F480050

General Info

Members Datasets Scaffolds Average Seq Length
770 374 731 214

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0092055|Ga0495654_0092055_79_843
Length 254
Sequence MFIKMGNPVEAGFAHDNTANCLELAHAQLKGRQGMEPVKWMVETLGVHELWLFILSGLLLNVTPGPDTAYIVGRSIQFGWRGGAAAATGISAGCLVHVFGAAIGLSALLMASSAAFTVLKWAGAAYLLVTGVQMLLSHSRPLAETAVAGSETSLARVFWQGALTNVLNPKVALFFLAFLPQFVTAESAHKTLAFLVLGLIFITSGTLWCFGIAAFAARVAGRIRQSAGAMAWINRALGGLFVYLGIRVAMLEAR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2791355199
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
14 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
15 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
16 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
17 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
18 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
19 2906610324
20 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
21 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
22 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
23 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
24 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
25 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
26 2922425934
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
29 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
30 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
31 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
339 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
343 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
347 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
348 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
352 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
356 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
357 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
367 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
368 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
369 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
370 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
371 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
372 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
373 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
374 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0.13
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.87
Nodule 3.64
Rhizoplane 5.32
Rhizosphere 72.47
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000118 3300003203 Bacteria 34503
2 JGI25406J46586_10007912 3300003203 Bacteria 4836
3 JGI25153J46596_10013940 3300003215 Bacteria 3371
4 rootH1_10063808 3300003316 Bacteria 1553
5 rootH1_10046565 3300003323 Bacteria 8553
6 rootH1_10341204 3300003323 Bacteria 1210
7 JGI25404J52841_10006748 3300003659 Bacteria 2410
8 JGI25404J52841_10018718 3300003659 Bacteria 1500
9 JGI25404J52841_10035704 3300003659 Bacteria 1058
10 JGI25405J52794_10002640 3300003911 Bacteria 3101
11 Ga0070676_10001300 3300005328 Bacteria 12562
12 Ga0070676_10084486 3300005328 Bacteria 1932
13 Ga0070683_100373843 3300005329 Bacteria 1358
14 Ga0070690_100613710 3300005330 Bacteria 827
15 Ga0070670_100151800 3300005331 Bacteria 2005
16 Ga0070670_100263660 3300005331 Bacteria 1502
17 Ga0070670_100289949 3300005331 Bacteria 1430
18 Ga0070670_100460507 3300005331 Bacteria 1128
19 Ga0070677_10003729 3300005333 Bacteria 4931
20 Ga0068869_100006393 3300005334 Bacteria 7471
21 Ga0068869_100044270 3300005334 Bacteria 3200
22 Ga0068869_100301500 3300005334 Bacteria 1294
23 Ga0070666_10001057 3300005335 Bacteria 16820
24 Ga0070666_10593548 3300005335 Bacteria 808
25 Ga0070680_100202121 3300005336 Bacteria 1676
26 Ga0068868_100013250 3300005338 Bacteria 6041
27 Ga0068868_100021214 3300005338 Bacteria 4891
28 Ga0068868_100051092 3300005338 Bacteria 3249
29 Ga0068868_100420164 3300005338 Bacteria 1157
30 Ga0070660_100122715 3300005339 Bacteria 2074
31 Ga0070689_100248302 3300005340 Bacteria 1468
32 Ga0070687_100444505 3300005343 Bacteria 861
33 Ga0070661_100186210 3300005344 Bacteria 1582
34 Ga0070668_100004548 3300005347 Bacteria 10284
35 Ga0070668_100028324 3300005347 Bacteria 4253
36 Ga0070668_100185959 3300005347 Bacteria 1699
37 Ga0070668_100190092 3300005347 Bacteria 1681
38 Ga0070668_100253439 3300005347 Bacteria 1462
39 Ga0070668_100295341 3300005347 Bacteria 1357
40 Ga0070668_100321353 3300005347 Bacteria 1303
41 Ga0070668_100353994 3300005347 Bacteria 1243
42 Ga0070668_100592773 3300005347 Bacteria 969
43 Ga0070669_100009203 3300005353 Bacteria 7038
44 Ga0070669_100242431 3300005353 Bacteria 1433
45 Ga0070669_100267094 3300005353 Bacteria 1367
46 Ga0070675_100001972 3300005354 Bacteria 15193
47 Ga0070671_100001035 3300005355 Bacteria 20462
48 Ga0070671_100049679 3300005355 Bacteria 3489
49 Ga0070671_100845689 3300005355 Bacteria 798
50 Ga0070674_100001310 3300005356 Bacteria 13095
51 Ga0070673_100001352 3300005364 Bacteria 14315
52 Ga0070673_100476928 3300005364 Bacteria 1125
53 Ga0070659_100091560 3300005366 Bacteria 2438
54 Ga0070659_100273058 3300005366 Bacteria 1405
55 Ga0070659_100282229 3300005366 Bacteria 1382
56 Ga0070667_100002933 3300005367 Bacteria 14661
57 Ga0070667_100316757 3300005367 Bacteria 1407
58 Ga0070667_100439515 3300005367 Bacteria 1191
59 Ga0070667_100516654 3300005367 Bacteria 1096
60 Ga0070667_100522228 3300005367 Bacteria 1090
61 Ga0070713_100040144 3300005436 Bacteria 3804
62 Ga0070710_10300917 3300005437 Bacteria 1047
63 Ga0070701_10111907 3300005438 Bacteria 1526
64 Ga0070700_100100500 3300005441 Bacteria 1905
65 Ga0070700_100171527 3300005441 Bacteria 1503
66 Ga0070663_100007686 3300005455 Bacteria 6581
67 Ga0070663_100033040 3300005455 Bacteria 3571
68 Ga0070663_100034595 3300005455 Bacteria 3500
69 Ga0070663_100125533 3300005455 Bacteria 1944
70 Ga0070663_100176076 3300005455 Bacteria 1656
71 Ga0070663_100371471 3300005455 Bacteria 1162
72 Ga0070678_100001003 3300005456 Bacteria 14655
73 Ga0070678_100014577 3300005456 Bacteria 4967
74 Ga0070678_100138931 3300005456 Bacteria 1941
75 Ga0070678_100176810 3300005456 Bacteria 1743
76 Ga0070678_100227783 3300005456 Bacteria 1552
77 Ga0070678_100311781 3300005456 Bacteria 1341
78 Ga0070678_100450918 3300005456 Bacteria 1127
79 Ga0070662_100146530 3300005457 Bacteria 1834
80 Ga0070681_10535506 3300005458 Bacteria 1085
81 Ga0068867_100010975 3300005459 Bacteria 6387
82 Ga0068867_100037083 3300005459 Bacteria 3542
83 Ga0068867_100135545 3300005459 Bacteria 1919
84 Ga0068867_100793598 3300005459 Bacteria 844
85 Ga0070685_10061983 3300005466 Bacteria 2192
86 Ga0070685_10286807 3300005466 Bacteria 1104
87 Ga0070698_100142039 3300005471 Bacteria 2352
88 Ga0070698_100624788 3300005471 Bacteria 1018
89 Ga0070699_100488680 3300005518 Bacteria 1118
90 Ga0070684_100056843 3300005535 Bacteria 3416
91 Ga0068853_100016152 3300005539 Bacteria 6139
92 Ga0068853_100115628 3300005539 Bacteria 2388
93 Ga0070672_100004801 3300005543 Bacteria 8874
94 Ga0070672_100199132 3300005543 Bacteria 1674
95 Ga0070686_100060417 3300005544 Bacteria 2446
96 Ga0070686_100095240 3300005544 Bacteria 2000
97 Ga0070686_100168594 3300005544 Bacteria 1547
98 Ga0070693_100416569 3300005547 Bacteria 935
99 Ga0070665_100015092 3300005548 Bacteria 7756
100 Ga0070665_100038313 3300005548 Bacteria 4819
101 Ga0070665_100111611 3300005548 Bacteria 2736
102 Ga0070665_100125570 3300005548 Bacteria 2568
103 Ga0070665_100418625 3300005548 Bacteria 1348
104 Ga0070704_100017490 3300005549 Bacteria 4560
105 Ga0068855_100036624 3300005563 Bacteria 5837
106 Ga0070664_100445627 3300005564 Bacteria 1188
107 Ga0068854_100691293 3300005578 Bacteria 880
108 Ga0068856_100142783 3300005614 Bacteria 2401
109 Ga0070702_100020928 3300005615 Bacteria 3433
110 Ga0070702_100207577 3300005615 Bacteria 1301
111 Ga0070702_100269726 3300005615 Bacteria 1163
112 Ga0070702_100391619 3300005615 Bacteria 991
113 Ga0068852_100001098 3300005616 Bacteria 17860
114 Ga0068852_100052442 3300005616 Bacteria 3505
115 Ga0068852_100054448 3300005616 Bacteria 3449
116 Ga0068852_100373304 3300005616 Bacteria 1398
117 Ga0068859_100048748 3300005617 Bacteria 4255
118 Ga0068859_100151549 3300005617 Bacteria 2394
119 Ga0068859_100167592 3300005617 Bacteria 2276
120 Ga0068859_100217700 3300005617 Bacteria 1997
121 Ga0068859_100578577 3300005617 Bacteria 1217
122 Ga0068864_100024533 3300005618 Bacteria 5074
123 Ga0068864_100031446 3300005618 Bacteria 4503
124 Ga0068864_100033384 3300005618 Bacteria 4375
125 Ga0068864_100086324 3300005618 Bacteria 2760
126 Ga0068864_100227737 3300005618 Bacteria 1723
127 Ga0068866_10052283 3300005718 Bacteria 2084
128 Ga0068866_10117677 3300005718 Bacteria 1492
129 Ga0068861_100074575 3300005719 Bacteria 2638
130 Ga0068861_100172531 3300005719 Bacteria 1793
131 Ga0068851_10000852 3300005834 Bacteria 13138
132 Ga0068870_10007499 3300005840 Bacteria 4868
133 Ga0068863_100015678 3300005841 Bacteria 7276
134 Ga0068863_100196706 3300005841 Bacteria 1938
135 Ga0068863_100274055 3300005841 Bacteria 1634
136 Ga0068863_100672786 3300005841 Bacteria 1027
137 Ga0068858_100056847 3300005842 Bacteria 3616
138 Ga0068858_100133876 3300005842 Bacteria 2325
139 Ga0068858_100154554 3300005842 Bacteria 2158
140 Ga0068858_100234024 3300005842 Bacteria 1742
141 Ga0068858_100286387 3300005842 Bacteria 1570
142 Ga0068858_100478475 3300005842 Bacteria 1202
143 Ga0068858_100652142 3300005842 Bacteria 1023
144 Ga0068858_100723654 3300005842 Bacteria 969
145 Ga0068860_100000441 3300005843 Bacteria 52446
146 Ga0068860_100006265 3300005843 Bacteria 11943
147 Ga0068860_100122368 3300005843 Bacteria 2492
148 Ga0068860_100330277 3300005843 Bacteria 1498
149 Ga0068862_100053367 3300005844 Bacteria 3460
150 Ga0068862_100083397 3300005844 Bacteria 2775
151 Ga0068862_100179877 3300005844 Bacteria 1897
152 Ga0068862_100210527 3300005844 Bacteria 1756
153 Ga0068862_100265761 3300005844 Bacteria 1567
154 Ga0081455_10013479 3300005937 Bacteria 8073
155 Ga0081455_10023557 3300005937 Bacteria 5727
156 Ga0081455_10041472 3300005937 Bacteria 4047
157 Ga0081455_10066358 3300005937 Bacteria 3014
158 Ga0081455_10410493 3300005937 Bacteria 937
159 Ga0081538_10018308 3300005981 Bacteria 5268
160 Ga0081540_1002251 3300005983 Bacteria 15895
161 Ga0081540_1003941 3300005983 Bacteria 11537
162 Ga0081540_1004960 3300005983 Bacteria 10007
163 Ga0081540_1006444 3300005983 Bacteria 8542
164 Ga0081540_1014502 3300005983 Bacteria 5042
165 Ga0081540_1046725 3300005983 Bacteria 2183
166 Ga0081539_10000425 3300005985 Bacteria 89942
167 Ga0081539_10001114 3300005985 Bacteria 48756
168 Ga0081539_10012644 3300005985 Bacteria 6472
169 Ga0081539_10018715 3300005985 Bacteria 4786
170 Ga0081539_10106778 3300005985 Bacteria 1417
171 Ga0070717_10310303 3300006028 Bacteria 1404
172 Ga0075365_10111769 3300006038 Bacteria 1878
173 Ga0075365_10189448 3300006038 Bacteria 1439
174 Ga0075365_10192026 3300006038 Bacteria 1429
175 Ga0075365_10273506 3300006038 Bacteria 1188
176 Ga0075365_10300082 3300006038 Bacteria 1130
177 Ga0075368_10009758 3300006042 Bacteria 3460
178 Ga0075368_10029321 3300006042 Bacteria 2127
179 Ga0075363_100001726 3300006048 Bacteria 8492
180 Ga0075364_10286232 3300006051 Bacteria 1121
181 Ga0075364_10292558 3300006051 Bacteria 1108
182 Ga0070716_100221232 3300006173 Bacteria 1272
183 Ga0075362_10021395 3300006177 Bacteria 2713
184 Ga0075362_10106050 3300006177 Bacteria 1319
185 Ga0075362_10172008 3300006177 Bacteria 1047
186 Ga0075362_10172111 3300006177 Bacteria 1047
187 Ga0075367_10074104 3300006178 Bacteria 2052
188 Ga0075369_10138245 3300006186 Bacteria 1110
189 Ga0075369_10148347 3300006186 Bacteria 1071
190 Ga0075366_10074192 3300006195 Bacteria 2028
191 Ga0097621_100072169 3300006237 Bacteria 2855
192 Ga0097621_100255131 3300006237 Bacteria 1537
193 Ga0075370_10056009 3300006353 Bacteria 2240
194 Ga0075370_10102902 3300006353 Bacteria 1654
195 Ga0075370_10106289 3300006353 Bacteria 1627
196 Ga0068871_100017539 3300006358 Bacteria 5420
197 Ga0068871_100087537 3300006358 Bacteria 2590
198 Ga0068871_100092844 3300006358 Bacteria 2517
199 Ga0068871_100208226 3300006358 Bacteria 1691
200 Ga0068871_100864221 3300006358 Bacteria 837
201 Ga0075428_100051259 3300006844 Bacteria 4526
202 Ga0075428_100472359 3300006844 Bacteria 1342
203 Ga0075434_100013575 3300006871 Bacteria 7761
204 Ga0075434_100178919 3300006871 Bacteria 2140
205 Ga0075434_100375451 3300006871 Bacteria 1443
206 Ga0075434_100922435 3300006871 Bacteria 888
207 Ga0075429_100583237 3300006880 Bacteria 980
208 Ga0068865_100044397 3300006881 Bacteria 3042
209 Ga0068865_100051818 3300006881 Bacteria 2842
210 Ga0068865_100222558 3300006881 Bacteria 1476
211 Ga0068865_100294011 3300006881 Bacteria 1297
212 Ga0097620_100048746 3300006931 Bacteria 4255
213 Ga0097620_100151548 3300006931 Bacteria 2394
214 Ga0097620_100167594 3300006931 Bacteria 2276
215 Ga0097620_100217712 3300006931 Bacteria 1997
216 Ga0097620_100578562 3300006931 Bacteria 1217
217 Ga0075435_100086681 3300007076 Bacteria 2579
218 Ga0099794_10062285 3300007265 Bacteria 1814
219 Ga0105240_10334243 3300009093 Bacteria 1723
220 Ga0111539_10126858 3300009094 Bacteria 2989
221 Ga0111539_10255949 3300009094 Bacteria 2039
222 Ga0105245_10011836 3300009098 Bacteria 7588
223 Ga0105245_10082796 3300009098 Bacteria 2936
224 Ga0105245_10349267 3300009098 Bacteria 1465
225 Ga0105245_10899099 3300009098 Bacteria 927
226 Ga0105245_11171872 3300009098 Bacteria 816
227 Ga0105247_10007548 3300009101 Bacteria 6663
228 Ga0105247_10026077 3300009101 Bacteria 3528
229 Ga0105247_10027309 3300009101 Bacteria 3452
230 Ga0105247_10338387 3300009101 Bacteria 1055
231 Ga0114129_10527373 3300009147 Bacteria 1539
232 Ga0105243_10152324 3300009148 Bacteria 1985
233 Ga0105243_10292936 3300009148 Bacteria 1471
234 Ga0105243_10522079 3300009148 Bacteria 1129
235 Ga0105241_10023322 3300009174 Bacteria 4589
236 Ga0105241_10178089 3300009174 Bacteria 1761
237 Ga0105241_10414686 3300009174 Bacteria 1184
238 Ga0105242_10034607 3300009176 Bacteria 4050
239 Ga0105242_10459247 3300009176 Bacteria 1202
240 Ga0105248_10050803 3300009177 Bacteria 4651
241 Ga0105248_10221292 3300009177 Bacteria 2131
242 Ga0105248_10612209 3300009177 Bacteria 1229
243 Ga0105237_10009401 3300009545 Bacteria 10469
244 Ga0105237_10033756 3300009545 Bacteria 5184
245 Ga0105237_10160609 3300009545 Bacteria 2246
246 Ga0105237_10959832 3300009545 Bacteria 862
247 Ga0105237_11215742 3300009545 Bacteria 760
248 Ga0105238_10042360 3300009551 Bacteria 4611
249 Ga0105238_10049191 3300009551 Bacteria 4247
250 Ga0105238_10225883 3300009551 Bacteria 1849
251 Ga0105238_10242274 3300009551 Bacteria 1781
252 Ga0105238_10605773 3300009551 Bacteria 1103
253 Ga0105249_10043356 3300009553 Bacteria 4092
254 Ga0105249_10052668 3300009553 Bacteria 3717
255 Ga0105249_10282383 3300009553 Bacteria 1659
256 Ga0105249_10618845 3300009553 Bacteria 1139
257 Ga0105239_10006226 3300010375 Bacteria 13885
258 Ga0105239_10025843 3300010375 Bacteria 6467
259 Ga0105239_10032597 3300010375 Bacteria 5725
260 Ga0105239_10054201 3300010375 Bacteria 4398
261 Ga0105239_10294287 3300010375 Bacteria 1828
262 Ga0105239_10324233 3300010375 Bacteria 1737
263 Ga0105246_10006538 3300011119 Bacteria 7118
264 Ga0105246_10059478 3300011119 Bacteria 2651
265 Ga0105246_10191870 3300011119 Bacteria 1582
266 Ga0105246_10421170 3300011119 Bacteria 1114
267 Ga0105246_10483753 3300011119 Bacteria 1048
268 Ga0157374_10025945 3300013296 Bacteria 5268
269 Ga0157374_10074206 3300013296 Bacteria 3211
270 Ga0157378_10019128 3300013297 Bacteria 6017
271 Ga0157378_10087727 3300013297 Bacteria 2822
272 Ga0157378_10101599 3300013297 Bacteria 2626
273 Ga0163162_10050121 3300013306 Bacteria 4187
274 Ga0163162_10206640 3300013306 Bacteria 2093
275 Ga0163162_10262948 3300013306 Bacteria 1857
276 Ga0163162_10405715 3300013306 Bacteria 1496
277 Ga0163162_10968636 3300013306 Bacteria 961
278 Ga0157375_10003835 3300013308 Bacteria 13039
279 Ga0157375_10016660 3300013308 Bacteria 6610
280 Ga0157375_10060282 3300013308 Bacteria 3763
281 Ga0157375_10118395 3300013308 Bacteria 2755
282 Ga0157375_10242492 3300013308 Bacteria 1962
283 Ga0157375_10271555 3300013308 Bacteria 1858
284 Ga0157375_11613687 3300013308 Bacteria 767
285 Ga0163163_10040677 3300014325 Bacteria 4540
286 Ga0163163_10134877 3300014325 Bacteria 2509
287 Ga0163163_10339241 3300014325 Bacteria 1558
288 Ga0163163_10798352 3300014325 Bacteria 1007
289 Ga0163163_11491717 3300014325 Bacteria 737
290 Ga0157380_10264581 3300014326 Bacteria 1564
291 Ga0157377_10278377 3300014745 Bacteria 1096
292 Ga0157379_10602264 3300014968 Bacteria 1026
293 Ga0157376_10021798 3300014969 Bacteria 4980
294 Ga0157376_10038264 3300014969 Bacteria 3901
295 Ga0157376_10794706 3300014969 Bacteria 958
296 Ga0163161_10045299 3300017792 Bacteria 3172
297 Ga0163161_10083802 3300017792 Bacteria 2350
298 Ga0163161_10197527 3300017792 Bacteria 1549
299 Ga0213872_10089598 3300021361 Bacteria 1377
300 Ga0209233_1006541 3300025261 Bacteria 3748
301 Ga0209758_1017706 3300025297 Bacteria 3529
302 Ga0209051_1003827 3300025303 Bacteria 9634
303 Ga0207656_10017624 3300025321 Bacteria 2800
304 Ga0207682_10000243 3300025893 Bacteria 24690
305 Ga0207642_10023155 3300025899 Bacteria 2477
306 Ga0207642_10108073 3300025899 Bacteria 1411
307 Ga0207710_10129305 3300025900 Bacteria 1212
308 Ga0207688_10011640 3300025901 Bacteria 4785
309 Ga0207688_10042147 3300025901 Bacteria 2541
310 Ga0207680_10279251 3300025903 Bacteria 1160
311 Ga0207647_10103374 3300025904 Bacteria 1689
312 Ga0207699_10060197 3300025906 Bacteria 2279
313 Ga0207645_10000045 3300025907 Bacteria 85310
314 Ga0207645_10107330 3300025907 Bacteria 1805
315 Ga0207643_10012247 3300025908 Bacteria 4637
316 Ga0207705_10449524 3300025909 Bacteria 999
317 Ga0207654_10019526 3300025911 Bacteria 3578
318 Ga0207707_10050125 3300025912 Bacteria 3638
319 Ga0207695_10469495 3300025913 Bacteria 1141
320 Ga0207671_10123853 3300025914 Bacteria 1978
321 Ga0207671_10179010 3300025914 Bacteria 1649
322 Ga0207671_10322646 3300025914 Bacteria 1222
323 Ga0207660_10546688 3300025917 Bacteria 942
324 Ga0207657_10226004 3300025919 Bacteria 1498
325 Ga0207649_10014137 3300025920 Bacteria 4468
326 Ga0207649_10020501 3300025920 Bacteria 3793
327 Ga0207652_10016146 3300025921 Bacteria 6090
328 Ga0207681_10023123 3300025923 Bacteria 3972
329 Ga0207681_10476931 3300025923 Bacteria 1018
330 Ga0207694_10037563 3300025924 Bacteria 3720
331 Ga0207694_10054759 3300025924 Bacteria 3095
332 Ga0207694_10441105 3300025924 Bacteria 1086
333 Ga0207650_10245564 3300025925 Bacteria 1448
334 Ga0207650_10251201 3300025925 Bacteria 1432
335 Ga0207659_10029878 3300025926 Bacteria 3718
336 Ga0207659_10312598 3300025926 Bacteria 1294
337 Ga0207687_10020088 3300025927 Bacteria 4430
338 Ga0207687_10052337 3300025927 Bacteria 2849
339 Ga0207687_10102900 3300025927 Bacteria 2105
340 Ga0207687_10197857 3300025927 Bacteria 1568
341 Ga0207687_10815748 3300025927 Bacteria 796
342 Ga0207700_10126299 3300025928 Bacteria 2082
343 Ga0207644_10119886 3300025931 Bacteria 2001
344 Ga0207706_10016793 3300025933 Bacteria 6606
345 Ga0207706_10144647 3300025933 Bacteria 2092
346 Ga0207686_10052617 3300025934 Bacteria 2542
347 Ga0207709_10388716 3300025935 Bacteria 1063
348 Ga0207709_10613168 3300025935 Bacteria 863
349 Ga0207670_10184269 3300025936 Bacteria 1575
350 Ga0207670_10329894 3300025936 Bacteria 1203
351 Ga0207669_10016576 3300025937 Bacteria 3748
352 Ga0207669_10018879 3300025937 Bacteria 3577
353 Ga0207669_10188622 3300025937 Bacteria 1485
354 Ga0207669_10313558 3300025937 Bacteria 1197
355 Ga0207704_10051040 3300025938 Bacteria 2499
356 Ga0207704_10079846 3300025938 Bacteria 2110
357 Ga0207704_10282098 3300025938 Bacteria 1263
358 Ga0207691_10000452 3300025940 Bacteria 40569
359 Ga0207691_10113142 3300025940 Bacteria 2412
360 Ga0207691_10133622 3300025940 Bacteria 2190
361 Ga0207691_10165000 3300025940 Bacteria 1941
362 Ga0207711_10041346 3300025941 Bacteria 3925
363 Ga0207711_10046143 3300025941 Bacteria 3722
364 Ga0207711_10346544 3300025941 Bacteria 1375
365 Ga0207689_10029882 3300025942 Bacteria 4545
366 Ga0207689_10156187 3300025942 Bacteria 1881
367 Ga0207689_10305825 3300025942 Bacteria 1318
368 Ga0207689_10325189 3300025942 Bacteria 1276
369 Ga0207661_10048891 3300025944 Bacteria 3364
370 Ga0207679_10031548 3300025945 Bacteria 3709
371 Ga0207679_10446928 3300025945 Bacteria 1146
372 Ga0207667_10034096 3300025949 Bacteria 5469
373 Ga0207651_10037748 3300025960 Bacteria 3167
374 Ga0207651_10060266 3300025960 Bacteria 2633
375 Ga0207651_10799250 3300025960 Bacteria 836
376 Ga0207712_10204638 3300025961 Bacteria 1568
377 Ga0207712_10334286 3300025961 Bacteria 1254
378 Ga0207712_10407817 3300025961 Bacteria 1144
379 Ga0207712_10542904 3300025961 Bacteria 999
380 Ga0207668_10019309 3300025972 Bacteria 4306
381 Ga0207668_10036661 3300025972 Bacteria 3274
382 Ga0207668_10085658 3300025972 Bacteria 2300
383 Ga0207668_10086905 3300025972 Bacteria 2285
384 Ga0207658_10010640 3300025986 Bacteria 6253
385 Ga0207658_10125546 3300025986 Bacteria 2053
386 Ga0207658_10344876 3300025986 Bacteria 1295
387 Ga0207677_10031617 3300026023 Bacteria 3391
388 Ga0207677_10225264 3300026023 Bacteria 1506
389 Ga0207677_10319270 3300026023 Bacteria 1290
390 Ga0207677_10508390 3300026023 Bacteria 1043
391 Ga0207677_10791596 3300026023 Bacteria 848
392 Ga0207703_10073183 3300026035 Bacteria 2834
393 Ga0207703_10414020 3300026035 Bacteria 1253
394 Ga0207703_10429583 3300026035 Bacteria 1231
395 Ga0207703_10508128 3300026035 Bacteria 1132
396 Ga0207639_10047484 3300026041 Bacteria 3245
397 Ga0207639_10051305 3300026041 Bacteria 3137
398 Ga0207639_10083373 3300026041 Bacteria 2537
399 Ga0207678_10006080 3300026067 Bacteria 10738
400 Ga0207678_10011560 3300026067 Bacteria 7753
401 Ga0207678_10026460 3300026067 Bacteria 5060
402 Ga0207678_10048025 3300026067 Bacteria 3690
403 Ga0207678_10071566 3300026067 Bacteria 2973
404 Ga0207678_10152734 3300026067 Bacteria 1972
405 Ga0207708_10014165 3300026075 Bacteria 5962
406 Ga0207708_10250326 3300026075 Bacteria 1427
407 Ga0207708_10861147 3300026075 Bacteria 783
408 Ga0207641_10037960 3300026088 Bacteria 4025
409 Ga0207641_10269196 3300026088 Bacteria 1598
410 Ga0207641_10360263 3300026088 Bacteria 1388
411 Ga0207641_10519386 3300026088 Bacteria 1158
412 Ga0207641_10883131 3300026088 Bacteria 887
413 Ga0207648_10009278 3300026089 Bacteria 9446
414 Ga0207648_10011805 3300026089 Bacteria 8209
415 Ga0207648_10226751 3300026089 Bacteria 1661
416 Ga0207648_10291036 3300026089 Bacteria 1462
417 Ga0207676_10019011 3300026095 Bacteria 5005
418 Ga0207676_10029628 3300026095 Bacteria 4100
419 Ga0207676_10063106 3300026095 Bacteria 2941
420 Ga0207676_10119335 3300026095 Bacteria 2221
421 Ga0207676_10574965 3300026095 Bacteria 1079
422 Ga0207675_100087515 3300026118 Bacteria 2926
423 Ga0207675_100183530 3300026118 Bacteria 2004
424 Ga0207675_100333972 3300026118 Bacteria 1482
425 Ga0207675_100338360 3300026118 Bacteria 1473
426 Ga0207675_100405315 3300026118 Bacteria 1344
427 Ga0207683_10000003 3300026121 Bacteria 191866
428 Ga0207683_10017266 3300026121 Bacteria 6147
429 Ga0207683_10075559 3300026121 Bacteria 2982
430 Ga0207683_10097079 3300026121 Bacteria 2628
431 Ga0207683_10282643 3300026121 Bacteria 1516
432 Ga0207683_10438286 3300026121 Bacteria 1204
433 Ga0207683_10694538 3300026121 Bacteria 943
434 Ga0207698_10191598 3300026142 Bacteria 1822
435 Ga0209588_1038165 3300027671 Bacteria 1547
436 Ga0207428_10133454 3300027907 Bacteria 1899
437 Ga0268266_10009316 3300028379 Bacteria 8657
438 Ga0268266_10013890 3300028379 Bacteria 6934
439 Ga0268266_10027089 3300028379 Bacteria 4876
440 Ga0268266_10051282 3300028379 Bacteria 3541
441 Ga0268266_10064139 3300028379 Bacteria 3173
442 Ga0268266_10569258 3300028379 Bacteria 1087
443 Ga0268265_10051545 3300028380 Bacteria 3106
444 Ga0268265_10072063 3300028380 Bacteria 2694
445 Ga0268265_10235763 3300028380 Bacteria 1611
446 Ga0268265_10315022 3300028380 Bacteria 1414
447 Ga0268265_10482457 3300028380 Bacteria 1164
448 Ga0268265_10491556 3300028380 Bacteria 1155
449 Ga0268265_10537737 3300028380 Bacteria 1107
450 Ga0268264_10000042 3300028381 Bacteria 372069
451 Ga0268264_10025888 3300028381 Bacteria 4790
452 Ga0268264_10108789 3300028381 Bacteria 2424
453 Ga0268264_10206537 3300028381 Bacteria 1800
454 Ga0307517_10000176 3300028786 Bacteria 105402
455 Ga0307517_10125173 3300028786 Bacteria 1879
456 Ga0307515_10024761 3300028794 Bacteria 10432
457 Ga0307515_10276368 3300028794 Bacteria 1393
458 Ga0265330_10037350 3300031235 Bacteria 2163
459 Ga0265332_10011294 3300031238 Bacteria 3970
460 Ga0265325_10012010 3300031241 Bacteria 4962
461 Ga0265340_10005142 3300031247 Bacteria 7272
462 Ga0265331_10036612 3300031250 Bacteria 2408
463 Ga0265331_10142252 3300031250 Bacteria 1091
464 Ga0265316_10229073 3300031344 Bacteria 1369
465 Ga0307513_10224786 3300031456 Bacteria 1695
466 Ga0307509_10030286 3300031507 Bacteria 5988
467 Ga0307509_10041504 3300031507 Bacteria 4992
468 Ga0307509_10224214 3300031507 Bacteria 1689
469 Ga0307509_10237301 3300031507 Bacteria 1620
470 Ga0307509_10237995 3300031507 Bacteria 1616
471 Ga0307408_100002235 3300031548 Bacteria 13806
472 Ga0265342_10045287 3300031712 Bacteria 2649
473 Ga0307516_10043260 3300031730 Bacteria 4464
474 Ga0307405_10014534 3300031731 Bacteria 4236
475 Ga0307405_10044058 3300031731 Bacteria 2727
476 Ga0307405_10055101 3300031731 Bacteria 2487
477 Ga0307413_10005415 3300031824 Bacteria 5695
478 Ga0307413_10096382 3300031824 Bacteria 1942
479 Ga0307410_10136364 3300031852 Bacteria 1810
480 Ga0307406_10019997 3300031901 Bacteria 3935
481 Ga0307407_10004562 3300031903 Bacteria 5900
482 Ga0307412_10022144 3300031911 Bacteria 3891
483 Ga0307412_10055269 3300031911 Bacteria 2640
484 Ga0307416_100005572 3300032002 Bacteria 7756
485 Ga0307416_100419617 3300032002 Bacteria 1382
486 Ga0307416_100535872 3300032002 Bacteria 1242
487 Ga0307416_100714652 3300032002 Bacteria 1092
488 Ga0307414_10333713 3300032004 Bacteria 1295
489 Ga0307411_10115547 3300032005 Bacteria 1930
490 Ga0307411_10239180 3300032005 Bacteria 1420
491 Ga0307415_100156380 3300032126 Bacteria 1761
492 Ga0307415_100156458 3300032126 Bacteria 1761
493 Ga0307510_10010093 3300033180 Bacteria 11228
494 Ga0307510_10061429 3300033180 Bacteria 3852
495 Ga0315911_1000005 3300033442 Bacteria 426255
496 Ga0373930_0003404 3300034816 Bacteria 2519
497 Ga0373934_0049906 3300035086 Bacteria 1658
498 Ga0373932_0130591 3300035112 Bacteria 846
499 Ga0373942_0011619 3300035207 Bacteria 2091
500 Ga0373961_0141103 3300035241 Bacteria 814
501 Ga0373931_0007598 3300035691 Bacteria 5107
502 Ga0373931_0046305 3300035691 Bacteria 2299
503 Ga0373931_0491480 3300035691 Bacteria 790
504 Ga0373935_0271445 3300035692 Bacteria 1192
505 Ga0373927_0027614 3300035695 Bacteria 3705
506 Ga0373947_0061128 3300035725 Bacteria 2289
507 Ga0372808_025793 3300036459 Bacteria 844
508 Ga0373925_0594519 3300037068 Bacteria 911
509 Ga0395905_0101761 3300037471 Bacteria 2697
510 Ga0395905_0838266 3300037471 Bacteria 822
511 Ga0436361_0629207 3300039447 Bacteria 6607
512 Ga0436361_1049914 3300039447 Bacteria 6080
513 Ga0451791_0193268 3300041451 Bacteria 1626
514 Ga0451837_1135996 3300041494 Bacteria 700
515 Ga0451577_0610604 3300042876 Bacteria 990
516 Ga0451577_0775739 3300042876 Bacteria 866
517 Ga0466965_0019706 3300044683 Bacteria 3239
518 Ga0453684_0076227 3300044712 Bacteria 4211
519 Ga0453684_0099213 3300044712 Bacteria 3568
520 Ga0466968_0105687 3300044735 Bacteria 1261
521 Ga0451576_0496485 3300045051 Bacteria 1282
522 Ga0495617_018296 3300046452 Bacteria 2369
523 Ga0495617_058697 3300046452 Bacteria 1275
524 Ga0495617_061020 3300046452 Bacteria 1247
525 Ga0495603_0008200 3300046455 Bacteria 6314
526 Ga0495603_0078051 3300046455 Bacteria 1942
527 Ga0495603_0117661 3300046455 Bacteria 1549
528 Ga0495603_0229043 3300046455 Bacteria 1071
529 Ga0495590_0038754 3300046457 Bacteria 1662
530 Ga0495629_0473373 3300046459 Bacteria 847
531 Ga0495638_0182573 3300046460 Bacteria 1196
532 Ga0495638_0243303 3300046460 Bacteria 995
533 Ga0495651_0016759 3300046462 Bacteria 5676
534 Ga0495580_0106199 3300046472 Bacteria 1951
535 Ga0495605_0186327 3300046474 Bacteria 910
536 Ga0495639_0076640 3300046475 Bacteria 1551
537 Ga0495639_0078937 3300046475 Bacteria 1530
538 Ga0495664_0162528 3300046477 Bacteria 1355
539 Ga0495584_0063036 3300046491 Bacteria 1863
540 Ga0495584_0274249 3300046491 Bacteria 857
541 Ga0495584_0336603 3300046491 Bacteria 766
542 Ga0495585_0019464 3300046492 Bacteria 3913
543 Ga0495585_0164826 3300046492 Bacteria 1148
544 Ga0495594_0298837 3300046499 Bacteria 917
545 Ga0495596_0036720 3300046500 Bacteria 1940
546 Ga0495607_0182961 3300046501 Bacteria 1049
547 Ga0495620_0086193 3300046515 Bacteria 1265
548 Ga0495643_0039389 3300046522 Bacteria 2585
549 Ga0495644_0090437 3300046523 Bacteria 1155
550 Ga0495644_0145615 3300046523 Bacteria 905
551 Ga0495648_0219814 3300046524 Bacteria 937
552 Ga0495663_0037812 3300046525 Bacteria 1457
553 Ga0495666_0054648 3300046526 Bacteria 1915
554 Ga0495654_0092055 3300046530 Bacteria 1406
555 Ga0495598_0004565 3300046537 Bacteria 3008
556 Ga0495598_0004693 3300046537 Bacteria 2978
557 Ga0495598_0019118 3300046537 Bacteria 1791
558 Ga0495621_0009869 3300046539 Bacteria 2913
559 Ga0495597_0179144 3300046542 Bacteria 857
560 Ga0495622_0015323 3300046557 Bacteria 3564
561 Ga0495622_0036962 3300046557 Bacteria 2275
562 Ga0495656_0007640 3300046615 Bacteria 3831
563 Ga0495656_0060480 3300046615 Bacteria 1651
564 Ga0495656_0091525 3300046615 Bacteria 1391
565 Ga0495656_0211994 3300046615 Bacteria 965
566 Ga0495668_0030525 3300046616 Bacteria 3042
567 Ga0495668_0066743 3300046616 Bacteria 1979
568 Ga0495668_0303940 3300046616 Bacteria 875
569 Ga0495611_0048349 3300046648 Bacteria 1911
570 Ga0495625_0115314 3300046660 Bacteria 1833
571 Ga0495625_0162019 3300046660 Bacteria 1498
572 Ga0495588_0049033 3300046674 Bacteria 2170
573 Ga0495647_0284000 3300046681 Bacteria 743
574 Ga0495613_0455745 3300046689 Bacteria 866
575 Ga0495624_0116002 3300046690 Bacteria 1646
576 Ga0495670_0100193 3300046691 Bacteria 1491
577 Ga0495670_0121937 3300046691 Bacteria 1354
578 Ga0495589_0028532 3300046794 Bacteria 2816
579 Ga0495600_0662466 3300046809 Bacteria 630
580 Ga0495581_0261150 3300047315 Bacteria 1013
581 Ga0495636_0011302 3300047318 Bacteria 3533
582 Ga0495636_0064953 3300047318 Bacteria 1549
583 Ga0495672_0044747 3300047320 Bacteria 2653
584 Ga0495680_0035877 3300047322 Bacteria 3988
585 Ga0495677_0042356 3300047445 Bacteria 1668
586 Ga0495673_0064792 3300047469 Bacteria 1553
587 Ga0495686_0086805 3300047472 Bacteria 1904
588 Ga0495614_0332308 3300048089 Bacteria 706
589 Ga0495626_0133456 3300048091 Bacteria 1058
590 Ga0496100_0056515 3300048903 Bacteria 2568
591 Ga0496100_0317561 3300048903 Bacteria 1169
592 Ga0496101_0040142 3300048904 Bacteria 3333
593 Ga0496101_0188718 3300048904 Bacteria 1590
594 Ga0496102_0006184 3300048905 Bacteria 10206
595 Ga0496102_0055839 3300048905 Bacteria 3601
596 Ga0496102_0102484 3300048905 Bacteria 2661
597 Ga0496102_0107367 3300048905 Bacteria 2599
598 Ga0496103_0006862 3300048906 Bacteria 6799
599 Ga0496104_0182611 3300048907 Bacteria 2008
600 Ga0496105_0015812 3300048908 Bacteria 6019
601 Ga0496106_0002146 3300048909 Bacteria 14733
602 Ga0496106_0009940 3300048909 Bacteria 7024
603 Ga0496106_0112826 3300048909 Bacteria 2118
604 Ga0496106_0151221 3300048909 Bacteria 1831
605 Ga0496106_0255960 3300048909 Bacteria 1400
606 Ga0496107_0026018 3300048910 Bacteria 4146
607 Ga0496107_0192009 3300048910 Bacteria 1517
608 Ga0496108_0024899 3300048911 Bacteria 4929
609 Ga0496108_0054602 3300048911 Bacteria 3353
610 Ga0496109_0010481 3300048912 Bacteria 7919
611 Ga0496109_0016308 3300048912 Bacteria 6493
612 Ga0496109_0705350 3300048912 Bacteria 946
613 Ga0496110_0033478 3300048913 Bacteria 4445
614 Ga0496111_0011084 3300048914 Bacteria 6067
615 Ga0496111_0024988 3300048914 Bacteria 4213
616 Ga0496112_0000022 3300048915 Bacteria 156255
617 Ga0496112_0008650 3300048915 Bacteria 9128
618 Ga0496112_0008856 3300048915 Bacteria 9029
619 Ga0496113_0012773 3300048916 Bacteria 5658
620 Ga0496113_0144243 3300048916 Bacteria 1875
621 Ga0496113_0253076 3300048916 Bacteria 1406
622 Ga0496113_0299625 3300048916 Bacteria 1287
623 Ga0496114_0018024 3300048917 Bacteria 5704
624 Ga0496114_0025976 3300048917 Bacteria 4791
625 Ga0496114_0583679 3300048917 Bacteria 986
626 Ga0496115_0015540 3300048918 Bacteria 5776
627 Ga0496115_0076300 3300048918 Bacteria 2724
628 Ga0496115_0136545 3300048918 Bacteria 2022
629 Ga0496116_0133859 3300048919 Bacteria 1408
630 Ga0496117_0072389 3300048920 Bacteria 2304
631 Ga0496117_0090274 3300048920 Bacteria 1975
632 Ga0496117_0113366 3300048920 Bacteria 1684
633 Ga0496118_0006640 3300048921 Bacteria 12631
634 Ga0496118_0031958 3300048921 Bacteria 4348
635 Ga0496118_0173273 3300048921 Bacteria 1315
636 Ga0496118_0189289 3300048921 Bacteria 1233
637 Ga0496119_0154557 3300048922 Bacteria 1226
638 Ga0496119_0276498 3300048922 Bacteria 837
639 Ga0496120_0106206 3300048923 Bacteria 1475
640 Ga0496121_0000146 3300048924 Bacteria 154459
641 Ga0496121_0000254 3300048924 Bacteria 113314
642 Ga0496121_0012395 3300048924 Bacteria 9307
643 Ga0496121_0027341 3300048924 Bacteria 5339
644 Ga0496121_0036689 3300048924 Bacteria 4364
645 Ga0496121_0101064 3300048924 Bacteria 2225
646 Ga0496121_0121575 3300048924 Bacteria 1971
647 Ga0496121_0201148 3300048924 Bacteria 1420
648 Ga0496122_0044528 3300048925 Bacteria 3461
649 Ga0496124_0001236 3300048927 Bacteria 39269
650 Ga0496124_0021839 3300048927 Bacteria 5887
651 Ga0496124_0115446 3300048927 Bacteria 2154
652 Ga0496124_0235348 3300048927 Bacteria 1366
653 Ga0496125_0000099 3300048928 Bacteria 203333
654 Ga0496125_0002791 3300048928 Bacteria 22081
655 Ga0496125_0013848 3300048928 Bacteria 7895
656 Ga0496125_0196049 3300048928 Bacteria 1328
657 Ga0496125_0262094 3300048928 Bacteria 1082
658 Ga0496126_0013383 3300048929 Bacteria 8350
659 Ga0496126_0031094 3300048929 Bacteria 5048
660 Ga0496126_0080959 3300048929 Bacteria 2872
661 Ga0496126_0094722 3300048929 Bacteria 2620
662 Ga0496126_0114563 3300048929 Bacteria 2345
663 Ga0496126_0141195 3300048929 Bacteria 2073
664 Ga0496126_0186516 3300048929 Bacteria 1759
665 Ga0496126_0502682 3300048929 Bacteria 968
666 Ga0496126_0534551 3300048929 Bacteria 932
667 Ga0495678_065081 3300049459 Bacteria 1355
668 Ga0501036_0722202 3300049572 Unclassified 823
669 Ga0501039_0728620 3300049575 Bacteria 775
670 Ga0501073_0534933 3300049589 Bacteria 810
671 Ga0501044_0177873 3300049823 Bacteria 2096
672 nmdc:mga03683_140166_c1 3300050489 Bacteria 1087
673 nmdc:mga03683_171936_c1 3300050489 Bacteria 985
674 nmdc:mga03n38_50524_c1 3300050490 Bacteria 1854
675 nmdc:mga00v17_79997_c1 3300050491 Bacteria 1008
676 nmdc:mga0yw44_102000_c1 3300050492 Bacteria 1829
677 nmdc:mga0yw44_185192_c1 3300050492 Bacteria 1372
678 nmdc:mga0yw44_228152_c1 3300050492 Bacteria 1236
679 nmdc:mga0yw44_47938_c1 3300050492 Bacteria 2574
680 nmdc:mga06z11_2940_c1 3300050494 Bacteria 6558
681 nmdc:mga06z11_335727_c1 3300050494 Bacteria 903
682 nmdc:mga04h51_45179_c1 3300050495 Bacteria 1456
683 nmdc:mga07m45_105530_c1 3300050496 Bacteria 1621
684 nmdc:mga07m45_45718_c1 3300050496 Bacteria 2458
685 nmdc:mga07m45_66878_c1 3300050496 Bacteria 2042
686 nmdc:mga05p37_57183_c1 3300050507 Bacteria 4803
687 nmdc:mga0n895_206416_c1 3300050512 Bacteria 1995
688 nmdc:mga0n895_61527_c1 3300050512 Bacteria 3707
689 nmdc:mga0n895_806596_c1 3300050512 Bacteria 929
690 nmdc:mga0rr50_423583_c1 3300050513 Bacteria 1126
691 nmdc:mga0a205_333403_c1 3300050515 Bacteria 1386
692 nmdc:mga0sz30_221674_c1 3300050516 Bacteria 841
693 nmdc:mga0sz30_28917_c2 3300050516 Bacteria 1506
694 Ga0500635_0000894 3300053080 Bacteria 7242
695 Ga0495655_0029188 3300053083 Bacteria 1324
696 Ga0495595_0004191 3300053084 Bacteria 5799
697 Ga0495619_0195611 3300053085 Bacteria 1400
698 Ga0500644_0184926 3300053088 Bacteria 855
699 Ga0500583_0155906 3300053092 Bacteria 1137
700 Ga0500566_0039553 3300053094 Bacteria 2726
701 Ga0500650_0190306 3300053098 Bacteria 937
702 Ga0500650_0190624 3300053098 Bacteria 936
703 Ga0500554_062200 3300053102 Bacteria 1200
704 Ga0500572_000383 3300053111 Bacteria 15750
705 Ga0500594_0046224 3300053118 Bacteria 1210
706 Ga0500595_000730 3300053119 Bacteria 19558
707 Ga0500595_010244 3300053119 Bacteria 3733
708 Ga0500595_018807 3300053119 Bacteria 2519
709 Ga0500618_012347 3300053125 Bacteria 2238
710 Ga0500642_0044293 3300053130 Bacteria 1937
711 Ga0500642_0224041 3300053130 Bacteria 870
712 Ga0500655_020538 3300053133 Bacteria 1234
713 Ga0500559_0000486 3300053136 Bacteria 28052
714 Ga0500559_0083822 3300053136 Bacteria 1452
715 Ga0500559_0113643 3300053136 Bacteria 1256
716 Ga0500568_0008112 3300053139 Bacteria 5092
717 Ga0500568_0072064 3300053139 Bacteria 1322
718 Ga0500573_0130733 3300053140 Bacteria 1390
719 Ga0500603_000741 3300053150 Bacteria 7961
720 Ga0500603_036444 3300053150 Bacteria 1294
721 Ga0500604_0267764 3300053151 Bacteria 592
722 Ga0500627_0110097 3300053158 Bacteria 1240
723 Ga0500627_0236034 3300053158 Bacteria 812
724 Ga0500638_000379 3300053162 Bacteria 10416
725 Ga0500639_118147 3300053163 Bacteria 1278
726 Ga0500637_0001280 3300053178 Bacteria 10539
727 Ga0500576_065937 3300053725 Bacteria 1570
728 Ga0500645_066633 3300053730 Bacteria 1036
729 Ga0500609_014367 3300053731 Bacteria 1073
730 Ga0500596_000696 3300053735 Bacteria 6550
731 Ga0500661_000550 3300055283 Bacteria 7001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0662466 Ga0495600_0662466_64_570 165
2 3300048089 Ga0495614_0332308 Ga0495614_0332308_20_526 165
3 3300028380 Ga0268265_10491556 Ga0268265_104915562 169
4 3300053151 Ga0500604_0267764 Ga0500604_0267764_61_576 170
5 3300031235 Ga0265330_10037350 Ga0265330_100373501 174
6 3300031238 Ga0265332_10011294 Ga0265332_100112945 174
7 3300031241 Ga0265325_10012010 Ga0265325_100120104 174
8 3300031250 Ga0265331_10036612 Ga0265331_100366123 174
9 3300031712 Ga0265342_10045287 Ga0265342_100452872 174
10 3300005331 Ga0070670_100151800 Ga0070670_1001518002 183
11 3300005367 Ga0070667_100316757 Ga0070667_1003167572 183
12 3300005617 Ga0068859_100217700 Ga0068859_1002177003 183
13 3300005618 Ga0068864_100086324 Ga0068864_1000863242 183
14 3300005842 Ga0068858_100133876 Ga0068858_1001338763 183
15 3300006931 Ga0097620_100217712 Ga0097620_1002177123 183
16 3300009098 Ga0105245_11171872 Ga0105245_111718722 183
17 3300013308 Ga0157375_11613687 Ga0157375_116136871 183
18 3300025927 Ga0207687_10815748 Ga0207687_108157481 183
19 3300026035 Ga0207703_10508128 Ga0207703_105081282 183
20 3300026095 Ga0207676_10119335 Ga0207676_101193352 183
21 3300026118 Ga0207675_100333972 Ga0207675_1003339721 183
22 3300026067 Ga0207678_10011560 Ga0207678_100115602 185
23 3300031731 Ga0307405_10014534 Ga0307405_100145346 200
24 3300032004 Ga0307414_10333713 Ga0307414_103337132 200
25 3300005438 Ga0070701_10111907 Ga0070701_101119071 201
26 3300005455 Ga0070663_100371471 Ga0070663_1003714711 201
27 3300032005 Ga0307411_10115547 Ga0307411_101155472 201
28 3300048905 Ga0496102_0102484 Ga0496102_0102484_543_1190 201
29 3300005336 Ga0070680_100202121 Ga0070680_1002021212 202
30 3300005458 Ga0070681_10535506 Ga0070681_105355061 202
31 3300025912 Ga0207707_10050125 Ga0207707_100501254 202
32 3300025917 Ga0207660_10546688 Ga0207660_105466881 202
33 3300049575 Ga0501039_0728620 Ga0501039_0728620_55_690 202
34 3300049823 Ga0501044_0177873 Ga0501044_0177873_725_1360 202
35 3300005471 Ga0070698_100624788 Ga0070698_1006247881 203
36 3300005549 Ga0070704_100017490 Ga0070704_1000174907 203
37 3300005617 Ga0068859_100151549 Ga0068859_1001515492 203
38 3300006931 Ga0097620_100151548 Ga0097620_1001515482 203
39 3300013297 Ga0157378_10019128 Ga0157378_100191285 204
40 3300005331 Ga0070670_100263660 Ga0070670_1002636601 206
41 3300005618 Ga0068864_100024533 Ga0068864_1000245336 206
42 3300005841 Ga0068863_100015678 Ga0068863_1000156785 206
43 3300009553 Ga0105249_10052668 Ga0105249_100526684 206
44 3300025925 Ga0207650_10251201 Ga0207650_102512013 206
45 3300025926 Ga0207659_10312598 Ga0207659_103125982 206
46 3300025961 Ga0207712_10204638 Ga0207712_102046383 206
47 3300026088 Ga0207641_10037960 Ga0207641_100379605 206
48 3300026095 Ga0207676_10019011 Ga0207676_100190113 206
49 3300028380 Ga0268265_10072063 Ga0268265_100720633 206
50 3300037068 Ga0373925_0594519 Ga0373925_0594519_102_731 206
51 3300046499 Ga0495594_0298837 Ga0495594_0298837_241_870 206
52 3300046689 Ga0495613_0455745 Ga0495613_0455745_162_791 206
53 3300047322 Ga0495680_0035877 Ga0495680_0035877_2564_3193 206
54 3300003316 rootH1_10063808 rootH1_100638082 207
55 3300003323 rootH1_10046565 rootH1_100465653 207
56 3300005547 Ga0070693_100416569 Ga0070693_1004165691 207
57 3300005843 Ga0068860_100000441 Ga0068860_1000004419 207
58 3300006871 Ga0075434_100013575 Ga0075434_1000135752 207
59 3300007076 Ga0075435_100086681 Ga0075435_1000866813 207
60 3300009098 Ga0105245_10082796 Ga0105245_100827963 207
61 3300021361 Ga0213872_10089598 Ga0213872_100895981 207
62 3300025303 Ga0209051_1003827 Ga0209051_10038273 207
63 3300025927 Ga0207687_10102900 Ga0207687_101029002 207
64 3300028381 Ga0268264_10000042 Ga0268264_1000004258 207
65 3300031507 Ga0307509_10224214 Ga0307509_102242142 207
66 3300039447 Ga0436361_0629207 Ga0436361_0629207_4437_5069 207
67 3300039447 Ga0436361_1049914 Ga0436361_1049914_4131_4763 207
68 3300045051 Ga0451576_0496485 Ga0451576_0496485_73_705 207
69 3300046681 Ga0495647_0284000 Ga0495647_0284000_32_664 207
70 3300048927 Ga0496124_0235348 Ga0496124_0235348_550_1179 207
71 iso_pu_bacteria 2513237096 2513655415 207
72 iso_pu_bacteria 2513237137 2513860021 207
73 iso_pu_bacteria 2513237145 2513916507 207
74 iso_pu_bacteria 2517572143 2517889902 207
75 iso_pu_bacteria 2524023210 2524470519 207
76 iso_pu_bacteria 2667528175 2671121074 207
77 iso_pu_bacteria 2728368998 2728751700 207
78 iso_pu_bacteria 2791355197 2793068150 207
79 iso_pu_bacteria 2885374607 2885379430 207
80 iso_pu_bacteria 2903748898 2903750749 207
81 iso_pu_bacteria 2904690495 2904692660 207
82 iso_pu_bacteria 2906610324 2906612360 207
83 iso_pu_bacteria 2906635258 2906638314 207
84 iso_pu_bacteria 2906660503 2906663401 207
85 iso_pu_bacteria 2908739725 2908739767 207
86 iso_pu_bacteria 2908756301 2908757872 207
87 iso_pu_bacteria 2922425934 2922426935 207
88 iso_pu_bacteria 2935630451 2935633094 207
89 iso_pu_bacteria 2941507105 2941509604 207
90 iso_pu_bacteria 2941515067 2941517433 207
91 iso_pu_bacteria 2941523033 2941526614 207
92 iso_pu_bacteria 3005474847 3005476119 207
93 iso_pu_bacteria 8006933436 8006937433 207
94 iso_pu_bacteria 8006973647 8006977462 207
95 iso_pu_bacteria 8019555841 8019561192 207
96 iso_pu_bacteria 8019565922 8019571282 207
97 iso_pu_bacteria 8056681323 8056685981 207
98 3300005328 Ga0070676_10001300 Ga0070676_100013002 208
99 3300005330 Ga0070690_100613710 Ga0070690_1006137102 208
100 3300005331 Ga0070670_100289949 Ga0070670_1002899491 208
101 3300005333 Ga0070677_10003729 Ga0070677_100037292 208
102 3300005334 Ga0068869_100006393 Ga0068869_10000639310 208
103 3300005335 Ga0070666_10001057 Ga0070666_1000105716 208
104 3300005338 Ga0068868_100013250 Ga0068868_1000132502 208
105 3300005347 Ga0070668_100004548 Ga0070668_1000045482 208
106 3300005347 Ga0070668_100185959 Ga0070668_1001859592 208
107 3300005347 Ga0070668_100253439 Ga0070668_1002534392 208
108 3300005347 Ga0070668_100321353 Ga0070668_1003213532 208
109 3300005347 Ga0070668_100592773 Ga0070668_1005927732 208
110 3300005353 Ga0070669_100009203 Ga0070669_1000092036 208
111 3300005354 Ga0070675_100001972 Ga0070675_10000197214 208
112 3300005355 Ga0070671_100001035 Ga0070671_10000103517 208
113 3300005356 Ga0070674_100001310 Ga0070674_10000131013 208
114 3300005364 Ga0070673_100001352 Ga0070673_10000135216 208
115 3300005366 Ga0070659_100273058 Ga0070659_1002730582 208
116 3300005367 Ga0070667_100002933 Ga0070667_10000293311 208
117 3300005367 Ga0070667_100439515 Ga0070667_1004395152 208
118 3300005455 Ga0070663_100034595 Ga0070663_1000345953 208
119 3300005456 Ga0070678_100001003 Ga0070678_1000010035 208
120 3300005456 Ga0070678_100311781 Ga0070678_1003117811 208
121 3300005459 Ga0068867_100010975 Ga0068867_1000109752 208
122 3300005539 Ga0068853_100016152 Ga0068853_1000161522 208
123 3300005543 Ga0070672_100004801 Ga0070672_1000048017 208
124 3300005548 Ga0070665_100038313 Ga0070665_1000383132 208
125 3300005548 Ga0070665_100418625 Ga0070665_1004186252 208
126 3300005564 Ga0070664_100445627 Ga0070664_1004456272 208
127 3300005615 Ga0070702_100269726 Ga0070702_1002697261 208
128 3300005615 Ga0070702_100391619 Ga0070702_1003916191 208
129 3300005616 Ga0068852_100001098 Ga0068852_1000010988 208
130 3300005618 Ga0068864_100031446 Ga0068864_1000314465 208
131 3300005618 Ga0068864_100227737 Ga0068864_1002277372 208
132 3300005834 Ga0068851_10000852 Ga0068851_100008522 208
133 3300005840 Ga0068870_10007499 Ga0068870_100074995 208
134 3300005842 Ga0068858_100234024 Ga0068858_1002340242 208
135 3300005843 Ga0068860_100006265 Ga0068860_1000062658 208
136 3300006038 Ga0075365_10189448 Ga0075365_101894482 208
137 3300006038 Ga0075365_10273506 Ga0075365_102735062 208
138 3300006042 Ga0075368_10009758 Ga0075368_100097582 208
139 3300006048 Ga0075363_100001726 Ga0075363_1000017262 208
140 3300006177 Ga0075362_10172111 Ga0075362_101721112 208
141 3300006178 Ga0075367_10074104 Ga0075367_100741042 208
142 3300006237 Ga0097621_100072169 Ga0097621_1000721695 208
143 3300006353 Ga0075370_10056009 Ga0075370_100560092 208
144 3300006353 Ga0075370_10106289 Ga0075370_101062892 208
145 3300006358 Ga0068871_100017539 Ga0068871_1000175392 208
146 3300006844 Ga0075428_100051259 Ga0075428_1000512596 208
147 3300006871 Ga0075434_100375451 Ga0075434_1003754512 208
148 3300006871 Ga0075434_100922435 Ga0075434_1009224351 208
149 3300009101 Ga0105247_10338387 Ga0105247_103383871 208
150 3300009174 Ga0105241_10414686 Ga0105241_104146861 208
151 3300011119 Ga0105246_10191870 Ga0105246_101918702 208
152 3300013296 Ga0157374_10074206 Ga0157374_100742062 208
153 3300013306 Ga0163162_10206640 Ga0163162_102066402 208
154 3300013306 Ga0163162_10968636 Ga0163162_109686362 208
155 3300013308 Ga0157375_10003835 Ga0157375_100038356 208
156 3300013308 Ga0157375_10242492 Ga0157375_102424923 208
157 3300013308 Ga0157375_10271555 Ga0157375_102715552 208
158 3300014325 Ga0163163_10339241 Ga0163163_103392412 208
159 3300014969 Ga0157376_10038264 Ga0157376_100382642 208
160 3300025321 Ga0207656_10017624 Ga0207656_100176242 208
161 3300025893 Ga0207682_10000243 Ga0207682_100002432 208
162 3300025901 Ga0207688_10042147 Ga0207688_100421471 208
163 3300025907 Ga0207645_10000045 Ga0207645_1000004517 208
164 3300025908 Ga0207643_10012247 Ga0207643_100122475 208
165 3300025923 Ga0207681_10023123 Ga0207681_100231231 208
166 3300025925 Ga0207650_10245564 Ga0207650_102455641 208
167 3300025926 Ga0207659_10029878 Ga0207659_100298783 208
168 3300025931 Ga0207644_10119886 Ga0207644_101198862 208
169 3300025933 Ga0207706_10144647 Ga0207706_101446474 208
170 3300025937 Ga0207669_10016576 Ga0207669_100165763 208
171 3300025940 Ga0207691_10000452 Ga0207691_1000045227 208
172 3300025942 Ga0207689_10305825 Ga0207689_103058252 208
173 3300025945 Ga0207679_10446928 Ga0207679_104469282 208
174 3300025960 Ga0207651_10060266 Ga0207651_100602662 208
175 3300025972 Ga0207668_10036661 Ga0207668_100366613 208
176 3300025972 Ga0207668_10085658 Ga0207668_100856582 208
177 3300025986 Ga0207658_10010640 Ga0207658_100106402 208
178 3300025986 Ga0207658_10125546 Ga0207658_101255462 208
179 3300026023 Ga0207677_10225264 Ga0207677_102252642 208
180 3300026023 Ga0207677_10508390 Ga0207677_105083902 208
181 3300026041 Ga0207639_10047484 Ga0207639_100474842 208
182 3300026067 Ga0207678_10048025 Ga0207678_100480252 208
183 3300026088 Ga0207641_10883131 Ga0207641_108831311 208
184 3300026089 Ga0207648_10009278 Ga0207648_100092786 208
185 3300026095 Ga0207676_10063106 Ga0207676_100631062 208
186 3300026095 Ga0207676_10574965 Ga0207676_105749651 208
187 3300026118 Ga0207675_100183530 Ga0207675_1001835302 208
188 3300026121 Ga0207683_10000003 Ga0207683_1000000382 208
189 3300026121 Ga0207683_10282643 Ga0207683_102826432 208
190 3300026142 Ga0207698_10191598 Ga0207698_101915982 208
191 3300028379 Ga0268266_10009316 Ga0268266_100093163 208
192 3300028379 Ga0268266_10013890 Ga0268266_100138906 208
193 3300028381 Ga0268264_10025888 Ga0268264_100258884 208
194 3300031548 Ga0307408_100002235 Ga0307408_10000223510 208
195 3300031731 Ga0307405_10044058 Ga0307405_100440582 208
196 3300031824 Ga0307413_10005415 Ga0307413_100054157 208
197 3300031901 Ga0307406_10019997 Ga0307406_100199976 208
198 3300031903 Ga0307407_10004562 Ga0307407_100045622 208
199 3300031911 Ga0307412_10022144 Ga0307412_100221442 208
200 3300032002 Ga0307416_100005572 Ga0307416_1000055727 208
201 3300032002 Ga0307416_100535872 Ga0307416_1005358722 208
202 3300032005 Ga0307411_10239180 Ga0307411_102391802 208
203 3300032126 Ga0307415_100156380 Ga0307415_1001563802 208
204 3300042876 Ga0451577_0610604 Ga0451577_0610604_334_963 208
205 3300042876 Ga0451577_0775739 Ga0451577_0775739_68_697 208
206 3300044683 Ga0466965_0019706 Ga0466965_0019706_1464_2099 208
207 3300044712 Ga0453684_0076227 Ga0453684_0076227_1971_2600 208
208 3300044712 Ga0453684_0099213 Ga0453684_0099213_2189_2818 208
209 3300044735 Ga0466968_0105687 Ga0466968_0105687_443_1078 208
210 3300046452 Ga0495617_058697 Ga0495617_058697_450_1094 208
211 3300046491 Ga0495584_0063036 Ga0495584_0063036_601_1245 208
212 3300046660 Ga0495625_0115314 Ga0495625_0115314_633_1277 208
213 3300048907 Ga0496104_0182611 Ga0496104_0182611_389_1030 208
214 3300048916 Ga0496113_0299625 Ga0496113_0299625_318_959 208
215 3300048918 Ga0496115_0136545 Ga0496115_0136545_735_1376 208
216 3300049572 Ga0501036_0722202 Ga0501036_0722202_99_728 208
217 3300050490 nmdc:mga03n38_50524_c1 nmdc:mga03n38_50524_c1_976_1617 208
218 3300050492 nmdc:mga0yw44_102000_c1 nmdc:mga0yw44_102000_c1_237_878 208
219 3300050492 nmdc:mga0yw44_47938_c1 nmdc:mga0yw44_47938_c1_52_696 208
220 3300050494 nmdc:mga06z11_2940_c1 nmdc:mga06z11_2940_c1_4033_4674 208
221 3300050496 nmdc:mga07m45_105530_c1 nmdc:mga07m45_105530_c1_306_947 208
222 3300050496 nmdc:mga07m45_66878_c1 nmdc:mga07m45_66878_c1_391_1035 208
223 3300050512 nmdc:mga0n895_206416_c1 nmdc:mga0n895_206416_c1_788_1429 208
224 3300053098 Ga0500650_0190306 Ga0500650_0190306_275_916 208
225 iso_pu_bacteria 8006984368 8006986206 208
226 3300005436 Ga0070713_100040144 Ga0070713_1000401442 209
227 3300005842 Ga0068858_100056847 Ga0068858_1000568472 209
228 3300009101 Ga0105247_10027309 Ga0105247_100273093 209
229 3300025906 Ga0207699_10060197 Ga0207699_100601973 209
230 3300025914 Ga0207671_10322646 Ga0207671_103226462 209
231 3300025928 Ga0207700_10126299 Ga0207700_101262992 209
232 3300048929 Ga0496126_0502682 Ga0496126_0502682_166_798 209
233 iso_pu_bacteria 2513237098 2513672485 209
234 iso_pu_bacteria 2885383462 2885388233 209
235 3300005456 Ga0070678_100450918 Ga0070678_1004509181 210
236 3300009551 Ga0105238_10042360 Ga0105238_100423602 210
237 3300010375 Ga0105239_10025843 Ga0105239_100258432 210
238 3300014325 Ga0163163_10798352 Ga0163163_107983522 210
239 3300025924 Ga0207694_10037563 Ga0207694_100375632 210
240 3300026121 Ga0207683_10694538 Ga0207683_106945381 210
241 3300031247 Ga0265340_10005142 Ga0265340_100051427 210
242 3300031344 Ga0265316_10229073 Ga0265316_102290732 210
243 3300032126 Ga0307415_100156458 Ga0307415_1001564582 210
244 3300035086 Ga0373934_0049906 Ga0373934_0049906_438_1073 210
245 3300035695 Ga0373927_0027614 Ga0373927_0027614_1471_2106 210
246 3300035725 Ga0373947_0061128 Ga0373947_0061128_1285_1920 210
247 3300046462 Ga0495651_0016759 Ga0495651_0016759_3154_3801 210
248 3300048921 Ga0496118_0189289 Ga0496118_0189289_484_1128 210
249 3300048923 Ga0496120_0106206 Ga0496120_0106206_70_732 210
250 3300048925 Ga0496122_0044528 Ga0496122_0044528_2429_3064 210
251 3300048927 Ga0496124_0115446 Ga0496124_0115446_741_1385 210
252 3300048928 Ga0496125_0000099 Ga0496125_0000099_45847_46509 210
253 3300048928 Ga0496125_0002791 Ga0496125_0002791_14587_15222 210
254 3300048928 Ga0496125_0262094 Ga0496125_0262094_115_759 210
255 3300048929 Ga0496126_0031094 Ga0496126_0031094_2711_3346 210
256 3300053111 Ga0500572_000383 Ga0500572_000383_6762_7400 210
257 3300053136 Ga0500559_0000486 Ga0500559_0000486_11147_11785 210
258 3300053163 Ga0500639_118147 Ga0500639_118147_56_694 210
259 3300053725 Ga0500576_065937 Ga0500576_065937_330_968 210
260 iso_pu_bacteria 2513237101 2513697533 210
261 iso_pu_bacteria 2791355199 2793078546 210
262 iso_pu_bacteria 2874604998 2874606732 210
263 iso_pu_bacteria 2889033259 2889034132 210
264 iso_pu_bacteria 2903768456 2903774576 210
265 iso_pu_bacteria 2922361189 2922367530 210
266 iso_pu_bacteria 2922386360 2922391505 210
267 iso_pu_bacteria 8056673599 8056678859 210
268 3300003203 JGI25406J46586_10000118 JGI25406J46586_1000011811 211
269 3300003203 JGI25406J46586_10007912 JGI25406J46586_100079123 211
270 3300003215 JGI25153J46596_10013940 JGI25153J46596_100139401 211
271 3300003323 rootH1_10341204 rootH1_103412042 211
272 3300003659 JGI25404J52841_10006748 JGI25404J52841_100067482 211
273 3300003659 JGI25404J52841_10018718 JGI25404J52841_100187182 211
274 3300003659 JGI25404J52841_10035704 JGI25404J52841_100357041 211
275 3300003911 JGI25405J52794_10002640 JGI25405J52794_100026402 211
276 3300005328 Ga0070676_10084486 Ga0070676_100844862 211
277 3300005329 Ga0070683_100373843 Ga0070683_1003738431 211
278 3300005331 Ga0070670_100460507 Ga0070670_1004605071 211
279 3300005334 Ga0068869_100044270 Ga0068869_1000442703 211
280 3300005334 Ga0068869_100301500 Ga0068869_1003015002 211
281 3300005335 Ga0070666_10593548 Ga0070666_105935481 211
282 3300005338 Ga0068868_100021214 Ga0068868_1000212144 211
283 3300005338 Ga0068868_100051092 Ga0068868_1000510923 211
284 3300005338 Ga0068868_100420164 Ga0068868_1004201641 211
285 3300005339 Ga0070660_100122715 Ga0070660_1001227153 211
286 3300005340 Ga0070689_100248302 Ga0070689_1002483022 211
287 3300005343 Ga0070687_100444505 Ga0070687_1004445051 211
288 3300005344 Ga0070661_100186210 Ga0070661_1001862102 211
289 3300005347 Ga0070668_100028324 Ga0070668_1000283242 211
290 3300005347 Ga0070668_100190092 Ga0070668_1001900921 211
291 3300005347 Ga0070668_100295341 Ga0070668_1002953412 211
292 3300005347 Ga0070668_100353994 Ga0070668_1003539941 211
293 3300005353 Ga0070669_100242431 Ga0070669_1002424311 211
294 3300005353 Ga0070669_100267094 Ga0070669_1002670942 211
295 3300005355 Ga0070671_100049679 Ga0070671_1000496792 211
296 3300005355 Ga0070671_100845689 Ga0070671_1008456891 211
297 3300005364 Ga0070673_100476928 Ga0070673_1004769281 211
298 3300005366 Ga0070659_100091560 Ga0070659_1000915602 211
299 3300005366 Ga0070659_100282229 Ga0070659_1002822292 211
300 3300005367 Ga0070667_100516654 Ga0070667_1005166541 211
301 3300005367 Ga0070667_100522228 Ga0070667_1005222281 211
302 3300005437 Ga0070710_10300917 Ga0070710_103009172 211
303 3300005441 Ga0070700_100100500 Ga0070700_1001005001 211
304 3300005441 Ga0070700_100171527 Ga0070700_1001715272 211
305 3300005455 Ga0070663_100007686 Ga0070663_1000076862 211
306 3300005455 Ga0070663_100033040 Ga0070663_1000330402 211
307 3300005455 Ga0070663_100125533 Ga0070663_1001255332 211
308 3300005455 Ga0070663_100176076 Ga0070663_1001760762 211
309 3300005456 Ga0070678_100014577 Ga0070678_1000145772 211
310 3300005456 Ga0070678_100138931 Ga0070678_1001389311 211
311 3300005456 Ga0070678_100176810 Ga0070678_1001768102 211
312 3300005456 Ga0070678_100227783 Ga0070678_1002277832 211
313 3300005457 Ga0070662_100146530 Ga0070662_1001465302 211
314 3300005459 Ga0068867_100037083 Ga0068867_1000370832 211
315 3300005459 Ga0068867_100135545 Ga0068867_1001355452 211
316 3300005459 Ga0068867_100793598 Ga0068867_1007935981 211
317 3300005466 Ga0070685_10061983 Ga0070685_100619831 211
318 3300005466 Ga0070685_10286807 Ga0070685_102868072 211
319 3300005471 Ga0070698_100142039 Ga0070698_1001420392 211
320 3300005518 Ga0070699_100488680 Ga0070699_1004886801 211
321 3300005535 Ga0070684_100056843 Ga0070684_1000568432 211
322 3300005539 Ga0068853_100115628 Ga0068853_1001156283 211
323 3300005543 Ga0070672_100199132 Ga0070672_1001991322 211
324 3300005544 Ga0070686_100060417 Ga0070686_1000604172 211
325 3300005544 Ga0070686_100095240 Ga0070686_1000952402 211
326 3300005544 Ga0070686_100168594 Ga0070686_1001685942 211
327 3300005548 Ga0070665_100015092 Ga0070665_1000150922 211
328 3300005548 Ga0070665_100111611 Ga0070665_1001116112 211
329 3300005548 Ga0070665_100125570 Ga0070665_1001255702 211
330 3300005563 Ga0068855_100036624 Ga0068855_1000366246 211
331 3300005578 Ga0068854_100691293 Ga0068854_1006912932 211
332 3300005614 Ga0068856_100142783 Ga0068856_1001427832 211
333 3300005615 Ga0070702_100020928 Ga0070702_1000209283 211
334 3300005615 Ga0070702_100207577 Ga0070702_1002075771 211
335 3300005616 Ga0068852_100052442 Ga0068852_1000524422 211
336 3300005616 Ga0068852_100054448 Ga0068852_1000544482 211
337 3300005616 Ga0068852_100373304 Ga0068852_1003733042 211
338 3300005617 Ga0068859_100048748 Ga0068859_1000487482 211
339 3300005617 Ga0068859_100167592 Ga0068859_1001675922 211
340 3300005617 Ga0068859_100578577 Ga0068859_1005785772 211
341 3300005618 Ga0068864_100033384 Ga0068864_1000333844 211
342 3300005718 Ga0068866_10052283 Ga0068866_100522832 211
343 3300005718 Ga0068866_10117677 Ga0068866_101176772 211
344 3300005719 Ga0068861_100074575 Ga0068861_1000745752 211
345 3300005719 Ga0068861_100172531 Ga0068861_1001725311 211
346 3300005841 Ga0068863_100196706 Ga0068863_1001967063 211
347 3300005841 Ga0068863_100274055 Ga0068863_1002740551 211
348 3300005841 Ga0068863_100672786 Ga0068863_1006727862 211
349 3300005842 Ga0068858_100154554 Ga0068858_1001545542 211
350 3300005842 Ga0068858_100286387 Ga0068858_1002863872 211
351 3300005842 Ga0068858_100478475 Ga0068858_1004784751 211
352 3300005842 Ga0068858_100652142 Ga0068858_1006521421 211
353 3300005842 Ga0068858_100723654 Ga0068858_1007236542 211
354 3300005843 Ga0068860_100122368 Ga0068860_1001223682 211
355 3300005843 Ga0068860_100330277 Ga0068860_1003302772 211
356 3300005844 Ga0068862_100053367 Ga0068862_1000533673 211
357 3300005844 Ga0068862_100083397 Ga0068862_1000833972 211
358 3300005844 Ga0068862_100179877 Ga0068862_1001798773 211
359 3300005844 Ga0068862_100210527 Ga0068862_1002105272 211
360 3300005844 Ga0068862_100265761 Ga0068862_1002657612 211
361 3300005937 Ga0081455_10013479 Ga0081455_100134795 211
362 3300005937 Ga0081455_10023557 Ga0081455_100235573 211
363 3300005937 Ga0081455_10041472 Ga0081455_100414724 211
364 3300005937 Ga0081455_10066358 Ga0081455_100663582 211
365 3300005937 Ga0081455_10410493 Ga0081455_104104932 211
366 3300005981 Ga0081538_10018308 Ga0081538_100183082 211
367 3300005983 Ga0081540_1002251 Ga0081540_100225110 211
368 3300005983 Ga0081540_1003941 Ga0081540_10039419 211
369 3300005983 Ga0081540_1004960 Ga0081540_10049606 211
370 3300005983 Ga0081540_1006444 Ga0081540_10064443 211
371 3300005983 Ga0081540_1014502 Ga0081540_10145023 211
372 3300005983 Ga0081540_1046725 Ga0081540_10467252 211
373 3300005985 Ga0081539_10000425 Ga0081539_1000042567 211
374 3300005985 Ga0081539_10001114 Ga0081539_1000111444 211
375 3300005985 Ga0081539_10012644 Ga0081539_100126442 211
376 3300005985 Ga0081539_10018715 Ga0081539_100187153 211
377 3300005985 Ga0081539_10106778 Ga0081539_101067782 211
378 3300006028 Ga0070717_10310303 Ga0070717_103103032 211
379 3300006038 Ga0075365_10111769 Ga0075365_101117693 211
380 3300006038 Ga0075365_10192026 Ga0075365_101920262 211
381 3300006038 Ga0075365_10300082 Ga0075365_103000822 211
382 3300006042 Ga0075368_10029321 Ga0075368_100293211 211
383 3300006051 Ga0075364_10286232 Ga0075364_102862322 211
384 3300006051 Ga0075364_10292558 Ga0075364_102925582 211
385 3300006173 Ga0070716_100221232 Ga0070716_1002212322 211
386 3300006177 Ga0075362_10021395 Ga0075362_100213952 211
387 3300006177 Ga0075362_10106050 Ga0075362_101060502 211
388 3300006177 Ga0075362_10172008 Ga0075362_101720081 211
389 3300006186 Ga0075369_10138245 Ga0075369_101382451 211
390 3300006186 Ga0075369_10148347 Ga0075369_101483471 211
391 3300006195 Ga0075366_10074192 Ga0075366_100741922 211
392 3300006237 Ga0097621_100255131 Ga0097621_1002551312 211
393 3300006353 Ga0075370_10102902 Ga0075370_101029022 211
394 3300006358 Ga0068871_100087537 Ga0068871_1000875372 211
395 3300006358 Ga0068871_100092844 Ga0068871_1000928442 211
396 3300006358 Ga0068871_100208226 Ga0068871_1002082262 211
397 3300006358 Ga0068871_100864221 Ga0068871_1008642211 211
398 3300006844 Ga0075428_100472359 Ga0075428_1004723592 211
399 3300006871 Ga0075434_100178919 Ga0075434_1001789192 211
400 3300006880 Ga0075429_100583237 Ga0075429_1005832372 211
401 3300006881 Ga0068865_100044397 Ga0068865_1000443972 211
402 3300006881 Ga0068865_100051818 Ga0068865_1000518183 211
403 3300006881 Ga0068865_100222558 Ga0068865_1002225582 211
404 3300006881 Ga0068865_100294011 Ga0068865_1002940112 211
405 3300006931 Ga0097620_100048746 Ga0097620_1000487464 211
406 3300006931 Ga0097620_100167594 Ga0097620_1001675942 211
407 3300006931 Ga0097620_100578562 Ga0097620_1005785621 211
408 3300007265 Ga0099794_10062285 Ga0099794_100622852 211
409 3300009093 Ga0105240_10334243 Ga0105240_103342431 211
410 3300009094 Ga0111539_10126858 Ga0111539_101268583 211
411 3300009094 Ga0111539_10255949 Ga0111539_102559492 211
412 3300009098 Ga0105245_10011836 Ga0105245_100118365 211
413 3300009098 Ga0105245_10349267 Ga0105245_103492672 211
414 3300009098 Ga0105245_10899099 Ga0105245_108990991 211
415 3300009101 Ga0105247_10007548 Ga0105247_100075483 211
416 3300009101 Ga0105247_10026077 Ga0105247_100260773 211
417 3300009147 Ga0114129_10527373 Ga0114129_105273731 211
418 3300009148 Ga0105243_10152324 Ga0105243_101523242 211
419 3300009148 Ga0105243_10292936 Ga0105243_102929362 211
420 3300009148 Ga0105243_10522079 Ga0105243_105220791 211
421 3300009174 Ga0105241_10023322 Ga0105241_100233222 211
422 3300009174 Ga0105241_10178089 Ga0105241_101780892 211
423 3300009176 Ga0105242_10034607 Ga0105242_100346074 211
424 3300009176 Ga0105242_10459247 Ga0105242_104592472 211
425 3300009177 Ga0105248_10050803 Ga0105248_100508032 211
426 3300009177 Ga0105248_10221292 Ga0105248_102212922 211
427 3300009177 Ga0105248_10612209 Ga0105248_106122091 211
428 3300009545 Ga0105237_10009401 Ga0105237_100094015 211
429 3300009545 Ga0105237_10033756 Ga0105237_100337563 211
430 3300009545 Ga0105237_10160609 Ga0105237_101606091 211
431 3300009545 Ga0105237_10959832 Ga0105237_109598322 211
432 3300009545 Ga0105237_11215742 Ga0105237_112157421 211
433 3300009551 Ga0105238_10049191 Ga0105238_100491912 211
434 3300009551 Ga0105238_10225883 Ga0105238_102258832 211
435 3300009551 Ga0105238_10242274 Ga0105238_102422742 211
436 3300009551 Ga0105238_10605773 Ga0105238_106057732 211
437 3300009553 Ga0105249_10043356 Ga0105249_100433563 211
438 3300009553 Ga0105249_10282383 Ga0105249_102823832 211
439 3300009553 Ga0105249_10618845 Ga0105249_106188452 211
440 3300010375 Ga0105239_10006226 Ga0105239_1000622610 211
441 3300010375 Ga0105239_10032597 Ga0105239_100325972 211
442 3300010375 Ga0105239_10054201 Ga0105239_100542014 211
443 3300010375 Ga0105239_10294287 Ga0105239_102942872 211
444 3300010375 Ga0105239_10324233 Ga0105239_103242332 211
445 3300011119 Ga0105246_10006538 Ga0105246_100065384 211
446 3300011119 Ga0105246_10059478 Ga0105246_100594782 211
447 3300011119 Ga0105246_10421170 Ga0105246_104211702 211
448 3300011119 Ga0105246_10483753 Ga0105246_104837531 211
449 3300013296 Ga0157374_10025945 Ga0157374_100259455 211
450 3300013297 Ga0157378_10087727 Ga0157378_100877273 211
451 3300013297 Ga0157378_10101599 Ga0157378_101015992 211
452 3300013306 Ga0163162_10050121 Ga0163162_100501215 211
453 3300013306 Ga0163162_10262948 Ga0163162_102629481 211
454 3300013306 Ga0163162_10405715 Ga0163162_104057152 211
455 3300013308 Ga0157375_10016660 Ga0157375_100166602 211
456 3300013308 Ga0157375_10060282 Ga0157375_100602823 211
457 3300013308 Ga0157375_10118395 Ga0157375_101183952 211
458 3300014325 Ga0163163_10040677 Ga0163163_100406772 211
459 3300014325 Ga0163163_10134877 Ga0163163_101348772 211
460 3300014325 Ga0163163_11491717 Ga0163163_114917171 211
461 3300014326 Ga0157380_10264581 Ga0157380_102645812 211
462 3300014745 Ga0157377_10278377 Ga0157377_102783771 211
463 3300014968 Ga0157379_10602264 Ga0157379_106022641 211
464 3300014969 Ga0157376_10021798 Ga0157376_100217985 211
465 3300014969 Ga0157376_10794706 Ga0157376_107947061 211
466 3300017792 Ga0163161_10045299 Ga0163161_100452993 211
467 3300017792 Ga0163161_10083802 Ga0163161_100838022 211
468 3300017792 Ga0163161_10197527 Ga0163161_101975272 211
469 3300025261 Ga0209233_1006541 Ga0209233_10065413 211
470 3300025297 Ga0209758_1017706 Ga0209758_10177063 211
471 3300025899 Ga0207642_10023155 Ga0207642_100231552 211
472 3300025899 Ga0207642_10108073 Ga0207642_101080732 211
473 3300025900 Ga0207710_10129305 Ga0207710_101293052 211
474 3300025901 Ga0207688_10011640 Ga0207688_100116403 211
475 3300025903 Ga0207680_10279251 Ga0207680_102792512 211
476 3300025904 Ga0207647_10103374 Ga0207647_101033742 211
477 3300025907 Ga0207645_10107330 Ga0207645_101073302 211
478 3300025909 Ga0207705_10449524 Ga0207705_104495241 211
479 3300025911 Ga0207654_10019526 Ga0207654_100195263 211
480 3300025913 Ga0207695_10469495 Ga0207695_104694952 211
481 3300025914 Ga0207671_10123853 Ga0207671_101238532 211
482 3300025914 Ga0207671_10179010 Ga0207671_101790102 211
483 3300025919 Ga0207657_10226004 Ga0207657_102260042 211
484 3300025920 Ga0207649_10014137 Ga0207649_100141374 211
485 3300025920 Ga0207649_10020501 Ga0207649_100205013 211
486 3300025921 Ga0207652_10016146 Ga0207652_100161465 211
487 3300025923 Ga0207681_10476931 Ga0207681_104769311 211
488 3300025924 Ga0207694_10054759 Ga0207694_100547592 211
489 3300025924 Ga0207694_10441105 Ga0207694_104411052 211
490 3300025927 Ga0207687_10020088 Ga0207687_100200883 211
491 3300025927 Ga0207687_10052337 Ga0207687_100523372 211
492 3300025927 Ga0207687_10197857 Ga0207687_101978572 211
493 3300025933 Ga0207706_10016793 Ga0207706_100167933 211
494 3300025934 Ga0207686_10052617 Ga0207686_100526173 211
495 3300025935 Ga0207709_10388716 Ga0207709_103887162 211
496 3300025935 Ga0207709_10613168 Ga0207709_106131681 211
497 3300025936 Ga0207670_10184269 Ga0207670_101842692 211
498 3300025936 Ga0207670_10329894 Ga0207670_103298942 211
499 3300025937 Ga0207669_10018879 Ga0207669_100188791 211
500 3300025937 Ga0207669_10188622 Ga0207669_101886222 211
501 3300025937 Ga0207669_10313558 Ga0207669_103135581 211
502 3300025938 Ga0207704_10051040 Ga0207704_100510402 211
503 3300025938 Ga0207704_10079846 Ga0207704_100798462 211
504 3300025938 Ga0207704_10282098 Ga0207704_102820982 211
505 3300025940 Ga0207691_10113142 Ga0207691_101131422 211
506 3300025940 Ga0207691_10133622 Ga0207691_101336221 211
507 3300025940 Ga0207691_10165000 Ga0207691_101650002 211
508 3300025941 Ga0207711_10041346 Ga0207711_100413464 211
509 3300025941 Ga0207711_10046143 Ga0207711_100461431 211
510 3300025941 Ga0207711_10346544 Ga0207711_103465442 211
511 3300025942 Ga0207689_10029882 Ga0207689_100298822 211
512 3300025942 Ga0207689_10156187 Ga0207689_101561872 211
513 3300025942 Ga0207689_10325189 Ga0207689_103251892 211
514 3300025944 Ga0207661_10048891 Ga0207661_100488913 211
515 3300025945 Ga0207679_10031548 Ga0207679_100315483 211
516 3300025949 Ga0207667_10034096 Ga0207667_100340966 211
517 3300025960 Ga0207651_10037748 Ga0207651_100377482 211
518 3300025960 Ga0207651_10799250 Ga0207651_107992501 211
519 3300025961 Ga0207712_10334286 Ga0207712_103342862 211
520 3300025961 Ga0207712_10407817 Ga0207712_104078172 211
521 3300025961 Ga0207712_10542904 Ga0207712_105429042 211
522 3300025972 Ga0207668_10019309 Ga0207668_100193092 211
523 3300025972 Ga0207668_10086905 Ga0207668_100869052 211
524 3300025986 Ga0207658_10344876 Ga0207658_103448761 211
525 3300026023 Ga0207677_10031617 Ga0207677_100316172 211
526 3300026023 Ga0207677_10319270 Ga0207677_103192701 211
527 3300026023 Ga0207677_10791596 Ga0207677_107915961 211
528 3300026035 Ga0207703_10073183 Ga0207703_100731832 211
529 3300026035 Ga0207703_10414020 Ga0207703_104140202 211
530 3300026035 Ga0207703_10429583 Ga0207703_104295831 211
531 3300026041 Ga0207639_10051305 Ga0207639_100513053 211
532 3300026041 Ga0207639_10083373 Ga0207639_100833732 211
533 3300026067 Ga0207678_10006080 Ga0207678_100060805 211
534 3300026067 Ga0207678_10026460 Ga0207678_100264604 211
535 3300026067 Ga0207678_10071566 Ga0207678_100715662 211
536 3300026067 Ga0207678_10152734 Ga0207678_101527342 211
537 3300026075 Ga0207708_10014165 Ga0207708_100141653 211
538 3300026075 Ga0207708_10250326 Ga0207708_102503262 211
539 3300026075 Ga0207708_10861147 Ga0207708_108611471 211
540 3300026088 Ga0207641_10269196 Ga0207641_102691961 211
541 3300026088 Ga0207641_10360263 Ga0207641_103602632 211
542 3300026088 Ga0207641_10519386 Ga0207641_105193861 211
543 3300026089 Ga0207648_10011805 Ga0207648_100118054 211
544 3300026089 Ga0207648_10226751 Ga0207648_102267512 211
545 3300026089 Ga0207648_10291036 Ga0207648_102910362 211
546 3300026095 Ga0207676_10029628 Ga0207676_100296283 211
547 3300026118 Ga0207675_100087515 Ga0207675_1000875152 211
548 3300026118 Ga0207675_100338360 Ga0207675_1003383602 211
549 3300026118 Ga0207675_100405315 Ga0207675_1004053152 211
550 3300026121 Ga0207683_10017266 Ga0207683_100172665 211
551 3300026121 Ga0207683_10075559 Ga0207683_100755592 211
552 3300026121 Ga0207683_10097079 Ga0207683_100970792 211
553 3300026121 Ga0207683_10438286 Ga0207683_104382862 211
554 3300027671 Ga0209588_1038165 Ga0209588_10381652 211
555 3300027907 Ga0207428_10133454 Ga0207428_101334543 211
556 3300028379 Ga0268266_10027089 Ga0268266_100270893 211
557 3300028379 Ga0268266_10051282 Ga0268266_100512823 211
558 3300028379 Ga0268266_10064139 Ga0268266_100641392 211
559 3300028379 Ga0268266_10569258 Ga0268266_105692581 211
560 3300028380 Ga0268265_10051545 Ga0268265_100515452 211
561 3300028380 Ga0268265_10235763 Ga0268265_102357632 211
562 3300028380 Ga0268265_10315022 Ga0268265_103150222 211
563 3300028380 Ga0268265_10482457 Ga0268265_104824572 211
564 3300028380 Ga0268265_10537737 Ga0268265_105377371 211
565 3300028381 Ga0268264_10108789 Ga0268264_101087892 211
566 3300028381 Ga0268264_10206537 Ga0268264_102065372 211
567 3300028786 Ga0307517_10000176 Ga0307517_1000017625 211
568 3300028786 Ga0307517_10125173 Ga0307517_101251732 211
569 3300028794 Ga0307515_10024761 Ga0307515_100247619 211
570 3300028794 Ga0307515_10276368 Ga0307515_102763682 211
571 3300031250 Ga0265331_10142252 Ga0265331_101422522 211
572 3300031456 Ga0307513_10224786 Ga0307513_102247862 211
573 3300031507 Ga0307509_10030286 Ga0307509_100302865 211
574 3300031507 Ga0307509_10041504 Ga0307509_100415042 211
575 3300031507 Ga0307509_10237301 Ga0307509_102373012 211
576 3300031507 Ga0307509_10237995 Ga0307509_102379951 211
577 3300031730 Ga0307516_10043260 Ga0307516_100432603 211
578 3300031731 Ga0307405_10055101 Ga0307405_100551013 211
579 3300031824 Ga0307413_10096382 Ga0307413_100963822 211
580 3300031852 Ga0307410_10136364 Ga0307410_101363641 211
581 3300031911 Ga0307412_10055269 Ga0307412_100552692 211
582 3300032002 Ga0307416_100419617 Ga0307416_1004196172 211
583 3300032002 Ga0307416_100714652 Ga0307416_1007146522 211
584 3300033180 Ga0307510_10010093 Ga0307510_100100936 211
585 3300033180 Ga0307510_10061429 Ga0307510_100614292 211
586 3300033442 Ga0315911_1000005 Ga0315911_1000005300 211
587 3300034816 Ga0373930_0003404 Ga0373930_0003404_170_832 211
588 3300035112 Ga0373932_0130591 Ga0373932_0130591_106_768 211
589 3300035207 Ga0373942_0011619 Ga0373942_0011619_1346_2008 211
590 3300035241 Ga0373961_0141103 Ga0373961_0141103_96_758 211
591 3300035691 Ga0373931_0007598 Ga0373931_0007598_1863_2525 211
592 3300035691 Ga0373931_0046305 Ga0373931_0046305_200_883 211
593 3300035691 Ga0373931_0491480 Ga0373931_0491480_39_686 211
594 3300035692 Ga0373935_0271445 Ga0373935_0271445_455_1117 211
595 3300036459 Ga0372808_025793 Ga0372808_025793_135_773 211
596 3300037471 Ga0395905_0101761 Ga0395905_0101761_1081_1716 211
597 3300037471 Ga0395905_0838266 Ga0395905_0838266_163_804 211
598 3300041451 Ga0451791_0193268 Ga0451791_0193268_137_799 211
599 3300041494 Ga0451837_1135996 Ga0451837_1135996_11_673 211
600 3300046452 Ga0495617_018296 Ga0495617_018296_402_1049 211
601 3300046452 Ga0495617_061020 Ga0495617_061020_154_804 211
602 3300046455 Ga0495603_0008200 Ga0495603_0008200_250_885 211
603 3300046455 Ga0495603_0078051 Ga0495603_0078051_551_1204 211
604 3300046455 Ga0495603_0117661 Ga0495603_0117661_618_1280 211
605 3300046455 Ga0495603_0229043 Ga0495603_0229043_42_689 211
606 3300046457 Ga0495590_0038754 Ga0495590_0038754_43_705 211
607 3300046459 Ga0495629_0473373 Ga0495629_0473373_53_805 211
608 3300046460 Ga0495638_0182573 Ga0495638_0182573_240_890 211
609 3300046460 Ga0495638_0243303 Ga0495638_0243303_96_743 211
610 3300046472 Ga0495580_0106199 Ga0495580_0106199_675_1325 211
611 3300046474 Ga0495605_0186327 Ga0495605_0186327_17_661 211
612 3300046475 Ga0495639_0076640 Ga0495639_0076640_842_1480 211
613 3300046475 Ga0495639_0078937 Ga0495639_0078937_17_661 211
614 3300046477 Ga0495664_0162528 Ga0495664_0162528_183_827 211
615 3300046491 Ga0495584_0274249 Ga0495584_0274249_18_665 211
616 3300046491 Ga0495584_0336603 Ga0495584_0336603_58_705 211
617 3300046492 Ga0495585_0019464 Ga0495585_0019464_475_1125 211
618 3300046492 Ga0495585_0164826 Ga0495585_0164826_204_941 211
619 3300046500 Ga0495596_0036720 Ga0495596_0036720_281_1033 211
620 3300046501 Ga0495607_0182961 Ga0495607_0182961_24_761 211
621 3300046515 Ga0495620_0086193 Ga0495620_0086193_187_834 211
622 3300046522 Ga0495643_0039389 Ga0495643_0039389_1650_2402 211
623 3300046523 Ga0495644_0090437 Ga0495644_0090437_106_753 211
624 3300046523 Ga0495644_0145615 Ga0495644_0145615_32_679 211
625 3300046524 Ga0495648_0219814 Ga0495648_0219814_26_673 211
626 3300046525 Ga0495663_0037812 Ga0495663_0037812_689_1336 211
627 3300046526 Ga0495666_0054648 Ga0495666_0054648_403_1053 211
628 3300046530 Ga0495654_0092055 Ga0495654_0092055_79_843 211
629 3300046537 Ga0495598_0004565 Ga0495598_0004565_1403_2140 211
630 3300046537 Ga0495598_0004693 Ga0495598_0004693_1321_1968 211
631 3300046537 Ga0495598_0019118 Ga0495598_0019118_49_705 211
632 3300046539 Ga0495621_0009869 Ga0495621_0009869_2071_2721 211
633 3300046542 Ga0495597_0179144 Ga0495597_0179144_152_799 211
634 3300046557 Ga0495622_0015323 Ga0495622_0015323_164_811 211
635 3300046557 Ga0495622_0036962 Ga0495622_0036962_490_1152 211
636 3300046615 Ga0495656_0007640 Ga0495656_0007640_2881_3618 211
637 3300046615 Ga0495656_0060480 Ga0495656_0060480_985_1632 211
638 3300046615 Ga0495656_0091525 Ga0495656_0091525_449_1201 211
639 3300046615 Ga0495656_0211994 Ga0495656_0211994_132_779 211
640 3300046616 Ga0495668_0030525 Ga0495668_0030525_1858_2520 211
641 3300046616 Ga0495668_0066743 Ga0495668_0066743_331_1005 211
642 3300046616 Ga0495668_0303940 Ga0495668_0303940_74_730 211
643 3300046648 Ga0495611_0048349 Ga0495611_0048349_957_1619 211
644 3300046660 Ga0495625_0162019 Ga0495625_0162019_23_667 211
645 3300046674 Ga0495588_0049033 Ga0495588_0049033_1068_1715 211
646 3300046690 Ga0495624_0116002 Ga0495624_0116002_585_1229 211
647 3300046691 Ga0495670_0100193 Ga0495670_0100193_519_1256 211
648 3300046691 Ga0495670_0121937 Ga0495670_0121937_584_1231 211
649 3300046794 Ga0495589_0028532 Ga0495589_0028532_678_1325 211
650 3300047315 Ga0495581_0261150 Ga0495581_0261150_157_807 211
651 3300047318 Ga0495636_0011302 Ga0495636_0011302_1169_1819 211
652 3300047318 Ga0495636_0064953 Ga0495636_0064953_315_965 211
653 3300047320 Ga0495672_0044747 Ga0495672_0044747_1289_1942 211
654 3300047445 Ga0495677_0042356 Ga0495677_0042356_140_787 211
655 3300047469 Ga0495673_0064792 Ga0495673_0064792_530_1204 211
656 3300047472 Ga0495686_0086805 Ga0495686_0086805_899_1573 211
657 3300048091 Ga0495626_0133456 Ga0495626_0133456_35_682 211
658 3300048903 Ga0496100_0056515 Ga0496100_0056515_816_1478 211
659 3300048903 Ga0496100_0317561 Ga0496100_0317561_404_1063 211
660 3300048904 Ga0496101_0040142 Ga0496101_0040142_612_1274 211
661 3300048904 Ga0496101_0188718 Ga0496101_0188718_656_1303 211
662 3300048905 Ga0496102_0006184 Ga0496102_0006184_7742_8401 211
663 3300048905 Ga0496102_0055839 Ga0496102_0055839_640_1287 211
664 3300048905 Ga0496102_0107367 Ga0496102_0107367_460_1122 211
665 3300048906 Ga0496103_0006862 Ga0496103_0006862_609_1268 211
666 3300048908 Ga0496105_0015812 Ga0496105_0015812_275_937 211
667 3300048909 Ga0496106_0002146 Ga0496106_0002146_2296_2937 211
668 3300048909 Ga0496106_0009940 Ga0496106_0009940_6167_6829 211
669 3300048909 Ga0496106_0112826 Ga0496106_0112826_393_1052 211
670 3300048909 Ga0496106_0151221 Ga0496106_0151221_323_970 211
671 3300048909 Ga0496106_0255960 Ga0496106_0255960_612_1259 211
672 3300048910 Ga0496107_0026018 Ga0496107_0026018_2936_3595 211
673 3300048910 Ga0496107_0192009 Ga0496107_0192009_607_1269 211
674 3300048911 Ga0496108_0024899 Ga0496108_0024899_27_674 211
675 3300048911 Ga0496108_0054602 Ga0496108_0054602_250_909 211
676 3300048912 Ga0496109_0010481 Ga0496109_0010481_1915_2574 211
677 3300048912 Ga0496109_0016308 Ga0496109_0016308_900_1544 211
678 3300048912 Ga0496109_0705350 Ga0496109_0705350_259_921 211
679 3300048913 Ga0496110_0033478 Ga0496110_0033478_487_1146 211
680 3300048914 Ga0496111_0011084 Ga0496111_0011084_2039_2701 211
681 3300048914 Ga0496111_0024988 Ga0496111_0024988_659_1318 211
682 3300048915 Ga0496112_0000022 Ga0496112_0000022_20799_21461 211
683 3300048915 Ga0496112_0008650 Ga0496112_0008650_6742_7389 211
684 3300048915 Ga0496112_0008856 Ga0496112_0008856_6170_6832 211
685 3300048916 Ga0496113_0012773 Ga0496113_0012773_2325_2987 211
686 3300048916 Ga0496113_0144243 Ga0496113_0144243_1014_1658 211
687 3300048916 Ga0496113_0253076 Ga0496113_0253076_226_885 211
688 3300048917 Ga0496114_0018024 Ga0496114_0018024_2994_3653 211
689 3300048917 Ga0496114_0025976 Ga0496114_0025976_3363_4025 211
690 3300048917 Ga0496114_0583679 Ga0496114_0583679_274_918 211
691 3300048918 Ga0496115_0015540 Ga0496115_0015540_2113_2772 211
692 3300048918 Ga0496115_0076300 Ga0496115_0076300_969_1616 211
693 3300048919 Ga0496116_0133859 Ga0496116_0133859_495_1157 211
694 3300048920 Ga0496117_0072389 Ga0496117_0072389_775_1416 211
695 3300048920 Ga0496117_0090274 Ga0496117_0090274_702_1340 211
696 3300048920 Ga0496117_0113366 Ga0496117_0113366_799_1461 211
697 3300048921 Ga0496118_0006640 Ga0496118_0006640_10186_10827 211
698 3300048921 Ga0496118_0031958 Ga0496118_0031958_1835_2473 211
699 3300048921 Ga0496118_0173273 Ga0496118_0173273_441_1103 211
700 3300048922 Ga0496119_0154557 Ga0496119_0154557_516_1154 211
701 3300048922 Ga0496119_0276498 Ga0496119_0276498_32_670 211
702 3300048924 Ga0496121_0000146 Ga0496121_0000146_11101_11742 211
703 3300048924 Ga0496121_0000254 Ga0496121_0000254_66637_67290 211
704 3300048924 Ga0496121_0012395 Ga0496121_0012395_7010_7648 211
705 3300048924 Ga0496121_0027341 Ga0496121_0027341_2821_3483 211
706 3300048924 Ga0496121_0036689 Ga0496121_0036689_452_1114 211
707 3300048924 Ga0496121_0101064 Ga0496121_0101064_550_1191 211
708 3300048924 Ga0496121_0121575 Ga0496121_0121575_902_1546 211
709 3300048924 Ga0496121_0201148 Ga0496121_0201148_560_1204 211
710 3300048927 Ga0496124_0001236 Ga0496124_0001236_11878_12519 211
711 3300048927 Ga0496124_0021839 Ga0496124_0021839_2111_2773 211
712 3300048928 Ga0496125_0013848 Ga0496125_0013848_3528_4190 211
713 3300048928 Ga0496125_0196049 Ga0496125_0196049_408_1136 211
714 3300048929 Ga0496126_0013383 Ga0496126_0013383_2746_3468 211
715 3300048929 Ga0496126_0080959 Ga0496126_0080959_1144_1788 211
716 3300048929 Ga0496126_0094722 Ga0496126_0094722_881_1522 211
717 3300048929 Ga0496126_0114563 Ga0496126_0114563_683_1345 211
718 3300048929 Ga0496126_0141195 Ga0496126_0141195_1361_2005 211
719 3300048929 Ga0496126_0186516 Ga0496126_0186516_650_1285 211
720 3300048929 Ga0496126_0534551 Ga0496126_0534551_44_682 211
721 3300049459 Ga0495678_065081 Ga0495678_065081_541_1188 211
722 3300049589 Ga0501073_0534933 Ga0501073_0534933_35_670 211
723 3300050489 nmdc:mga03683_140166_c1 nmdc:mga03683_140166_c1_66_713 211
724 3300050489 nmdc:mga03683_171936_c1 nmdc:mga03683_171936_c1_220_855 211
725 3300050491 nmdc:mga00v17_79997_c1 nmdc:mga00v17_79997_c1_19_666 211
726 3300050492 nmdc:mga0yw44_185192_c1 nmdc:mga0yw44_185192_c1_225_869 211
727 3300050492 nmdc:mga0yw44_228152_c1 nmdc:mga0yw44_228152_c1_343_990 211
728 3300050494 nmdc:mga06z11_335727_c1 nmdc:mga06z11_335727_c1_93_755 211
729 3300050495 nmdc:mga04h51_45179_c1 nmdc:mga04h51_45179_c1_495_1139 211
730 3300050496 nmdc:mga07m45_45718_c1 nmdc:mga07m45_45718_c1_905_1567 211
731 3300050507 nmdc:mga05p37_57183_c1 nmdc:mga05p37_57183_c1_3536_4183 211
732 3300050512 nmdc:mga0n895_61527_c1 nmdc:mga0n895_61527_c1_3038_3685 211
733 3300050512 nmdc:mga0n895_806596_c1 nmdc:mga0n895_806596_c1_129_812 211
734 3300050513 nmdc:mga0rr50_423583_c1 nmdc:mga0rr50_423583_c1_397_1080 211
735 3300050515 nmdc:mga0a205_333403_c1 nmdc:mga0a205_333403_c1_75_722 211
736 3300050516 nmdc:mga0sz30_221674_c1 nmdc:mga0sz30_221674_c1_179_826 211
737 3300050516 nmdc:mga0sz30_28917_c2 nmdc:mga0sz30_28917_c2_11_658 211
738 3300053080 Ga0500635_0000894 Ga0500635_0000894_6070_6723 211
739 3300053083 Ga0495655_0029188 Ga0495655_0029188_34_681 211
740 3300053084 Ga0495595_0004191 Ga0495595_0004191_1477_2121 211
741 3300053085 Ga0495619_0195611 Ga0495619_0195611_679_1323 211
742 3300053088 Ga0500644_0184926 Ga0500644_0184926_55_717 211
743 3300053092 Ga0500583_0155906 Ga0500583_0155906_312_956 211
744 3300053094 Ga0500566_0039553 Ga0500566_0039553_1092_1736 211
745 3300053098 Ga0500650_0190624 Ga0500650_0190624_136_798 211
746 3300053102 Ga0500554_062200 Ga0500554_062200_153_806 211
747 3300053118 Ga0500594_0046224 Ga0500594_0046224_493_1131 211
748 3300053119 Ga0500595_000730 Ga0500595_000730_246_890 211
749 3300053119 Ga0500595_010244 Ga0500595_010244_286_930 211
750 3300053119 Ga0500595_018807 Ga0500595_018807_1072_1710 211
751 3300053125 Ga0500618_012347 Ga0500618_012347_1352_1990 211
752 3300053130 Ga0500642_0044293 Ga0500642_0044293_276_923 211
753 3300053130 Ga0500642_0224041 Ga0500642_0224041_153_791 211
754 3300053133 Ga0500655_020538 Ga0500655_020538_144_806 211
755 3300053136 Ga0500559_0083822 Ga0500559_0083822_457_1098 211
756 3300053136 Ga0500559_0113643 Ga0500559_0113643_236_880 211
757 3300053139 Ga0500568_0008112 Ga0500568_0008112_3884_4537 211
758 3300053139 Ga0500568_0072064 Ga0500568_0072064_387_1049 211
759 3300053140 Ga0500573_0130733 Ga0500573_0130733_584_1225 211
760 3300053150 Ga0500603_000741 Ga0500603_000741_322_975 211
761 3300053150 Ga0500603_036444 Ga0500603_036444_52_696 211
762 3300053158 Ga0500627_0110097 Ga0500627_0110097_461_1105 211
763 3300053158 Ga0500627_0236034 Ga0500627_0236034_26_688 211
764 3300053162 Ga0500638_000379 Ga0500638_000379_3365_4009 211
765 3300053178 Ga0500637_0001280 Ga0500637_0001280_5982_6626 211
766 3300053730 Ga0500645_066633 Ga0500645_066633_181_843 211
767 3300053731 Ga0500609_014367 Ga0500609_014367_76_738 211
768 3300053735 Ga0500596_000696 Ga0500596_000696_3094_3735 211
769 3300055283 Ga0500661_000550 Ga0500661_000550_6020_6664 211
770 iso_pu_bacteria 8006964411 8006965882 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

58

252

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bp3-assembly1.cif.gz_B cryo-em structure of the human mct2 0.4454 51 207
4jr9-assembly1.cif.gz_A crystal structure of nitrate/nitrite exchanger nark 0.4377 23 204
4u4w-assembly2.cif.gz_B structure of a nitrate/nitrite antiporter nark in nitrate-bound occluded state 0.4332 23 204
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.4299 10 210
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.4252 7 210
ID Description Score Start End Superfamily
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5706 9 209 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5601 9 209 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5415 9 209 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5372 9 209 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4841 3 211 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7K1BCG1-F1-model_v4 LysE family translocator 0.9356 8 206 GO:0005886
GO:0015171
AF-A0A6C1B1M2-F1-model_v4 LysE family translocator 0.9122 7 211 GO:0005886
GO:0015171
AF-A4Z138-F1-model_v4 Putative amino acid efflux protein, LysE family 0.9109 1 211 GO:0005886
GO:0015171
AF-A0A151FS10-F1-model_v4 deleted 0.9083 1 211
AF-A0A7J5EDQ9-F1-model_v4 LysE family translocator 0.9044 7 210 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
89.01 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map