F480109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 390 | 1544 | 410 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10106412|Ga0111539_101064122 |
| Length | 437 |
| Sequence | VTVAPERPRTWANVDPSLLRGGPIYEGTRIPHPIPTILEVSDEVRATDDILTVNFGPNHPSTHGVLRLIVDLDGETVVGVRAIIGYLHTGFEKNMEAKTWWKGITYGPRIDYVSFQNNELVFVLAVEKLLQLETPEKAVWMRTLLAELNRIHSHLVWLGTSGLELGAISMFWYCFRERDQILDLFELVTGYRMHTRYFQVGGLAEDIPDGFYAECRKFVDWMPRALDDYLGLLDRNPIWLERTKGVGLLSAEDAVAMGQSGPVLRASGVDWDNRKRSPYLAYDQVDFDVPVYPEGDTYARYRVHMDEMAQSVRIVEQCLDRLEELRDGPWIADDRKVVLPPRHELHTSMESLIHHFKIVTEGYRVPEGEVYTVIESPRGENGCYVVSDGGPRPWRVKFRAPSFVATPMAAVMCNGILVADMIAVIGSLDTVMGEVDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 156 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 185 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 186 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 187 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 188 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 191 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 327 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 334 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 337 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 340 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 341 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 342 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 343 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 344 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 345 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 346 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 347 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 348 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 349 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 350 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 351 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 352 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 353 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 354 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 355 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 356 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 357 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 358 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 359 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 360 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 361 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 362 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 363 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 364 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 365 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 366 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 367 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 368 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 369 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 370 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 371 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 372 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 373 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 374 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 375 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 376 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 377 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 378 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 379 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 380 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 381 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 382 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 383 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 384 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 385 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 386 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 387 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 388 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 389 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 390 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.13 |
| Metatranscriptomes | 0.26 |
| Isolates | 6.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.85 |
| Nodule | 0.39 |
| Rhizoplane | 9.33 |
| Rhizosphere | 82.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10106412 | 3300009094 | Bacteria | 3290 |
| 2 | ARcpr5oldR_c001385 | 3300000041 | Bacteria | 2449 |
| 3 | ARcpr5yngRDRAFT_c001296 | 3300000043 | Bacteria | 2778 |
| 4 | ARSoilOldRDRAFT_c001312 | 3300000044 | Bacteria | 2329 |
| 5 | Ga0006562J51391_1035120 | 3300003578 | Bacteria | 1970 |
| 6 | Ga0006562J51391_1035122 | 3300003578 | Bacteria | 9580 |
| 7 | Ga0070658_10015063 | 3300005327 | Bacteria | 6188 |
| 8 | Ga0070658_10016206 | 3300005327 | Bacteria | 5962 |
| 9 | Ga0070683_100008132 | 3300005329 | Bacteria | 8908 |
| 10 | Ga0070683_100020240 | 3300005329 | Bacteria | 5920 |
| 11 | Ga0070683_100075139 | 3300005329 | Bacteria | 3157 |
| 12 | Ga0068869_100105477 | 3300005334 | Bacteria | 2137 |
| 13 | Ga0070680_100010144 | 3300005336 | Bacteria | 7262 |
| 14 | Ga0070680_100096901 | 3300005336 | Bacteria | 2445 |
| 15 | Ga0070682_100094833 | 3300005337 | Bacteria | 1958 |
| 16 | Ga0070682_100113219 | 3300005337 | Bacteria | 1812 |
| 17 | Ga0068868_100084428 | 3300005338 | Bacteria | 2550 |
| 18 | Ga0068868_100233437 | 3300005338 | Bacteria | 1544 |
| 19 | Ga0068868_100251514 | 3300005338 | Bacteria | 1487 |
| 20 | Ga0070660_100039145 | 3300005339 | Bacteria | 3602 |
| 21 | Ga0070660_100094178 | 3300005339 | Bacteria | 2366 |
| 22 | Ga0070689_100036534 | 3300005340 | Bacteria | 3758 |
| 23 | Ga0070691_10002704 | 3300005341 | Bacteria | 7901 |
| 24 | Ga0070691_10040359 | 3300005341 | Bacteria | 2205 |
| 25 | Ga0070687_100101825 | 3300005343 | Bacteria | 1609 |
| 26 | Ga0070661_100020187 | 3300005344 | Bacteria | 4750 |
| 27 | Ga0070668_100012259 | 3300005347 | Bacteria | 6387 |
| 28 | Ga0070671_100037278 | 3300005355 | Bacteria | 4031 |
| 29 | Ga0070671_100067798 | 3300005355 | Bacteria | 2975 |
| 30 | Ga0070671_100176526 | 3300005355 | Bacteria | 1808 |
| 31 | Ga0070659_100014825 | 3300005366 | Bacteria | 5828 |
| 32 | Ga0070659_100047003 | 3300005366 | Bacteria | 3384 |
| 33 | Ga0070659_100091451 | 3300005366 | Bacteria | 2439 |
| 34 | Ga0070703_10007546 | 3300005406 | Bacteria | 3055 |
| 35 | Ga0070714_100016643 | 3300005435 | Bacteria | 5943 |
| 36 | Ga0070713_100002608 | 3300005436 | Bacteria | 11779 |
| 37 | Ga0070710_10032165 | 3300005437 | Bacteria | 2839 |
| 38 | Ga0070705_100024733 | 3300005440 | Bacteria | 3246 |
| 39 | Ga0070700_100043859 | 3300005441 | Bacteria | 2752 |
| 40 | Ga0070708_100019534 | 3300005445 | Bacteria | 5696 |
| 41 | Ga0070678_100029847 | 3300005456 | Bacteria | 3739 |
| 42 | Ga0070662_100002641 | 3300005457 | Bacteria | 11051 |
| 43 | Ga0070662_100092736 | 3300005457 | Bacteria | 2270 |
| 44 | Ga0070681_10003419 | 3300005458 | Bacteria | 14871 |
| 45 | Ga0070681_10012572 | 3300005458 | Bacteria | 8400 |
| 46 | Ga0070681_10027200 | 3300005458 | Bacteria | 5751 |
| 47 | Ga0070681_10168940 | 3300005458 | Bacteria | 2109 |
| 48 | Ga0068867_100009644 | 3300005459 | Bacteria | 6806 |
| 49 | Ga0070706_100101363 | 3300005467 | Bacteria | 2675 |
| 50 | Ga0070707_100033547 | 3300005468 | Bacteria | 4896 |
| 51 | Ga0070698_100008838 | 3300005471 | Bacteria | 10835 |
| 52 | Ga0070698_100053383 | 3300005471 | Bacteria | 4107 |
| 53 | Ga0070699_100052819 | 3300005518 | Bacteria | 3516 |
| 54 | Ga0070699_100079565 | 3300005518 | Bacteria | 2855 |
| 55 | Ga0070679_100009974 | 3300005530 | Bacteria | 8991 |
| 56 | Ga0070679_100011004 | 3300005530 | Bacteria | 8600 |
| 57 | Ga0070679_100024397 | 3300005530 | Bacteria | 5925 |
| 58 | Ga0070679_100029047 | 3300005530 | Bacteria | 5454 |
| 59 | Ga0070679_100029602 | 3300005530 | Bacteria | 5402 |
| 60 | Ga0070679_100072153 | 3300005530 | Bacteria | 3444 |
| 61 | Ga0070679_100075147 | 3300005530 | Bacteria | 3369 |
| 62 | Ga0070679_100153389 | 3300005530 | Bacteria | 2279 |
| 63 | Ga0070684_100008653 | 3300005535 | Bacteria | 7974 |
| 64 | Ga0070684_100036248 | 3300005535 | Bacteria | 4226 |
| 65 | Ga0070684_100122358 | 3300005535 | Bacteria | 2341 |
| 66 | Ga0068853_100047525 | 3300005539 | Bacteria | 3682 |
| 67 | Ga0068853_100115000 | 3300005539 | Bacteria | 2394 |
| 68 | Ga0070672_100077560 | 3300005543 | Bacteria | 2657 |
| 69 | Ga0070686_100054188 | 3300005544 | Bacteria | 2564 |
| 70 | Ga0070695_100020417 | 3300005545 | Bacteria | 4045 |
| 71 | Ga0070695_100052827 | 3300005545 | Bacteria | 2612 |
| 72 | Ga0070696_100063122 | 3300005546 | Bacteria | 2594 |
| 73 | Ga0070696_100102415 | 3300005546 | Bacteria | 2053 |
| 74 | Ga0070693_100128546 | 3300005547 | Bacteria | 1580 |
| 75 | Ga0068855_100024569 | 3300005563 | Bacteria | 7208 |
| 76 | Ga0068855_100073422 | 3300005563 | Bacteria | 3974 |
| 77 | Ga0068855_100088467 | 3300005563 | Bacteria | 3577 |
| 78 | Ga0068857_100090175 | 3300005577 | Bacteria | 2743 |
| 79 | Ga0068854_100113673 | 3300005578 | Bacteria | 2045 |
| 80 | Ga0068854_100162589 | 3300005578 | Bacteria | 1730 |
| 81 | Ga0068856_100069237 | 3300005614 | Bacteria | 3489 |
| 82 | Ga0068856_100254667 | 3300005614 | Bacteria | 1770 |
| 83 | Ga0070702_100018760 | 3300005615 | Bacteria | 3594 |
| 84 | Ga0070702_100036937 | 3300005615 | Bacteria | 2711 |
| 85 | Ga0070702_100040627 | 3300005615 | Bacteria | 2603 |
| 86 | Ga0068852_100079647 | 3300005616 | Bacteria | 2902 |
| 87 | Ga0068864_100113330 | 3300005618 | Bacteria | 2417 |
| 88 | Ga0068861_100001783 | 3300005719 | Bacteria | 13846 |
