 3300048916 | Ga0496113_0010845 | Ga0496113_0010845_1113_2219 | 361 |
| 689 | 3300048925 | Ga0496122_0003354 | Ga0496122_0003354_7478_8584 | 361 |
| 690 | 3300048926 | Ga0496123_0002554 | Ga0496123_0002554_12635_13741 | 361 |
| 691 | 3300049459 | Ga0495678_000013 | Ga0495678_000013_114305_115393 | 361 |
| 692 | 3300049459 | Ga0495678_000339 | Ga0495678_000339_1860_2948 | 361 |
| 693 | 3300049459 | Ga0495678_001879 | Ga0495678_001879_449_1555 | 361 |
| 694 | 3300049460 | Ga0495682_0030344 | Ga0495682_0030344_11_1117 | 361 |
| 695 | 3300049665 | Ga0501227_000835 | Ga0501227_000835_4689_5786 | 361 |
| 696 | 3300046452 | Ga0495617_000098 | Ga0495617_000098_3605_4759 | 362 |
| 697 | 3300046492 | Ga0495585_0000004 | Ga0495585_0000004_184712_185866 | 362 |
| 698 | 3300046524 | Ga0495648_0000044 | Ga0495648_0000044_96840_97994 | 362 |
| 699 | 3300037418 | Ga0395900_0000729 | Ga0395900_0000729_28494_29666 | 363 |
| 700 | 3300046491 | Ga0495584_0021515 | Ga0495584_0021515_476_1597 | 363 |
| 701 | 3300037312 | Ga0395899_0062812 | Ga0395899_0062812_1336_2451 | 364 |
| 702 | 3300037418 | Ga0395900_0100316 | Ga0395900_0100316_827_1930 | 364 |
| 703 | 3300046453 | Ga0495627_000339 | Ga0495627_000339_14618_15721 | 364 |
| 704 | 3300046500 | Ga0495596_0002100 | Ga0495596_0002100_5978_7081 | 364 |
| 705 | 3300046506 | Ga0495583_0014707 | Ga0495583_0014707_2129_3232 | 364 |
| 706 | 3300046513 | Ga0495616_0007566 | Ga0495616_0007566_1096_2199 | 364 |
| 707 | 3300046518 | Ga0495631_0002244 | Ga0495631_0002244_6561_7664 | 364 |
| 708 | 3300046522 | Ga0495643_0023173 | Ga0495643_0023173_528_1637 | 364 |
| 709 | 3300046523 | Ga0495644_0016225 | Ga0495644_0016225_1376_2479 | 364 |
| 710 | 3300046528 | Ga0495642_0000075 | Ga0495642_0000075_5979_7082 | 364 |
| 711 | 3300046530 | Ga0495654_0033510 | Ga0495654_0033510_208_1311 | 364 |
| 712 | 3300046692 | Ga0495671_0000613 | Ga0495671_0000613_10615_11718 | 364 |
| 713 | 3300047443 | Ga0495687_000166 | Ga0495687_000166_97572_98678 | 364 |
| 714 | 3300047445 | Ga0495677_0003879 | Ga0495677_0003879_1089_2192 | 364 |
| 715 | 3300047470 | Ga0495681_0000404 | Ga0495681_0000404_28322_29425 | 364 |
| 716 | 3300047472 | Ga0495686_0108404 | Ga0495686_0108404_343_1446 | 364 |
| 717 | 3300048905 | Ga0496102_0000508 | Ga0496102_0000508_39661_40764 | 364 |
| 718 | 3300037471 | Ga0395905_0008422 | Ga0395905_0008422_7832_8968 | 365 |
| 719 | 3300046538 | Ga0495609_0000268 | Ga0495609_0000268_24075_25241 | 366 |
| 720 | 3300046492 | Ga0495585_0009766 | Ga0495585_0009766_4160_5323 | 368 |
| 721 | 3300046528 | Ga0495642_0003143 | Ga0495642_0003143_2568_3731 | 368 |
| 722 | 3300046542 | Ga0495597_0019635 | Ga0495597_0019635_652_1815 | 368 |
| 723 | 3300046616 | Ga0495668_0015083 | Ga0495668_0015083_143_1306 | 368 |
| 724 | 3300046665 | Ga0495661_0020189 | Ga0495661_0020189_2457_3620 | 368 |
