F480109

General Info

Members Datasets Scaffolds Average Seq Length
772 390 1544 410

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10106412|Ga0111539_101064122
Length 437
Sequence VTVAPERPRTWANVDPSLLRGGPIYEGTRIPHPIPTILEVSDEVRATDDILTVNFGPNHPSTHGVLRLIVDLDGETVVGVRAIIGYLHTGFEKNMEAKTWWKGITYGPRIDYVSFQNNELVFVLAVEKLLQLETPEKAVWMRTLLAELNRIHSHLVWLGTSGLELGAISMFWYCFRERDQILDLFELVTGYRMHTRYFQVGGLAEDIPDGFYAECRKFVDWMPRALDDYLGLLDRNPIWLERTKGVGLLSAEDAVAMGQSGPVLRASGVDWDNRKRSPYLAYDQVDFDVPVYPEGDTYARYRVHMDEMAQSVRIVEQCLDRLEELRDGPWIADDRKVVLPPRHELHTSMESLIHHFKIVTEGYRVPEGEVYTVIESPRGENGCYVVSDGGPRPWRVKFRAPSFVATPMAAVMCNGILVADMIAVIGSLDTVMGEVDR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
331 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
337 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
341 2643221647 Streptomyces sp. Root369 Isolate Unclassified
342 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
343 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
344 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
345 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
346 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
347 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
348 2808606448 Streptomyces sp. 193411 Isolate Unclassified
349 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
350 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
351 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
352 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
353 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
354 2862574272 Streptomyces sp. AcE210 Isolate Nodule
355 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
356 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
357 2867369537 Streptomyces sp. Z26 Isolate Unclassified
358 2867428634 Streptomyces sp. RP5T Isolate Unclassified
359 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
360 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
361 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
362 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
363 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
364 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
365 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
366 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
367 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
368 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
369 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
370 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
371 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
372 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
373 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
374 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
375 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
376 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
377 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
378 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
379 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
380 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
381 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
382 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
383 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
384 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
385 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
386 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
387 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
388 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
389 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
390 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.13
Metatranscriptomes 0.26
Isolates 6.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0.39
Rhizoplane 9.33
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10106412 3300009094 Bacteria 3290
2 ARcpr5oldR_c001385 3300000041 Bacteria 2449
3 ARcpr5yngRDRAFT_c001296 3300000043 Bacteria 2778
4 ARSoilOldRDRAFT_c001312 3300000044 Bacteria 2329
5 Ga0006562J51391_1035120 3300003578 Bacteria 1970
6 Ga0006562J51391_1035122 3300003578 Bacteria 9580
7 Ga0070658_10015063 3300005327 Bacteria 6188
8 Ga0070658_10016206 3300005327 Bacteria 5962
9 Ga0070683_100008132 3300005329 Bacteria 8908
10 Ga0070683_100020240 3300005329 Bacteria 5920
11 Ga0070683_100075139 3300005329 Bacteria 3157
12 Ga0068869_100105477 3300005334 Bacteria 2137
13 Ga0070680_100010144 3300005336 Bacteria 7262
14 Ga0070680_100096901 3300005336 Bacteria 2445
15 Ga0070682_100094833 3300005337 Bacteria 1958
16 Ga0070682_100113219 3300005337 Bacteria 1812
17 Ga0068868_100084428 3300005338 Bacteria 2550
18 Ga0068868_100233437 3300005338 Bacteria 1544
19 Ga0068868_100251514 3300005338 Bacteria 1487
20 Ga0070660_100039145 3300005339 Bacteria 3602
21 Ga0070660_100094178 3300005339 Bacteria 2366
22 Ga0070689_100036534 3300005340 Bacteria 3758
23 Ga0070691_10002704 3300005341 Bacteria 7901
24 Ga0070691_10040359 3300005341 Bacteria 2205
25 Ga0070687_100101825 3300005343 Bacteria 1609
26 Ga0070661_100020187 3300005344 Bacteria 4750
27 Ga0070668_100012259 3300005347 Bacteria 6387
28 Ga0070671_100037278 3300005355 Bacteria 4031
29 Ga0070671_100067798 3300005355 Bacteria 2975
30 Ga0070671_100176526 3300005355 Bacteria 1808
31 Ga0070659_100014825 3300005366 Bacteria 5828
32 Ga0070659_100047003 3300005366 Bacteria 3384
33 Ga0070659_100091451 3300005366 Bacteria 2439
34 Ga0070703_10007546 3300005406 Bacteria 3055
35 Ga0070714_100016643 3300005435 Bacteria 5943
36 Ga0070713_100002608 3300005436 Bacteria 11779
37 Ga0070710_10032165 3300005437 Bacteria 2839
38 Ga0070705_100024733 3300005440 Bacteria 3246
39 Ga0070700_100043859 3300005441 Bacteria 2752
40 Ga0070708_100019534 3300005445 Bacteria 5696
41 Ga0070678_100029847 3300005456 Bacteria 3739
42 Ga0070662_100002641 3300005457 Bacteria 11051
43 Ga0070662_100092736 3300005457 Bacteria 2270
44 Ga0070681_10003419 3300005458 Bacteria 14871
45 Ga0070681_10012572 3300005458 Bacteria 8400
46 Ga0070681_10027200 3300005458 Bacteria 5751
47 Ga0070681_10168940 3300005458 Bacteria 2109
48 Ga0068867_100009644 3300005459 Bacteria 6806
49 Ga0070706_100101363 3300005467 Bacteria 2675
50 Ga0070707_100033547 3300005468 Bacteria 4896
51 Ga0070698_100008838 3300005471 Bacteria 10835
52 Ga0070698_100053383 3300005471 Bacteria 4107
53 Ga0070699_100052819 3300005518 Bacteria 3516
54 Ga0070699_100079565 3300005518 Bacteria 2855
55 Ga0070679_100009974 3300005530 Bacteria 8991
56 Ga0070679_100011004 3300005530 Bacteria 8600
57 Ga0070679_100024397 3300005530 Bacteria 5925
58 Ga0070679_100029047 3300005530 Bacteria 5454
59 Ga0070679_100029602 3300005530 Bacteria 5402
60 Ga0070679_100072153 3300005530 Bacteria 3444
61 Ga0070679_100075147 3300005530 Bacteria 3369
62 Ga0070679_100153389 3300005530 Bacteria 2279
63 Ga0070684_100008653 3300005535 Bacteria 7974
64 Ga0070684_100036248 3300005535 Bacteria 4226
65 Ga0070684_100122358 3300005535 Bacteria 2341
66 Ga0068853_100047525 3300005539 Bacteria 3682
67 Ga0068853_100115000 3300005539 Bacteria 2394
68 Ga0070672_100077560 3300005543 Bacteria 2657
69 Ga0070686_100054188 3300005544 Bacteria 2564
70 Ga0070695_100020417 3300005545 Bacteria 4045
71 Ga0070695_100052827 3300005545 Bacteria 2612
72 Ga0070696_100063122 3300005546 Bacteria 2594
73 Ga0070696_100102415 3300005546 Bacteria 2053
74 Ga0070693_100128546 3300005547 Bacteria 1580
75 Ga0068855_100024569 3300005563 Bacteria 7208
76 Ga0068855_100073422 3300005563 Bacteria 3974
77 Ga0068855_100088467 3300005563 Bacteria 3577
78 Ga0068857_100090175 3300005577 Bacteria 2743
79 Ga0068854_100113673 3300005578 Bacteria 2045
80 Ga0068854_100162589 3300005578 Bacteria 1730
81 Ga0068856_100069237 3300005614 Bacteria 3489
82 Ga0068856_100254667 3300005614 Bacteria 1770
83 Ga0070702_100018760 3300005615 Bacteria 3594
84 Ga0070702_100036937 3300005615 Bacteria 2711
85 Ga0070702_100040627 3300005615 Bacteria 2603
86 Ga0068852_100079647 3300005616 Bacteria 2902
87 Ga0068864_100113330 3300005618 Bacteria 2417
88 Ga0068861_100001783 3300005719 Bacteria 13846
89 Ga0068870_10051347 3300005840 Bacteria 2182
90 Ga0081455_10019559 3300005937 Bacteria 6403
91 Ga0081540_1014346 3300005983 Bacteria 5081
92 Ga0081539_10000200 3300005985 Bacteria 139291
93 Ga0081539_10000867 3300005985 Bacteria 57938
94 Ga0075368_10048035 3300006042 Bacteria 1691
95 Ga0075432_10003491 3300006058 Bacteria 5320
96 Ga0070715_10008364 3300006163 Bacteria 3603
97 Ga0070716_100009248 3300006173 Bacteria 4910
98 Ga0070716_100037807 3300006173 Bacteria 2669
99 Ga0070716_100046618 3300006173 Bacteria 2440
100 Ga0070712_100001482 3300006175 Bacteria 14325
101 Ga0075367_10001380 3300006178 Bacteria 10368
102 Ga0075367_10128397 3300006178 Bacteria 1566
103 Ga0097621_100149288 3300006237 Bacteria 2004
104 Ga0075370_10008702 3300006353 Bacteria 5234
105 Ga0075428_100021918 3300006844 Bacteria 7074
106 Ga0075428_100037530 3300006844 Bacteria 5334
107 Ga0075428_100095575 3300006844 Bacteria 3239
108 Ga0075430_100073420 3300006846 Bacteria 2869
109 Ga0075430_100077560 3300006846 Bacteria 2785
110 Ga0075430_100169274 3300006846 Bacteria 1817
111 Ga0075431_100001660 3300006847 Bacteria 20853
112 Ga0075433_10043840 3300006852 Bacteria 3885
113 Ga0075433_10047878 3300006852 Bacteria 3718
114 Ga0075433_10164838 3300006852 Bacteria 1972
115 Ga0075433_10186095 3300006852 Bacteria 1848
116 Ga0075434_100029826 3300006871 Bacteria 5369
117 Ga0075434_100244620 3300006871 Bacteria 1814
118 Ga0075429_100223356 3300006880 Bacteria 1650
119 Ga0068865_100011940 3300006881 Bacteria 5453
120 Ga0075436_100186824 3300006914 Bacteria 1466
121 Ga0075435_100025556 3300007076 Bacteria 4597
122 Ga0105244_10080448 3300009036 Bacteria 1614
123 Ga0105240_10076875 3300009093 Bacteria 4114
124 Ga0105240_10129459 3300009093 Bacteria 3029
125 Ga0111539_10008714 3300009094 Bacteria 12869
126 Ga0111539_10035748 3300009094 Bacteria 6013
127 Ga0111539_10180389 3300009094 Bacteria 2466
128 Ga0105245_10071821 3300009098 Bacteria 3144
129 Ga0105245_10227388 3300009098 Bacteria 1803
130 Ga0114129_10008166 3300009147 Bacteria 14913
131 Ga0114129_10018159 3300009147 Bacteria 10015
132 Ga0105243_10011008 3300009148 Bacteria 6839
133 Ga0105243_10112217 3300009148 Bacteria 2283
134 Ga0105243_10365336 3300009148 Bacteria 1330
135 Ga0105248_10088431 3300009177 Bacteria 3486
136 Ga0105248_10135629 3300009177 Bacteria 2776
137 Ga0105237_10129677 3300009545 Bacteria 2516
138 Ga0105238_10072267 3300009551 Bacteria 3446
139 Ga0105238_10191878 3300009551 Bacteria 2019
140 Ga0105238_10337403 3300009551 Bacteria 1495
141 Ga0105249_10001703 3300009553 Bacteria 19257
142 Ga0105239_10072822 3300010375 Bacteria 3778
143 Ga0157373_10060213 3300013100 Bacteria 2690
144 Ga0157373_10097746 3300013100 Bacteria 2067
145 Ga0157371_10134136 3300013102 Bacteria 1763
146 Ga0157370_10037029 3300013104 Bacteria 4732
147 Ga0157369_10020280 3300013105 Bacteria 7429
148 Ga0157369_10030859 3300013105 Bacteria 5908
149 Ga0157374_10147360 3300013296 Bacteria 2287
150 Ga0157378_10185890 3300013297 Bacteria 1957
151 Ga0163162_10038088 3300013306 Bacteria 4799
152 Ga0163162_10090462 3300013306 Bacteria 3142
153 Ga0163162_10263829 3300013306 Bacteria 1854
154 Ga0157372_10021088 3300013307 Bacteria 7037
155 Ga0157380_10006119 3300014326 Bacteria 8436
156 Ga0157380_10028368 3300014326 Bacteria 4266
157 Ga0157380_10142338 3300014326 Bacteria 2062
158 Ga0157376_10011084 3300014969 Bacteria 6629
159 Ga0163161_10043707 3300017792 Bacteria 3226
160 Ga0213875_10017925 3300021388 Bacteria 3417
161 Ga0207426_1003642 3300025302 Bacteria 8146
162 Ga0207426_1009984 3300025302 Bacteria 3715
163 Ga0207653_10014440 3300025885 Bacteria 2478
164 Ga0207692_10094910 3300025898 Bacteria 1625
165 Ga0207688_10008324 3300025901 Bacteria 5640
166 Ga0207647_10041315 3300025904 Bacteria 2901
167 Ga0207645_10051435 3300025907 Bacteria 2632
168 Ga0207643_10037285 3300025908 Bacteria 2728
169 Ga0207705_10005496 3300025909 Bacteria 9479
170 Ga0207705_10012310 3300025909 Bacteria 6180
171 Ga0207705_10012655 3300025909 Bacteria 6089
172 Ga0207705_10118873 3300025909 Bacteria 1959
173 Ga0207684_10017162 3300025910 Bacteria 6213
174 Ga0207707_10007563 3300025912 Bacteria 9464
175 Ga0207707_10014298 3300025912 Bacteria 6912
176 Ga0207707_10019074 3300025912 Bacteria 5985
177 Ga0207707_10024976 3300025912 Bacteria 5228
178 Ga0207707_10051905 3300025912 Bacteria 3571
179 Ga0207707_10200886 3300025912 Bacteria 1738
180 Ga0207695_10179577 3300025913 Bacteria 2038
181 Ga0207671_10213070 3300025914 Bacteria 1512
182 Ga0207693_10001016 3300025915 Bacteria 25132
183 Ga0207693_10003173 3300025915 Bacteria 14125
184 Ga0207693_10003612 3300025915 Bacteria 13208
185 Ga0207663_10135480 3300025916 Bacteria 1708
186 Ga0207660_10017699 3300025917 Bacteria 4740
187 Ga0207660_10018755 3300025917 Bacteria 4618
188 Ga0207660_10120870 3300025917 Bacteria 1983
189 Ga0207657_10005284 3300025919 Bacteria 13530
190 Ga0207657_10007571 3300025919 Bacteria 11131
191 Ga0207657_10016238 3300025919 Bacteria 7185
192 Ga0207657_10046528 3300025919 Bacteria 3799
193 Ga0207657_10062709 3300025919 Bacteria 3181
194 Ga0207657_10211805 3300025919 Bacteria 1555
195 Ga0207649_10074133 3300025920 Bacteria 2183
196 Ga0207649_10199578 3300025920 Bacteria 1412
197 Ga0207652_10018126 3300025921 Bacteria 5771
198 Ga0207652_10032369 3300025921 Bacteria 4395
199 Ga0207652_10076750 3300025921 Bacteria 2914
200 Ga0207646_10001072 3300025922 Bacteria 34848
201 Ga0207646_10027364 3300025922 Bacteria 5201
202 Ga0207659_10126301 3300025926 Bacteria 1967
203 Ga0207687_10073140 3300025927 Bacteria 2454
204 Ga0207687_10135866 3300025927 Bacteria 1859
205 Ga0207700_10000001 3300025928 Bacteria 1122509
206 Ga0207700_10080444 3300025928 Bacteria 2541
207 Ga0207644_10110037 3300025931 Bacteria 2082
208 Ga0207690_10011819 3300025932 Bacteria 5221
209 Ga0207690_10051892 3300025932 Bacteria 2744
210 Ga0207690_10086031 3300025932 Bacteria 2208
211 Ga0207706_10014850 3300025933 Bacteria 7051
212 Ga0207709_10040500 3300025935 Bacteria 2790
213 Ga0207665_10008523 3300025939 Bacteria 6750
214 Ga0207691_10019105 3300025940 Bacteria 6489
215 Ga0207711_10175355 3300025941 Bacteria 1947
216 Ga0207711_10219911 3300025941 Bacteria 1737
217 Ga0207711_10232798 3300025941 Bacteria 1688
218 Ga0207661_10008048 3300025944 Bacteria 7513
219 Ga0207667_10054593 3300025949 Bacteria 4202
220 Ga0207667_10107278 3300025949 Bacteria 2881
221 Ga0207667_10117968 3300025949 Bacteria 2735
222 Ga0207667_10203569 3300025949 Bacteria 2030
223 Ga0207651_10040296 3300025960 Bacteria 3089
224 Ga0207712_10007048 3300025961 Bacteria 7092
225 Ga0207712_10038933 3300025961 Bacteria 3254
226 Ga0207668_10027466 3300025972 Bacteria 3707
227 Ga0207640_10057756 3300025981 Bacteria 2554
228 Ga0207640_10090370 3300025981 Bacteria 2119
229 Ga0207639_10026202 3300026041 Bacteria 4236
230 Ga0207708_10016026 3300026075 Bacteria 5629
231 Ga0207708_10047470 3300026075 Bacteria 3269
232 Ga0207702_10037641 3300026078 Bacteria 4050
233 Ga0207648_10020479 3300026089 Bacteria 5955
234 Ga0207648_10024817 3300026089 Bacteria 5347
235 Ga0207676_10118178 3300026095 Bacteria 2231
236 Ga0207675_100044599 3300026118 Bacteria 4144
237 Ga0207675_100050780 3300026118 Bacteria 3870
238 Ga0207683_10051131 3300026121 Bacteria 3620
239 Ga0207683_10137781 3300026121 Bacteria 2197
240 Ga0207698_10180544 3300026142 Bacteria 1869
241 Ga0209813_10013231 3300027866 Bacteria 2199
242 Ga0207428_10000244 3300027907 Bacteria 74209
243 Ga0207428_10027943 3300027907 Bacteria 4692
244 Ga0207428_10104805 3300027907 Bacteria 2182
245 Ga0268266_10046859 3300028379 Bacteria 3701
246 Ga0307517_10008770 3300028786 Bacteria 14457
247 Ga0307515_10073513 3300028794 Bacteria 4593
248 Ga0307513_10074778 3300031456 Bacteria 3521
249 Ga0307408_100030330 3300031548 Bacteria 3754
250 Ga0307508_10011891 3300031616 Bacteria 7960
251 Ga0307514_10021200 3300031649 Bacteria 5299
252 Ga0307516_10137883 3300031730 Bacteria 2212
253 Ga0307405_10074579 3300031731 Bacteria 2194
254 Ga0316577_10063287 3300031733 Bacteria 2066
255 Ga0307413_10005959 3300031824 Bacteria 5512
256 Ga0307518_10030990 3300031838 Bacteria 3874
257 Ga0307410_10013107 3300031852 Bacteria 4824
258 Ga0307412_10014671 3300031911 Bacteria 4629
259 Ga0307416_100032245 3300032002 Bacteria 3955
260 Ga0307411_10007234 3300032005 Bacteria 5632
261 Ga0307507_10145581 3300033179 Bacteria 1801
262 Ga0373928_0003310 3300035084 Bacteria 3085
263 Ga0373940_0002686 3300035088 Bacteria 3507
264 Ga0373949_0020994 3300035090 Bacteria 1498
265 Ga0373951_0011866 3300035091 Bacteria 1959
266 Ga0373952_0002257 3300035092 Bacteria 3470
267 Ga0373932_0007715 3300035112 Bacteria 2567
268 Ga0373939_0002179 3300035114 Bacteria 4639
269 Ga0373939_0016692 3300035114 Bacteria 1940
270 Ga0373941_0022527 3300035115 Bacteria 1788
271 Ga0373945_0045937 3300035116 Bacteria 1592
272 Ga0373943_0000299 3300035170 Bacteria 20623
273 Ga0373946_0001582 3300035171 Bacteria 7930
274 Ga0373955_0033805 3300035172 Bacteria 2695
275 Ga0373942_0005086 3300035207 Bacteria 3050
276 Ga0373961_0008730 3300035241 Bacteria 2468
277 Ga0373931_0006511 3300035691 Bacteria 5458
278 Ga0373935_0012369 3300035692 Bacteria 5136
279 Ga0373947_0000185 3300035725 Bacteria 34341
280 Ga0373947_0007323 3300035725 Bacteria 6389
281 Ga0373925_0006691 3300037068 Bacteria 8454
282 Ga0373925_0075134 3300037068 Bacteria 2560
283 Ga0373925_0159247 3300037068 Bacteria 1777
284 Ga0395899_0006920 3300037312 Bacteria 8784
285 Ga0395899_0007215 3300037312 Bacteria 8603
286 Ga0395899_0011411 3300037312 Bacteria 6803
287 Ga0395899_0013616 3300037312 Bacteria 6218
288 Ga0395900_0000528 3300037418 Bacteria 53945
289 Ga0395900_0002771 3300037418 Bacteria 19158
290 Ga0395900_0025290 3300037418 Bacteria 6078
291 Ga0395900_0025854 3300037418 Bacteria 6010
292 Ga0395900_0040788 3300037418 Bacteria 4784
293 Ga0395900_0054193 3300037418 Bacteria 4129
294 Ga0395900_0055681 3300037418 Bacteria 4072
295 Ga0395900_0057266 3300037418 Bacteria 4012
296 Ga0395900_0068954 3300037418 Bacteria 3634
297 Ga0395900_0076411 3300037418 Bacteria 3442
298 Ga0395900_0092986 3300037418 Bacteria 3098
299 Ga0395900_0098804 3300037418 Bacteria 2999
300 Ga0395900_0102055 3300037418 Bacteria 2947
301 Ga0395900_0154139 3300037418 Bacteria 2347
302 Ga0395898_0001875 3300037466 Bacteria 26866
303 Ga0395898_0002139 3300037466 Bacteria 24346
304 Ga0395898_0003526 3300037466 Bacteria 17447
305 Ga0395898_0003680 3300037466 Bacteria 17031
306 Ga0395898_0012709 3300037466 Bacteria 8695
307 Ga0395898_0016068 3300037466 Bacteria 7668
308 Ga0395898_0021434 3300037466 Bacteria 6553
309 Ga0395898_0021753 3300037466 Bacteria 6499
310 Ga0395898_0067339 3300037466 Bacteria 3467
311 Ga0395898_0091834 3300037466 Bacteria 2920
312 Ga0395898_0311983 3300037466 Bacteria 1500
313 Ga0395905_0000661 3300037471 Bacteria 45819
314 Ga0395905_0005716 3300037471 Bacteria 12642
315 Ga0395905_0006912 3300037471 Bacteria 11345
316 Ga0395905_0009554 3300037471 Bacteria 9471
317 Ga0395905_0021602 3300037471 Bacteria 6086
318 Ga0395905_0031768 3300037471 Bacteria 4968
319 Ga0395905_0042861 3300037471 Bacteria 4246
320 Ga0395905_0053172 3300037471 Bacteria 3791
321 Ga0395905_0073662 3300037471 Bacteria 3201
322 Ga0436364_1424714 3300037853 Bacteria 20926
323 Ga0395901_0001057 3300038443 Bacteria 29607
324 Ga0395901_0001983 3300038443 Bacteria 21042
325 Ga0395901_0005247 3300038443 Bacteria 13081
326 Ga0395901_0010426 3300038443 Bacteria 9415
327 Ga0395901_0012794 3300038443 Bacteria 8510
328 Ga0395901_0019001 3300038443 Bacteria 7025
329 Ga0395901_0021701 3300038443 Bacteria 6579
330 Ga0395901_0027883 3300038443 Bacteria 5806
331 Ga0395901_0046191 3300038443 Bacteria 4522
332 Ga0395901_0049126 3300038443 Bacteria 4382
333 Ga0395901_0091435 3300038443 Bacteria 3185
334 Ga0395901_0157721 3300038443 Bacteria 2383
335 Ga0395901_0176364 3300038443 Bacteria 2242
336 Ga0395901_0212120 3300038443 Bacteria 2026
337 Ga0395901_0236488 3300038443 Bacteria 1906
338 Ga0395901_0313033 3300038443 Bacteria 1625
339 Ga0242420_000637 3300038996 Bacteria 4102
340 Ga0436365_0868245 3300039437 Bacteria 1985
341 Ga0436365_1320454 3300039437 Bacteria 1393
342 Ga0439436_0000548 3300041404 Bacteria 9885
343 Ga0439436_0002790 3300041404 Bacteria 5283
344 Ga0439439_0005529 3300041406 Bacteria 2889
345 Ga0451837_1533153 3300041494 Bacteria 1500
346 Ga0451839_0165057 3300041496 Bacteria 2945
347 Ga0451847_0111370 3300041503 Bacteria 3495
348 Ga0451849_0650206 3300041505 Bacteria 2930
349 Ga0451855_1406534 3300041511 Bacteria 3231
350 Ga0451853_0938959 3300041512 Bacteria 1878
351 Ga0439433_0000982 3300041999 Bacteria 5740
352 Ga0439457_000625 3300042014 Bacteria 10447
353 Ga0439458_0000467 3300042157 Bacteria 10310
354 Ga0466969_0048588 3300044656 Bacteria 2097
355 Ga0466965_0093234 3300044683 Bacteria 1534
356 Ga0466966_0025154 3300044684 Bacteria 3890
357 Ga0466966_0049536 3300044684 Bacteria 2676
358 Ga0466966_0054794 3300044684 Bacteria 2525
359 Ga0466961_0005145 3300044693 Bacteria 8227
360 Ga0466963_0000425 3300044694 Bacteria 19423
361 Ga0466963_0022160 3300044694 Bacteria 4020
362 Ga0466963_0050178 3300044694 Bacteria 2762
363 Ga0466963_0086844 3300044694 Bacteria 2126
364 Ga0466964_0005916 3300044706 Bacteria 4554
365 Ga0466968_0011262 3300044735 Bacteria 3483
366 Ga0466968_0047178 3300044735 Bacteria 1831
367 Ga0466957_0007534 3300044842 Bacteria 6150
368 Ga0466957_0103032 3300044842 Bacteria 1801
369 Ga0466960_0048131 3300044901 Bacteria 2048
370 Ga0466960_0080296 3300044901 Bacteria 1642
371 Ga0466959_0024988 3300045049 Bacteria 4425
372 Ga0466959_0038560 3300045049 Bacteria 3531
373 Ga0466959_0061002 3300045049 Bacteria 2743
374 Ga0466959_0072170 3300045049 Bacteria 2499
375 Ga0466959_0110908 3300045049 Bacteria 1958
376 Ga0451576_0237297 3300045051 Bacteria 1904
377 Ga0466958_0028850 3300045836 Bacteria 3293
378 Ga0466967_0000455 3300045976 Bacteria 19649
379 Ga0466967_0003231 3300045976 Bacteria 10538
380 Ga0466967_0013456 3300045976 Bacteria 6323
381 Ga0466967_0017725 3300045976 Bacteria 5666
382 Ga0466967_0033564 3300045976 Bacteria 4345
383 Ga0466967_0049751 3300045976 Bacteria 3667
384 Ga0466967_0061889 3300045976 Bacteria 3321
385 Ga0495603_0001553 3300046455 Bacteria 13437
386 Ga0495603_0014904 3300046455 Bacteria 4702
387 Ga0495603_0085874 3300046455 Bacteria 1842
388 Ga0495629_0000403 3300046459 Bacteria 36268
389 Ga0495629_0007357 3300046459 Bacteria 8118
390 Ga0495629_0052950 3300046459 Bacteria 2840
391 Ga0495629_0053381 3300046459 Bacteria 2828
392 Ga0495629_0101502 3300046459 Bacteria 2008
393 Ga0495638_0062170 3300046460 Bacteria 2305
394 Ga0495641_0004211 3300046461 Bacteria 10314
395 Ga0495641_0013330 3300046461 Bacteria 4525
396 Ga0495651_0009341 3300046462 Bacteria 7525
397 Ga0495651_0011990 3300046462 Bacteria 6671
398 Ga0495653_0030572 3300046463 Bacteria 4288
399 Ga0495653_0050259 3300046463 Bacteria 3207
400 Ga0495582_0000426 3300046473 Bacteria 23059
401 Ga0495582_0039439 3300046473 Bacteria 2600
402 Ga0495662_0005709 3300046476 Bacteria 6221
403 Ga0495662_0044813 3300046476 Bacteria 2135
404 Ga0495594_0002137 3300046499 Bacteria 10289
405 Ga0495594_0014754 3300046499 Bacteria 4101
406 Ga0495594_0056310 3300046499 Bacteria 2169
407 Ga0495596_0048098 3300046500 Bacteria 1673
408 Ga0495608_0148850 3300046511 Bacteria 1492
409 Ga0495628_0052266 3300046516 Bacteria 3228
410 Ga0495628_0198499 3300046516 Bacteria 1512
411 Ga0495630_0038934 3300046517 Bacteria 3556
412 Ga0495630_0172351 3300046517 Bacteria 1649
413 Ga0495632_0014041 3300046519 Bacteria 4546
414 Ga0495637_0042431 3300046520 Bacteria 1946
415 Ga0495643_0001898 3300046522 Bacteria 17653
416 Ga0495652_0073651 3300046529 Bacteria 2843
417 Ga0495665_0000274 3300046531 Bacteria 26250
418 Ga0495640_0006459 3300046533 Bacteria 9271
419 Ga0495640_0032842 3300046533 Bacteria 3693
420 Ga0495586_0002031 3300046535 Bacteria 10987
421 Ga0495645_0104086 3300046543 Bacteria 2016
422 Ga0495645_0135190 3300046543 Bacteria 1725
423 Ga0495622_0038849 3300046557 Bacteria 2216
424 Ga0495633_0116850 3300046558 Bacteria 1236
425 Ga0495667_0064059 3300046559 Bacteria 2405
426 Ga0495667_0066496 3300046559 Bacteria 2356
427 Ga0495667_0114365 3300046559 Bacteria 1744
428 Ga0495667_0115104 3300046559 Bacteria 1737
429 Ga0495634_0028980 3300046642 Bacteria 3837
430 Ga0495611_0037453 3300046648 Bacteria 2155
431 Ga0495625_0050005 3300046660 Bacteria 3002
432 Ga0495635_0006072 3300046663 Bacteria 8428
433 Ga0495635_0012510 3300046663 Bacteria 5945
434 Ga0495661_0099459 3300046665 Bacteria 1640
435 Ga0495588_0051583 3300046674 Bacteria 2119
436 Ga0495657_0020037 3300046675 Bacteria 4814
437 Ga0495657_0031766 3300046675 Bacteria 3688
438 Ga0495657_0119065 3300046675 Bacteria 1665
439 Ga0495599_0036996 3300046678 Bacteria 3067
440 Ga0495599_0051626 3300046678 Bacteria 2576
441 Ga0495646_0021309 3300046680 Bacteria 4097
442 Ga0495613_0046329 3300046689 Bacteria 3215
443 Ga0495613_0211362 3300046689 Bacteria 1364
444 Ga0495624_0007344 3300046690 Bacteria 7738
445 Ga0495671_0136661 3300046692 Bacteria 1195
446 Ga0495589_0003307 3300046794 Bacteria 8748
447 Ga0495589_0015884 3300046794 Bacteria 3871
448 Ga0495589_0032481 3300046794 Bacteria 2624
449 Ga0495589_0071779 3300046794 Bacteria 1691
450 Ga0495581_0000117 3300047315 Bacteria 33592
451 Ga0495604_0016838 3300047317 Bacteria 5848
452 Ga0495604_0060821 3300047317 Bacteria 2891
453 Ga0495604_0075752 3300047317 Bacteria 2532
454 Ga0495636_0013268 3300047318 Bacteria 3269
455 Ga0495636_0064958 3300047318 Bacteria 1549
456 Ga0495674_0007348 3300047319 Bacteria 10535
457 Ga0495674_0028349 3300047319 Bacteria 5107
458 Ga0495676_0000268 3300047321 Bacteria 42236
459 Ga0495676_0022291 3300047321 Bacteria 5513
460 Ga0495676_0034836 3300047321 Bacteria 4218
461 Ga0495680_0081152 3300047322 Bacteria 2449
462 Ga0495680_0251573 3300047322 Bacteria 1252
463 Ga0495675_0017674 3300047444 Bacteria 4521
464 Ga0495677_0044117 3300047445 Bacteria 1635
465 Ga0495679_005854 3300047446 Bacteria 5396
466 Ga0495685_000743 3300047447 Bacteria 9986
467 Ga0495685_006018 3300047447 Bacteria 3965
468 Ga0495681_0080632 3300047470 Bacteria 1453
469 Ga0495684_0028863 3300047471 Bacteria 4259
470 Ga0495686_0114001 3300047472 Bacteria 1618
471 Ga0495593_0003689 3300047673 Bacteria 9145
472 Ga0495602_0208045 3300048088 Bacteria 1488
473 Ga0495614_0044178 3300048089 Bacteria 1911
474 Ga0496100_0004276 3300048903 Bacteria 7557
475 Ga0496100_0024619 3300048903 Bacteria 3673
476 Ga0496100_0049625 3300048903 Bacteria 2715
477 Ga0496100_0133134 3300048903 Bacteria 1753
478 Ga0496101_0000774 3300048904 Bacteria 18911
479 Ga0496101_0001593 3300048904 Bacteria 13628
480 Ga0496101_0062543 3300048904 Bacteria 2706
481 Ga0496101_0071634 3300048904 Bacteria 2541
482 Ga0496101_0091421 3300048904 Bacteria 2265
483 Ga0496101_0123398 3300048904 Bacteria 1960
484 Ga0496101_0382474 3300048904 Bacteria 1107
485 Ga0496102_0006501 3300048905 Bacteria 9969
486 Ga0496102_0044194 3300048905 Bacteria 4042
487 Ga0496102_0143875 3300048905 Bacteria 2237
488 Ga0496102_0176047 3300048905 Bacteria 2014
489 Ga0496103_0029092 3300048906 Bacteria 3356
490 Ga0496103_0058752 3300048906 Bacteria 2389
491 Ga0496104_0000557 3300048907 Bacteria 31776
492 Ga0496104_0005277 3300048907 Bacteria 11294
493 Ga0496104_0011491 3300048907 Bacteria 7933
494 Ga0496104_0017167 3300048907 Bacteria 6583
495 Ga0496104_0071520 3300048907 Bacteria 3298
496 Ga0496105_0000609 3300048908 Bacteria 23924
497 Ga0496105_0005850 3300048908 Bacteria 9378
498 Ga0496105_0010159 3300048908 Bacteria 7396
499 Ga0496105_0041229 3300048908 Bacteria 3804
500 Ga0496105_0071048 3300048908 Bacteria 2877
501 Ga0496105_0110502 3300048908 Bacteria 2269
502 Ga0496105_0111317 3300048908 Bacteria 2260
503 Ga0496106_0001053 3300048909 Bacteria 20313
504 Ga0496107_0007205 3300048910 Bacteria 7661
505 Ga0496107_0045274 3300048910 Bacteria 3164
506 Ga0496107_0123417 3300048910 Bacteria 1908
507 Ga0496108_0000612 3300048911 Bacteria 27959
508 Ga0496108_0008456 3300048911 Bacteria 8350
509 Ga0496109_0007085 3300048912 Bacteria 9464
510 Ga0496109_0018429 3300048912 Bacteria 6133
511 Ga0496109_0031328 3300048912 Bacteria 4772
512 Ga0496109_0103584 3300048912 Bacteria 2641
513 Ga0496110_0000564 3300048913 Bacteria 25354
514 Ga0496110_0004006 3300048913 Bacteria 11348
515 Ga0496110_0016135 3300048913 Bacteria 6228
516 Ga0496110_0024690 3300048913 Bacteria 5126
517 Ga0496110_0045401 3300048913 Bacteria 3840
518 Ga0496110_0110182 3300048913 Bacteria 2473
519 Ga0496110_0152052 3300048913 Bacteria 2096
520 Ga0496110_0196753 3300048913 Bacteria 1831
521 Ga0496111_0000294 3300048914 Bacteria 24345
522 Ga0496111_0001848 3300048914 Bacteria 12482
523 Ga0496111_0010981 3300048914 Bacteria 6093
524 Ga0496111_0011449 3300048914 Bacteria 5974
525 Ga0496111_0018445 3300048914 Bacteria 4836
526 Ga0496111_0069596 3300048914 Bacteria 2559
527 Ga0496112_0001443 3300048915 Bacteria 18248
528 Ga0496112_0004854 3300048915 Bacteria 11487
529 Ga0496112_0275407 3300048915 Bacteria 1630
530 Ga0496112_0314015 3300048915 Bacteria 1512
531 Ga0496113_0000414 3300048916 Bacteria 20698
532 Ga0496113_0041263 3300048916 Bacteria 3404
533 Ga0496113_0210042 3300048916 Bacteria 1549
534 Ga0496114_0003819 3300048917 Bacteria 11617
535 Ga0496114_0020054 3300048917 Bacteria 5423
536 Ga0496114_0020229 3300048917 Bacteria 5401
537 Ga0496114_0045444 3300048917 Bacteria 3648
538 Ga0496114_0053105 3300048917 Bacteria 3377
539 Ga0496114_0088794 3300048917 Bacteria 2622
540 Ga0496114_0198625 3300048917 Bacteria 1756
541 Ga0496115_0000276 3300048918 Bacteria 45046
542 Ga0496115_0001519 3300048918 Bacteria 16688
543 Ga0496115_0044620 3300048918 Bacteria 3537
544 Ga0496115_0051073 3300048918 Bacteria 3315
545 Ga0496115_0189399 3300048918 Bacteria 1699
546 Ga0501031_0008593 3300049568 Bacteria 6645
547 Ga0501031_0059499 3300049568 Bacteria 2490
548 Ga0501032_0015104 3300049569 Bacteria 5453
549 Ga0501032_0020059 3300049569 Bacteria 4661
550 Ga0501033_0005594 3300049570 Bacteria 9930
551 Ga0501033_0012051 3300049570 Bacteria 6601
552 Ga0501033_0034644 3300049570 Bacteria 3786
553 Ga0501034_0014464 3300049571 Bacteria 8126
554 Ga0501034_0080671 3300049571 Bacteria 3256
555 Ga0501034_0107053 3300049571 Bacteria 2788
556 Ga0501036_0001794 3300049572 Bacteria 16668
557 Ga0501036_0002846 3300049572 Bacteria 13715
558 Ga0501036_0011887 3300049572 Bacteria 7217
559 Ga0501036_0021665 3300049572 Bacteria 5403
560 Ga0501036_0025102 3300049572 Bacteria 5026
561 Ga0501036_0040152 3300049572 Bacteria 3958
562 Ga0501036_0044228 3300049572 Bacteria 3772
563 Ga0501036_0053869 3300049572 Bacteria 3405
564 Ga0501037_0015389 3300049573 Bacteria 5628
565 Ga0501037_0018448 3300049573 Bacteria 5144
566 Ga0501037_0021270 3300049573 Bacteria 4793
567 Ga0501037_0033954 3300049573 Bacteria 3767
568 Ga0501037_0036163 3300049573 Bacteria 3639
569 Ga0501037_0063273 3300049573 Bacteria 2697
570 Ga0501037_0069756 3300049573 Bacteria 2558
571 Ga0501038_0018104 3300049574 Bacteria 6364
572 Ga0501038_0061085 3300049574 Bacteria 3224
573 Ga0501038_0076524 3300049574 Bacteria 2826
574 Ga0501038_0135139 3300049574 Bacteria 2021
575 Ga0501039_0002534 3300049575 Bacteria 13632
576 Ga0501039_0015366 3300049575 Bacteria 5860
577 Ga0501039_0027964 3300049575 Bacteria 4337
578 Ga0501039_0066223 3300049575 Bacteria 2804
579 Ga0501040_0007612 3300049576 Bacteria 7009
580 Ga0501040_0008003 3300049576 Bacteria 6864
581 Ga0501040_0014061 3300049576 Bacteria 5268
582 Ga0501040_0078750 3300049576 Bacteria 2281
583 Ga0501041_0000710 3300049577 Bacteria 17673
584 Ga0501041_0022921 3300049577 Bacteria 3741
585 Ga0501042_0025521 3300049578 Bacteria 4151
586 Ga0501042_0034767 3300049578 Bacteria 3574
587 Ga0501042_0047985 3300049578 Bacteria 3045
588 Ga0501042_0086275 3300049578 Bacteria 2251
589 Ga0501043_0002611 3300049579 Bacteria 15194
590 Ga0501043_0006028 3300049579 Bacteria 9741
591 Ga0501043_0008471 3300049579 Bacteria 8094
592 Ga0501043_0034434 3300049579 Bacteria 3983
593 Ga0501043_0113338 3300049579 Bacteria 2129
594 Ga0501046_0003884 3300049580 Bacteria 13666
595 Ga0501046_0005237 3300049580 Bacteria 11597
596 Ga0501046_0006469 3300049580 Bacteria 10364
597 Ga0501047_0009023 3300049581 Bacteria 9415
598 Ga0501047_0027872 3300049581 Bacteria 5444
599 Ga0501047_0092762 3300049581 Bacteria 2898
600 Ga0501047_0242381 3300049581 Bacteria 1653
601 Ga0501048_0017670 3300049582 Bacteria 5250
602 Ga0501048_0041910 3300049582 Bacteria 3279
603 Ga0501048_0055295 3300049582 Bacteria 2818
604 Ga0501048_0146071 3300049582 Bacteria 1672
605 Ga0501048_0174935 3300049582 Bacteria 1521
606 Ga0501067_0000470 3300049583 Bacteria 21961
607 Ga0501067_0001142 3300049583 Bacteria 14398
608 Ga0501067_0001839 3300049583 Bacteria 11670
609 Ga0501067_0051110 3300049583 Bacteria 2292
610 Ga0501067_0079760 3300049583 Bacteria 1814
611 Ga0501068_0000618 3300049584 Bacteria 18101
612 Ga0501068_0023438 3300049584 Bacteria 3617
613 Ga0501068_0053171 3300049584 Bacteria 2451
614 Ga0501069_0003172 3300049585 Bacteria 8425
615 Ga0501069_0003245 3300049585 Bacteria 8341
616 Ga0501069_0019064 3300049585 Bacteria 3707
617 Ga0501069_0034419 3300049585 Bacteria 2790
618 Ga0501070_0001222 3300049586 Bacteria 22995
619 Ga0501070_0003991 3300049586 Bacteria 12685
620 Ga0501070_0029790 3300049586 Bacteria 4573
621 Ga0501070_0042676 3300049586 Bacteria 3777
622 Ga0501070_0078432 3300049586 Bacteria 2733
623 Ga0501071_0000108 3300049587 Bacteria 32155
624 Ga0501071_0022045 3300049587 Bacteria 4439
625 Ga0501071_0037155 3300049587 Bacteria 3476
626 Ga0501071_0077533 3300049587 Bacteria 2427
627 Ga0501072_0011340 3300049588 Bacteria 6811
628 Ga0501072_0067005 3300049588 Bacteria 2832
629 Ga0501073_0011693 3300049589 Bacteria 6411
630 Ga0501073_0016031 3300049589 Bacteria 5431
631 Ga0501074_0016473 3300049590 Bacteria 5366
632 Ga0501074_0034299 3300049590 Bacteria 3679
633 Ga0501074_0038646 3300049590 Bacteria 3457
634 Ga0501074_0063791 3300049590 Bacteria 2653
635 Ga0501076_0002689 3300049592 Bacteria 12285
636 Ga0501076_0011545 3300049592 Bacteria 6585
637 Ga0501076_0062956 3300049592 Bacteria 2955
638 Ga0501076_0188151 3300049592 Bacteria 1684
639 Ga0501077_0023406 3300049593 Bacteria 3916
640 Ga0501077_0094722 3300049593 Bacteria 1893
641 Ga0501079_0003324 3300049741 Bacteria 11793
642 Ga0501079_0009675 3300049741 Bacteria 7308
643 Ga0501079_0026049 3300049741 Bacteria 4484
644 Ga0501079_0057533 3300049741 Bacteria 3000
645 Ga0501080_0002881 3300049742 Bacteria 15128
646 Ga0501080_0019482 3300049742 Bacteria 6284
647 Ga0501080_0049937 3300049742 Bacteria 3893
648 Ga0501080_0071091 3300049742 Bacteria 3236
649 Ga0501081_0004843 3300049743 Bacteria 8648
650 Ga0501081_0035528 3300049743 Bacteria 3392
651 Ga0501083_0001526 3300049744 Bacteria 15828
652 Ga0501083_0009224 3300049744 Bacteria 6966
653 Ga0501083_0023726 3300049744 Bacteria 4254
654 Ga0501035_0004527 3300049822 Bacteria 13192
655 Ga0501035_0008497 3300049822 Bacteria 9562
656 Ga0501035_0040429 3300049822 Bacteria 4213
657 Ga0501035_0054798 3300049822 Bacteria 3561
658 Ga0501035_0063031 3300049822 Bacteria 3298
659 Ga0501035_0079863 3300049822 Bacteria 2889
660 Ga0501035_0091486 3300049822 Bacteria 2677
661 Ga0501044_0003483 3300049823 Bacteria 17730
662 Ga0501044_0018750 3300049823 Bacteria 7410
663 Ga0501044_0020502 3300049823 Bacteria 7059
664 Ga0501044_0068907 3300049823 Bacteria 3602
665 Ga0501044_0104907 3300049823 Bacteria 2840
666 Ga0501045_0021820 3300049824 Bacteria 4582
667 Ga0501045_0073852 3300049824 Bacteria 2512
668 nmdc:mga06z11_1309_c1 3300050494 Bacteria 9201
669 nmdc:mga04h51_5519_c1 3300050495 Bacteria 3228
670 nmdc:mga07m45_15947_c1 3300050496 Bacteria 4018
671 nmdc:mga05p37_241318_c1 3300050507 Bacteria 2173
672 nmdc:mga05p37_6607_c1 3300050507 Bacteria 13670
673 nmdc:mga05p37_77797_c1 3300050507 Bacteria 4084
674 nmdc:mga09592_13265_c1 3300050508 Bacteria 6728
675 nmdc:mga09592_38915_c1 3300050508 Bacteria 3993
676 nmdc:mga0qj67_218734_c1 3300050509 Bacteria 1546
677 nmdc:mga0qj67_65866_c1 3300050509 Bacteria 2884
678 nmdc:mga06r32_204956_c1 3300050510 Bacteria 1960
679 nmdc:mga06r32_449_c1 3300050510 Bacteria 34962
680 nmdc:mga08y16_11412_c1 3300050511 Bacteria 9336
681 nmdc:mga08y16_158805_c1 3300050511 Bacteria 2349
682 nmdc:mga08y16_175567_c1 3300050511 Bacteria 2225
683 nmdc:mga08y16_82116_c1 3300050511 Bacteria 3360
684 nmdc:mga0n895_113216_c1 3300050512 Bacteria 2730
685 nmdc:mga0n895_130156_c1 3300050512 Bacteria 2541
686 nmdc:mga0n895_14788_c1 3300050512 Bacteria 7100
687 nmdc:mga0n895_8895_c1 3300050512 Bacteria 8748
688 nmdc:mga0rr50_100880_c1 3300050513 Bacteria 2268
689 nmdc:mga0rr50_248995_c1 3300050513 Bacteria 1475
690 nmdc:mga08x19_77649_c1 3300050514 Bacteria 2175
691 nmdc:mga0a205_122548_c1 3300050515 Bacteria 2499
692 nmdc:mga0a205_21186_c1 3300050515 Bacteria 6148
693 nmdc:mga0a205_229295_c1 3300050515 Bacteria 1741
694 Ga0495601_0015071 3300053077 Bacteria 4668
695 Ga0495601_0030136 3300053077 Bacteria 3368
696 Ga0495655_0028212 3300053083 Bacteria 1339
697 Ga0495595_0015476 3300053084 Bacteria 3254
698 Ga0495619_0009482 3300053085 Bacteria 6139
699 Ga0495619_0040721 3300053085 Bacteria 3037
700 Ga0500578_0151244 3300053086 Bacteria 1445
701 Ga0500651_0122844 3300053093 Bacteria 1575
702 Ga0500566_0075409 3300053094 Bacteria 1887
703 Ga0500560_004643 3300053107 Bacteria 2946
704 Ga0500569_000894 3300053109 Bacteria 5327
705 Ga0500652_053372 3300053131 Bacteria 1653
706 Ga0500658_0056498 3300053134 Bacteria 1619
707 Ga0500561_0000412 3300053137 Bacteria 7030
708 Ga0500600_0054940 3300053149 Bacteria 2243
709 Ga0500616_0083431 3300053153 Bacteria 1600
710 Ga0500633_0037512 3300053160 Bacteria 1609
711 Ga0500634_0046736 3300053161 Bacteria 2337
712 Ga0501084_0089455 3300054114 Bacteria 2584
713 Ga0501084_0145799 3300054114 Bacteria 1994
714 Ga0501084_0248232 3300054114 Bacteria 1503
715 Ga0590075_004461 3300059424 Bacteria 3315
716 Ga0590077_004917 3300059426 Bacteria 2732
717 Ga0501082_0026469 3300060353 Bacteria 4999
718 Ga0501082_0182637 3300060353 Bacteria 1824
719 Ga0530510_0002662 3300061734 Bacteria 12275
720 Ga0530510_0013262 3300061734 Bacteria 5794
721 Ga0530510_0029929 3300061734 Bacteria 3909
722 2585305134 2582581313 Bacteria 10042643
723 2644266179 2643221647 Bacteria 10741251
724 2644437598 2643221678 Bacteria 9540101
725 2768642026 2767802112 Bacteria 6465194
726 2785342165 2784746763 Bacteria 9783172
727 2786671648 2786546132 Bacteria 10419719
728 2804845837 2802429296 Bacteria 7227771
729 2808843053 2808606359 Bacteria 9866990
730 2809233076 2808606448 Bacteria 8656184
731 2812357070 2811994879 Bacteria 9313447
732 2812479731 2811994917 Bacteria 7761064
733 2852640067 2852635781 Bacteria 8251373
734 2862179501 2862178590 Bacteria 8583590
735 2862390068 2862382967 Bacteria 10317375
736 2862578432 2862574272 Bacteria 10567477
737 2862709550 2862705112 Bacteria 6563286
738 2863411847 2863404153 Bacteria 9672205
739 2867372997 2867369537 Bacteria 6501581
740 2867435712 2867428634 Bacteria 9590268
741 2877680128 2877676314 Bacteria 9512378
742 2912731044 2912723979 Bacteria 8557534
743 2919471469 2919468124 Bacteria 9133025
744 2946068808 2946064051 Bacteria 8957905
745 2947228102 2947224130 Bacteria 9938529
746 2954385061 2954380949 Bacteria 10050426
747 2954677934 2954673503 Bacteria 9685905
748 2954686223 2954682443 Bacteria 9862841
749 2954695879 2954691527 Bacteria 10720516
750 2954711070 2954701450 Bacteria 10834262
751 2954715284 2954711539 Bacteria 10867210
752 2954725225 2954721474 Bacteria 10456478
753 2954736591 2954731030 Bacteria 10243860
754 2954744158 2954740390 Bacteria 10229294
755 2954755440 2954749733 Bacteria 10366972
756 2954763101 2954759201 Bacteria 9358192
757 2990045606 2990044586 Bacteria 6603797
758 2990063970 2990059506 Bacteria 9321252
759 2990091290 2990088156 Bacteria 6657676
760 3006324976 3006321560 Bacteria 8247479
761 3006397276 3006393351 Bacteria 6615579
762 3006492226 3006486233 Bacteria 8157040
763 3006498234 3006493962 Bacteria 8825450
764 8008485898 8008485437 Bacteria 7198341
765 8008566241 8008558824 Bacteria 10610750
766 8008578056 8008574985 Bacteria 7815457
767 8025418512 8025413630 Bacteria 7014048
768 8025524982 8025524527 Bacteria 7197316
769 8033690080 8033684223 Bacteria 6906479
770 8048409562 8048406513 Bacteria 8936924
771 8056454033 8056447290 Bacteria 7680491
772 8056833237 8056829672 Bacteria 9045328
773 Ga0111539_10106412
774 ARcpr5oldR_c001385
775 ARcpr5yngRDRAFT_c001296
776 ARSoilOldRDRAFT_c001312
777 Ga0006562J51391_1035120
778 Ga0006562J51391_1035122
779 Ga0070658_10015063
780 Ga0070658_10016206
781 Ga0070683_100008132
782 Ga0070683_100020240
783 Ga0070683_100075139
784 Ga0068869_100105477
785 Ga0070680_100010144
786 Ga0070680_100096901
787 Ga0070682_100094833
788 Ga0070682_100113219
789 Ga0068868_100084428
790 Ga0068868_100233437
791 Ga0068868_100251514
792 Ga0070660_100039145
793 Ga0070660_100094178
794 Ga0070689_100036534
795 Ga0070691_10002704
796 Ga0070691_10040359
797 Ga0070687_100101825
798 Ga0070661_100020187
799 Ga0070668_100012259
800 Ga0070671_100037278
801 Ga0070671_100067798
802 Ga0070671_100176526
803 Ga0070659_100014825
804 Ga0070659_100047003
805 Ga0070659_100091451
806 Ga0070703_10007546
807 Ga0070714_100016643
808 Ga0070713_100002608
809 Ga0070710_10032165
810 Ga0070705_100024733
811 Ga0070700_100043859
812 Ga0070708_100019534
813 Ga0070678_100029847
814 Ga0070662_100002641
815 Ga0070662_100092736
816 Ga0070681_10003419
817 Ga0070681_10012572
818 Ga0070681_10027200
819 Ga0070681_10168940
820 Ga0068867_100009644
821 Ga0070706_100101363
822 Ga0070707_100033547
823 Ga0070698_100008838
824 Ga0070698_100053383
825 Ga0070699_100052819
826 Ga0070699_100079565
827 Ga0070679_100009974
828 Ga0070679_100011004
829 Ga0070679_100024397
830 Ga0070679_100029047
831 Ga0070679_100029602
832 Ga0070679_100072153
833 Ga0070679_100075147
834 Ga0070679_100153389
835 Ga0070684_100008653
836 Ga0070684_100036248
837 Ga0070684_100122358
838 Ga0068853_100047525
839 Ga0068853_100115000
840 Ga0070672_100077560
841 Ga0070686_100054188
842 Ga0070695_100020417
843 Ga0070695_100052827
844 Ga0070696_100063122
845 Ga0070696_100102415
846 Ga0070693_100128546
847 Ga0068855_100024569
848 Ga0068855_100073422
849 Ga0068855_100088467
850 Ga0068857_100090175
851 Ga0068854_100113673
852 Ga0068854_100162589
853 Ga0068856_100069237
854 Ga0068856_100254667
855 Ga0070702_100018760
856 Ga0070702_100036937
857 Ga0070702_100040627
858 Ga0068852_100079647
859 Ga0068864_100113330
860 Ga0068861_100001783
861 Ga0068870_10051347
862 Ga0081455_10019559
863 Ga0081540_1014346
864 Ga0081539_10000200
865 Ga0081539_10000867
866 Ga0075368_10048035
867 Ga0075432_10003491
868 Ga0070715_10008364
869 Ga0070716_100009248
870 Ga0070716_100037807
871 Ga0070716_100046618
872 Ga0070712_100001482
873 Ga0075367_10001380
874 Ga0075367_10128397
875 Ga0097621_100149288
876 Ga0075370_10008702
877 Ga0075428_100021918
878 Ga0075428_100037530
879 Ga0075428_100095575
880 Ga0075430_100073420
881 Ga0075430_100077560
882 Ga0075430_100169274
883 Ga0075431_100001660
884 Ga0075433_10043840
885 Ga0075433_10047878
886 Ga0075433_10164838
887 Ga0075433_10186095
888 Ga0075434_100029826
889 Ga0075434_100244620
890 Ga0075429_100223356
891 Ga0068865_100011940
892 Ga0075436_100186824
893 Ga0075435_100025556
894 Ga0105244_10080448
895 Ga0105240_10076875
896 Ga0105240_10129459
897 Ga0111539_10008714
898 Ga0111539_10035748
899 Ga0111539_10180389
900 Ga0105245_10071821
901 Ga0105245_10227388
902 Ga0114129_10008166
903 Ga0114129_10018159
904 Ga0105243_10011008
905 Ga0105243_10112217
906 Ga0105243_10365336
907 Ga0105248_10088431
908 Ga0105248_10135629
909 Ga0105237_10129677
910 Ga0105238_10072267
911 Ga0105238_10191878
912 Ga0105238_10337403
913 Ga0105249_10001703
914 Ga0105239_10072822
915 Ga0157373_10060213
916 Ga0157373_10097746
917 Ga0157371_10134136
918 Ga0157370_10037029
919 Ga0157369_10020280
920 Ga0157369_10030859
921 Ga0157374_10147360
922 Ga0157378_10185890
923 Ga0163162_10038088
924 Ga0163162_10090462
925 Ga0163162_10263829
926 Ga0157372_10021088
927 Ga0157380_10006119
928 Ga0157380_10028368
929 Ga0157380_10142338
930 Ga0157376_10011084
931 Ga0163161_10043707
932 Ga0213875_10017925
933 Ga0207426_1003642
934 Ga0207426_1009984
935 Ga0207653_10014440
936 Ga0207692_10094910
937 Ga0207688_10008324
938 Ga0207647_10041315
939 Ga0207645_10051435
940 Ga0207643_10037285
941 Ga0207705_10005496
942 Ga0207705_10012310
943 Ga0207705_10012655
944 Ga0207705_10118873
945 Ga0207684_10017162
946 Ga0207707_10007563
947 Ga0207707_10014298
948 Ga0207707_10019074
949 Ga0207707_10024976
950 Ga0207707_10051905
951 Ga0207707_10200886
952 Ga0207695_10179577
953 Ga0207671_10213070
954 Ga0207693_10001016
955 Ga0207693_10003173
956 Ga0207693_10003612
957 Ga0207663_10135480
958 Ga0207660_10017699
959 Ga0207660_10018755
960 Ga0207660_10120870
961 Ga0207657_10005284
962 Ga0207657_10007571
963 Ga0207657_10016238
964 Ga0207657_10046528
965 Ga0207657_10062709
966 Ga0207657_10211805
967 Ga0207649_10074133
968 Ga0207649_10199578
969 Ga0207652_10018126
970 Ga0207652_10032369
971 Ga0207652_10076750
972 Ga0207646_10001072
973 Ga0207646_10027364
974 Ga0207659_10126301
975 Ga0207687_10073140
976 Ga0207687_10135866
977 Ga0207700_10000001
978 Ga0207700_10080444
979 Ga0207644_10110037
980 Ga0207690_10011819
981 Ga0207690_10051892
982 Ga0207690_10086031
983 Ga0207706_10014850
984 Ga0207709_10040500
985 Ga0207665_10008523
986 Ga0207691_10019105
987 Ga0207711_10175355
988 Ga0207711_10219911
989 Ga0207711_10232798
990 Ga0207661_10008048
991 Ga0207667_10054593
992 Ga0207667_10107278
993 Ga0207667_10117968
994 Ga0207667_10203569
995 Ga0207651_10040296
996 Ga0207712_10007048
997 Ga0207712_10038933
998 Ga0207668_10027466
999 Ga0207640_10057756
1000 Ga0207640_10090370
1001 Ga0207639_10026202
1002 Ga0207708_10016026
1003 Ga0207708_10047470
1004 Ga0207702_10037641
1005 Ga0207648_10020479
1006 Ga0207648_10024817
1007 Ga0207676_10118178
1008 Ga0207675_100044599
1009 Ga0207675_100050780
1010 Ga0207683_10051131
1011 Ga0207683_10137781
1012 Ga0207698_10180544
1013 Ga0209813_10013231
1014 Ga0207428_10000244
1015 Ga0207428_10027943
1016 Ga0207428_10104805
1017 Ga0268266_10046859
1018 Ga0307517_10008770
1019 Ga0307515_10073513
1020 Ga0307513_10074778
1021 Ga0307408_100030330
1022 Ga0307508_10011891
1023 Ga0307514_10021200
1024 Ga0307516_10137883
1025 Ga0307405_10074579
1026 Ga0316577_10063287
1027 Ga0307413_10005959
1028 Ga0307518_10030990
1029 Ga0307410_10013107
1030 Ga0307412_10014671
1031 Ga0307416_100032245
1032 Ga0307411_10007234
1033 Ga0307507_10145581
1034 Ga0373928_0003310
1035 Ga0373940_0002686
1036 Ga0373949_0020994
1037 Ga0373951_0011866
1038 Ga0373952_0002257
1039 Ga0373932_0007715
1040 Ga0373939_0002179
1041 Ga0373939_0016692
1042 Ga0373941_0022527
1043 Ga0373945_0045937
1044 Ga0373943_0000299
1045 Ga0373946_0001582
1046 Ga0373955_0033805
1047 Ga0373942_0005086
1048 Ga0373961_0008730
1049 Ga0373931_0006511
1050 Ga0373935_0012369
1051 Ga0373947_0000185
1052 Ga0373947_0007323
1053 Ga0373925_0006691
1054 Ga0373925_0075134
1055 Ga0373925_0159247
1056 Ga0395899_0006920
1057 Ga0395899_0007215
1058 Ga0395899_0011411
1059 Ga0395899_0013616
1060 Ga0395900_0000528
1061 Ga0395900_0002771
1062 Ga0395900_0025290
1063 Ga0395900_0025854
1064 Ga0395900_0040788
1065 Ga0395900_0054193
1066 Ga0395900_0055681
1067 Ga0395900_0057266
1068 Ga0395900_0068954
1069 Ga0395900_0076411
1070 Ga0395900_0092986
1071 Ga0395900_0098804
1072 Ga0395900_0102055
1073 Ga0395900_0154139
1074 Ga0395898_0001875
1075 Ga0395898_0002139
1076 Ga0395898_0003526
1077 Ga0395898_0003680
1078 Ga0395898_0012709
1079 Ga0395898_0016068
1080 Ga0395898_0021434
1081 Ga0395898_0021753
1082 Ga0395898_0067339
1083 Ga0395898_0091834
1084 Ga0395898_0311983
1085 Ga0395905_0000661
1086 Ga0395905_0005716
1087 Ga0395905_0006912
1088 Ga0395905_0009554
1089 Ga0395905_0021602
1090 Ga0395905_0031768
1091 Ga0395905_0042861
1092 Ga0395905_0053172
1093 Ga0395905_0073662
1094 Ga0436364_1424714
1095 Ga0395901_0001057
1096 Ga0395901_0001983
1097 Ga0395901_0005247
1098 Ga0395901_0010426
1099 Ga0395901_0012794
1100 Ga0395901_0019001
1101 Ga0395901_0021701
1102 Ga0395901_0027883
1103 Ga0395901_0046191
1104 Ga0395901_0049126
1105 Ga0395901_0091435
1106 Ga0395901_0157721
1107 Ga0395901_0176364
1108 Ga0395901_0212120
1109 Ga0395901_0236488
1110 Ga0395901_0313033
1111 Ga0242420_000637
1112 Ga0436365_0868245
1113 Ga0436365_1320454
1114 Ga0439436_0000548
1115 Ga0439436_0002790
1116 Ga0439439_0005529
1117 Ga0451837_1533153
1118 Ga0451839_0165057
1119 Ga0451847_0111370
1120 Ga0451849_0650206
1121 Ga0451855_1406534
1122 Ga0451853_0938959
1123 Ga0439433_0000982
1124 Ga0439457_000625
1125 Ga0439458_0000467
1126 Ga0466969_0048588
1127 Ga0466965_0093234
1128 Ga0466966_0025154
1129 Ga0466966_0049536
1130 Ga0466966_0054794
1131 Ga0466961_0005145
1132 Ga0466963_0000425
1133 Ga0466963_0022160
1134 Ga0466963_0050178
1135 Ga0466963_0086844
1136 Ga0466964_0005916
1137 Ga0466968_0011262
1138 Ga0466968_0047178
1139 Ga0466957_0007534
1140 Ga0466957_0103032
1141 Ga0466960_0048131
1142 Ga0466960_0080296
1143 Ga0466959_0024988
1144 Ga0466959_0038560
1145 Ga0466959_0061002
1146 Ga0466959_0072170
1147 Ga0466959_0110908
1148 Ga0451576_0237297
1149 Ga0466958_0028850
1150 Ga0466967_0000455
1151 Ga0466967_0003231
1152 Ga0466967_0013456
1153 Ga0466967_0017725
1154 Ga0466967_0033564
1155 Ga0466967_0049751
1156 Ga0466967_0061889
1157 Ga0495603_0001553
1158 Ga0495603_0014904
1159 Ga0495603_0085874
1160 Ga0495629_0000403
1161 Ga0495629_0007357
1162 Ga0495629_0052950
1163 Ga0495629_0053381
1164 Ga0495629_0101502
1165 Ga0495638_0062170
1166 Ga0495641_0004211
1167 Ga0495641_0013330
1168 Ga0495651_0009341
1169 Ga0495651_0011990
1170 Ga0495653_0030572
1171 Ga0495653_0050259
1172 Ga0495582_0000426
1173 Ga0495582_0039439
1174 Ga0495662_0005709
1175 Ga0495662_0044813
1176 Ga0495594_0002137
1177 Ga0495594_0014754
1178 Ga0495594_0056310
1179 Ga0495596_0048098
1180 Ga0495608_0148850
1181 Ga0495628_0052266
1182 Ga0495628_0198499
1183 Ga0495630_0038934
1184 Ga0495630_0172351
1185 Ga0495632_0014041
1186 Ga0495637_0042431
1187 Ga0495643_0001898
1188 Ga0495652_0073651
1189 Ga0495665_0000274
1190 Ga0495640_0006459
1191 Ga0495640_0032842
1192 Ga0495586_0002031
1193 Ga0495645_0104086
1194 Ga0495645_0135190
1195 Ga0495622_0038849
1196 Ga0495633_0116850
1197 Ga0495667_0064059
1198 Ga0495667_0066496
1199 Ga0495667_0114365
1200 Ga0495667_0115104
1201 Ga0495634_0028980
1202 Ga0495611_0037453
1203 Ga0495625_0050005
1204 Ga0495635_0006072
1205 Ga0495635_0012510
1206 Ga0495661_0099459
1207 Ga0495588_0051583
1208 Ga0495657_0020037
1209 Ga0495657_0031766
1210 Ga0495657_0119065
1211 Ga0495599_0036996
1212 Ga0495599_0051626
1213 Ga0495646_0021309
1214 Ga0495613_0046329
1215 Ga0495613_0211362
1216 Ga0495624_0007344
1217 Ga0495671_0136661
1218 Ga0495589_0003307
1219 Ga0495589_0015884
1220 Ga0495589_0032481
1221 Ga0495589_0071779
1222 Ga0495581_0000117
1223 Ga0495604_0016838
1224 Ga0495604_0060821
1225 Ga0495604_0075752
1226 Ga0495636_0013268
1227 Ga0495636_0064958
1228 Ga0495674_0007348
1229 Ga0495674_0028349
1230 Ga0495676_0000268
1231 Ga0495676_0022291
1232 Ga0495676_0034836
1233 Ga0495680_0081152
1234 Ga0495680_0251573
1235 Ga0495675_0017674
1236 Ga0495677_0044117
1237 Ga0495679_005854
1238 Ga0495685_000743
1239 Ga0495685_006018
1240 Ga0495681_0080632
1241 Ga0495684_0028863
1242 Ga0495686_0114001
1243 Ga0495593_0003689
1244 Ga0495602_0208045
1245 Ga0495614_0044178
1246 Ga0496100_0004276
1247 Ga0496100_0024619
1248 Ga0496100_0049625
1249 Ga0496100_0133134
1250 Ga0496101_0000774
1251 Ga0496101_0001593
1252 Ga0496101_0062543
1253 Ga0496101_0071634
1254 Ga0496101_0091421
1255 Ga0496101_0123398
1256 Ga0496101_0382474
1257 Ga0496102_0006501
1258 Ga0496102_0044194
1259 Ga0496102_0143875
1260 Ga0496102_0176047
1261 Ga0496103_0029092
1262 Ga0496103_0058752
1263 Ga0496104_0000557
1264 Ga0496104_0005277
1265 Ga0496104_0011491
1266 Ga0496104_0017167
1267 Ga0496104_0071520
1268 Ga0496105_0000609
1269 Ga0496105_0005850
1270 Ga0496105_0010159
1271 Ga0496105_0041229
1272 Ga0496105_0071048
1273 Ga0496105_0110502
1274 Ga0496105_0111317
1275 Ga0496106_0001053
1276 Ga0496107_0007205
1277 Ga0496107_0045274
1278 Ga0496107_0123417
1279 Ga0496108_0000612
1280 Ga0496108_0008456
1281 Ga0496109_0007085
1282 Ga0496109_0018429
1283 Ga0496109_0031328
1284 Ga0496109_0103584
1285 Ga0496110_0000564
1286 Ga0496110_0004006
1287 Ga0496110_0016135
1288 Ga0496110_0024690
1289 Ga0496110_0045401
1290 Ga0496110_0110182
1291 Ga0496110_0152052
1292 Ga0496110_0196753
1293 Ga0496111_0000294
1294 Ga0496111_0001848
1295 Ga0496111_0010981
1296 Ga0496111_0011449
1297 Ga0496111_0018445
1298 Ga0496111_0069596
1299 Ga0496112_0001443
1300 Ga0496112_0004854
1301 Ga0496112_0275407
1302 Ga0496112_0314015
1303 Ga0496113_0000414
1304 Ga0496113_0041263
1305 Ga0496113_0210042
1306 Ga0496114_0003819
1307 Ga0496114_0020054
1308 Ga0496114_0020229
1309 Ga0496114_0045444
1310 Ga0496114_0053105
1311 Ga0496114_0088794
1312 Ga0496114_0198625
1313 Ga0496115_0000276
1314 Ga0496115_0001519
1315 Ga0496115_0044620
1316 Ga0496115_0051073
1317 Ga0496115_0189399
1318 Ga0501031_0008593
1319 Ga0501031_0059499
1320 Ga0501032_0015104
1321 Ga0501032_0020059
1322 Ga0501033_0005594
1323 Ga0501033_0012051
1324 Ga0501033_0034644
1325 Ga0501034_0014464
1326 Ga0501034_0080671
1327 Ga0501034_0107053
1328 Ga0501036_0001794
1329 Ga0501036_0002846
1330 Ga0501036_0011887
1331 Ga0501036_0021665
1332 Ga0501036_0025102
1333 Ga0501036_0040152
1334 Ga0501036_0044228
1335 Ga0501036_0053869
1336 Ga0501037_0015389
1337 Ga0501037_0018448
1338 Ga0501037_0021270
1339 Ga0501037_0033954
1340 Ga0501037_0036163
1341 Ga0501037_0063273
1342 Ga0501037_0069756
1343 Ga0501038_0018104
1344 Ga0501038_0061085
1345 Ga0501038_0076524
1346 Ga0501038_0135139
1347 Ga0501039_0002534
1348 Ga0501039_0015366
1349 Ga0501039_0027964
1350 Ga0501039_0066223
1351 Ga0501040_0007612
1352 Ga0501040_0008003
1353 Ga0501040_0014061
1354 Ga0501040_0078750
1355 Ga0501041_0000710
1356 Ga0501041_0022921
1357 Ga0501042_0025521
1358 Ga0501042_0034767
1359 Ga0501042_0047985
1360 Ga0501042_0086275
1361 Ga0501043_0002611
1362 Ga0501043_0006028
1363 Ga0501043_0008471
1364 Ga0501043_0034434
1365 Ga0501043_0113338
1366 Ga0501046_0003884
1367 Ga0501046_0005237
1368 Ga0501046_0006469
1369 Ga0501047_0009023
1370 Ga0501047_0027872
1371 Ga0501047_0092762
1372 Ga0501047_0242381
1373 Ga0501048_0017670
1374 Ga0501048_0041910
1375 Ga0501048_0055295
1376 Ga0501048_0146071
1377 Ga0501048_0174935
1378 Ga0501067_0000470
1379 Ga0501067_0001142
1380 Ga0501067_0001839
1381 Ga0501067_0051110
1382 Ga0501067_0079760
1383 Ga0501068_0000618
1384 Ga0501068_0023438
1385 Ga0501068_0053171
1386 Ga0501069_0003172
1387 Ga0501069_0003245
1388 Ga0501069_0019064
1389 Ga0501069_0034419
1390 Ga0501070_0001222
1391 Ga0501070_0003991
1392 Ga0501070_0029790
1393 Ga0501070_0042676
1394 Ga0501070_0078432
1395 Ga0501071_0000108
1396 Ga0501071_0022045
1397 Ga0501071_0037155
1398 Ga0501071_0077533
1399 Ga0501072_0011340
1400 Ga0501072_0067005
1401 Ga0501073_0011693
1402 Ga0501073_0016031
1403 Ga0501074_0016473
1404 Ga0501074_0034299
1405 Ga0501074_0038646
1406 Ga0501074_0063791
1407 Ga0501076_0002689
1408 Ga0501076_0011545
1409 Ga0501076_0062956
1410 Ga0501076_0188151
1411 Ga0501077_0023406
1412 Ga0501077_0094722
1413 Ga0501079_0003324
1414 Ga0501079_0009675
1415 Ga0501079_0026049
1416 Ga0501079_0057533
1417 Ga0501080_0002881
1418 Ga0501080_0019482
1419 Ga0501080_0049937
1420 Ga0501080_0071091
1421 Ga0501081_0004843
1422 Ga0501081_0035528
1423 Ga0501083_0001526
1424 Ga0501083_0009224
1425 Ga0501083_0023726
1426 Ga0501035_0004527
1427 Ga0501035_0008497
1428 Ga0501035_0040429
1429 Ga0501035_0054798
1430 Ga0501035_0063031
1431 Ga0501035_0079863
1432 Ga0501035_0091486
1433 Ga0501044_0003483
1434 Ga0501044_0018750
1435 Ga0501044_0020502
1436 Ga0501044_0068907
1437 Ga0501044_0104907
1438 Ga0501045_0021820
1439 Ga0501045_0073852
1440 nmdc:mga06z11_1309_c1
1441 nmdc:mga04h51_5519_c1
1442 nmdc:mga07m45_15947_c1
1443 nmdc:mga05p37_241318_c1
1444 nmdc:mga05p37_6607_c1
1445 nmdc:mga05p37_77797_c1
1446 nmdc:mga09592_13265_c1
1447 nmdc:mga09592_38915_c1
1448 nmdc:mga0qj67_218734_c1
1449 nmdc:mga0qj67_65866_c1
1450 nmdc:mga06r32_204956_c1
1451 nmdc:mga06r32_449_c1
1452 nmdc:mga08y16_11412_c1
1453 nmdc:mga08y16_158805_c1
1454 nmdc:mga08y16_175567_c1
1455 nmdc:mga08y16_82116_c1
1456 nmdc:mga0n895_113216_c1
1457 nmdc:mga0n895_130156_c1
1458 nmdc:mga0n895_14788_c1
1459 nmdc:mga0n895_8895_c1
1460 nmdc:mga0rr50_100880_c1
1461 nmdc:mga0rr50_248995_c1
1462 nmdc:mga08x19_77649_c1
1463 nmdc:mga0a205_122548_c1
1464 nmdc:mga0a205_21186_c1
1465 nmdc:mga0a205_229295_c1
1466 Ga0495601_0015071
1467 Ga0495601_0030136
1468 Ga0495655_0028212
1469 Ga0495595_0015476
1470 Ga0495619_0009482
1471 Ga0495619_0040721
1472 Ga0500578_0151244
1473 Ga0500651_0122844
1474 Ga0500566_0075409
1475 Ga0500560_004643
1476 Ga0500569_000894
1477 Ga0500652_053372
1478 Ga0500658_0056498
1479 Ga0500561_0000412
1480 Ga0500600_0054940
1481 Ga0500616_0083431
1482 Ga0500633_0037512
1483 Ga0500634_0046736
1484 Ga0501084_0089455
1485 Ga0501084_0145799
1486 Ga0501084_0248232
1487 Ga0590075_004461
1488 Ga0590077_004917
1489 Ga0501082_0026469
1490 Ga0501082_0182637
1491 Ga0530510_0002662
1492 Ga0530510_0013262
1493 Ga0530510_0029929
1494 2585305134
1495 2644266179
1496 2644437598
1497 2768642026
1498 2785342165
1499 2786671648
1500 2804845837
1501 2808843053
1502 2809233076
1503 2812357070
1504 2812479731
1505 2852640067
1506 2862179501
1507 2862390068
1508 2862578432
1509 2862709550
1510 2863411847
1511 2867372997
1512 2867435712
1513 2877680128
1514 2912731044
1515 2919471469
1516 2946068808
1517 2947228102
1518 2954385061
1519 2954677934
1520 2954686223
1521 2954695879
1522 2954711070
1523 2954715284
1524 2954725225
1525 2954736591
1526 2954744158
1527 2954755440
1528 2954763101
1529 2990045606
1530 2990063970
1531 2990091290
1532 3006324976
1533 3006397276
1534 3006492226
1535 3006498234
1536 8008485898
1537 8008566241
1538 8008578056
1539 8025418512
1540 8025524982
1541 8033690080
1542 8048409562
1543 8056454033
1544 8056833237

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

164

437

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsn-assembly1.cif.gz_D bovine complex i in lipid nanodisc, deactive-apo 0.9725 75 422
7vwj-assembly1.cif.gz_Q matrix arm of deactive state ci from rotenone-nadh dataset 0.9707 36 422
6zk9-assembly1.cif.gz_4 peripheral domain of open complex i during turnover 0.9701 36 422
8e73-assembly1.cif.gz_S2 vigna radiata supercomplex i+iii2 (full bridge) 0.9694 36 422
8e73-assembly1.cif.gz_S2 vigna radiata supercomplex i+iii2 (full bridge) 0.9669 36 422
ID Description Score Start End Superfamily
af_Q23883_16_406_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9528 36 422 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9512 36 422 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9465 36 422 1.10.645.10
af_Q23883_16_406_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9409 36 422 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9401 36 422 1.10.645.10
ID Description Score Start End GO Terms
AF-A0A7V9UXZ8-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) 0.9839 70 422 GO:0016651
GO:0048038
GO:0051287
AF-A0A7V9UXZ8-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) 0.9811 70 422 GO:0016651
GO:0048038
GO:0051287
AF-A0A7W0YZR1-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) 0.9773 125 422 GO:0016020
GO:0016651
GO:0048038
GO:0051287
AF-A0A5Q0UVT3-F1-model_v4 NADH-plastoquinone oxidoreductase subunit 7 0.9769 59 298 GO:0009535
GO:0016651
GO:0048038
GO:0051287
AF-A0A067TRS5-F1-model_v4 NADH-quinone oxidoreductase subunit D domain-containing protein 0.9762 54 420 GO:0005739
GO:0006120
GO:0016651
GO:0048038
GO:0051287

Map