| 89 | Ga0068870_10051347 | 3300005840 | Bacteria | 2182 |
| 90 | Ga0081455_10019559 | 3300005937 | Bacteria | 6403 |
| 91 | Ga0081540_1014346 | 3300005983 | Bacteria | 5081 |
| 92 | Ga0081539_10000200 | 3300005985 | Bacteria | 139291 |
| 93 | Ga0081539_10000867 | 3300005985 | Bacteria | 57938 |
| 94 | Ga0075368_10048035 | 3300006042 | Bacteria | 1691 |
| 95 | Ga0075432_10003491 | 3300006058 | Bacteria | 5320 |
| 96 | Ga0070715_10008364 | 3300006163 | Bacteria | 3603 |
| 97 | Ga0070716_100009248 | 3300006173 | Bacteria | 4910 |
| 98 | Ga0070716_100037807 | 3300006173 | Bacteria | 2669 |
| 99 | Ga0070716_100046618 | 3300006173 | Bacteria | 2440 |
| 100 | Ga0070712_100001482 | 3300006175 | Bacteria | 14325 |
| 101 | Ga0075367_10001380 | 3300006178 | Bacteria | 10368 |
| 102 | Ga0075367_10128397 | 3300006178 | Bacteria | 1566 |
| 103 | Ga0097621_100149288 | 3300006237 | Bacteria | 2004 |
| 104 | Ga0075370_10008702 | 3300006353 | Bacteria | 5234 |
| 105 | Ga0075428_100021918 | 3300006844 | Bacteria | 7074 |
| 106 | Ga0075428_100037530 | 3300006844 | Bacteria | 5334 |
| 107 | Ga0075428_100095575 | 3300006844 | Bacteria | 3239 |
| 108 | Ga0075430_100073420 | 3300006846 | Bacteria | 2869 |
| 109 | Ga0075430_100077560 | 3300006846 | Bacteria | 2785 |
| 110 | Ga0075430_100169274 | 3300006846 | Bacteria | 1817 |
| 111 | Ga0075431_100001660 | 3300006847 | Bacteria | 20853 |
| 112 | Ga0075433_10043840 | 3300006852 | Bacteria | 3885 |
| 113 | Ga0075433_10047878 | 3300006852 | Bacteria | 3718 |
| 114 | Ga0075433_10164838 | 3300006852 | Bacteria | 1972 |
| 115 | Ga0075433_10186095 | 3300006852 | Bacteria | 1848 |
| 116 | Ga0075434_100029826 | 3300006871 | Bacteria | 5369 |
| 117 | Ga0075434_100244620 | 3300006871 | Bacteria | 1814 |
| 118 | Ga0075429_100223356 | 3300006880 | Bacteria | 1650 |
| 119 | Ga0068865_100011940 | 3300006881 | Bacteria | 5453 |
| 120 | Ga0075436_100186824 | 3300006914 | Bacteria | 1466 |
| 121 | Ga0075435_100025556 | 3300007076 | Bacteria | 4597 |
| 122 | Ga0105244_10080448 | 3300009036 | Bacteria | 1614 |
| 123 | Ga0105240_10076875 | 3300009093 | Bacteria | 4114 |
| 124 | Ga0105240_10129459 | 3300009093 | Bacteria | 3029 |
| 125 | Ga0111539_10008714 | 3300009094 | Bacteria | 12869 |
| 126 | Ga0111539_10035748 | 3300009094 | Bacteria | 6013 |
| 127 | Ga0111539_10180389 | 3300009094 | Bacteria | 2466 |
| 128 | Ga0105245_10071821 | 3300009098 | Bacteria | 3144 |
| 129 | Ga0105245_10227388 | 3300009098 | Bacteria | 1803 |
| 130 | Ga0114129_10008166 | 3300009147 | Bacteria | 14913 |
| 131 | Ga0114129_10018159 | 3300009147 | Bacteria | 10015 |
| 132 | Ga0105243_10011008 | 3300009148 | Bacteria | 6839 |
| 133 | Ga0105243_10112217 | 3300009148 | Bacteria | 2283 |
| 134 | Ga0105243_10365336 | 3300009148 | Bacteria | 1330 |
| 135 | Ga0105248_10088431 | 3300009177 | Bacteria | 3486 |
| 136 | Ga0105248_10135629 | 3300009177 | Bacteria | 2776 |
| 137 | Ga0105237_10129677 | 3300009545 | Bacteria | 2516 |
| 138 | Ga0105238_10072267 | 3300009551 | Bacteria | 3446 |
| 139 | Ga0105238_10191878 | 3300009551 | Bacteria | 2019 |
| 140 | Ga0105238_10337403 | 3300009551 | Bacteria | 1495 |
| 141 | Ga0105249_10001703 | 3300009553 | Bacteria | 19257 |
| 142 | Ga0105239_10072822 | 3300010375 | Bacteria | 3778 |
| 143 | Ga0157373_10060213 | 3300013100 | Bacteria | 2690 |
| 144 | Ga0157373_10097746 | 3300013100 | Bacteria | 2067 |
| 145 | Ga0157371_10134136 | 3300013102 | Bacteria | 1763 |
| 146 | Ga0157370_10037029 | 3300013104 | Bacteria | 4732 |
| 147 | Ga0157369_10020280 | 3300013105 | Bacteria | 7429 |
| 148 | Ga0157369_10030859 | 3300013105 | Bacteria | 5908 |
| 149 | Ga0157374_10147360 | 3300013296 | Bacteria | 2287 |
| 150 | Ga0157378_10185890 | 3300013297 | Bacteria | 1957 |
| 151 | Ga0163162_10038088 | 3300013306 | Bacteria | 4799 |
| 152 | Ga0163162_10090462 | 3300013306 | Bacteria | 3142 |
| 153 | Ga0163162_10263829 | 3300013306 | Bacteria | 1854 |
| 154 | Ga0157372_10021088 | 3300013307 | Bacteria | 7037 |
| 155 | Ga0157380_10006119 | 3300014326 | Bacteria | 8436 |
| 156 | Ga0157380_10028368 | 3300014326 | Bacteria | 4266 |
| 157 | Ga0157380_10142338 | 3300014326 | Bacteria | 2062 |
| 158 | Ga0157376_10011084 | 3300014969 | Bacteria | 6629 |
| 159 | Ga0163161_10043707 | 3300017792 | Bacteria | 3226 |
| 160 | Ga0213875_10017925 | 3300021388 | Bacteria | 3417 |
| 161 | Ga0207426_1003642 | 3300025302 | Bacteria | 8146 |
| 162 | Ga0207426_1009984 | 3300025302 | Bacteria | 3715 |
| 163 | Ga0207653_10014440 | 3300025885 | Bacteria | 2478 |
| 164 | Ga0207692_10094910 | 3300025898 | Bacteria | 1625 |
| 165 | Ga0207688_10008324 | 3300025901 | Bacteria | 5640 |
| 166 | Ga0207647_10041315 | 3300025904 | Bacteria | 2901 |
| 167 | Ga0207645_10051435 | 3300025907 | Bacteria | 2632 |
| 168 | Ga0207643_10037285 | 3300025908 | Bacteria | 2728 |
| 169 | Ga0207705_10005496 | 3300025909 | Bacteria | 9479 |
| 170 | Ga0207705_10012310 | 3300025909 | Bacteria | 6180 |
| 171 | Ga0207705_10012655 | 3300025909 | Bacteria | 6089 |
| 172 | Ga0207705_10118873 | 3300025909 | Bacteria | 1959 |
| 173 | Ga0207684_10017162 | 3300025910 | Bacteria | 6213 |
| 174 | Ga0207707_10007563 | 3300025912 | Bacteria | 9464 |
| 175 | Ga0207707_10014298 | 3300025912 | Bacteria | 6912 |
| 176 | Ga0207707_10019074 | 3300025912 | Bacteria | 5985 |
| 177 | Ga0207707_10024976 | 3300025912 | Bacteria | 5228 |
| 178 | Ga0207707_10051905 | 3300025912 | Bacteria | 3571 |
| 179 | Ga0207707_10200886 | 3300025912 | Bacteria | 1738 |
| 180 | Ga0207695_10179577 | 3300025913 | Bacteria | 2038 |
| 181 | Ga0207671_10213070 | 3300025914 | Bacteria | 1512 |
| 182 | Ga0207693_10001016 | 3300025915 | Bacteria | 25132 |
| 183 | Ga0207693_10003173 | 3300025915 | Bacteria | 14125 |
| 184 | Ga0207693_10003612 | 3300025915 | Bacteria | 13208 |
| 185 | Ga0207663_10135480 | 3300025916 | Bacteria | 1708 |
| 186 | Ga0207660_10017699 | 3300025917 | Bacteria | 4740 |
| 187 | Ga0207660_10018755 | 3300025917 | Bacteria | 4618 |
| 188 | Ga0207660_10120870 | 3300025917 | Bacteria | 1983 |
| 189 | Ga0207657_10005284 | 3300025919 | Bacteria | 13530 |
| 190 | Ga0207657_10007571 | 3300025919 | Bacteria | 11131 |
| 191 | Ga0207657_10016238 | 3300025919 | Bacteria | 7185 |
| 192 | Ga0207657_10046528 | 3300025919 | Bacteria | 3799 |
| 193 | Ga0207657_10062709 | 3300025919 | Bacteria | 3181 |
| 194 | Ga0207657_10211805 | 3300025919 | Bacteria | 1555 |
| 195 | Ga0207649_10074133 | 3300025920 | Bacteria | 2183 |
| 196 | Ga0207649_10199578 | 3300025920 | Bacteria | 1412 |
| 197 | Ga0207652_10018126 | 3300025921 | Bacteria | 5771 |
| 198 | Ga0207652_10032369 | 3300025921 | Bacteria | 4395 |
| 199 | Ga0207652_10076750 | 3300025921 | Bacteria | 2914 |
| 200 | Ga0207646_10001072 | 3300025922 | Bacteria | 34848 |
| 201 | Ga0207646_10027364 | 3300025922 | Bacteria | 5201 |
| 202 | Ga0207659_10126301 | 3300025926 | Bacteria | 1967 |
| 203 | Ga0207687_10073140 | 3300025927 | Bacteria | 2454 |
| 204 | Ga0207687_10135866 | 3300025927 | Bacteria | 1859 |
| 205 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 206 | Ga0207700_10080444 | 3300025928 | Bacteria | 2541 |
| 207 | Ga0207644_10110037 | 3300025931 | Bacteria | 2082 |
| 208 | Ga0207690_10011819 | 3300025932 | Bacteria | 5221 |
| 209 | Ga0207690_10051892 | 3300025932 | Bacteria | 2744 |
| 210 | Ga0207690_10086031 | 3300025932 | Bacteria | 2208 |
| 211 | Ga0207706_10014850 | 3300025933 | Bacteria | 7051 |
| 212 | Ga0207709_10040500 | 3300025935 | Bacteria | 2790 |
| 213 | Ga0207665_10008523 | 3300025939 | Bacteria | 6750 |
| 214 | Ga0207691_10019105 | 3300025940 | Bacteria | 6489 |
| 215 | Ga0207711_10175355 | 3300025941 | Bacteria | 1947 |
| 216 | Ga0207711_10219911 | 3300025941 | Bacteria | 1737 |
| 217 | Ga0207711_10232798 | 3300025941 | Bacteria | 1688 |
| 218 | Ga0207661_10008048 | 3300025944 | Bacteria | 7513 |
| 219 | Ga0207667_10054593 | 3300025949 | Bacteria | 4202 |
| 220 | Ga0207667_10107278 | 3300025949 | Bacteria | 2881 |
| 221 | Ga0207667_10117968 | 3300025949 | Bacteria | 2735 |
| 222 | Ga0207667_10203569 | 3300025949 | Bacteria | 2030 |
| 223 | Ga0207651_10040296 | 3300025960 | Bacteria | 3089 |
| 224 | Ga0207712_10007048 | 3300025961 | Bacteria | 7092 |
| 225 | Ga0207712_10038933 | 3300025961 | Bacteria | 3254 |
| 226 | Ga0207668_10027466 | 3300025972 | Bacteria | 3707 |
| 227 | Ga0207640_10057756 | 3300025981 | Bacteria | 2554 |
| 228 | Ga0207640_10090370 | 3300025981 | Bacteria | 2119 |
| 229 | Ga0207639_10026202 | 3300026041 | Bacteria | 4236 |
| 230 | Ga0207708_10016026 | 3300026075 | Bacteria | 5629 |
| 231 | Ga0207708_10047470 | 3300026075 | Bacteria | 3269 |
| 232 | Ga0207702_10037641 | 3300026078 | Bacteria | 4050 |
| 233 | Ga0207648_10020479 | 3300026089 | Bacteria | 5955 |
| 234 | Ga0207648_10024817 | 3300026089 | Bacteria | 5347 |
| 235 | Ga0207676_10118178 | 3300026095 | Bacteria | 2231 |
| 236 | Ga0207675_100044599 | 3300026118 | Bacteria | 4144 |
| 237 | Ga0207675_100050780 | 3300026118 | Bacteria | 3870 |
| 238 | Ga0207683_10051131 | 3300026121 | Bacteria | 3620 |
| 239 | Ga0207683_10137781 | 3300026121 | Bacteria | 2197 |
| 240 | Ga0207698_10180544 | 3300026142 | Bacteria | 1869 |
| 241 | Ga0209813_10013231 | 3300027866 | Bacteria | 2199 |
| 242 | Ga0207428_10000244 | 3300027907 | Bacteria | 74209 |
| 243 | Ga0207428_10027943 | 3300027907 | Bacteria | 4692 |
| 244 | Ga0207428_10104805 | 3300027907 | Bacteria | 2182 |
| 245 | Ga0268266_10046859 | 3300028379 | Bacteria | 3701 |
| 246 | Ga0307517_10008770 | 3300028786 | Bacteria | 14457 |
| 247 | Ga0307515_10073513 | 3300028794 | Bacteria | 4593 |
| 248 | Ga0307513_10074778 | 3300031456 | Bacteria | 3521 |
| 249 | Ga0307408_100030330 | 3300031548 | Bacteria | 3754 |
| 250 | Ga0307508_10011891 | 3300031616 | Bacteria | 7960 |
| 251 | Ga0307514_10021200 | 3300031649 | Bacteria | 5299 |
| 252 | Ga0307516_10137883 | 3300031730 | Bacteria | 2212 |
| 253 | Ga0307405_10074579 | 3300031731 | Bacteria | 2194 |
| 254 | Ga0316577_10063287 | 3300031733 | Bacteria | 2066 |
| 255 | Ga0307413_10005959 | 3300031824 | Bacteria | 5512 |
| 256 | Ga0307518_10030990 | 3300031838 | Bacteria | 3874 |
| 257 | Ga0307410_10013107 | 3300031852 | Bacteria | 4824 |
| 258 | Ga0307412_10014671 | 3300031911 | Bacteria | 4629 |
| 259 | Ga0307416_100032245 | 3300032002 | Bacteria | 3955 |
| 260 | Ga0307411_10007234 | 3300032005 | Bacteria | 5632 |
| 261 | Ga0307507_10145581 | 3300033179 | Bacteria | 1801 |
| 262 | Ga0373928_0003310 | 3300035084 | Bacteria | 3085 |
| 263 | Ga0373940_0002686 | 3300035088 | Bacteria | 3507 |
| 264 | Ga0373949_0020994 | 3300035090 | Bacteria | 1498 |
| 265 | Ga0373951_0011866 | 3300035091 | Bacteria | 1959 |
| 266 | Ga0373952_0002257 | 3300035092 | Bacteria | 3470 |
| 267 | Ga0373932_0007715 | 3300035112 | Bacteria | 2567 |
| 268 | Ga0373939_0002179 | 3300035114 | Bacteria | 4639 |
| 269 | Ga0373939_0016692 | 3300035114 | Bacteria | 1940 |
| 270 | Ga0373941_0022527 | 3300035115 | Bacteria | 1788 |
| 271 | Ga0373945_0045937 | 3300035116 | Bacteria | 1592 |
| 272 | Ga0373943_0000299 | 3300035170 | Bacteria | 20623 |
| 273 | Ga0373946_0001582 | 3300035171 | Bacteria | 7930 |
| 274 | Ga0373955_0033805 | 3300035172 | Bacteria | 2695 |
| 275 | Ga0373942_0005086 | 3300035207 | Bacteria | 3050 |
| 276 | Ga0373961_0008730 | 3300035241 | Bacteria | 2468 |
| 277 | Ga0373931_0006511 | 3300035691 | Bacteria | 5458 |
| 278 | Ga0373935_0012369 | 3300035692 | Bacteria | 5136 |
| 279 | Ga0373947_0000185 | 3300035725 | Bacteria | 34341 |
| 280 | Ga0373947_0007323 | 3300035725 | Bacteria | 6389 |
| 281 | Ga0373925_0006691 | 3300037068 | Bacteria | 8454 |
| 282 | Ga0373925_0075134 | 3300037068 | Bacteria | 2560 |
| 283 | Ga0373925_0159247 | 3300037068 | Bacteria | 1777 |
| 284 | Ga0395899_0006920 | 3300037312 | Bacteria | 8784 |
| 285 | Ga0395899_0007215 | 3300037312 | Bacteria | 8603 |
| 286 | Ga0395899_0011411 | 3300037312 | Bacteria | 6803 |
| 287 | Ga0395899_0013616 | 3300037312 | Bacteria | 6218 |
| 288 | Ga0395900_0000528 | 3300037418 | Bacteria | 53945 |
| 289 | Ga0395900_0002771 | 3300037418 | Bacteria | 19158 |
| 290 | Ga0395900_0025290 | 3300037418 | Bacteria | 6078 |
| 291 | Ga0395900_0025854 | 3300037418 | Bacteria | 6010 |
| 292 | Ga0395900_0040788 | 3300037418 | Bacteria | 4784 |
| 293 | Ga0395900_0054193 | 3300037418 | Bacteria | 4129 |
| 294 | Ga0395900_0055681 | 3300037418 | Bacteria | 4072 |
| 295 | Ga0395900_0057266 | 3300037418 | Bacteria | 4012 |
| 296 | Ga0395900_0068954 | 3300037418 | Bacteria | 3634 |
| 297 | Ga0395900_0076411 | 3300037418 | Bacteria | 3442 |
| 298 | Ga0395900_0092986 | 3300037418 | Bacteria | 3098 |
| 299 | Ga0395900_0098804 | 3300037418 | Bacteria | 2999 |
| 300 | Ga0395900_0102055 | 3300037418 | Bacteria | 2947 |
| 301 | Ga0395900_0154139 | 3300037418 | Bacteria | 2347 |
| 302 | Ga0395898_0001875 | 3300037466 | Bacteria | 26866 |
| 303 | Ga0395898_0002139 | 3300037466 | Bacteria | 24346 |
| 304 | Ga0395898_0003526 | 3300037466 | Bacteria | 17447 |
| 305 | Ga0395898_0003680 | 3300037466 | Bacteria | 17031 |
| 306 | Ga0395898_0012709 | 3300037466 | Bacteria | 8695 |
| 307 | Ga0395898_0016068 | 3300037466 | Bacteria | 7668 |
| 308 | Ga0395898_0021434 | 3300037466 | Bacteria | 6553 |
| 309 | Ga0395898_0021753 | 3300037466 | Bacteria | 6499 |
| 310 | Ga0395898_0067339 | 3300037466 | Bacteria | 3467 |
| 311 | Ga0395898_0091834 | 3300037466 | Bacteria | 2920 |
| 312 | Ga0395898_0311983 | 3300037466 | Bacteria | 1500 |
| 313 | Ga0395905_0000661 | 3300037471 | Bacteria | 45819 |
| 314 | Ga0395905_0005716 | 3300037471 | Bacteria | 12642 |
| 315 | Ga0395905_0006912 | 3300037471 | Bacteria | 11345 |
| 316 | Ga0395905_0009554 | 3300037471 | Bacteria | 9471 |
| 317 | Ga0395905_0021602 | 3300037471 | Bacteria | 6086 |
| 318 | Ga0395905_0031768 | 3300037471 | Bacteria | 4968 |
| 319 | Ga0395905_0042861 | 3300037471 | Bacteria | 4246 |
| 320 | Ga0395905_0053172 | 3300037471 | Bacteria | 3791 |
| 321 | Ga0395905_0073662 | 3300037471 | Bacteria | 3201 |
| 322 | Ga0436364_1424714 | 3300037853 | Bacteria | 20926 |
| 323 | Ga0395901_0001057 | 3300038443 | Bacteria | 29607 |
| 324 | Ga0395901_0001983 | 3300038443 | Bacteria | 21042 |
| 325 | Ga0395901_0005247 | 3300038443 | Bacteria | 13081 |
| 326 | Ga0395901_0010426 | 3300038443 | Bacteria | 9415 |
| 327 | Ga0395901_0012794 | 3300038443 | Bacteria | 8510 |
| 328 | Ga0395901_0019001 | 3300038443 | Bacteria | 7025 |
| 329 | Ga0395901_0021701 | 3300038443 | Bacteria | 6579 |
| 330 | Ga0395901_0027883 | 3300038443 | Bacteria | 5806 |
| 331 | Ga0395901_0046191 | 3300038443 | Bacteria | 4522 |
| 332 | Ga0395901_0049126 | 3300038443 | Bacteria | 4382 |
| 333 | Ga0395901_0091435 | 3300038443 | Bacteria | 3185 |
| 334 | Ga0395901_0157721 | 3300038443 | Bacteria | 2383 |
| 335 | Ga0395901_0176364 | 3300038443 | Bacteria | 2242 |
| 336 | Ga0395901_0212120 | 3300038443 | Bacteria | 2026 |
| 337 | Ga0395901_0236488 | 3300038443 | Bacteria | 1906 |
| 338 | Ga0395901_0313033 | 3300038443 | Bacteria | 1625 |
| 339 | Ga0242420_000637 | 3300038996 | Bacteria | 4102 |
| 340 | Ga0436365_0868245 | 3300039437 | Bacteria | 1985 |
| 341 | Ga0436365_1320454 | 3300039437 | Bacteria | 1393 |
| 342 | Ga0439436_0000548 | 3300041404 | Bacteria | 9885 |
| 343 | Ga0439436_0002790 | 3300041404 | Bacteria | 5283 |
| 344 | Ga0439439_0005529 | 3300041406 | Bacteria | 2889 |
| 345 | Ga0451837_1533153 | 3300041494 | Bacteria | 1500 |
| 346 | Ga0451839_0165057 | 3300041496 | Bacteria | 2945 |
| 347 | Ga0451847_0111370 | 3300041503 | Bacteria | 3495 |
| 348 | Ga0451849_0650206 | 3300041505 | Bacteria | 2930 |
| 349 | Ga0451855_1406534 | 3300041511 | Bacteria | 3231 |
| 350 | Ga0451853_0938959 | 3300041512 | Bacteria | 1878 |
| 351 | Ga0439433_0000982 | 3300041999 | Bacteria | 5740 |
| 352 | Ga0439457_000625 | 3300042014 | Bacteria | 10447 |
| 353 | Ga0439458_0000467 | 3300042157 | Bacteria | 10310 |
| 354 | Ga0466969_0048588 | 3300044656 | Bacteria | 2097 |
| 355 | Ga0466965_0093234 | 3300044683 | Bacteria | 1534 |
| 356 | Ga0466966_0025154 | 3300044684 | Bacteria | 3890 |
| 357 | Ga0466966_0049536 | 3300044684 | Bacteria | 2676 |
| 358 | Ga0466966_0054794 | 3300044684 | Bacteria | 2525 |
| 359 | Ga0466961_0005145 | 3300044693 | Bacteria | 8227 |
| 360 | Ga0466963_0000425 | 3300044694 | Bacteria | 19423 |
| 361 | Ga0466963_0022160 | 3300044694 | Bacteria | 4020 |
| 362 | Ga0466963_0050178 | 3300044694 | Bacteria | 2762 |
| 363 | Ga0466963_0086844 | 3300044694 | Bacteria | 2126 |
| 364 | Ga0466964_0005916 | 3300044706 | Bacteria | 4554 |
| 365 | Ga0466968_0011262 | 3300044735 | Bacteria | 3483 |
| 366 | Ga0466968_0047178 | 3300044735 | Bacteria | 1831 |
| 367 | Ga0466957_0007534 | 3300044842 | Bacteria | 6150 |
| 368 | Ga0466957_0103032 | 3300044842 | Bacteria | 1801 |
| 369 | Ga0466960_0048131 | 3300044901 | Bacteria | 2048 |
| 370 | Ga0466960_0080296 | 3300044901 | Bacteria | 1642 |
| 371 | Ga0466959_0024988 | 3300045049 | Bacteria | 4425 |
| 372 | Ga0466959_0038560 | 3300045049 | Bacteria | 3531 |
| 373 | Ga0466959_0061002 | 3300045049 | Bacteria | 2743 |
| 374 | Ga0466959_0072170 | 3300045049 | Bacteria | 2499 |
| 375 | Ga0466959_0110908 | 3300045049 | Bacteria | 1958 |
| 376 | Ga0451576_0237297 | 3300045051 | Bacteria | 1904 |
| 377 | Ga0466958_0028850 | 3300045836 | Bacteria | 3293 |
| 378 | Ga0466967_0000455 | 3300045976 | Bacteria | 19649 |
| 379 | Ga0466967_0003231 | 3300045976 | Bacteria | 10538 |
| 380 | Ga0466967_0013456 | 3300045976 | Bacteria | 6323 |
| 381 | Ga0466967_0017725 | 3300045976 | Bacteria | 5666 |
| 382 | Ga0466967_0033564 | 3300045976 | Bacteria | 4345 |
| 383 | Ga0466967_0049751 | 3300045976 | Bacteria | 3667 |
| 384 | Ga0466967_0061889 | 3300045976 | Bacteria | 3321 |
| 385 | Ga0495603_0001553 | 3300046455 | Bacteria | 13437 |
| 386 | Ga0495603_0014904 | 3300046455 | Bacteria | 4702 |
| 387 | Ga0495603_0085874 | 3300046455 | Bacteria | 1842 |
| 388 | Ga0495629_0000403 | 3300046459 | Bacteria | 36268 |
| 389 | Ga0495629_0007357 | 3300046459 | Bacteria | 8118 |
| 390 | Ga0495629_0052950 | 3300046459 | Bacteria | 2840 |
| 391 | Ga0495629_0053381 | 3300046459 | Bacteria | 2828 |
| 392 | Ga0495629_0101502 | 3300046459 | Bacteria | 2008 |
| 393 | Ga0495638_0062170 | 3300046460 | Bacteria | 2305 |
| 394 | Ga0495641_0004211 | 3300046461 | Bacteria | 10314 |
| 395 | Ga0495641_0013330 | 3300046461 | Bacteria | 4525 |
| 396 | Ga0495651_0009341 | 3300046462 | Bacteria | 7525 |
| 397 | Ga0495651_0011990 | 3300046462 | Bacteria | 6671 |
| 398 | Ga0495653_0030572 | 3300046463 | Bacteria | 4288 |
| 399 | Ga0495653_0050259 | 3300046463 | Bacteria | 3207 |
| 400 | Ga0495582_0000426 | 3300046473 | Bacteria | 23059 |
| 401 | Ga0495582_0039439 | 3300046473 | Bacteria | 2600 |
| 402 | Ga0495662_0005709 | 3300046476 | Bacteria | 6221 |
| 403 | Ga0495662_0044813 | 3300046476 | Bacteria | 2135 |
| 404 | Ga0495594_0002137 | 3300046499 | Bacteria | 10289 |
| 405 | Ga0495594_0014754 | 3300046499 | Bacteria | 4101 |
| 406 | Ga0495594_0056310 | 3300046499 | Bacteria | 2169 |
| 407 | Ga0495596_0048098 | 3300046500 | Bacteria | 1673 |
| 408 | Ga0495608_0148850 | 3300046511 | Bacteria | 1492 |
| 409 | Ga0495628_0052266 | 3300046516 | Bacteria | 3228 |
| 410 | Ga0495628_0198499 | 3300046516 | Bacteria | 1512 |
| 411 | Ga0495630_0038934 | 3300046517 | Bacteria | 3556 |
| 412 | Ga0495630_0172351 | 3300046517 | Bacteria | 1649 |
| 413 | Ga0495632_0014041 | 3300046519 | Bacteria | 4546 |
| 414 | Ga0495637_0042431 | 3300046520 | Bacteria | 1946 |
| 415 | Ga0495643_0001898 | 3300046522 | Bacteria | 17653 |
| 416 | Ga0495652_0073651 | 3300046529 | Bacteria | 2843 |
| 417 | Ga0495665_0000274 | 3300046531 | Bacteria | 26250 |
| 418 | Ga0495640_0006459 | 3300046533 | Bacteria | 9271 |
| 419 | Ga0495640_0032842 | 3300046533 | Bacteria | 3693 |
| 420 | Ga0495586_0002031 | 3300046535 | Bacteria | 10987 |
| 421 | Ga0495645_0104086 | 3300046543 | Bacteria | 2016 |
| 422 | Ga0495645_0135190 | 3300046543 | Bacteria | 1725 |
| 423 | Ga0495622_0038849 | 3300046557 | Bacteria | 2216 |
| 424 | Ga0495633_0116850 | 3300046558 | Bacteria | 1236 |
| 425 | Ga0495667_0064059 | 3300046559 | Bacteria | 2405 |
| 426 | Ga0495667_0066496 | 3300046559 | Bacteria | 2356 |
| 427 | Ga0495667_0114365 | 3300046559 | Bacteria | 1744 |
| 428 | Ga0495667_0115104 | 3300046559 | Bacteria | 1737 |
| 429 | Ga0495634_0028980 | 3300046642 | Bacteria | 3837 |
| 430 | Ga0495611_0037453 | 3300046648 | Bacteria | 2155 |
| 431 | Ga0495625_0050005 | 3300046660 | Bacteria | 3002 |
| 432 | Ga0495635_0006072 | 3300046663 | Bacteria | 8428 |
| 433 | Ga0495635_0012510 | 3300046663 | Bacteria | 5945 |
| 434 | Ga0495661_0099459 | 3300046665 | Bacteria | 1640 |
| 435 | Ga0495588_0051583 | 3300046674 | Bacteria | 2119 |
| 436 | Ga0495657_0020037 | 3300046675 | Bacteria | 4814 |
| 437 | Ga0495657_0031766 | 3300046675 | Bacteria | 3688 |
| 438 | Ga0495657_0119065 | 3300046675 | Bacteria | 1665 |
| 439 | Ga0495599_0036996 | 3300046678 | Bacteria | 3067 |
| 440 | Ga0495599_0051626 | 3300046678 | Bacteria | 2576 |
| 441 | Ga0495646_0021309 | 3300046680 | Bacteria | 4097 |
| 442 | Ga0495613_0046329 | 3300046689 | Bacteria | 3215 |
| 443 | Ga0495613_0211362 | 3300046689 | Bacteria | 1364 |
| 444 | Ga0495624_0007344 | 3300046690 | Bacteria | 7738 |
| 445 | Ga0495671_0136661 | 3300046692 | Bacteria | 1195 |
| 446 | Ga0495589_0003307 | 3300046794 | Bacteria | 8748 |
| 447 | Ga0495589_0015884 | 3300046794 | Bacteria | 3871 |
| 448 | Ga0495589_0032481 | 3300046794 | Bacteria | 2624 |
| 449 | Ga0495589_0071779 | 3300046794 | Bacteria | 1691 |
| 450 | Ga0495581_0000117 | 3300047315 | Bacteria | 33592 |
| 451 | Ga0495604_0016838 | 3300047317 | Bacteria | 5848 |
| 452 | Ga0495604_0060821 | 3300047317 | Bacteria | 2891 |
| 453 | Ga0495604_0075752 | 3300047317 | Bacteria | 2532 |
| 454 | Ga0495636_0013268 | 3300047318 | Bacteria | 3269 |
| 455 | Ga0495636_0064958 | 3300047318 | Bacteria | 1549 |
| 456 | Ga0495674_0007348 | 3300047319 | Bacteria | 10535 |
| 457 | Ga0495674_0028349 | 3300047319 | Bacteria | 5107 |
| 458 | Ga0495676_0000268 | 3300047321 | Bacteria | 42236 |
| 459 | Ga0495676_0022291 | 3300047321 | Bacteria | 5513 |
| 460 | Ga0495676_0034836 | 3300047321 | Bacteria | 4218 |
| 461 | Ga0495680_0081152 | 3300047322 | Bacteria | 2449 |
| 462 | Ga0495680_0251573 | 3300047322 | Bacteria | 1252 |
| 463 | Ga0495675_0017674 | 3300047444 | Bacteria | 4521 |
| 464 | Ga0495677_0044117 | 3300047445 | Bacteria | 1635 |
| 465 | Ga0495679_005854 | 3300047446 | Bacteria | 5396 |
| 466 | Ga0495685_000743 | 3300047447 | Bacteria | 9986 |
| 467 | Ga0495685_006018 | 3300047447 | Bacteria | 3965 |
| 468 | Ga0495681_0080632 | 3300047470 | Bacteria | 1453 |
| 469 | Ga0495684_0028863 | 3300047471 | Bacteria | 4259 |
| 470 | Ga0495686_0114001 | 3300047472 | Bacteria | 1618 |
| 471 | Ga0495593_0003689 | 3300047673 | Bacteria | 9145 |
| 472 | Ga0495602_0208045 | 3300048088 | Bacteria | 1488 |
| 473 | Ga0495614_0044178 | 3300048089 | Bacteria | 1911 |
| 474 | Ga0496100_0004276 | 3300048903 | Bacteria | 7557 |
| 475 | Ga0496100_0024619 | 3300048903 | Bacteria | 3673 |
| 476 | Ga0496100_0049625 | 3300048903 | Bacteria | 2715 |
| 477 | Ga0496100_0133134 | 3300048903 | Bacteria | 1753 |
| 478 | Ga0496101_0000774 | 3300048904 | Bacteria | 18911 |
| 479 | Ga0496101_0001593 | 3300048904 | Bacteria | 13628 |
| 480 | Ga0496101_0062543 | 3300048904 | Bacteria | 2706 |
| 481 | Ga0496101_0071634 | 3300048904 | Bacteria | 2541 |
| 482 | Ga0496101_0091421 | 3300048904 | Bacteria | 2265 |
| 483 | Ga0496101_0123398 | 3300048904 | Bacteria | 1960 |
| 484 | Ga0496101_0382474 | 3300048904 | Bacteria | 1107 |
| 485 | Ga0496102_0006501 | 3300048905 | Bacteria | 9969 |
| 486 | Ga0496102_0044194 | 3300048905 | Bacteria | 4042 |
| 487 | Ga0496102_0143875 | 3300048905 | Bacteria | 2237 |
| 488 | Ga0496102_0176047 | 3300048905 | Bacteria | 2014 |
| 489 | Ga0496103_0029092 | 3300048906 | Bacteria | 3356 |
| 490 | Ga0496103_0058752 | 3300048906 | Bacteria | 2389 |
| 491 | Ga0496104_0000557 | 3300048907 | Bacteria | 31776 |
| 492 | Ga0496104_0005277 | 3300048907 | Bacteria | 11294 |
| 493 | Ga0496104_0011491 | 3300048907 | Bacteria | 7933 |
| 494 | Ga0496104_0017167 | 3300048907 | Bacteria | 6583 |
| 495 | Ga0496104_0071520 | 3300048907 | Bacteria | 3298 |
| 496 | Ga0496105_0000609 | 3300048908 | Bacteria | 23924 |
| 497 | Ga0496105_0005850 | 3300048908 | Bacteria | 9378 |
| 498 | Ga0496105_0010159 | 3300048908 | Bacteria | 7396 |
| 499 | Ga0496105_0041229 | 3300048908 | Bacteria | 3804 |
| 500 | Ga0496105_0071048 | 3300048908 | Bacteria | 2877 |
| 501 | Ga0496105_0110502 | 3300048908 | Bacteria | 2269 |
| 502 | Ga0496105_0111317 | 3300048908 | Bacteria | 2260 |
| 503 | Ga0496106_0001053 | 3300048909 | Bacteria | 20313 |
| 504 | Ga0496107_0007205 | 3300048910 | Bacteria | 7661 |
| 505 | Ga0496107_0045274 | 3300048910 | Bacteria | 3164 |
| 506 | Ga0496107_0123417 | 3300048910 | Bacteria | 1908 |
| 507 | Ga0496108_0000612 | 3300048911 | Bacteria | 27959 |
| 508 | Ga0496108_0008456 | 3300048911 | Bacteria | 8350 |
| 509 | Ga0496109_0007085 | 3300048912 | Bacteria | 9464 |
| 510 | Ga0496109_0018429 | 3300048912 | Bacteria | 6133 |
| 511 | Ga0496109_0031328 | 3300048912 | Bacteria | 4772 |
| 512 | Ga0496109_0103584 | 3300048912 | Bacteria | 2641 |
| 513 | Ga0496110_0000564 | 3300048913 | Bacteria | 25354 |
| 514 | Ga0496110_0004006 | 3300048913 | Bacteria | 11348 |
| 515 | Ga0496110_0016135 | 3300048913 | Bacteria | 6228 |
| 516 | Ga0496110_0024690 | 3300048913 | Bacteria | 5126 |
| 517 | Ga0496110_0045401 | 3300048913 | Bacteria | 3840 |
| 518 | Ga0496110_0110182 | 3300048913 | Bacteria | 2473 |
| 519 | Ga0496110_0152052 | 3300048913 | Bacteria | 2096 |
| 520 | Ga0496110_0196753 | 3300048913 | Bacteria | 1831 |
| 521 | Ga0496111_0000294 | 3300048914 | Bacteria | 24345 |
| 522 | Ga0496111_0001848 | 3300048914 | Bacteria | 12482 |
| 523 | Ga0496111_0010981 | 3300048914 | Bacteria | 6093 |
| 524 | Ga0496111_0011449 | 3300048914 | Bacteria | 5974 |
| 525 | Ga0496111_0018445 | 3300048914 | Bacteria | 4836 |
| 526 | Ga0496111_0069596 | 3300048914 | Bacteria | 2559 |
| 527 | Ga0496112_0001443 | 3300048915 | Bacteria | 18248 |
| 528 | Ga0496112_0004854 | 3300048915 | Bacteria | 11487 |
| 529 | Ga0496112_0275407 | 3300048915 | Bacteria | 1630 |
| 530 | Ga0496112_0314015 | 3300048915 | Bacteria | 1512 |
| 531 | Ga0496113_0000414 | 3300048916 | Bacteria | 20698 |
| 532 | Ga0496113_0041263 | 3300048916 | Bacteria | 3404 |
| 533 | Ga0496113_0210042 | 3300048916 | Bacteria | 1549 |
| 534 | Ga0496114_0003819 | 3300048917 | Bacteria | 11617 |
| 535 | Ga0496114_0020054 | 3300048917 | Bacteria | 5423 |
| 536 | Ga0496114_0020229 | 3300048917 | Bacteria | 5401 |
| 537 | Ga0496114_0045444 | 3300048917 | Bacteria | 3648 |
| 538 | Ga0496114_0053105 | 3300048917 | Bacteria | 3377 |
| 539 | Ga0496114_0088794 | 3300048917 | Bacteria | 2622 |
| 540 | Ga0496114_0198625 | 3300048917 | Bacteria | 1756 |
| 541 | Ga0496115_0000276 | 3300048918 | Bacteria | 45046 |
| 542 | Ga0496115_0001519 | 3300048918 | Bacteria | 16688 |
| 543 | Ga0496115_0044620 | 3300048918 | Bacteria | 3537 |
| 544 | Ga0496115_0051073 | 3300048918 | Bacteria | 3315 |
| 545 | Ga0496115_0189399 | 3300048918 | Bacteria | 1699 |
| 546 | Ga0501031_0008593 | 3300049568 | Bacteria | 6645 |
| 547 | Ga0501031_0059499 | 3300049568 | Bacteria | 2490 |
| 548 | Ga0501032_0015104 | 3300049569 | Bacteria | 5453 |
| 549 | Ga0501032_0020059 | 3300049569 | Bacteria | 4661 |
| 550 | Ga0501033_0005594 | 3300049570 | Bacteria | 9930 |
| 551 | Ga0501033_0012051 | 3300049570 | Bacteria | 6601 |
| 552 | Ga0501033_0034644 | 3300049570 | Bacteria | 3786 |
| 553 | Ga0501034_0014464 | 3300049571 | Bacteria | 8126 |
| 554 | Ga0501034_0080671 | 3300049571 | Bacteria | 3256 |
| 555 | Ga0501034_0107053 | 3300049571 | Bacteria | 2788 |
| 556 | Ga0501036_0001794 | 3300049572 | Bacteria | 16668 |
| 557 | Ga0501036_0002846 | 3300049572 | Bacteria | 13715 |
| 558 | Ga0501036_0011887 | 3300049572 | Bacteria | 7217 |
| 559 | Ga0501036_0021665 | 3300049572 | Bacteria | 5403 |
| 560 | Ga0501036_0025102 | 3300049572 | Bacteria | 5026 |
| 561 | Ga0501036_0040152 | 3300049572 | Bacteria | 3958 |
| 562 | Ga0501036_0044228 | 3300049572 | Bacteria | 3772 |
| 563 | Ga0501036_0053869 | 3300049572 | Bacteria | 3405 |
| 564 | Ga0501037_0015389 | 3300049573 | Bacteria | 5628 |
| 565 | Ga0501037_0018448 | 3300049573 | Bacteria | 5144 |
| 566 | Ga0501037_0021270 | 3300049573 | Bacteria | 4793 |
| 567 | Ga0501037_0033954 | 3300049573 | Bacteria | 3767 |
| 568 | Ga0501037_0036163 | 3300049573 | Bacteria | 3639 |
| 569 | Ga0501037_0063273 | 3300049573 | Bacteria | 2697 |
| 570 | Ga0501037_0069756 | 3300049573 | Bacteria | 2558 |
| 571 | Ga0501038_0018104 | 3300049574 | Bacteria | 6364 |
| 572 | Ga0501038_0061085 | 3300049574 | Bacteria | 3224 |
| 573 | Ga0501038_0076524 | 3300049574 | Bacteria | 2826 |
| 574 | Ga0501038_0135139 | 3300049574 | Bacteria | 2021 |
| 575 | Ga0501039_0002534 | 3300049575 | Bacteria | 13632 |
| 576 | Ga0501039_0015366 | 3300049575 | Bacteria | 5860 |
| 577 | Ga0501039_0027964 | 3300049575 | Bacteria | 4337 |
| 578 | Ga0501039_0066223 | 3300049575 | Bacteria | 2804 |
| 579 | Ga0501040_0007612 | 3300049576 | Bacteria | 7009 |
| 580 | Ga0501040_0008003 | 3300049576 | Bacteria | 6864 |
| 581 | Ga0501040_0014061 | 3300049576 | Bacteria | 5268 |
| 582 | Ga0501040_0078750 | 3300049576 | Bacteria | 2281 |
| 583 | Ga0501041_0000710 | 3300049577 | Bacteria | 17673 |
| 584 | Ga0501041_0022921 | 3300049577 | Bacteria | 3741 |
| 585 | Ga0501042_0025521 | 3300049578 | Bacteria | 4151 |
| 586 | Ga0501042_0034767 | 3300049578 | Bacteria | 3574 |
| 587 | Ga0501042_0047985 | 3300049578 | Bacteria | 3045 |
| 588 | Ga0501042_0086275 | 3300049578 | Bacteria | 2251 |
| 589 | Ga0501043_0002611 | 3300049579 | Bacteria | 15194 |
| 590 | Ga0501043_0006028 | 3300049579 | Bacteria | 9741 |
| 591 | Ga0501043_0008471 | 3300049579 | Bacteria | 8094 |
| 592 | Ga0501043_0034434 | 3300049579 | Bacteria | 3983 |
| 593 | Ga0501043_0113338 | 3300049579 | Bacteria | 2129 |
| 594 | Ga0501046_0003884 | 3300049580 | Bacteria | 13666 |
| 595 | Ga0501046_0005237 | 3300049580 | Bacteria | 11597 |
| 596 | Ga0501046_0006469 | 3300049580 | Bacteria | 10364 |
| 597 | Ga0501047_0009023 | 3300049581 | Bacteria | 9415 |
| 598 | Ga0501047_0027872 | 3300049581 | Bacteria | 5444 |
| 599 | Ga0501047_0092762 | 3300049581 | Bacteria | 2898 |
| 600 | Ga0501047_0242381 | 3300049581 | Bacteria | 1653 |
| 601 | Ga0501048_0017670 | 3300049582 | Bacteria | 5250 |
| 602 | Ga0501048_0041910 | 3300049582 | Bacteria | 3279 |
| 603 | Ga0501048_0055295 | 3300049582 | Bacteria | 2818 |
| 604 | Ga0501048_0146071 | 3300049582 | Bacteria | 1672 |
| 605 | Ga0501048_0174935 | 3300049582 | Bacteria | 1521 |
| 606 | Ga0501067_0000470 | 3300049583 | Bacteria | 21961 |
| 607 | Ga0501067_0001142 | 3300049583 | Bacteria | 14398 |
| 608 | Ga0501067_0001839 | 3300049583 | Bacteria | 11670 |
| 609 | Ga0501067_0051110 | 3300049583 | Bacteria | 2292 |
| 610 | Ga0501067_0079760 | 3300049583 | Bacteria | 1814 |
| 611 | Ga0501068_0000618 | 3300049584 | Bacteria | 18101 |
| 612 | Ga0501068_0023438 | 3300049584 | Bacteria | 3617 |
| 613 | Ga0501068_0053171 | 3300049584 | Bacteria | 2451 |
| 614 | Ga0501069_0003172 | 3300049585 | Bacteria | 8425 |
| 615 | Ga0501069_0003245 | 3300049585 | Bacteria | 8341 |
| 616 | Ga0501069_0019064 | 3300049585 | Bacteria | 3707 |
| 617 | Ga0501069_0034419 | 3300049585 | Bacteria | 2790 |
| 618 | Ga0501070_0001222 | 3300049586 | Bacteria | 22995 |
| 619 | Ga0501070_0003991 | 3300049586 | Bacteria | 12685 |
| 620 | Ga0501070_0029790 | 3300049586 | Bacteria | 4573 |
| 621 | Ga0501070_0042676 | 3300049586 | Bacteria | 3777 |
| 622 | Ga0501070_0078432 | 3300049586 | Bacteria | 2733 |
| 623 | Ga0501071_0000108 | 3300049587 | Bacteria | 32155 |
| 624 | Ga0501071_0022045 | 3300049587 | Bacteria | 4439 |
| 625 | Ga0501071_0037155 | 3300049587 | Bacteria | 3476 |
| 626 | Ga0501071_0077533 | 3300049587 | Bacteria | 2427 |
| 627 | Ga0501072_0011340 | 3300049588 | Bacteria | 6811 |
| 628 | Ga0501072_0067005 | 3300049588 | Bacteria | 2832 |
| 629 | Ga0501073_0011693 | 3300049589 | Bacteria | 6411 |
| 630 | Ga0501073_0016031 | 3300049589 | Bacteria | 5431 |
| 631 | Ga0501074_0016473 | 3300049590 | Bacteria | 5366 |
| 632 | Ga0501074_0034299 | 3300049590 | Bacteria | 3679 |
| 633 | Ga0501074_0038646 | 3300049590 | Bacteria | 3457 |
| 634 | Ga0501074_0063791 | 3300049590 | Bacteria | 2653 |
| 635 | Ga0501076_0002689 | 3300049592 | Bacteria | 12285 |
| 636 | Ga0501076_0011545 | 3300049592 | Bacteria | 6585 |
| 637 | Ga0501076_0062956 | 3300049592 | Bacteria | 2955 |
| 638 | Ga0501076_0188151 | 3300049592 | Bacteria | 1684 |
| 639 | Ga0501077_0023406 | 3300049593 | Bacteria | 3916 |
| 640 | Ga0501077_0094722 | 3300049593 | Bacteria | 1893 |
| 641 | Ga0501079_0003324 | 3300049741 | Bacteria | 11793 |
| 642 | Ga0501079_0009675 | 3300049741 | Bacteria | 7308 |
| 643 | Ga0501079_0026049 | 3300049741 | Bacteria | 4484 |
| 644 | Ga0501079_0057533 | 3300049741 | Bacteria | 3000 |
| 645 | Ga0501080_0002881 | 3300049742 | Bacteria | 15128 |
| 646 | Ga0501080_0019482 | 3300049742 | Bacteria | 6284 |
| 647 | Ga0501080_0049937 | 3300049742 | Bacteria | 3893 |
| 648 | Ga0501080_0071091 | 3300049742 | Bacteria | 3236 |
| 649 | Ga0501081_0004843 | 3300049743 | Bacteria | 8648 |
| 650 | Ga0501081_0035528 | 3300049743 | Bacteria | 3392 |
| 651 | Ga0501083_0001526 | 3300049744 | Bacteria | 15828 |
| 652 | Ga0501083_0009224 | 3300049744 | Bacteria | 6966 |
| 653 | Ga0501083_0023726 | 3300049744 | Bacteria | 4254 |
| 654 | Ga0501035_0004527 | 3300049822 | Bacteria | 13192 |
| 655 | Ga0501035_0008497 | 3300049822 | Bacteria | 9562 |
| 656 | Ga0501035_0040429 | 3300049822 | Bacteria | 4213 |
| 657 | Ga0501035_0054798 | 3300049822 | Bacteria | 3561 |
| 658 | Ga0501035_0063031 | 3300049822 | Bacteria | 3298 |
| 659 | Ga0501035_0079863 | 3300049822 | Bacteria | 2889 |
| 660 | Ga0501035_0091486 | 3300049822 | Bacteria | 2677 |
| 661 | Ga0501044_0003483 | 3300049823 | Bacteria | 17730 |
| 662 | Ga0501044_0018750 | 3300049823 | Bacteria | 7410 |
| 663 | Ga0501044_0020502 | 3300049823 | Bacteria | 7059 |
| 664 | Ga0501044_0068907 | 3300049823 | Bacteria | 3602 |
| 665 | Ga0501044_0104907 | 3300049823 | Bacteria | 2840 |
| 666 | Ga0501045_0021820 | 3300049824 | Bacteria | 4582 |
| 667 | Ga0501045_0073852 | 3300049824 | Bacteria | 2512 |
| 668 | nmdc:mga06z11_1309_c1 | 3300050494 | Bacteria | 9201 |
| 669 | nmdc:mga04h51_5519_c1 | 3300050495 | Bacteria | 3228 |
| 670 | nmdc:mga07m45_15947_c1 | 3300050496 | Bacteria | 4018 |
| 671 | nmdc:mga05p37_241318_c1 | 3300050507 | Bacteria | 2173 |
| 672 | nmdc:mga05p37_6607_c1 | 3300050507 | Bacteria | 13670 |
| 673 | nmdc:mga05p37_77797_c1 | 3300050507 | Bacteria | 4084 |
| 674 | nmdc:mga09592_13265_c1 | 3300050508 | Bacteria | 6728 |
| 675 | nmdc:mga09592_38915_c1 | 3300050508 | Bacteria | 3993 |
| 676 | nmdc:mga0qj67_218734_c1 | 3300050509 | Bacteria | 1546 |
| 677 | nmdc:mga0qj67_65866_c1 | 3300050509 | Bacteria | 2884 |
| 678 | nmdc:mga06r32_204956_c1 | 3300050510 | Bacteria | 1960 |
| 679 | nmdc:mga06r32_449_c1 | 3300050510 | Bacteria | 34962 |
| 680 | nmdc:mga08y16_11412_c1 | 3300050511 | Bacteria | 9336 |
| 681 | nmdc:mga08y16_158805_c1 | 3300050511 | Bacteria | 2349 |
| 682 | nmdc:mga08y16_175567_c1 | 3300050511 | Bacteria | 2225 |
| 683 | nmdc:mga08y16_82116_c1 | 3300050511 | Bacteria | 3360 |
| 684 | nmdc:mga0n895_113216_c1 | 3300050512 | Bacteria | 2730 |
| 685 | nmdc:mga0n895_130156_c1 | 3300050512 | Bacteria | 2541 |
| 686 | nmdc:mga0n895_14788_c1 | 3300050512 | Bacteria | 7100 |
| 687 | nmdc:mga0n895_8895_c1 | 3300050512 | Bacteria | 8748 |
| 688 | nmdc:mga0rr50_100880_c1 | 3300050513 | Bacteria | 2268 |
| 689 | nmdc:mga0rr50_248995_c1 | 3300050513 | Bacteria | 1475 |
| 690 | nmdc:mga08x19_77649_c1 | 3300050514 | Bacteria | 2175 |
| 691 | nmdc:mga0a205_122548_c1 | 3300050515 | Bacteria | 2499 |
| 692 | nmdc:mga0a205_21186_c1 | 3300050515 | Bacteria | 6148 |
| 693 | nmdc:mga0a205_229295_c1 | 3300050515 | Bacteria | 1741 |
| 694 | Ga0495601_0015071 | 3300053077 | Bacteria | 4668 |
| 695 | Ga0495601_0030136 | 3300053077 | Bacteria | 3368 |
| 696 | Ga0495655_0028212 | 3300053083 | Bacteria | 1339 |
| 697 | Ga0495595_0015476 | 3300053084 | Bacteria | 3254 |
| 698 | Ga0495619_0009482 | 3300053085 | Bacteria | 6139 |
| 699 | Ga0495619_0040721 | 3300053085 | Bacteria | 3037 |
| 700 | Ga0500578_0151244 | 3300053086 | Bacteria | 1445 |
| 701 | Ga0500651_0122844 | 3300053093 | Bacteria | 1575 |
| 702 | Ga0500566_0075409 | 3300053094 | Bacteria | 1887 |
| 703 | Ga0500560_004643 | 3300053107 | Bacteria | 2946 |
| 704 | Ga0500569_000894 | 3300053109 | Bacteria | 5327 |
| 705 | Ga0500652_053372 | 3300053131 | Bacteria | 1653 |
| 706 | Ga0500658_0056498 | 3300053134 | Bacteria | 1619 |
| 707 | Ga0500561_0000412 | 3300053137 | Bacteria | 7030 |
| 708 | Ga0500600_0054940 | 3300053149 | Bacteria | 2243 |
| 709 | Ga0500616_0083431 | 3300053153 | Bacteria | 1600 |
| 710 | Ga0500633_0037512 | 3300053160 | Bacteria | 1609 |
| 711 | Ga0500634_0046736 | 3300053161 | Bacteria | 2337 |
| 712 | Ga0501084_0089455 | 3300054114 | Bacteria | 2584 |
| 713 | Ga0501084_0145799 | 3300054114 | Bacteria | 1994 |
| 714 | Ga0501084_0248232 | 3300054114 | Bacteria | 1503 |
| 715 | Ga0590075_004461 | 3300059424 | Bacteria | 3315 |
| 716 | Ga0590077_004917 | 3300059426 | Bacteria | 2732 |
| 717 | Ga0501082_0026469 | 3300060353 | Bacteria | 4999 |
| 718 | Ga0501082_0182637 | 3300060353 | Bacteria | 1824 |
| 719 | Ga0530510_0002662 | 3300061734 | Bacteria | 12275 |
| 720 | Ga0530510_0013262 | 3300061734 | Bacteria | 5794 |
| 721 | Ga0530510_0029929 | 3300061734 | Bacteria | 3909 |
| 722 | 2585305134 | 2582581313 | Bacteria | 10042643 |
| 723 | 2644266179 | 2643221647 | Bacteria | 10741251 |
| 724 | 2644437598 | 2643221678 | Bacteria | 9540101 |
| 725 | 2768642026 | 2767802112 | Bacteria | 6465194 |
| 726 | 2785342165 | 2784746763 | Bacteria | 9783172 |
| 727 | 2786671648 | 2786546132 | Bacteria | 10419719 |
| 728 | 2804845837 | 2802429296 | Bacteria | 7227771 |
| 729 | 2808843053 | 2808606359 | Bacteria | 9866990 |
| 730 | 2809233076 | 2808606448 | Bacteria | 8656184 |
| 731 | 2812357070 | 2811994879 | Bacteria | 9313447 |
| 732 | 2812479731 | 2811994917 | Bacteria | 7761064 |
| 733 | 2852640067 | 2852635781 | Bacteria | 8251373 |
| 734 | 2862179501 | 2862178590 | Bacteria | 8583590 |
| 735 | 2862390068 | 2862382967 | Bacteria | 10317375 |
| 736 | 2862578432 | 2862574272 | Bacteria | 10567477 |
| 737 | 2862709550 | 2862705112 | Bacteria | 6563286 |
| 738 | 2863411847 | 2863404153 | Bacteria | 9672205 |
| 739 | 2867372997 | 2867369537 | Bacteria | 6501581 |
| 740 | 2867435712 | 2867428634 | Bacteria | 9590268 |
| 741 | 2877680128 | 2877676314 | Bacteria | 9512378 |
| 742 | 2912731044 | 2912723979 | Bacteria | 8557534 |
| 743 | 2919471469 | 2919468124 | Bacteria | 9133025 |
| 744 | 2946068808 | 2946064051 | Bacteria | 8957905 |
| 745 | 2947228102 | 2947224130 | Bacteria | 9938529 |
| 746 | 2954385061 | 2954380949 | Bacteria | 10050426 |
| 747 | 2954677934 | 2954673503 | Bacteria | 9685905 |
| 748 | 2954686223 | 2954682443 | Bacteria | 9862841 |
| 749 | 2954695879 | 2954691527 | Bacteria | 10720516 |
| 750 | 2954711070 | 2954701450 | Bacteria | 10834262 |
| 751 | 2954715284 | 2954711539 | Bacteria | 10867210 |
| 752 | 2954725225 | 2954721474 | Bacteria | 10456478 |
| 753 | 2954736591 | 2954731030 | Bacteria | 10243860 |
| 754 | 2954744158 | 2954740390 | Bacteria | 10229294 |
| 755 | 2954755440 | 2954749733 | Bacteria | 10366972 |
| 756 | 2954763101 | 2954759201 | Bacteria | 9358192 |
| 757 | 2990045606 | 2990044586 | Bacteria | 6603797 |
| 758 | 2990063970 | 2990059506 | Bacteria | 9321252 |
| 759 | 2990091290 | 2990088156 | Bacteria | 6657676 |
| 760 | 3006324976 | 3006321560 | Bacteria | 8247479 |
| 761 | 3006397276 | 3006393351 | Bacteria | 6615579 |
| 762 | 3006492226 | 3006486233 | Bacteria | 8157040 |
| 763 | 3006498234 | 3006493962 | Bacteria | 8825450 |
| 764 | 8008485898 | 8008485437 | Bacteria | 7198341 |
| 765 | 8008566241 | 8008558824 | Bacteria | 10610750 |
| 766 | 8008578056 | 8008574985 | Bacteria | 7815457 |
| 767 | 8025418512 | 8025413630 | Bacteria | 7014048 |
| 768 | 8025524982 | 8025524527 | Bacteria | 7197316 |
| 769 | 8033690080 | 8033684223 | Bacteria | 6906479 |
| 770 | 8048409562 | 8048406513 | Bacteria | 8936924 |
| 771 | 8056454033 | 8056447290 | Bacteria | 7680491 |
| 772 | 8056833237 | 8056829672 | Bacteria | 9045328 |
| 773 | Ga0111539_10106412 | |||
| 774 | ARcpr5oldR_c001385 | |||
| 775 | ARcpr5yngRDRAFT_c001296 | |||
| 776 | ARSoilOldRDRAFT_c001312 | |||
| 777 | Ga0006562J51391_1035120 | |||
| 778 | Ga0006562J51391_1035122 | |||
| 779 | Ga0070658_10015063 | |||
| 780 | Ga0070658_10016206 | |||
| 781 | Ga0070683_100008132 | |||
| 782 | Ga0070683_100020240 | |||
| 783 | Ga0070683_100075139 | |||
| 784 | Ga0068869_100105477 | |||
| 785 | Ga0070680_100010144 | |||
| 786 | Ga0070680_100096901 | |||
| 787 | Ga0070682_100094833 | |||
| 788 | Ga0070682_100113219 | |||
| 789 | Ga0068868_100084428 | |||
| 790 | Ga0068868_100233437 | |||
| 791 | Ga0068868_100251514 | |||
| 792 | Ga0070660_100039145 | |||
| 793 | Ga0070660_100094178 | |||
| 794 | Ga0070689_100036534 | |||
| 795 | Ga0070691_10002704 | |||
| 796 | Ga0070691_10040359 | |||
| 797 | Ga0070687_100101825 | |||
| 798 | Ga0070661_100020187 | |||
| 799 | Ga0070668_100012259 | |||
| 800 | Ga0070671_100037278 | |||
| 801 | Ga0070671_100067798 | |||
| 802 | Ga0070671_100176526 | |||
| 803 | Ga0070659_100014825 | |||
| 804 | Ga0070659_100047003 | |||
| 805 | Ga0070659_100091451 | |||
| 806 | Ga0070703_10007546 | |||
| 807 | Ga0070714_100016643 | |||
| 808 | Ga0070713_100002608 | |||
| 809 | Ga0070710_10032165 | |||
| 810 | Ga0070705_100024733 | |||
| 811 | Ga0070700_100043859 | |||
| 812 | Ga0070708_100019534 | |||
| 813 | Ga0070678_100029847 | |||
| 814 | Ga0070662_100002641 | |||
| 815 | Ga0070662_100092736 | |||
| 816 | Ga0070681_10003419 | |||
| 817 | Ga0070681_10012572 | |||
| 818 | Ga0070681_10027200 | |||
| 819 | Ga0070681_10168940 | |||
| 820 | Ga0068867_100009644 | |||
| 821 | Ga0070706_100101363 | |||
| 822 | Ga0070707_100033547 | |||
| 823 | Ga0070698_100008838 | |||
| 824 | Ga0070698_100053383 | |||
| 825 | Ga0070699_100052819 | |||
| 826 | Ga0070699_100079565 | |||
| 827 | Ga0070679_100009974 | |||
| 828 | Ga0070679_100011004 | |||
| 829 | Ga0070679_100024397 | |||
| 830 | Ga0070679_100029047 | |||
| 831 | Ga0070679_100029602 | |||
| 832 | Ga0070679_100072153 | |||
| 833 | Ga0070679_100075147 | |||
| 834 | Ga0070679_100153389 | |||
| 835 | Ga0070684_100008653 | |||
| 836 | Ga0070684_100036248 | |||
| 837 | Ga0070684_100122358 | |||
| 838 | Ga0068853_100047525 | |||
| 839 | Ga0068853_100115000 | |||
| 840 | Ga0070672_100077560 | |||
| 841 | Ga0070686_100054188 | |||
| 842 | Ga0070695_100020417 | |||
| 843 | Ga0070695_100052827 | |||
| 844 | Ga0070696_100063122 | |||
| 845 | Ga0070696_100102415 | |||
| 846 | Ga0070693_100128546 | |||
| 847 | Ga0068855_100024569 | |||
| 848 | Ga0068855_100073422 | |||
| 849 | Ga0068855_100088467 | |||
| 850 | Ga0068857_100090175 | |||
| 851 | Ga0068854_100113673 | |||
| 852 | Ga0068854_100162589 | |||
| 853 | Ga0068856_100069237 | |||
| 854 | Ga0068856_100254667 | |||
| 855 | Ga0070702_100018760 | |||
| 856 | Ga0070702_100036937 | |||
| 857 | Ga0070702_100040627 | |||
| 858 | Ga0068852_100079647 | |||
| 859 | Ga0068864_100113330 | |||
| 860 | Ga0068861_100001783 | |||
| 861 | Ga0068870_10051347 | |||
| 862 | Ga0081455_10019559 | |||
| 863 | Ga0081540_1014346 | |||
| 864 | Ga0081539_10000200 | |||
| 865 | Ga0081539_10000867 | |||
| 866 | Ga0075368_10048035 | |||
| 867 | Ga0075432_10003491 | |||
| 868 | Ga0070715_10008364 | |||
| 869 | Ga0070716_100009248 | |||
| 870 | Ga0070716_100037807 | |||
| 871 | Ga0070716_100046618 | |||
| 872 | Ga0070712_100001482 | |||
| 873 | Ga0075367_10001380 | |||
| 874 | Ga0075367_10128397 | |||
| 875 | Ga0097621_100149288 | |||
| 876 | Ga0075370_10008702 | |||
| 877 | Ga0075428_100021918 | |||
| 878 | Ga0075428_100037530 | |||
| 879 | Ga0075428_100095575 | |||
| 880 | Ga0075430_100073420 | |||
| 881 | Ga0075430_100077560 | |||
| 882 | Ga0075430_100169274 | |||
| 883 | Ga0075431_100001660 | |||
| 884 | Ga0075433_10043840 | |||
| 885 | Ga0075433_10047878 | |||
| 886 | Ga0075433_10164838 | |||
| 887 | Ga0075433_10186095 | |||
| 888 | Ga0075434_100029826 | |||
| 889 | Ga0075434_100244620 | |||
| 890 | Ga0075429_100223356 | |||
| 891 | Ga0068865_100011940 | |||
| 892 | Ga0075436_100186824 | |||
| 893 | Ga0075435_100025556 | |||
| 894 | Ga0105244_10080448 | |||
| 895 | Ga0105240_10076875 | |||
| 896 | Ga0105240_10129459 | |||
| 897 | Ga0111539_10008714 | |||
| 898 | Ga0111539_10035748 | |||
| 899 | Ga0111539_10180389 | |||
| 900 | Ga0105245_10071821 | |||
| 901 | Ga0105245_10227388 | |||
| 902 | Ga0114129_10008166 | |||
| 903 | Ga0114129_10018159 | |||
| 904 | Ga0105243_10011008 | |||
| 905 | Ga0105243_10112217 | |||
| 906 | Ga0105243_10365336 | |||
| 907 | Ga0105248_10088431 | |||
| 908 | Ga0105248_10135629 | |||
| 909 | Ga0105237_10129677 | |||
| 910 | Ga0105238_10072267 | |||
| 911 | Ga0105238_10191878 | |||
| 912 | Ga0105238_10337403 | |||
| 913 | Ga0105249_10001703 | |||
| 914 | Ga0105239_10072822 | |||
| 915 | Ga0157373_10060213 | |||
| 916 | Ga0157373_10097746 | |||
| 917 | Ga0157371_10134136 | |||
| 918 | Ga0157370_10037029 | |||
| 919 | Ga0157369_10020280 | |||
| 920 | Ga0157369_10030859 | |||
| 921 | Ga0157374_10147360 | |||
| 922 | Ga0157378_10185890 | |||
| 923 | Ga0163162_10038088 | |||
| 924 | Ga0163162_10090462 | |||
| 925 | Ga0163162_10263829 | |||
| 926 | Ga0157372_10021088 | |||
| 927 | Ga0157380_10006119 | |||
| 928 | Ga0157380_10028368 | |||
| 929 | Ga0157380_10142338 | |||
| 930 | Ga0157376_10011084 | |||
| 931 | Ga0163161_10043707 | |||
| 932 | Ga0213875_10017925 | |||
| 933 | Ga0207426_1003642 | |||
| 934 | Ga0207426_1009984 | |||
| 935 | Ga0207653_10014440 | |||
| 936 | Ga0207692_10094910 | |||
| 937 | Ga0207688_10008324 | |||
| 938 | Ga0207647_10041315 | |||
| 939 | Ga0207645_10051435 | |||
| 940 | Ga0207643_10037285 | |||
| 941 | Ga0207705_10005496 | |||
| 942 | Ga0207705_10012310 | |||
| 943 | Ga0207705_10012655 | |||
| 944 | Ga0207705_10118873 | |||
| 945 | Ga0207684_10017162 | |||
| 946 | Ga0207707_10007563 | |||
| 947 | Ga0207707_10014298 | |||
| 948 | Ga0207707_10019074 | |||
| 949 | Ga0207707_10024976 | |||
| 950 | Ga0207707_10051905 | |||
| 951 | Ga0207707_10200886 | |||
| 952 | Ga0207695_10179577 | |||
| 953 | Ga0207671_10213070 | |||
| 954 | Ga0207693_10001016 | |||
| 955 | Ga0207693_10003173 | |||
| 956 | Ga0207693_10003612 | |||
| 957 | Ga0207663_10135480 | |||
| 958 | Ga0207660_10017699 | |||
| 959 | Ga0207660_10018755 | |||
| 960 | Ga0207660_10120870 | |||
| 961 | Ga0207657_10005284 | |||
| 962 | Ga0207657_10007571 | |||
| 963 | Ga0207657_10016238 | |||
| 964 | Ga0207657_10046528 | |||
| 965 | Ga0207657_10062709 | |||
| 966 | Ga0207657_10211805 | |||
| 967 | Ga0207649_10074133 | |||
| 968 | Ga0207649_10199578 | |||
| 969 | Ga0207652_10018126 | |||
| 970 | Ga0207652_10032369 | |||
| 971 | Ga0207652_10076750 | |||
| 972 | Ga0207646_10001072 | |||
| 973 | Ga0207646_10027364 | |||
| 974 | Ga0207659_10126301 | |||
| 975 | Ga0207687_10073140 | |||
| 976 | Ga0207687_10135866 | |||
| 977 | Ga0207700_10000001 | |||
| 978 | Ga0207700_10080444 | |||
| 979 | Ga0207644_10110037 | |||
| 980 | Ga0207690_10011819 | |||
| 981 | Ga0207690_10051892 | |||
| 982 | Ga0207690_10086031 | |||
| 983 | Ga0207706_10014850 | |||
| 984 | Ga0207709_10040500 | |||
| 985 | Ga0207665_10008523 | |||
| 986 | Ga0207691_10019105 | |||
| 987 | Ga0207711_10175355 | |||
| 988 | Ga0207711_10219911 | |||
| 989 | Ga0207711_10232798 | |||
| 990 | Ga0207661_10008048 | |||
| 991 | Ga0207667_10054593 | |||
| 992 | Ga0207667_10107278 | |||
| 993 | Ga0207667_10117968 | |||
| 994 | Ga0207667_10203569 | |||
| 995 | Ga0207651_10040296 | |||
| 996 | Ga0207712_10007048 | |||
| 997 | Ga0207712_10038933 | |||
| 998 | Ga0207668_10027466 | |||
| 999 | Ga0207640_10057756 | |||
| 1000 | Ga0207640_10090370 | |||
| 1001 | Ga0207639_10026202 | |||
| 1002 | Ga0207708_10016026 | |||
| 1003 | Ga0207708_10047470 | |||
| 1004 | Ga0207702_10037641 | |||
| 1005 | Ga0207648_10020479 | |||
| 1006 | Ga0207648_10024817 | |||
| 1007 | Ga0207676_10118178 | |||
| 1008 | Ga0207675_100044599 | |||
| 1009 | Ga0207675_100050780 | |||
| 1010 | Ga0207683_10051131 | |||
| 1011 | Ga0207683_10137781 | |||
| 1012 | Ga0207698_10180544 | |||
| 1013 | Ga0209813_10013231 | |||
| 1014 | Ga0207428_10000244 | |||
| 1015 | Ga0207428_10027943 | |||
| 1016 | Ga0207428_10104805 | |||
| 1017 | Ga0268266_10046859 | |||
| 1018 | Ga0307517_10008770 | |||
| 1019 | Ga0307515_10073513 | |||
| 1020 | Ga0307513_10074778 | |||
| 1021 | Ga0307408_100030330 | |||
| 1022 | Ga0307508_10011891 | |||
| 1023 | Ga0307514_10021200 | |||
| 1024 | Ga0307516_10137883 | |||
| 1025 | Ga0307405_10074579 | |||
| 1026 | Ga0316577_10063287 | |||
| 1027 | Ga0307413_10005959 | |||
| 1028 | Ga0307518_10030990 | |||
| 1029 | Ga0307410_10013107 | |||
| 1030 | Ga0307412_10014671 | |||
| 1031 | Ga0307416_100032245 | |||
| 1032 | Ga0307411_10007234 | |||
| 1033 | Ga0307507_10145581 | |||
| 1034 | Ga0373928_0003310 | |||
| 1035 | Ga0373940_0002686 | |||
| 1036 | Ga0373949_0020994 | |||
| 1037 | Ga0373951_0011866 | |||
| 1038 | Ga0373952_0002257 | |||
| 1039 | Ga0373932_0007715 | |||
| 1040 | Ga0373939_0002179 | |||
| 1041 | Ga0373939_0016692 | |||
| 1042 | Ga0373941_0022527 | |||
| 1043 | Ga0373945_0045937 | |||
| 1044 | Ga0373943_0000299 | |||
| 1045 | Ga0373946_0001582 | |||
| 1046 | Ga0373955_0033805 | |||
| 1047 | Ga0373942_0005086 | |||
| 1048 | Ga0373961_0008730 | |||
| 1049 | Ga0373931_0006511 | |||
| 1050 | Ga0373935_0012369 | |||
| 1051 | Ga0373947_0000185 | |||
| 1052 | Ga0373947_0007323 | |||
| 1053 | Ga0373925_0006691 | |||
| 1054 | Ga0373925_0075134 | |||
| 1055 | Ga0373925_0159247 | |||
| 1056 | Ga0395899_0006920 | |||
| 1057 | Ga0395899_0007215 | |||
| 1058 | Ga0395899_0011411 | |||
| 1059 | Ga0395899_0013616 | |||
| 1060 | Ga0395900_0000528 | |||
| 1061 | Ga0395900_0002771 | |||
| 1062 | Ga0395900_0025290 | |||
| 1063 | Ga0395900_0025854 | |||
| 1064 | Ga0395900_0040788 | |||
| 1065 | Ga0395900_0054193 | |||
| 1066 | Ga0395900_0055681 | |||
| 1067 | Ga0395900_0057266 | |||
| 1068 | Ga0395900_0068954 | |||
| 1069 | Ga0395900_0076411 | |||
| 1070 | Ga0395900_0092986 | |||
| 1071 | Ga0395900_0098804 | |||
| 1072 | Ga0395900_0102055 | |||
| 1073 | Ga0395900_0154139 | |||
| 1074 | Ga0395898_0001875 | |||
| 1075 | Ga0395898_0002139 | |||
| 1076 | Ga0395898_0003526 | |||
| 1077 | Ga0395898_0003680 | |||
| 1078 | Ga0395898_0012709 | |||
| 1079 | Ga0395898_0016068 | |||
| 1080 | Ga0395898_0021434 | |||
| 1081 | Ga0395898_0021753 | |||
| 1082 | Ga0395898_0067339 | |||
| 1083 | Ga0395898_0091834 | |||
| 1084 | Ga0395898_0311983 | |||
| 1085 | Ga0395905_0000661 | |||
| 1086 | Ga0395905_0005716 | |||
| 1087 | Ga0395905_0006912 | |||
| 1088 | Ga0395905_0009554 | |||
| 1089 | Ga0395905_0021602 | |||
| 1090 | Ga0395905_0031768 | |||
| 1091 | Ga0395905_0042861 | |||
| 1092 | Ga0395905_0053172 | |||
| 1093 | Ga0395905_0073662 | |||
| 1094 | Ga0436364_1424714 | |||
| 1095 | Ga0395901_0001057 | |||
| 1096 | Ga0395901_0001983 | |||
| 1097 | Ga0395901_0005247 | |||
| 1098 | Ga0395901_0010426 | |||
| 1099 | Ga0395901_0012794 | |||
| 1100 | Ga0395901_0019001 | |||
| 1101 | Ga0395901_0021701 | |||
| 1102 | Ga0395901_0027883 | |||
| 1103 | Ga0395901_0046191 | |||
| 1104 | Ga0395901_0049126 | |||
| 1105 | Ga0395901_0091435 | |||
| 1106 | Ga0395901_0157721 | |||
| 1107 | Ga0395901_0176364 | |||
| 1108 | Ga0395901_0212120 | |||
| 1109 | Ga0395901_0236488 | |||
| 1110 | Ga0395901_0313033 | |||
| 1111 | Ga0242420_000637 | |||
| 1112 | Ga0436365_0868245 | |||
| 1113 | Ga0436365_1320454 | |||
| 1114 | Ga0439436_0000548 | |||
| 1115 | Ga0439436_0002790 | |||
| 1116 | Ga0439439_0005529 | |||
| 1117 | Ga0451837_1533153 | |||
| 1118 | Ga0451839_0165057 | |||
| 1119 | Ga0451847_0111370 | |||
| 1120 | Ga0451849_0650206 | |||
| 1121 | Ga0451855_1406534 | |||
| 1122 | Ga0451853_0938959 | |||
| 1123 | Ga0439433_0000982 | |||
| 1124 | Ga0439457_000625 | |||
| 1125 | Ga0439458_0000467 | |||
| 1126 | Ga0466969_0048588 | |||
| 1127 | Ga0466965_0093234 | |||
| 1128 | Ga0466966_0025154 | |||
| 1129 | Ga0466966_0049536 | |||
| 1130 | Ga0466966_0054794 | |||
| 1131 | Ga0466961_0005145 | |||
| 1132 | Ga0466963_0000425 | |||
| 1133 | Ga0466963_0022160 | |||
| 1134 | Ga0466963_0050178 | |||
| 1135 | Ga0466963_0086844 | |||
| 1136 | Ga0466964_0005916 | |||
| 1137 | Ga0466968_0011262 | |||
| 1138 | Ga0466968_0047178 | |||
| 1139 | Ga0466957_0007534 | |||
| 1140 | Ga0466957_0103032 | |||
| 1141 | Ga0466960_0048131 | |||
| 1142 | Ga0466960_0080296 | |||
| 1143 | Ga0466959_0024988 | |||
| 1144 | Ga0466959_0038560 | |||
| 1145 | Ga0466959_0061002 | |||
| 1146 | Ga0466959_0072170 | |||
| 1147 | Ga0466959_0110908 | |||
| 1148 | Ga0451576_0237297 | |||
| 1149 | Ga0466958_0028850 | |||
| 1150 | Ga0466967_0000455 | |||
| 1151 | Ga0466967_0003231 | |||
| 1152 | Ga0466967_0013456 | |||
| 1153 | Ga0466967_0017725 | |||
| 1154 | Ga0466967_0033564 | |||
| 1155 | Ga0466967_0049751 | |||
| 1156 | Ga0466967_0061889 | |||
| 1157 | Ga0495603_0001553 | |||
| 1158 | Ga0495603_0014904 | |||
| 1159 | Ga0495603_0085874 | |||
| 1160 | Ga0495629_0000403 | |||
| 1161 | Ga0495629_0007357 | |||
| 1162 | Ga0495629_0052950 | |||
| 1163 | Ga0495629_0053381 | |||
| 1164 | Ga0495629_0101502 | |||
| 1165 | Ga0495638_0062170 | |||
| 1166 | Ga0495641_0004211 | |||
| 1167 | Ga0495641_0013330 | |||
| 1168 | Ga0495651_0009341 | |||
| 1169 | Ga0495651_0011990 | |||
| 1170 | Ga0495653_0030572 | |||
| 1171 | Ga0495653_0050259 | |||
| 1172 | Ga0495582_0000426 | |||
| 1173 | Ga0495582_0039439 | |||
| 1174 | Ga0495662_0005709 | |||
| 1175 | Ga0495662_0044813 | |||
| 1176 | Ga0495594_0002137 | |||
| 1177 | Ga0495594_0014754 | |||
| 1178 | Ga0495594_0056310 | |||
| 1179 | Ga0495596_0048098 | |||
| 1180 | Ga0495608_0148850 | |||
| 1181 | Ga0495628_0052266 | |||
| 1182 | Ga0495628_0198499 | |||
| 1183 | Ga0495630_0038934 | |||
| 1184 | Ga0495630_0172351 | |||
| 1185 | Ga0495632_0014041 | |||
| 1186 | Ga0495637_0042431 | |||
| 1187 | Ga0495643_0001898 | |||
| 1188 | Ga0495652_0073651 | |||
| 1189 | Ga0495665_0000274 | |||
| 1190 | Ga0495640_0006459 | |||
| 1191 | Ga0495640_0032842 | |||
| 1192 | Ga0495586_0002031 | |||
| 1193 | Ga0495645_0104086 | |||
| 1194 | Ga0495645_0135190 | |||
| 1195 | Ga0495622_0038849 | |||
| 1196 | Ga0495633_0116850 | |||
| 1197 | Ga0495667_0064059 | |||
| 1198 | Ga0495667_0066496 | |||
| 1199 | Ga0495667_0114365 | |||
| 1200 | Ga0495667_0115104 | |||
| 1201 | Ga0495634_0028980 | |||
| 1202 | Ga0495611_0037453 | |||
| 1203 | Ga0495625_0050005 | |||
| 1204 | Ga0495635_0006072 | |||
| 1205 | Ga0495635_0012510 | |||
| 1206 | Ga0495661_0099459 | |||
| 1207 | Ga0495588_0051583 | |||
| 1208 | Ga0495657_0020037 | |||
| 1209 | Ga0495657_0031766 | |||
| 1210 | Ga0495657_0119065 | |||
| 1211 | Ga0495599_0036996 | |||
| 1212 | Ga0495599_0051626 | |||
| 1213 | Ga0495646_0021309 | |||
| 1214 | Ga0495613_0046329 | |||
| 1215 | Ga0495613_0211362 | |||
| 1216 | Ga0495624_0007344 | |||
| 1217 | Ga0495671_0136661 | |||
| 1218 | Ga0495589_0003307 | |||
| 1219 | Ga0495589_0015884 | |||
| 1220 | Ga0495589_0032481 | |||
| 1221 | Ga0495589_0071779 | |||
| 1222 | Ga0495581_0000117 | |||
| 1223 | Ga0495604_0016838 | |||
| 1224 | Ga0495604_0060821 | |||
| 1225 | Ga0495604_0075752 | |||
| 1226 | Ga0495636_0013268 | |||
| 1227 | Ga0495636_0064958 | |||
| 1228 | Ga0495674_0007348 | |||
| 1229 | Ga0495674_0028349 | |||
| 1230 | Ga0495676_0000268 | |||
| 1231 | Ga0495676_0022291 | |||
| 1232 | Ga0495676_0034836 | |||
| 1233 | Ga0495680_0081152 | |||
| 1234 | Ga0495680_0251573 | |||
| 1235 | Ga0495675_0017674 | |||
| 1236 | Ga0495677_0044117 | |||
| 1237 | Ga0495679_005854 | |||
| 1238 | Ga0495685_000743 | |||
| 1239 | Ga0495685_006018 | |||
| 1240 | Ga0495681_0080632 | |||
| 1241 | Ga0495684_0028863 | |||
| 1242 | Ga0495686_0114001 | |||
| 1243 | Ga0495593_0003689 | |||
| 1244 | Ga0495602_0208045 | |||
| 1245 | Ga0495614_0044178 | |||
| 1246 | Ga0496100_0004276 | |||
| 1247 | Ga0496100_0024619 | |||
| 1248 | Ga0496100_0049625 | |||
| 1249 | Ga0496100_0133134 | |||
| 1250 | Ga0496101_0000774 | |||
| 1251 | Ga0496101_0001593 | |||
| 1252 | Ga0496101_0062543 | |||
| 1253 | Ga0496101_0071634 | |||
| 1254 | Ga0496101_0091421 | |||
| 1255 | Ga0496101_0123398 | |||
| 1256 | Ga0496101_0382474 | |||
| 1257 | Ga0496102_0006501 | |||
| 1258 | Ga0496102_0044194 | |||
| 1259 | Ga0496102_0143875 | |||
| 1260 | Ga0496102_0176047 | |||
| 1261 | Ga0496103_0029092 | |||
| 1262 | Ga0496103_0058752 | |||
| 1263 | Ga0496104_0000557 | |||
| 1264 | Ga0496104_0005277 | |||
| 1265 | Ga0496104_0011491 | |||
| 1266 | Ga0496104_0017167 | |||
| 1267 | Ga0496104_0071520 | |||
| 1268 | Ga0496105_0000609 | |||
| 1269 | Ga0496105_0005850 | |||
| 1270 | Ga0496105_0010159 | |||
| 1271 | Ga0496105_0041229 | |||
| 1272 | Ga0496105_0071048 | |||
| 1273 | Ga0496105_0110502 | |||
| 1274 | Ga0496105_0111317 | |||
| 1275 | Ga0496106_0001053 | |||
| 1276 | Ga0496107_0007205 | |||
| 1277 | Ga0496107_0045274 | |||
| 1278 | Ga0496107_0123417 | |||
| 1279 | Ga0496108_0000612 | |||
| 1280 | Ga0496108_0008456 | |||
| 1281 | Ga0496109_0007085 | |||
| 1282 | Ga0496109_0018429 | |||
| 1283 | Ga0496109_0031328 | |||
| 1284 | Ga0496109_0103584 | |||
| 1285 | Ga0496110_0000564 | |||
| 1286 | Ga0496110_0004006 | |||
| 1287 | Ga0496110_0016135 | |||
| 1288 | Ga0496110_0024690 | |||
| 1289 | Ga0496110_0045401 | |||
| 1290 | Ga0496110_0110182 | |||
| 1291 | Ga0496110_0152052 | |||
| 1292 | Ga0496110_0196753 | |||
| 1293 | Ga0496111_0000294 | |||
| 1294 | Ga0496111_0001848 | |||
| 1295 | Ga0496111_0010981 | |||
| 1296 | Ga0496111_0011449 | |||
| 1297 | Ga0496111_0018445 | |||
| 1298 | Ga0496111_0069596 | |||
| 1299 | Ga0496112_0001443 | |||
| 1300 | Ga0496112_0004854 | |||
| 1301 | Ga0496112_0275407 | |||
| 1302 | Ga0496112_0314015 | |||
| 1303 | Ga0496113_0000414 | |||
| 1304 | Ga0496113_0041263 | |||
| 1305 | Ga0496113_0210042 | |||
| 1306 | Ga0496114_0003819 | |||
| 1307 | Ga0496114_0020054 | |||
| 1308 | Ga0496114_0020229 | |||
| 1309 | Ga0496114_0045444 | |||
| 1310 | Ga0496114_0053105 | |||
| 1311 | Ga0496114_0088794 | |||
| 1312 | Ga0496114_0198625 | |||
| 1313 | Ga0496115_0000276 | |||
| 1314 | Ga0496115_0001519 | |||
| 1315 | Ga0496115_0044620 | |||
| 1316 | Ga0496115_0051073 | |||
| 1317 | Ga0496115_0189399 | |||
| 1318 | Ga0501031_0008593 | |||
| 1319 | Ga0501031_0059499 | |||
| 1320 | Ga0501032_0015104 | |||
| 1321 | Ga0501032_0020059 | |||
| 1322 | Ga0501033_0005594 | |||
| 1323 | Ga0501033_0012051 | |||
| 1324 | Ga0501033_0034644 | |||
| 1325 | Ga0501034_0014464 | |||
| 1326 | Ga0501034_0080671 | |||
| 1327 | Ga0501034_0107053 | |||
| 1328 | Ga0501036_0001794 | |||
| 1329 | Ga0501036_0002846 | |||
| 1330 | Ga0501036_0011887 | |||
| 1331 | Ga0501036_0021665 | |||
| 1332 | Ga0501036_0025102 | |||
| 1333 | Ga0501036_0040152 | |||
| 1334 | Ga0501036_0044228 | |||
| 1335 | Ga0501036_0053869 | |||
| 1336 | Ga0501037_0015389 | |||
| 1337 | Ga0501037_0018448 | |||
| 1338 | Ga0501037_0021270 | |||
| 1339 | Ga0501037_0033954 | |||
| 1340 | Ga0501037_0036163 | |||
| 1341 | Ga0501037_0063273 | |||
| 1342 | Ga0501037_0069756 | |||
| 1343 | Ga0501038_0018104 | |||
| 1344 | Ga0501038_0061085 | |||
| 1345 | Ga0501038_0076524 | |||
| 1346 | Ga0501038_0135139 | |||
| 1347 | Ga0501039_0002534 | |||
| 1348 | Ga0501039_0015366 | |||
| 1349 | Ga0501039_0027964 | |||
| 1350 | Ga0501039_0066223 | |||
| 1351 | Ga0501040_0007612 | |||
| 1352 | Ga0501040_0008003 | |||
| 1353 | Ga0501040_0014061 | |||
| 1354 | Ga0501040_0078750 | |||
| 1355 | Ga0501041_0000710 | |||
| 1356 | Ga0501041_0022921 | |||
| 1357 | Ga0501042_0025521 | |||
| 1358 | Ga0501042_0034767 | |||
| 1359 | Ga0501042_0047985 | |||
| 1360 | Ga0501042_0086275 | |||
| 1361 | Ga0501043_0002611 | |||
| 1362 | Ga0501043_0006028 | |||
| 1363 | Ga0501043_0008471 | |||
| 1364 | Ga0501043_0034434 | |||
| 1365 | Ga0501043_0113338 | |||
| 1366 | Ga0501046_0003884 | |||
| 1367 | Ga0501046_0005237 | |||
| 1368 | Ga0501046_0006469 | |||
| 1369 | Ga0501047_0009023 | |||
| 1370 | Ga0501047_0027872 | |||
| 1371 | Ga0501047_0092762 | |||
| 1372 | Ga0501047_0242381 | |||
| 1373 | Ga0501048_0017670 | |||
| 1374 | Ga0501048_0041910 | |||
| 1375 | Ga0501048_0055295 | |||
| 1376 | Ga0501048_0146071 | |||
| 1377 | Ga0501048_0174935 | |||
| 1378 | Ga0501067_0000470 | |||
| 1379 | Ga0501067_0001142 | |||
| 1380 | Ga0501067_0001839 | |||
| 1381 | Ga0501067_0051110 | |||
| 1382 | Ga0501067_0079760 | |||
| 1383 | Ga0501068_0000618 | |||
| 1384 | Ga0501068_0023438 | |||
| 1385 | Ga0501068_0053171 | |||
| 1386 | Ga0501069_0003172 | |||
| 1387 | Ga0501069_0003245 | |||
| 1388 | Ga0501069_0019064 | |||
| 1389 | Ga0501069_0034419 | |||
| 1390 | Ga0501070_0001222 | |||
| 1391 | Ga0501070_0003991 | |||
| 1392 | Ga0501070_0029790 | |||
| 1393 | Ga0501070_0042676 | |||
| 1394 | Ga0501070_0078432 | |||
| 1395 | Ga0501071_0000108 | |||
| 1396 | Ga0501071_0022045 | |||
| 1397 | Ga0501071_0037155 | |||
| 1398 | Ga0501071_0077533 | |||
| 1399 | Ga0501072_0011340 | |||
| 1400 | Ga0501072_0067005 | |||
| 1401 | Ga0501073_0011693 | |||
| 1402 | Ga0501073_0016031 | |||
| 1403 | Ga0501074_0016473 | |||
| 1404 | Ga0501074_0034299 | |||
| 1405 | Ga0501074_0038646 | |||
| 1406 | Ga0501074_0063791 | |||
| 1407 | Ga0501076_0002689 | |||
| 1408 | Ga0501076_0011545 | |||
| 1409 | Ga0501076_0062956 | |||
| 1410 | Ga0501076_0188151 | |||
| 1411 | Ga0501077_0023406 | |||
| 1412 | Ga0501077_0094722 | |||
| 1413 | Ga0501079_0003324 | |||
| 1414 | Ga0501079_0009675 | |||
| 1415 | Ga0501079_0026049 | |||
| 1416 | Ga0501079_0057533 | |||
| 1417 | Ga0501080_0002881 | |||
| 1418 | Ga0501080_0019482 | |||
| 1419 | Ga0501080_0049937 | |||
| 1420 | Ga0501080_0071091 | |||
| 1421 | Ga0501081_0004843 | |||
| 1422 | Ga0501081_0035528 | |||
| 1423 | Ga0501083_0001526 | |||
| 1424 | Ga0501083_0009224 | |||
| 1425 | Ga0501083_0023726 | |||
| 1426 | Ga0501035_0004527 | |||
| 1427 | Ga0501035_0008497 | |||
| 1428 | Ga0501035_0040429 | |||
| 1429 | Ga0501035_0054798 | |||
| 1430 | Ga0501035_0063031 | |||
| 1431 | Ga0501035_0079863 | |||
| 1432 | Ga0501035_0091486 | |||
| 1433 | Ga0501044_0003483 | |||
| 1434 | Ga0501044_0018750 | |||
| 1435 | Ga0501044_0020502 | |||
| 1436 | Ga0501044_0068907 | |||
| 1437 | Ga0501044_0104907 | |||
| 1438 | Ga0501045_0021820 | |||
| 1439 | Ga0501045_0073852 | |||
| 1440 | nmdc:mga06z11_1309_c1 | |||
| 1441 | nmdc:mga04h51_5519_c1 | |||
| 1442 | nmdc:mga07m45_15947_c1 | |||
| 1443 | nmdc:mga05p37_241318_c1 | |||
| 1444 | nmdc:mga05p37_6607_c1 | |||
| 1445 | nmdc:mga05p37_77797_c1 | |||
| 1446 | nmdc:mga09592_13265_c1 | |||
| 1447 | nmdc:mga09592_38915_c1 | |||
| 1448 | nmdc:mga0qj67_218734_c1 | |||
| 1449 | nmdc:mga0qj67_65866_c1 | |||
| 1450 | nmdc:mga06r32_204956_c1 | |||
| 1451 | nmdc:mga06r32_449_c1 | |||
| 1452 | nmdc:mga08y16_11412_c1 | |||
| 1453 | nmdc:mga08y16_158805_c1 | |||
| 1454 | nmdc:mga08y16_175567_c1 | |||
| 1455 | nmdc:mga08y16_82116_c1 | |||
| 1456 | nmdc:mga0n895_113216_c1 | |||
| 1457 | nmdc:mga0n895_130156_c1 | |||
| 1458 | nmdc:mga0n895_14788_c1 | |||
| 1459 | nmdc:mga0n895_8895_c1 | |||
| 1460 | nmdc:mga0rr50_100880_c1 | |||
| 1461 | nmdc:mga0rr50_248995_c1 | |||
| 1462 | nmdc:mga08x19_77649_c1 | |||
| 1463 | nmdc:mga0a205_122548_c1 | |||
| 1464 | nmdc:mga0a205_21186_c1 | |||
| 1465 | nmdc:mga0a205_229295_c1 | |||
| 1466 | Ga0495601_0015071 | |||
| 1467 | Ga0495601_0030136 | |||
| 1468 | Ga0495655_0028212 | |||
| 1469 | Ga0495595_0015476 | |||
| 1470 | Ga0495619_0009482 | |||
| 1471 | Ga0495619_0040721 | |||
| 1472 | Ga0500578_0151244 | |||
| 1473 | Ga0500651_0122844 | |||
| 1474 | Ga0500566_0075409 | |||
| 1475 | Ga0500560_004643 | |||
| 1476 | Ga0500569_000894 | |||
| 1477 | Ga0500652_053372 | |||
| 1478 | Ga0500658_0056498 | |||
| 1479 | Ga0500561_0000412 | |||
| 1480 | Ga0500600_0054940 | |||
| 1481 | Ga0500616_0083431 | |||
| 1482 | Ga0500633_0037512 | |||
| 1483 | Ga0500634_0046736 | |||
| 1484 | Ga0501084_0089455 | |||
| 1485 | Ga0501084_0145799 | |||
| 1486 | Ga0501084_0248232 | |||
| 1487 | Ga0590075_004461 | |||
| 1488 | Ga0590077_004917 | |||
| 1489 | Ga0501082_0026469 | |||
| 1490 | Ga0501082_0182637 | |||
| 1491 | Ga0530510_0002662 | |||
| 1492 | Ga0530510_0013262 | |||
| 1493 | Ga0530510_0029929 | |||
| 1494 | 2585305134 | |||
| 1495 | 2644266179 | |||
| 1496 | 2644437598 | |||
| 1497 | 2768642026 | |||
| 1498 | 2785342165 | |||
| 1499 | 2786671648 | |||
| 1500 | 2804845837 | |||
| 1501 | 2808843053 | |||
| 1502 | 2809233076 | |||
| 1503 | 2812357070 | |||
| 1504 | 2812479731 | |||
| 1505 | 2852640067 | |||
| 1506 | 2862179501 | |||
| 1507 | 2862390068 | |||
| 1508 | 2862578432 | |||
| 1509 | 2862709550 | |||
| 1510 | 2863411847 | |||
| 1511 | 2867372997 | |||
| 1512 | 2867435712 | |||
| 1513 | 2877680128 | |||
| 1514 | 2912731044 | |||
| 1515 | 2919471469 | |||
| 1516 | 2946068808 | |||
| 1517 | 2947228102 | |||
| 1518 | 2954385061 | |||
| 1519 | 2954677934 | |||
| 1520 | 2954686223 | |||
| 1521 | 2954695879 | |||
| 1522 | 2954711070 | |||
| 1523 | 2954715284 | |||
| 1524 | 2954725225 | |||
| 1525 | 2954736591 | |||
| 1526 | 2954744158 | |||
| 1527 | 2954755440 | |||
| 1528 | 2954763101 | |||
| 1529 | 2990045606 | |||
| 1530 | 2990063970 | |||
| 1531 | 2990091290 | |||
| 1532 | 3006324976 | |||
| 1533 | 3006397276 | |||
| 1534 | 3006492226 | |||
| 1535 | 3006498234 | |||
| 1536 | 8008485898 | |||
| 1537 | 8008566241 | |||
| 1538 | 8008578056 | |||
| 1539 | 8025418512 | |||
| 1540 | 8025524982 | |||
| 1541 | 8033690080 | |||
| 1542 | 8048409562 | |||
| 1543 | 8056454033 | |||
| 1544 | 8056833237 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qsn-assembly1.cif.gz_D | bovine complex i in lipid nanodisc, deactive-apo | 0.9725 | 75 | 422 |
| 7vwj-assembly1.cif.gz_Q | matrix arm of deactive state ci from rotenone-nadh dataset | 0.9707 | 36 | 422 |
| 6zk9-assembly1.cif.gz_4 | peripheral domain of open complex i during turnover | 0.9701 | 36 | 422 |
| 8e73-assembly1.cif.gz_S2 | vigna radiata supercomplex i+iii2 (full bridge) | 0.9694 | 36 | 422 |
| 8e73-assembly1.cif.gz_S2 | vigna radiata supercomplex i+iii2 (full bridge) | 0.9669 | 36 | 422 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q23883_16_406_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9528 | 36 | 422 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9512 | 36 | 422 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9465 | 36 | 422 | 1.10.645.10 |
| af_Q23883_16_406_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9409 | 36 | 422 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9401 | 36 | 422 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9UXZ8-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9839 | 70 | 422 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A7V9UXZ8-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9811 | 70 | 422 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A7W0YZR1-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9773 | 125 | 422 |
GO:0016020
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A5Q0UVT3-F1-model_v4 | NADH-plastoquinone oxidoreductase subunit 7 | 0.9769 | 59 | 298 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A067TRS5-F1-model_v4 | NADH-quinone oxidoreductase subunit D domain-containing protein | 0.9762 | 54 | 420 |
GO:0005739
GO:0006120 GO:0016651 GO:0048038 GO:0051287 |