| 725 | 3300047470 | Ga0495681_0086115 | Ga0495681_0086115_205_1368 | 368 |
| 726 | iso_pu_bacteria | 2643221554 | 2643788594 | 368 |
| 727 | iso_pu_bacteria | 2643221638 | 2644213379 | 368 |
| 728 | 3300046460 | Ga0495638_0031063 | Ga0495638_0031063_880_2076 | 369 |
| 729 | 3300047320 | Ga0495672_0000060 | Ga0495672_0000060_29567_30751 | 369 |
| 730 | 3300002773 | JGI25152J39213_1000113 | JGI25152J39213_100011331 | 371 |
| 731 | 3300002774 | JGI25150J39212_1000548 | JGI25150J39212_10005485 | 371 |
| 732 | 3300002774 | JGI25150J39212_1000864 | JGI25150J39212_10008642 | 371 |
| 733 | 3300002987 | JGI25159J45721_1002871 | JGI25159J45721_10028713 | 371 |
| 734 | 3300003374 | JGI25161J50226_1000555 | JGI25161J50226_10005557 | 371 |
| 735 | 3300003374 | JGI25161J50226_1000906 | JGI25161J50226_10009067 | 371 |
| 736 | 3300003771 | Ga0055526_1002983 | Ga0055526_10029836 | 371 |
| 737 | 3300003773 | Ga0055537_1001054 | Ga0055537_10010546 | 371 |
| 738 | 3300003775 | Ga0055524_1002327 | Ga0055524_10023279 | 371 |
| 739 | 3300003775 | Ga0055524_1002530 | Ga0055524_10025304 | 371 |
| 740 | 3300003784 | Ga0055534_1003065 | Ga0055534_10030653 | 371 |
| 741 | 3300003790 | Ga0055528_1010403 | Ga0055528_10104033 | 371 |
| 742 | 3300003791 | Ga0055530_10003244 | Ga0055530_100032444 | 371 |
| 743 | 3300003794 | Ga0055531_10001264 | Ga0055531_100012642 | 371 |
| 744 | 3300004625 | Ga0055543_1000334 | Ga0055543_100033416 | 371 |
| 745 | 3300005262 | Ga0065165_1001090 | Ga0065165_100109016 | 371 |
| 746 | 3300025208 | Ga0209436_100782 | Ga0209436_10078210 | 371 |
| 747 | 3300025208 | Ga0209436_101271 | Ga0209436_1012715 | 371 |
| 748 | 3300025245 | Ga0207425_1000006 | Ga0207425_1000006140 | 371 |
| 749 | 3300025245 | Ga0207425_1000136 | Ga0207425_100013635 | 371 |
| 750 | 3300025245 | Ga0207425_1000533 | Ga0207425_10005334 | 371 |
| 751 | 3300025258 | Ga0209129_1000090 | Ga0209129_1000090140 | 371 |
| 752 | 3300025263 | Ga0209565_1000382 | Ga0209565_100038221 | 371 |
| 753 | 3300025263 | Ga0209565_1000431 | Ga0209565_100043115 | 371 |
| 754 | 3300025263 | Ga0209565_1003896 | Ga0209565_10038962 | 371 |
| 755 | 3300025273 | Ga0209673_1018787 | Ga0209673_10187873 | 371 |
| 756 | 3300025284 | Ga0209130_1000809 | Ga0209130_100080911 | 371 |
| 757 | 3300025284 | Ga0209130_1000987 | Ga0209130_100098710 | 371 |
| 758 | 3300025284 | Ga0209130_1001171 | Ga0209130_10011712 | 371 |
| 759 | 3300025291 | Ga0209675_1001081 | Ga0209675_10010814 | 371 |
| 760 | 3300025291 | Ga0209675_1003168 | Ga0209675_10031683 | 371 |
| 761 | 3300025295 | Ga0209564_1000639 | Ga0209564_100063914 | 371 |
| 762 | 3300025295 | Ga0209564_1000888 | Ga0209564_100088823 | 371 |
| 763 | 3300025297 | Ga0209758_1000047 | Ga0209758_1000047200 | 371 |
| 764 | 3300025298 | Ga0209050_1000469 | Ga0209050_100046942 | 371 |
| 765 | 3300025299 | Ga0209256_1000863 | Ga0209256_100086333 | 371 |
| 766 | 3300025299 | Ga0209256_1001470 | Ga0209256_100147011 | 371 |
| 767 | 3300025299 | Ga0209256_1002052 | Ga0209256_10020522 | 371 |
| 768 | 3300025302 | Ga0207426_1003550 | Ga0207426_10035504 | 371 |
| 769 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010687 | 371 |
| 770 | 3300031548 | Ga0307408_100001016 | Ga0307408_1000010166 | 371 |
| 771 | 3300031548 | Ga0307408_100003907 | Ga0307408_10000390710 | 371 |
| 772 | 3300047443 | Ga0495687_005231 | Ga0495687_005231_4097_5239 | 371 |
| 773 | iso_pu_bacteria | 2643221603 | 2644027905 | 371 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t8y-assembly1.cif.gz_A | structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. | 0.8976 | 20 | 370 |
| 5t8y-assembly1.cif.gz_A | structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. | 0.8189 | 20 | 370 |
| 5d0b-assembly2.cif.gz_B | crystal structure of epoxyqueuosine reductase with a trna-tyr epoxyqueuosine-modified trna stem loop | 0.7991 | 20 | 370 |
| 5t8y-assembly2.cif.gz_B | structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. | 0.7933 | 20 | 370 |
| 4k92-assembly2.cif.gz_B | a cryptic tog domain with a distinct architecture underlies clasp-dependent bipolar spindle formation | 0.7784 | 320 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L292_1_124_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8842 | 320 | 370 | 1.25.10.10 |
| af_P0CL83_5_173_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8656 | 321 | 370 | 1.25.10.10 |
| af_Q54CL0_46_602_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8521 | 295 | 370 | 1.25.10.10 |
| af_Q8I701_33_189_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8294 | 295 | 370 | 1.25.10.10 |
| af_A0A1D6H7Y0_14_292_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.8165 | 321 | 370 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5F0LUD1-F1-model_v4 | Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) | 0.9851 | 18 | 371 |
GO:0005737
GO:0006400 GO:0008616 GO:0031419 GO:0046872 GO:0051539 GO:0052693 |
| AF-A0A223PEC3-F1-model_v4 | Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) | 0.9846 | 18 | 371 |
GO:0005737
GO:0006400 GO:0008616 GO:0031419 GO:0046872 GO:0051539 GO:0052693 |
| AF-A0A515DHD9-F1-model_v4 | Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) | 0.9825 | 20 | 369 |
GO:0005737
GO:0006400 GO:0008616 GO:0031419 GO:0046872 GO:0051539 GO:0052693 |
| AF-A0A0U3DAP3-F1-model_v4 | Epoxyqueuosine reductase (EC 1.17.99.6) (Queuosine biosynthesis protein QueG) | 0.9807 | 20 | 371 |
GO:0005737
GO:0006400 GO:0008616 GO:0031419 GO:0046872 GO:0051539 GO:0052693 |
| AF-A0A377RRE3-F1-model_v4 | Epoxyqueuosine reductase (EC 1.1.-.-) | 0.9798 | 172 | 370 |
GO:0008033
GO:0008616 GO:0046872 GO:0051539 GO:0052693 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar