F480050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 770 | 374 | 731 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0092055|Ga0495654_0092055_79_843 |
| Length | 254 |
| Sequence | MFIKMGNPVEAGFAHDNTANCLELAHAQLKGRQGMEPVKWMVETLGVHELWLFILSGLLLNVTPGPDTAYIVGRSIQFGWRGGAAAATGISAGCLVHVFGAAIGLSALLMASSAAFTVLKWAGAAYLLVTGVQMLLSHSRPLAETAVAGSETSLARVFWQGALTNVLNPKVALFFLAFLPQFVTAESAHKTLAFLVLGLIFITSGTLWCFGIAAFAARVAGRIRQSAGAMAWINRALGGLFVYLGIRVAMLEAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2791355199 | |||
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 14 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 15 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 16 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 17 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 18 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 19 | 2906610324 | |||
| 20 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 21 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 22 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 23 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 24 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 25 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 26 | 2922425934 | |||
| 27 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 28 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 29 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 30 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 31 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 32 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 229 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 339 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 347 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 352 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 356 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 361 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 362 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 366 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 367 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 368 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 369 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 370 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 371 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 372 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 373 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 374 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.18 |
| Metatranscriptomes | 0.13 |
| Isolates | 4.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.87 |
| Nodule | 3.64 |
| Rhizoplane | 5.32 |
| Rhizosphere | 72.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000118 | 3300003203 | Bacteria | 34503 |
| 2 | JGI25406J46586_10007912 | 3300003203 | Bacteria | 4836 |
| 3 | JGI25153J46596_10013940 | 3300003215 | Bacteria | 3371 |
| 4 | rootH1_10063808 | 3300003316 | Bacteria | 1553 |
| 5 | rootH1_10046565 | 3300003323 | Bacteria | 8553 |
| 6 | rootH1_10341204 | 3300003323 | Bacteria | 1210 |
| 7 | JGI25404J52841_10006748 | 3300003659 | Bacteria | 2410 |
| 8 | JGI25404J52841_10018718 | 3300003659 | Bacteria | 1500 |
| 9 | JGI25404J52841_10035704 | 3300003659 | Bacteria | 1058 |
| 10 | JGI25405J52794_10002640 | 3300003911 | Bacteria | 3101 |
| 11 | Ga0070676_10001300 | 3300005328 | Bacteria | 12562 |
| 12 | Ga0070676_10084486 | 3300005328 | Bacteria | 1932 |
| 13 | Ga0070683_100373843 | 3300005329 | Bacteria | 1358 |
| 14 | Ga0070690_100613710 | 3300005330 | Bacteria | 827 |
| 15 | Ga0070670_100151800 | 3300005331 | Bacteria | 2005 |
| 16 | Ga0070670_100263660 | 3300005331 | Bacteria | 1502 |
| 17 | Ga0070670_100289949 | 3300005331 | Bacteria | 1430 |
| 18 | Ga0070670_100460507 | 3300005331 | Bacteria | 1128 |
| 19 | Ga0070677_10003729 | 3300005333 | Bacteria | 4931 |
| 20 | Ga0068869_100006393 | 3300005334 | Bacteria | 7471 |
| 21 | Ga0068869_100044270 | 3300005334 | Bacteria | 3200 |
| 22 | Ga0068869_100301500 | 3300005334 | Bacteria | 1294 |
| 23 | Ga0070666_10001057 | 3300005335 | Bacteria | 16820 |
| 24 | Ga0070666_10593548 | 3300005335 | Bacteria | 808 |
| 25 | Ga0070680_100202121 | 3300005336 | Bacteria | 1676 |
| 26 | Ga0068868_100013250 | 3300005338 | Bacteria | 6041 |
| 27 | Ga0068868_100021214 | 3300005338 | Bacteria | 4891 |
| 28 | Ga0068868_100051092 | 3300005338 | Bacteria | 3249 |
| 29 | Ga0068868_100420164 | 3300005338 | Bacteria | 1157 |
| 30 | Ga0070660_100122715 | 3300005339 | Bacteria | 2074 |
| 31 | Ga0070689_100248302 | 3300005340 | Bacteria | 1468 |
| 32 | Ga0070687_100444505 | 3300005343 | Bacteria | 861 |
| 33 | Ga0070661_100186210 | 3300005344 | Bacteria | 1582 |
| 34 | Ga0070668_100004548 | 3300005347 | Bacteria | 10284 |
| 35 | Ga0070668_100028324 | 3300005347 | Bacteria | 4253 |
| 36 | Ga0070668_100185959 | 3300005347 | Bacteria | 1699 |
| 37 | Ga0070668_100190092 | 3300005347 | Bacteria | 1681 |
| 38 | Ga0070668_100253439 | 3300005347 | Bacteria | 1462 |
| 39 | Ga0070668_100295341 | 3300005347 | Bacteria | 1357 |
| 40 | Ga0070668_100321353 | 3300005347 | Bacteria | 1303 |
| 41 | Ga0070668_100353994 | 3300005347 | Bacteria | 1243 |
| 42 | Ga0070668_100592773 | 3300005347 | Bacteria | 969 |
| 43 | Ga0070669_100009203 | 3300005353 | Bacteria | 7038 |
| 44 | Ga0070669_100242431 | 3300005353 | Bacteria | 1433 |
| 45 | Ga0070669_100267094 | 3300005353 | Bacteria | 1367 |
| 46 | Ga0070675_100001972 | 3300005354 | Bacteria | 15193 |
| 47 | Ga0070671_100001035 | 3300005355 | Bacteria | 20462 |
| 48 | Ga0070671_100049679 | 3300005355 | Bacteria | 3489 |
| 49 | Ga0070671_100845689 | 3300005355 | Bacteria | 798 |
| 50 | Ga0070674_100001310 | 3300005356 | Bacteria | 13095 |
| 51 | Ga0070673_100001352 | 3300005364 | Bacteria | 14315 |
| 52 | Ga0070673_100476928 | 3300005364 | Bacteria | 1125 |
| 53 | Ga0070659_100091560 | 3300005366 | Bacteria | 2438 |
| 54 | Ga0070659_100273058 | 3300005366 | Bacteria | 1405 |
| 55 | Ga0070659_100282229 | 3300005366 | Bacteria | 1382 |
| 56 | Ga0070667_100002933 | 3300005367 | Bacteria | 14661 |
| 57 | Ga0070667_100316757 | 3300005367 | Bacteria | 1407 |
| 58 | Ga0070667_100439515 | 3300005367 | Bacteria | 1191 |
| 59 | Ga0070667_100516654 | 3300005367 | Bacteria | 1096 |
| 60 | Ga0070667_100522228 | 3300005367 | Bacteria | 1090 |
| 61 | Ga0070713_100040144 | 3300005436 | Bacteria | 3804 |
| 62 | Ga0070710_10300917 | 3300005437 | Bacteria | 1047 |
| 63 | Ga0070701_10111907 | 3300005438 | Bacteria | 1526 |
| 64 | Ga0070700_100100500 | 3300005441 | Bacteria | 1905 |
| 65 | Ga0070700_100171527 | 3300005441 | Bacteria | 1503 |
| 66 | Ga0070663_100007686 | 3300005455 | Bacteria | 6581 |
| 67 | Ga0070663_100033040 | 3300005455 | Bacteria | 3571 |
| 68 | Ga0070663_100034595 | 3300005455 | Bacteria | 3500 |
| 69 | Ga0070663_100125533 | 3300005455 | Bacteria | 1944 |
| 70 | Ga0070663_100176076 | 3300005455 | Bacteria | 1656 |
| 71 | Ga0070663_100371471 | 3300005455 | Bacteria | 1162 |
| 72 | Ga0070678_100001003 | 3300005456 | Bacteria | 14655 |
| 73 | Ga0070678_100014577 | 3300005456 | Bacteria | 4967 |
| 74 | Ga0070678_100138931 | 3300005456 | Bacteria | 1941 |
| 75 | Ga0070678_100176810 | 3300005456 | Bacteria | 1743 |
| 76 | Ga0070678_100227783 | 3300005456 | Bacteria | 1552 |
| 77 | Ga0070678_100311781 | 3300005456 | Bacteria | 1341 |
| 78 | Ga0070678_100450918 | 3300005456 | Bacteria | 1127 |
| 79 | Ga0070662_100146530 | 3300005457 | Bacteria | 1834 |
| 80 | Ga0070681_10535506 | 3300005458 | Bacteria | 1085 |
| 81 | Ga0068867_100010975 | 3300005459 | Bacteria | 6387 |
| 82 | Ga0068867_100037083 | 3300005459 | Bacteria | 3542 |
| 83 | Ga0068867_100135545 | 3300005459 | Bacteria | 1919 |
| 84 | Ga0068867_100793598 | 3300005459 | Bacteria | 844 |
| 85 | Ga0070685_10061983 | 3300005466 | Bacteria | 2192 |
| 86 | Ga0070685_10286807 | 3300005466 | Bacteria | 1104 |
| 87 | Ga0070698_100142039 | 3300005471 | Bacteria | 2352 |
| 88 | Ga0070698_100624788 | 3300005471 | Bacteria | 1018 |
| 89 | Ga0070699_100488680 | 3300005518 | Bacteria | 1118 |
| 90 | Ga0070684_100056843 | 3300005535 | Bacteria | 3416 |
| 91 | Ga0068853_100016152 | 3300005539 | Bacteria | 6139 |
| 92 | Ga0068853_100115628 | 3300005539 | Bacteria | 2388 |
| 93 | Ga0070672_100004801 | 3300005543 | Bacteria | 8874 |
| 94 | Ga0070672_100199132 | 3300005543 | Bacteria | 1674 |
| 95 | Ga0070686_100060417 | 3300005544 | Bacteria | 2446 |
| 96 | Ga0070686_100095240 | 3300005544 | Bacteria | 2000 |
| 97 | Ga0070686_100168594 | 3300005544 | Bacteria | 1547 |
| 98 | Ga0070693_100416569 | 3300005547 | Bacteria | 935 |
| 99 | Ga0070665_100015092 | 3300005548 | Bacteria | 7756 |
| 100 | Ga0070665_100038313 | 3300005548 | Bacteria | 4819 |
| 101 | Ga0070665_100111611 | 3300005548 | Bacteria | 2736 |
| 102 | Ga0070665_100125570 | 3300005548 | Bacteria | 2568 |
| 103 | Ga0070665_100418625 | 3300005548 | Bacteria | 1348 |
| 104 | Ga0070704_100017490 | 3300005549 | Bacteria | 4560 |
| 105 | Ga0068855_100036624 | 3300005563 | Bacteria | 5837 |
| 106 | Ga0070664_100445627 | 3300005564 | Bacteria | 1188 |
| 107 | Ga0068854_100691293 | 3300005578 | Bacteria | 880 |
| 108 | Ga0068856_100142783 | 3300005614 | Bacteria | 2401 |
| 109 | Ga0070702_100020928 | 3300005615 | Bacteria | 3433 |
| 110 | Ga0070702_100207577 | 3300005615 | Bacteria | 1301 |
| 111 | Ga0070702_100269726 | 3300005615 | Bacteria | 1163 |
| 112 | Ga0070702_100391619 | 3300005615 | Bacteria | 991 |
| 113 | Ga0068852_100001098 | 3300005616 | Bacteria | 17860 |
| 114 | Ga0068852_100052442 | 3300005616 | Bacteria | 3505 |
| 115 | Ga0068852_100054448 | 3300005616 | Bacteria | 3449 |
| 116 | Ga0068852_100373304 | 3300005616 | Bacteria | 1398 |
| 117 | Ga0068859_100048748 | 3300005617 | Bacteria | 4255 |
| 118 | Ga0068859_100151549 | 3300005617 | Bacteria | 2394 |
| 119 | Ga0068859_100167592 | 3300005617 | Bacteria | 2276 |
| 120 | Ga0068859_100217700 | 3300005617 | Bacteria | 1997 |
| 121 | Ga0068859_100578577 | 3300005617 | Bacteria | 1217 |
| 122 | Ga0068864_100024533 | 3300005618 | Bacteria | 5074 |
| 123 | Ga0068864_100031446 | 3300005618 | Bacteria | 4503 |
| 124 | Ga0068864_100033384 | 3300005618 | Bacteria | 4375 |
| 125 | Ga0068864_100086324 | 3300005618 | Bacteria | 2760 |
| 126 | Ga0068864_100227737 | 3300005618 | Bacteria | 1723 |
| 127 | Ga0068866_10052283 | 3300005718 | Bacteria | 2084 |
| 128 | Ga0068866_10117677 | 3300005718 | Bacteria | 1492 |
| 129 | Ga0068861_100074575 | 3300005719 | Bacteria | 2638 |
| 130 | Ga0068861_100172531 | 3300005719 | Bacteria | 1793 |
| 131 | Ga0068851_10000852 | 3300005834 | Bacteria | 13138 |
| 132 | Ga0068870_10007499 | 3300005840 | Bacteria | 4868 |
| 133 | Ga0068863_100015678 | 3300005841 | Bacteria | 7276 |
| 134 | Ga0068863_100196706 | 3300005841 | Bacteria | 1938 |
| 135 | Ga0068863_100274055 | 3300005841 | Bacteria | 1634 |
| 136 | Ga0068863_100672786 | 3300005841 | Bacteria | 1027 |
| 137 | Ga0068858_100056847 | 3300005842 | Bacteria | 3616 |
| 138 | Ga0068858_100133876 | 3300005842 | Bacteria | 2325 |
| 139 | Ga0068858_100154554 | 3300005842 | Bacteria | 2158 |
| 140 | Ga0068858_100234024 | 3300005842 | Bacteria | 1742 |
| 141 | Ga0068858_100286387 | 3300005842 | Bacteria | 1570 |
| 142 | Ga0068858_100478475 | 3300005842 | Bacteria | 1202 |
| 143 | Ga0068858_100652142 | 3300005842 | Bacteria | 1023 |
| 144 | Ga0068858_100723654 | 3300005842 | Bacteria | 969 |
| 145 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 146 | Ga0068860_100006265 | 3300005843 | Bacteria | 11943 |
| 147 | Ga0068860_100122368 | 3300005843 | Bacteria | 2492 |
| 148 | Ga0068860_100330277 | 3300005843 | Bacteria | 1498 |
| 149 | Ga0068862_100053367 | 3300005844 | Bacteria | 3460 |
| 150 | Ga0068862_100083397 | 3300005844 | Bacteria | 2775 |
| 151 | Ga0068862_100179877 | 3300005844 | Bacteria | 1897 |
| 152 | Ga0068862_100210527 | 3300005844 | Bacteria | 1756 |
| 153 | Ga0068862_100265761 | 3300005844 | Bacteria | 1567 |
| 154 | Ga0081455_10013479 | 3300005937 | Bacteria | 8073 |
| 155 | Ga0081455_10023557 | 3300005937 | Bacteria | 5727 |
| 156 | Ga0081455_10041472 | 3300005937 | Bacteria | 4047 |
| 157 | Ga0081455_10066358 | 3300005937 | Bacteria | 3014 |
| 158 | Ga0081455_10410493 | 3300005937 | Bacteria | 937 |
| 159 | Ga0081538_10018308 | 3300005981 | Bacteria | 5268 |
| 160 | Ga0081540_1002251 | 3300005983 | Bacteria | 15895 |
| 161 | Ga0081540_1003941 | 3300005983 | Bacteria | 11537 |
| 162 | Ga0081540_1004960 | 3300005983 | Bacteria | 10007 |
| 163 | Ga0081540_1006444 | 3300005983 | Bacteria | 8542 |
| 164 | Ga0081540_1014502 | 3300005983 | Bacteria | 5042 |
| 165 | Ga0081540_1046725 | 3300005983 | Bacteria | 2183 |
| 166 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 167 | Ga0081539_10001114 | 3300005985 | Bacteria | 48756 |
| 168 | Ga0081539_10012644 | 3300005985 | Bacteria | 6472 |
| 169 | Ga0081539_10018715 | 3300005985 | Bacteria | 4786 |
| 170 | Ga0081539_10106778 | 3300005985 | Bacteria | 1417 |
| 171 | Ga0070717_10310303 | 3300006028 | Bacteria | 1404 |
| 172 | Ga0075365_10111769 | 3300006038 | Bacteria | 1878 |
| 173 | Ga0075365_10189448 | 3300006038 | Bacteria | 1439 |
| 174 | Ga0075365_10192026 | 3300006038 | Bacteria | 1429 |
| 175 | Ga0075365_10273506 | 3300006038 | Bacteria | 1188 |
| 176 | Ga0075365_10300082 | 3300006038 | Bacteria | 1130 |
| 177 | Ga0075368_10009758 | 3300006042 | Bacteria | 3460 |
| 178 | Ga0075368_10029321 | 3300006042 | Bacteria | 2127 |
| 179 | Ga0075363_100001726 | 3300006048 | Bacteria | 8492 |
| 180 | Ga0075364_10286232 | 3300006051 | Bacteria | 1121 |
| 181 | Ga0075364_10292558 | 3300006051 | Bacteria | 1108 |
| 182 | Ga0070716_100221232 | 3300006173 | Bacteria | 1272 |
| 183 | Ga0075362_10021395 | 3300006177 | Bacteria | 2713 |
| 184 | Ga0075362_10106050 | 3300006177 | Bacteria | 1319 |
| 185 | Ga0075362_10172008 | 3300006177 | Bacteria | 1047 |
| 186 | Ga0075362_10172111 | 3300006177 | Bacteria | 1047 |
| 187 | Ga0075367_10074104 | 3300006178 | Bacteria | 2052 |
| 188 | Ga0075369_10138245 | 3300006186 | Bacteria | 1110 |
| 189 | Ga0075369_10148347 | 3300006186 | Bacteria | 1071 |
| 190 | Ga0075366_10074192 | 3300006195 | Bacteria | 2028 |
| 191 | Ga0097621_100072169 | 3300006237 | Bacteria | 2855 |
| 192 | Ga0097621_100255131 | 3300006237 | Bacteria | 1537 |
| 193 | Ga0075370_10056009 | 3300006353 | Bacteria | 2240 |
| 194 | Ga0075370_10102902 | 3300006353 | Bacteria | 1654 |
| 195 | Ga0075370_10106289 | 3300006353 | Bacteria | 1627 |
| 196 | Ga0068871_100017539 | 3300006358 | Bacteria | 5420 |
| 197 | Ga0068871_100087537 | 3300006358 | Bacteria | 2590 |
| 198 | Ga0068871_100092844 | 3300006358 | Bacteria | 2517 |
| 199 | Ga0068871_100208226 | 3300006358 | Bacteria | 1691 |
| 200 | Ga0068871_100864221 | 3300006358 | Bacteria | 837 |
| 201 | Ga0075428_100051259 | 3300006844 | Bacteria | 4526 |
| 202 | Ga0075428_100472359 | 3300006844 | Bacteria | 1342 |
| 203 | Ga0075434_100013575 | 3300006871 | Bacteria | 7761 |
| 204 | Ga0075434_100178919 | 3300006871 | Bacteria | 2140 |
| 205 | Ga0075434_100375451 | 3300006871 | Bacteria | 1443 |
| 206 | Ga0075434_100922435 | 3300006871 | Bacteria | 888 |
| 207 | Ga0075429_100583237 | 3300006880 | Bacteria | 980 |
| 208 | Ga0068865_100044397 | 3300006881 | Bacteria | 3042 |
| 209 | Ga0068865_100051818 | 3300006881 | Bacteria | 2842 |
| 210 | Ga0068865_100222558 | 3300006881 | Bacteria | 1476 |
| 211 | Ga0068865_100294011 | 3300006881 | Bacteria | 1297 |
| 212 | Ga0097620_100048746 | 3300006931 | Bacteria | 4255 |
| 213 | Ga0097620_100151548 | 3300006931 | Bacteria | 2394 |
| 214 | Ga0097620_100167594 | 3300006931 | Bacteria | 2276 |
| 215 | Ga0097620_100217712 | 3300006931 | Bacteria | 1997 |
| 216 | Ga0097620_100578562 | 3300006931 | Bacteria | 1217 |
| 217 | Ga0075435_100086681 | 3300007076 | Bacteria | 2579 |
| 218 | Ga0099794_10062285 | 3300007265 | Bacteria | 1814 |
| 219 | Ga0105240_10334243 | 3300009093 | Bacteria | 1723 |
| 220 | Ga0111539_10126858 | 3300009094 | Bacteria | 2989 |
| 221 | Ga0111539_10255949 | 3300009094 | Bacteria | 2039 |
| 222 | Ga0105245_10011836 | 3300009098 | Bacteria | 7588 |
| 223 | Ga0105245_10082796 | 3300009098 | Bacteria | 2936 |
| 224 | Ga0105245_10349267 | 3300009098 | Bacteria | 1465 |
| 225 | Ga0105245_10899099 | 3300009098 | Bacteria | 927 |
| 226 | Ga0105245_11171872 | 3300009098 | Bacteria | 816 |
| 227 | Ga0105247_10007548 | 3300009101 | Bacteria | 6663 |
| 228 | Ga0105247_10026077 | 3300009101 | Bacteria | 3528 |
| 229 | Ga0105247_10027309 | 3300009101 | Bacteria | 3452 |
| 230 | Ga0105247_10338387 | 3300009101 | Bacteria | 1055 |
| 231 | Ga0114129_10527373 | 3300009147 | Bacteria | 1539 |
| 232 | Ga0105243_10152324 | 3300009148 | Bacteria | 1985 |
| 233 | Ga0105243_10292936 | 3300009148 | Bacteria | 1471 |
| 234 | Ga0105243_10522079 | 3300009148 | Bacteria | 1129 |
| 235 | Ga0105241_10023322 | 3300009174 | Bacteria | 4589 |
| 236 | Ga0105241_10178089 | 3300009174 | Bacteria | 1761 |
| 237 | Ga0105241_10414686 | 3300009174 | Bacteria | 1184 |
| 238 | Ga0105242_10034607 | 3300009176 | Bacteria | 4050 |
| 239 | Ga0105242_10459247 | 3300009176 | Bacteria | 1202 |
| 240 | Ga0105248_10050803 | 3300009177 | Bacteria | 4651 |
| 241 | Ga0105248_10221292 | 3300009177 | Bacteria | 2131 |
| 242 | Ga0105248_10612209 | 3300009177 | Bacteria | 1229 |
| 243 | Ga0105237_10009401 | 3300009545 | Bacteria | 10469 |
| 244 | Ga0105237_10033756 | 3300009545 | Bacteria | 5184 |
| 245 | Ga0105237_10160609 | 3300009545 | Bacteria | 2246 |
| 246 | Ga0105237_10959832 | 3300009545 | Bacteria | 862 |
| 247 | Ga0105237_11215742 | 3300009545 | Bacteria | 760 |
| 248 | Ga0105238_10042360 | 3300009551 | Bacteria | 4611 |
| 249 | Ga0105238_10049191 | 3300009551 | Bacteria | 4247 |
| 250 | Ga0105238_10225883 | 3300009551 | Bacteria | 1849 |
| 251 | Ga0105238_10242274 | 3300009551 | Bacteria | 1781 |
| 252 | Ga0105238_10605773 | 3300009551 | Bacteria | 1103 |
| 253 | Ga0105249_10043356 | 3300009553 | Bacteria | 4092 |
| 254 | Ga0105249_10052668 | 3300009553 | Bacteria | 3717 |
| 255 | Ga0105249_10282383 | 3300009553 | Bacteria | 1659 |
| 256 | Ga0105249_10618845 | 3300009553 | Bacteria | 1139 |
| 257 | Ga0105239_10006226 | 3300010375 | Bacteria | 13885 |
| 258 | Ga0105239_10025843 | 3300010375 | Bacteria | 6467 |
| 259 | Ga0105239_10032597 | 3300010375 | Bacteria | 5725 |
| 260 | Ga0105239_10054201 | 3300010375 | Bacteria | 4398 |
| 261 | Ga0105239_10294287 | 3300010375 | Bacteria | 1828 |
| 262 | Ga0105239_10324233 | 3300010375 | Bacteria | 1737 |
| 263 | Ga0105246_10006538 | 3300011119 | Bacteria | 7118 |
| 264 | Ga0105246_10059478 | 3300011119 | Bacteria | 2651 |
| 265 | Ga0105246_10191870 | 3300011119 | Bacteria | 1582 |
| 266 | Ga0105246_10421170 | 3300011119 | Bacteria | 1114 |
| 267 | Ga0105246_10483753 | 3300011119 | Bacteria | 1048 |
| 268 | Ga0157374_10025945 | 3300013296 | Bacteria | 5268 |
| 269 | Ga0157374_10074206 | 3300013296 | Bacteria | 3211 |
| 270 | Ga0157378_10019128 | 3300013297 | Bacteria | 6017 |
| 271 | Ga0157378_10087727 | 3300013297 | Bacteria | 2822 |
| 272 | Ga0157378_10101599 | 3300013297 | Bacteria | 2626 |
| 273 | Ga0163162_10050121 | 3300013306 | Bacteria | 4187 |
| 274 | Ga0163162_10206640 | 3300013306 | Bacteria | 2093 |
| 275 | Ga0163162_10262948 | 3300013306 | Bacteria | 1857 |
| 276 | Ga0163162_10405715 | 3300013306 | Bacteria | 1496 |
| 277 | Ga0163162_10968636 | 3300013306 | Bacteria | 961 |
| 278 | Ga0157375_10003835 | 3300013308 | Bacteria | 13039 |
| 279 | Ga0157375_10016660 | 3300013308 | Bacteria | 6610 |
| 280 | Ga0157375_10060282 | 3300013308 | Bacteria | 3763 |
| 281 | Ga0157375_10118395 | 3300013308 | Bacteria | 2755 |
| 282 | Ga0157375_10242492 | 3300013308 | Bacteria | 1962 |
| 283 | Ga0157375_10271555 | 3300013308 | Bacteria | 1858 |
| 284 | Ga0157375_11613687 | 3300013308 | Bacteria | 767 |
| 285 | Ga0163163_10040677 | 3300014325 | Bacteria | 4540 |
| 286 | Ga0163163_10134877 | 3300014325 | Bacteria | 2509 |
| 287 | Ga0163163_10339241 | 3300014325 | Bacteria | 1558 |
| 288 | Ga0163163_10798352 | 3300014325 | Bacteria | 1007 |
| 289 | Ga0163163_11491717 | 3300014325 | Bacteria | 737 |
| 290 | Ga0157380_10264581 | 3300014326 | Bacteria | 1564 |
| 291 | Ga0157377_10278377 | 3300014745 | Bacteria | 1096 |
| 292 | Ga0157379_10602264 | 3300014968 | Bacteria | 1026 |
| 293 | Ga0157376_10021798 | 3300014969 | Bacteria | 4980 |
| 294 | Ga0157376_10038264 | 3300014969 | Bacteria | 3901 |
| 295 | Ga0157376_10794706 | 3300014969 | Bacteria | 958 |
| 296 | Ga0163161_10045299 | 3300017792 | Bacteria | 3172 |
| 297 | Ga0163161_10083802 | 3300017792 | Bacteria | 2350 |
| 298 | Ga0163161_10197527 | 3300017792 | Bacteria | 1549 |
| 299 | Ga0213872_10089598 | 3300021361 | Bacteria | 1377 |
| 300 | Ga0209233_1006541 | 3300025261 | Bacteria | 3748 |
| 301 | Ga0209758_1017706 | 3300025297 | Bacteria | 3529 |
| 302 | Ga0209051_1003827 | 3300025303 | Bacteria | 9634 |
| 303 | Ga0207656_10017624 | 3300025321 | Bacteria | 2800 |
| 304 | Ga0207682_10000243 | 3300025893 | Bacteria | 24690 |
| 305 | Ga0207642_10023155 | 3300025899 | Bacteria | 2477 |
| 306 | Ga0207642_10108073 | 3300025899 | Bacteria | 1411 |
| 307 | Ga0207710_10129305 | 3300025900 | Bacteria | 1212 |
| 308 | Ga0207688_10011640 | 3300025901 | Bacteria | 4785 |
| 309 | Ga0207688_10042147 | 3300025901 | Bacteria | 2541 |
| 310 | Ga0207680_10279251 | 3300025903 | Bacteria | 1160 |
| 311 | Ga0207647_10103374 | 3300025904 | Bacteria | 1689 |
| 312 | Ga0207699_10060197 | 3300025906 | Bacteria | 2279 |
| 313 | Ga0207645_10000045 | 3300025907 | Bacteria | 85310 |
| 314 | Ga0207645_10107330 | 3300025907 | Bacteria | 1805 |
| 315 | Ga0207643_10012247 | 3300025908 | Bacteria | 4637 |
| 316 | Ga0207705_10449524 | 3300025909 | Bacteria | 999 |
| 317 | Ga0207654_10019526 | 3300025911 | Bacteria | 3578 |
| 318 | Ga0207707_10050125 | 3300025912 | Bacteria | 3638 |
| 319 | Ga0207695_10469495 | 3300025913 | Bacteria | 1141 |
| 320 | Ga0207671_10123853 | 3300025914 | Bacteria | 1978 |
| 321 | Ga0207671_10179010 | 3300025914 | Bacteria | 1649 |
| 322 | Ga0207671_10322646 | 3300025914 | Bacteria | 1222 |
| 323 | Ga0207660_10546688 | 3300025917 | Bacteria | 942 |
| 324 | Ga0207657_10226004 | 3300025919 | Bacteria | 1498 |
| 325 | Ga0207649_10014137 | 3300025920 | Bacteria | 4468 |
| 326 | Ga0207649_10020501 | 3300025920 | Bacteria | 3793 |
| 327 | Ga0207652_10016146 | 3300025921 | Bacteria | 6090 |
| 328 | Ga0207681_10023123 | 3300025923 | Bacteria | 3972 |
| 329 | Ga0207681_10476931 | 3300025923 | Bacteria | 1018 |
| 330 | Ga0207694_10037563 | 3300025924 | Bacteria | 3720 |
| 331 | Ga0207694_10054759 | 3300025924 | Bacteria | 3095 |
| 332 | Ga0207694_10441105 | 3300025924 | Bacteria | 1086 |
| 333 | Ga0207650_10245564 | 3300025925 | Bacteria | 1448 |
| 334 | Ga0207650_10251201 | 3300025925 | Bacteria | 1432 |
| 335 | Ga0207659_10029878 | 3300025926 | Bacteria | 3718 |
| 336 | Ga0207659_10312598 | 3300025926 | Bacteria | 1294 |
| 337 | Ga0207687_10020088 | 3300025927 | Bacteria | 4430 |
| 338 | Ga0207687_10052337 | 3300025927 | Bacteria | 2849 |
| 339 | Ga0207687_10102900 | 3300025927 | Bacteria | 2105 |
| 340 | Ga0207687_10197857 | 3300025927 | Bacteria | 1568 |
| 341 | Ga0207687_10815748 | 3300025927 | Bacteria | 796 |
| 342 | Ga0207700_10126299 | 3300025928 | Bacteria | 2082 |
| 343 | Ga0207644_10119886 | 3300025931 | Bacteria | 2001 |
| 344 | Ga0207706_10016793 | 3300025933 | Bacteria | 6606 |
| 345 | Ga0207706_10144647 | 3300025933 | Bacteria | 2092 |
| 346 | Ga0207686_10052617 | 3300025934 | Bacteria | 2542 |
| 347 | Ga0207709_10388716 | 3300025935 | Bacteria | 1063 |
| 348 | Ga0207709_10613168 | 3300025935 | Bacteria | 863 |
| 349 | Ga0207670_10184269 | 3300025936 | Bacteria | 1575 |
| 350 | Ga0207670_10329894 | 3300025936 | Bacteria | 1203 |
| 351 | Ga0207669_10016576 | 3300025937 | Bacteria | 3748 |
| 352 | Ga0207669_10018879 | 3300025937 | Bacteria | 3577 |
| 353 | Ga0207669_10188622 | 3300025937 | Bacteria | 1485 |
| 354 | Ga0207669_10313558 | 3300025937 | Bacteria | 1197 |
| 355 | Ga0207704_10051040 | 3300025938 | Bacteria | 2499 |
| 356 | Ga0207704_10079846 | 3300025938 | Bacteria | 2110 |
| 357 | Ga0207704_10282098 | 3300025938 | Bacteria | 1263 |
| 358 | Ga0207691_10000452 | 3300025940 | Bacteria | 40569 |
| 359 | Ga0207691_10113142 | 3300025940 | Bacteria | 2412 |
| 360 | Ga0207691_10133622 | 3300025940 | Bacteria | 2190 |
| 361 | Ga0207691_10165000 | 3300025940 | Bacteria | 1941 |
| 362 | Ga0207711_10041346 | 3300025941 | Bacteria | 3925 |
| 363 | Ga0207711_10046143 | 3300025941 | Bacteria | 3722 |
| 364 | Ga0207711_10346544 | 3300025941 | Bacteria | 1375 |
| 365 | Ga0207689_10029882 | 3300025942 | Bacteria | 4545 |
| 366 | Ga0207689_10156187 | 3300025942 | Bacteria | 1881 |
| 367 | Ga0207689_10305825 | 3300025942 | Bacteria | 1318 |
| 368 | Ga0207689_10325189 | 3300025942 | Bacteria | 1276 |
| 369 | Ga0207661_10048891 | 3300025944 | Bacteria | 3364 |
| 370 | Ga0207679_10031548 | 3300025945 | Bacteria | 3709 |
| 371 | Ga0207679_10446928 | 3300025945 | Bacteria | 1146 |
| 372 | Ga0207667_10034096 | 3300025949 | Bacteria | 5469 |
| 373 | Ga0207651_10037748 | 3300025960 | Bacteria | 3167 |
| 374 | Ga0207651_10060266 | 3300025960 | Bacteria | 2633 |
| 375 | Ga0207651_10799250 | 3300025960 | Bacteria | 836 |
| 376 | Ga0207712_10204638 | 3300025961 | Bacteria | 1568 |
| 377 | Ga0207712_10334286 | 3300025961 | Bacteria | 1254 |
| 378 | Ga0207712_10407817 | 3300025961 | Bacteria | 1144 |
| 379 | Ga0207712_10542904 | 3300025961 | Bacteria | 999 |
| 380 | Ga0207668_10019309 | 3300025972 | Bacteria | 4306 |
| 381 | Ga0207668_10036661 | 3300025972 | Bacteria | 3274 |
| 382 | Ga0207668_10085658 | 3300025972 | Bacteria | 2300 |
| 383 | Ga0207668_10086905 | 3300025972 | Bacteria | 2285 |
| 384 | Ga0207658_10010640 | 3300025986 | Bacteria | 6253 |
| 385 | Ga0207658_10125546 | 3300025986 | Bacteria | 2053 |
| 386 | Ga0207658_10344876 | 3300025986 | Bacteria | 1295 |
| 387 | Ga0207677_10031617 | 3300026023 | Bacteria | 3391 |
| 388 | Ga0207677_10225264 | 3300026023 | Bacteria | 1506 |
| 389 | Ga0207677_10319270 | 3300026023 | Bacteria | 1290 |
| 390 | Ga0207677_10508390 | 3300026023 | Bacteria | 1043 |
| 391 | Ga0207677_10791596 | 3300026023 | Bacteria | 848 |
| 392 | Ga0207703_10073183 | 3300026035 | Bacteria | 2834 |
| 393 | Ga0207703_10414020 | 3300026035 | Bacteria | 1253 |
| 394 | Ga0207703_10429583 | 3300026035 | Bacteria | 1231 |
| 395 | Ga0207703_10508128 | 3300026035 | Bacteria | 1132 |
| 396 | Ga0207639_10047484 | 3300026041 | Bacteria | 3245 |
| 397 | Ga0207639_10051305 | 3300026041 | Bacteria | 3137 |
| 398 | Ga0207639_10083373 | 3300026041 | Bacteria | 2537 |
| 399 | Ga0207678_10006080 | 3300026067 | Bacteria | 10738 |
| 400 | Ga0207678_10011560 | 3300026067 | Bacteria | 7753 |
| 401 | Ga0207678_10026460 | 3300026067 | Bacteria | 5060 |
| 402 | Ga0207678_10048025 | 3300026067 | Bacteria | 3690 |
| 403 | Ga0207678_10071566 | 3300026067 | Bacteria | 2973 |
| 404 | Ga0207678_10152734 | 3300026067 | Bacteria | 1972 |
| 405 | Ga0207708_10014165 | 3300026075 | Bacteria | 5962 |
| 406 | Ga0207708_10250326 | 3300026075 | Bacteria | 1427 |
| 407 | Ga0207708_10861147 | 3300026075 | Bacteria | 783 |
| 408 | Ga0207641_10037960 | 3300026088 | Bacteria | 4025 |
| 409 | Ga0207641_10269196 | 3300026088 | Bacteria | 1598 |
| 410 | Ga0207641_10360263 | 3300026088 | Bacteria | 1388 |
| 411 | Ga0207641_10519386 | 3300026088 | Bacteria | 1158 |
| 412 | Ga0207641_10883131 | 3300026088 | Bacteria | 887 |
| 413 | Ga0207648_10009278 | 3300026089 | Bacteria | 9446 |
| 414 | Ga0207648_10011805 | 3300026089 | Bacteria | 8209 |
| 415 | Ga0207648_10226751 | 3300026089 | Bacteria | 1661 |
| 416 | Ga0207648_10291036 | 3300026089 | Bacteria | 1462 |
| 417 | Ga0207676_10019011 | 3300026095 | Bacteria | 5005 |
| 418 | Ga0207676_10029628 | 3300026095 | Bacteria | 4100 |
| 419 | Ga0207676_10063106 | 3300026095 | Bacteria | 2941 |
| 420 | Ga0207676_10119335 | 3300026095 | Bacteria | 2221 |
| 421 | Ga0207676_10574965 | 3300026095 | Bacteria | 1079 |
| 422 | Ga0207675_100087515 | 3300026118 | Bacteria | 2926 |
| 423 | Ga0207675_100183530 | 3300026118 | Bacteria | 2004 |
| 424 | Ga0207675_100333972 | 3300026118 | Bacteria | 1482 |
| 425 | Ga0207675_100338360 | 3300026118 | Bacteria | 1473 |
| 426 | Ga0207675_100405315 | 3300026118 | Bacteria | 1344 |
| 427 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 428 | Ga0207683_10017266 | 3300026121 | Bacteria | 6147 |
| 429 | Ga0207683_10075559 | 3300026121 | Bacteria | 2982 |
| 430 | Ga0207683_10097079 | 3300026121 | Bacteria | 2628 |
| 431 | Ga0207683_10282643 | 3300026121 | Bacteria | 1516 |
| 432 | Ga0207683_10438286 | 3300026121 | Bacteria | 1204 |
| 433 | Ga0207683_10694538 | 3300026121 | Bacteria | 943 |
| 434 | Ga0207698_10191598 | 3300026142 | Bacteria | 1822 |
| 435 | Ga0209588_1038165 | 3300027671 | Bacteria | 1547 |
| 436 | Ga0207428_10133454 | 3300027907 | Bacteria | 1899 |
| 437 | Ga0268266_10009316 | 3300028379 | Bacteria | 8657 |
| 438 | Ga0268266_10013890 | 3300028379 | Bacteria | 6934 |
| 439 | Ga0268266_10027089 | 3300028379 | Bacteria | 4876 |
| 440 | Ga0268266_10051282 | 3300028379 | Bacteria | 3541 |
| 441 | Ga0268266_10064139 | 3300028379 | Bacteria | 3173 |
| 442 | Ga0268266_10569258 | 3300028379 | Bacteria | 1087 |
| 443 | Ga0268265_10051545 | 3300028380 | Bacteria | 3106 |
| 444 | Ga0268265_10072063 | 3300028380 | Bacteria | 2694 |
| 445 | Ga0268265_10235763 | 3300028380 | Bacteria | 1611 |
| 446 | Ga0268265_10315022 | 3300028380 | Bacteria | 1414 |
| 447 | Ga0268265_10482457 | 3300028380 | Bacteria | 1164 |
| 448 | Ga0268265_10491556 | 3300028380 | Bacteria | 1155 |
| 449 | Ga0268265_10537737 | 3300028380 | Bacteria | 1107 |
| 450 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 451 | Ga0268264_10025888 | 3300028381 | Bacteria | 4790 |
| 452 | Ga0268264_10108789 | 3300028381 | Bacteria | 2424 |
| 453 | Ga0268264_10206537 | 3300028381 | Bacteria | 1800 |
| 454 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 455 | Ga0307517_10125173 | 3300028786 | Bacteria | 1879 |
| 456 | Ga0307515_10024761 | 3300028794 | Bacteria | 10432 |
| 457 | Ga0307515_10276368 | 3300028794 | Bacteria | 1393 |
| 458 | Ga0265330_10037350 | 3300031235 | Bacteria | 2163 |
| 459 | Ga0265332_10011294 | 3300031238 | Bacteria | 3970 |
| 460 | Ga0265325_10012010 | 3300031241 | Bacteria | 4962 |
| 461 | Ga0265340_10005142 | 3300031247 | Bacteria | 7272 |
| 462 | Ga0265331_10036612 | 3300031250 | Bacteria | 2408 |
| 463 | Ga0265331_10142252 | 3300031250 | Bacteria | 1091 |
| 464 | Ga0265316_10229073 | 3300031344 | Bacteria | 1369 |
| 465 | Ga0307513_10224786 | 3300031456 | Bacteria | 1695 |
| 466 | Ga0307509_10030286 | 3300031507 | Bacteria | 5988 |
| 467 | Ga0307509_10041504 | 3300031507 | Bacteria | 4992 |
| 468 | Ga0307509_10224214 | 3300031507 | Bacteria | 1689 |
| 469 | Ga0307509_10237301 | 3300031507 | Bacteria | 1620 |
| 470 | Ga0307509_10237995 | 3300031507 | Bacteria | 1616 |
| 471 | Ga0307408_100002235 | 3300031548 | Bacteria | 13806 |
| 472 | Ga0265342_10045287 | 3300031712 | Bacteria | 2649 |
| 473 | Ga0307516_10043260 | 3300031730 | Bacteria | 4464 |
| 474 | Ga0307405_10014534 | 3300031731 | Bacteria | 4236 |
| 475 | Ga0307405_10044058 | 3300031731 | Bacteria | 2727 |
| 476 | Ga0307405_10055101 | 3300031731 | Bacteria | 2487 |
| 477 | Ga0307413_10005415 | 3300031824 | Bacteria | 5695 |
| 478 | Ga0307413_10096382 | 3300031824 | Bacteria | 1942 |
| 479 | Ga0307410_10136364 | 3300031852 | Bacteria | 1810 |
| 480 | Ga0307406_10019997 | 3300031901 | Bacteria | 3935 |
| 481 | Ga0307407_10004562 | 3300031903 | Bacteria | 5900 |
| 482 | Ga0307412_10022144 | 3300031911 | Bacteria | 3891 |
| 483 | Ga0307412_10055269 | 3300031911 | Bacteria | 2640 |
| 484 | Ga0307416_100005572 | 3300032002 | Bacteria | 7756 |
| 485 | Ga0307416_100419617 | 3300032002 | Bacteria | 1382 |
| 486 | Ga0307416_100535872 | 3300032002 | Bacteria | 1242 |
| 487 | Ga0307416_100714652 | 3300032002 | Bacteria | 1092 |
| 488 | Ga0307414_10333713 | 3300032004 | Bacteria | 1295 |
| 489 | Ga0307411_10115547 | 3300032005 | Bacteria | 1930 |
| 490 | Ga0307411_10239180 | 3300032005 | Bacteria | 1420 |
| 491 | Ga0307415_100156380 | 3300032126 | Bacteria | 1761 |
| 492 | Ga0307415_100156458 | 3300032126 | Bacteria | 1761 |
| 493 | Ga0307510_10010093 | 3300033180 | Bacteria | 11228 |
| 494 | Ga0307510_10061429 | 3300033180 | Bacteria | 3852 |
| 495 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 496 | Ga0373930_0003404 | 3300034816 | Bacteria | 2519 |
| 497 | Ga0373934_0049906 | 3300035086 | Bacteria | 1658 |
| 498 | Ga0373932_0130591 | 3300035112 | Bacteria | 846 |
| 499 | Ga0373942_0011619 | 3300035207 | Bacteria | 2091 |
| 500 | Ga0373961_0141103 | 3300035241 | Bacteria | 814 |
| 501 | Ga0373931_0007598 | 3300035691 | Bacteria | 5107 |
| 502 | Ga0373931_0046305 | 3300035691 | Bacteria | 2299 |
| 503 | Ga0373931_0491480 | 3300035691 | Bacteria | 790 |
| 504 | Ga0373935_0271445 | 3300035692 | Bacteria | 1192 |
| 505 | Ga0373927_0027614 | 3300035695 | Bacteria | 3705 |
| 506 | Ga0373947_0061128 | 3300035725 | Bacteria | 2289 |
| 507 | Ga0372808_025793 | 3300036459 | Bacteria | 844 |
| 508 | Ga0373925_0594519 | 3300037068 | Bacteria | 911 |
| 509 | Ga0395905_0101761 | 3300037471 | Bacteria | 2697 |
| 510 | Ga0395905_0838266 | 3300037471 | Bacteria | 822 |
| 511 | Ga0436361_0629207 | 3300039447 | Bacteria | 6607 |
| 512 | Ga0436361_1049914 | 3300039447 | Bacteria | 6080 |
| 513 | Ga0451791_0193268 | 3300041451 | Bacteria | 1626 |
| 514 | Ga0451837_1135996 | 3300041494 | Bacteria | 700 |
| 515 | Ga0451577_0610604 | 3300042876 | Bacteria | 990 |
| 516 | Ga0451577_0775739 | 3300042876 | Bacteria | 866 |
| 517 | Ga0466965_0019706 | 3300044683 | Bacteria | 3239 |
| 518 | Ga0453684_0076227 | 3300044712 | Bacteria | 4211 |
| 519 | Ga0453684_0099213 | 3300044712 | Bacteria | 3568 |
| 520 | Ga0466968_0105687 | 3300044735 | Bacteria | 1261 |
| 521 | Ga0451576_0496485 | 3300045051 | Bacteria | 1282 |
| 522 | Ga0495617_018296 | 3300046452 | Bacteria | 2369 |
| 523 | Ga0495617_058697 | 3300046452 | Bacteria | 1275 |
| 524 | Ga0495617_061020 | 3300046452 | Bacteria | 1247 |
| 525 | Ga0495603_0008200 | 3300046455 | Bacteria | 6314 |
| 526 | Ga0495603_0078051 | 3300046455 | Bacteria | 1942 |
| 527 | Ga0495603_0117661 | 3300046455 | Bacteria | 1549 |
| 528 | Ga0495603_0229043 | 3300046455 | Bacteria | 1071 |
| 529 | Ga0495590_0038754 | 3300046457 | Bacteria | 1662 |
| 530 | Ga0495629_0473373 | 3300046459 | Bacteria | 847 |
| 531 | Ga0495638_0182573 | 3300046460 | Bacteria | 1196 |
| 532 | Ga0495638_0243303 | 3300046460 | Bacteria | 995 |
| 533 | Ga0495651_0016759 | 3300046462 | Bacteria | 5676 |
| 534 | Ga0495580_0106199 | 3300046472 | Bacteria | 1951 |
| 535 | Ga0495605_0186327 | 3300046474 | Bacteria | 910 |
| 536 | Ga0495639_0076640 | 3300046475 | Bacteria | 1551 |
| 537 | Ga0495639_0078937 | 3300046475 | Bacteria | 1530 |
| 538 | Ga0495664_0162528 | 3300046477 | Bacteria | 1355 |
| 539 | Ga0495584_0063036 | 3300046491 | Bacteria | 1863 |
| 540 | Ga0495584_0274249 | 3300046491 | Bacteria | 857 |
| 541 | Ga0495584_0336603 | 3300046491 | Bacteria | 766 |
| 542 | Ga0495585_0019464 | 3300046492 | Bacteria | 3913 |
| 543 | Ga0495585_0164826 | 3300046492 | Bacteria | 1148 |
| 544 | Ga0495594_0298837 | 3300046499 | Bacteria | 917 |
| 545 | Ga0495596_0036720 | 3300046500 | Bacteria | 1940 |
| 546 | Ga0495607_0182961 | 3300046501 | Bacteria | 1049 |
| 547 | Ga0495620_0086193 | 3300046515 | Bacteria | 1265 |
| 548 | Ga0495643_0039389 | 3300046522 | Bacteria | 2585 |
| 549 | Ga0495644_0090437 | 3300046523 | Bacteria | 1155 |
| 550 | Ga0495644_0145615 | 3300046523 | Bacteria | 905 |
| 551 | Ga0495648_0219814 | 3300046524 | Bacteria | 937 |
| 552 | Ga0495663_0037812 | 3300046525 | Bacteria | 1457 |
| 553 | Ga0495666_0054648 | 3300046526 | Bacteria | 1915 |
| 554 | Ga0495654_0092055 | 3300046530 | Bacteria | 1406 |
| 555 | Ga0495598_0004565 | 3300046537 | Bacteria | 3008 |
| 556 | Ga0495598_0004693 | 3300046537 | Bacteria | 2978 |
| 557 | Ga0495598_0019118 | 3300046537 | Bacteria | 1791 |
| 558 | Ga0495621_0009869 | 3300046539 | Bacteria | 2913 |
| 559 | Ga0495597_0179144 | 3300046542 | Bacteria | 857 |
| 560 | Ga0495622_0015323 | 3300046557 | Bacteria | 3564 |
| 561 | Ga0495622_0036962 | 3300046557 | Bacteria | 2275 |
| 562 | Ga0495656_0007640 | 3300046615 | Bacteria | 3831 |
| 563 | Ga0495656_0060480 | 3300046615 | Bacteria | 1651 |
| 564 | Ga0495656_0091525 | 3300046615 | Bacteria | 1391 |
| 565 | Ga0495656_0211994 | 3300046615 | Bacteria | 965 |
| 566 | Ga0495668_0030525 | 3300046616 | Bacteria | 3042 |
| 567 | Ga0495668_0066743 | 3300046616 | Bacteria | 1979 |
| 568 | Ga0495668_0303940 | 3300046616 | Bacteria | 875 |
| 569 | Ga0495611_0048349 | 3300046648 | Bacteria | 1911 |
| 570 | Ga0495625_0115314 | 3300046660 | Bacteria | 1833 |
| 571 | Ga0495625_0162019 | 3300046660 | Bacteria | 1498 |
| 572 | Ga0495588_0049033 | 3300046674 | Bacteria | 2170 |
| 573 | Ga0495647_0284000 | 3300046681 | Bacteria | 743 |
| 574 | Ga0495613_0455745 | 3300046689 | Bacteria | 866 |
| 575 | Ga0495624_0116002 | 3300046690 | Bacteria | 1646 |
| 576 | Ga0495670_0100193 | 3300046691 | Bacteria | 1491 |
| 577 | Ga0495670_0121937 | 3300046691 | Bacteria | 1354 |
| 578 | Ga0495589_0028532 | 3300046794 | Bacteria | 2816 |
| 579 | Ga0495600_0662466 | 3300046809 | Bacteria | 630 |
| 580 | Ga0495581_0261150 | 3300047315 | Bacteria | 1013 |
| 581 | Ga0495636_0011302 | 3300047318 | Bacteria | 3533 |
| 582 | Ga0495636_0064953 | 3300047318 | Bacteria | 1549 |
| 583 | Ga0495672_0044747 | 3300047320 | Bacteria | 2653 |
| 584 | Ga0495680_0035877 | 3300047322 | Bacteria | 3988 |
| 585 | Ga0495677_0042356 | 3300047445 | Bacteria | 1668 |
| 586 | Ga0495673_0064792 | 3300047469 | Bacteria | 1553 |
| 587 | Ga0495686_0086805 | 3300047472 | Bacteria | 1904 |
| 588 | Ga0495614_0332308 | 3300048089 | Bacteria | 706 |
| 589 | Ga0495626_0133456 | 3300048091 | Bacteria | 1058 |
| 590 | Ga0496100_0056515 | 3300048903 | Bacteria | 2568 |
| 591 | Ga0496100_0317561 | 3300048903 | Bacteria | 1169 |
| 592 | Ga0496101_0040142 | 3300048904 | Bacteria | 3333 |
| 593 | Ga0496101_0188718 | 3300048904 | Bacteria | 1590 |
| 594 | Ga0496102_0006184 | 3300048905 | Bacteria | 10206 |
| 595 | Ga0496102_0055839 | 3300048905 | Bacteria | 3601 |
| 596 | Ga0496102_0102484 | 3300048905 | Bacteria | 2661 |
| 597 | Ga0496102_0107367 | 3300048905 | Bacteria | 2599 |
| 598 | Ga0496103_0006862 | 3300048906 | Bacteria | 6799 |
| 599 | Ga0496104_0182611 | 3300048907 | Bacteria | 2008 |
| 600 | Ga0496105_0015812 | 3300048908 | Bacteria | 6019 |
| 601 | Ga0496106_0002146 | 3300048909 | Bacteria | 14733 |
| 602 | Ga0496106_0009940 | 3300048909 | Bacteria | 7024 |
| 603 | Ga0496106_0112826 | 3300048909 | Bacteria | 2118 |
| 604 | Ga0496106_0151221 | 3300048909 | Bacteria | 1831 |
| 605 | Ga0496106_0255960 | 3300048909 | Bacteria | 1400 |
| 606 | Ga0496107_0026018 | 3300048910 | Bacteria | 4146 |
| 607 | Ga0496107_0192009 | 3300048910 | Bacteria | 1517 |
| 608 | Ga0496108_0024899 | 3300048911 | Bacteria | 4929 |
| 609 | Ga0496108_0054602 | 3300048911 | Bacteria | 3353 |
| 610 | Ga0496109_0010481 | 3300048912 | Bacteria | 7919 |
| 611 | Ga0496109_0016308 | 3300048912 | Bacteria | 6493 |
| 612 | Ga0496109_0705350 | 3300048912 | Bacteria | 946 |
| 613 | Ga0496110_0033478 | 3300048913 | Bacteria | 4445 |
| 614 | Ga0496111_0011084 | 3300048914 | Bacteria | 6067 |
| 615 | Ga0496111_0024988 | 3300048914 | Bacteria | 4213 |
| 616 | Ga0496112_0000022 | 3300048915 | Bacteria | 156255 |
| 617 | Ga0496112_0008650 | 3300048915 | Bacteria | 9128 |
| 618 | Ga0496112_0008856 | 3300048915 | Bacteria | 9029 |
| 619 | Ga0496113_0012773 | 3300048916 | Bacteria | 5658 |
| 620 | Ga0496113_0144243 | 3300048916 | Bacteria | 1875 |
| 621 | Ga0496113_0253076 | 3300048916 | Bacteria | 1406 |
| 622 | Ga0496113_0299625 | 3300048916 | Bacteria | 1287 |
| 623 | Ga0496114_0018024 | 3300048917 | Bacteria | 5704 |
| 624 | Ga0496114_0025976 | 3300048917 | Bacteria | 4791 |
| 625 | Ga0496114_0583679 | 3300048917 | Bacteria | 986 |
| 626 | Ga0496115_0015540 | 3300048918 | Bacteria | 5776 |
| 627 | Ga0496115_0076300 | 3300048918 | Bacteria | 2724 |
| 628 | Ga0496115_0136545 | 3300048918 | Bacteria | 2022 |
| 629 | Ga0496116_0133859 | 3300048919 | Bacteria | 1408 |
| 630 | Ga0496117_0072389 | 3300048920 | Bacteria | 2304 |
| 631 | Ga0496117_0090274 | 3300048920 | Bacteria | 1975 |
| 632 | Ga0496117_0113366 | 3300048920 | Bacteria | 1684 |
| 633 | Ga0496118_0006640 | 3300048921 | Bacteria | 12631 |
| 634 | Ga0496118_0031958 | 3300048921 | Bacteria | 4348 |
| 635 | Ga0496118_0173273 | 3300048921 | Bacteria | 1315 |
| 636 | Ga0496118_0189289 | 3300048921 | Bacteria | 1233 |
| 637 | Ga0496119_0154557 | 3300048922 | Bacteria | 1226 |
| 638 | Ga0496119_0276498 | 3300048922 | Bacteria | 837 |
| 639 | Ga0496120_0106206 | 3300048923 | Bacteria | 1475 |
| 640 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 641 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 642 | Ga0496121_0012395 | 3300048924 | Bacteria | 9307 |
| 643 | Ga0496121_0027341 | 3300048924 | Bacteria | 5339 |
| 644 | Ga0496121_0036689 | 3300048924 | Bacteria | 4364 |
| 645 | Ga0496121_0101064 | 3300048924 | Bacteria | 2225 |
| 646 | Ga0496121_0121575 | 3300048924 | Bacteria | 1971 |
| 647 | Ga0496121_0201148 | 3300048924 | Bacteria | 1420 |
| 648 | Ga0496122_0044528 | 3300048925 | Bacteria | 3461 |
| 649 | Ga0496124_0001236 | 3300048927 | Bacteria | 39269 |
| 650 | Ga0496124_0021839 | 3300048927 | Bacteria | 5887 |
| 651 | Ga0496124_0115446 | 3300048927 | Bacteria | 2154 |
| 652 | Ga0496124_0235348 | 3300048927 | Bacteria | 1366 |
| 653 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 654 | Ga0496125_0002791 | 3300048928 | Bacteria | 22081 |
| 655 | Ga0496125_0013848 | 3300048928 | Bacteria | 7895 |
| 656 | Ga0496125_0196049 | 3300048928 | Bacteria | 1328 |
| 657 | Ga0496125_0262094 | 3300048928 | Bacteria | 1082 |
| 658 | Ga0496126_0013383 | 3300048929 | Bacteria | 8350 |
| 659 | Ga0496126_0031094 | 3300048929 | Bacteria | 5048 |
| 660 | Ga0496126_0080959 | 3300048929 | Bacteria | 2872 |
| 661 | Ga0496126_0094722 | 3300048929 | Bacteria | 2620 |
| 662 | Ga0496126_0114563 | 3300048929 | Bacteria | 2345 |
| 663 | Ga0496126_0141195 | 3300048929 | Bacteria | 2073 |
| 664 | Ga0496126_0186516 | 3300048929 | Bacteria | 1759 |
| 665 | Ga0496126_0502682 | 3300048929 | Bacteria | 968 |
| 666 | Ga0496126_0534551 | 3300048929 | Bacteria | 932 |
| 667 | Ga0495678_065081 | 3300049459 | Bacteria | 1355 |
| 668 | Ga0501036_0722202 | 3300049572 | Unclassified | 823 |
| 669 | Ga0501039_0728620 | 3300049575 | Bacteria | 775 |
| 670 | Ga0501073_0534933 | 3300049589 | Bacteria | 810 |
| 671 | Ga0501044_0177873 | 3300049823 | Bacteria | 2096 |
| 672 | nmdc:mga03683_140166_c1 | 3300050489 | Bacteria | 1087 |
| 673 | nmdc:mga03683_171936_c1 | 3300050489 | Bacteria | 985 |
| 674 | nmdc:mga03n38_50524_c1 | 3300050490 | Bacteria | 1854 |
| 675 | nmdc:mga00v17_79997_c1 | 3300050491 | Bacteria | 1008 |
| 676 | nmdc:mga0yw44_102000_c1 | 3300050492 | Bacteria | 1829 |
| 677 | nmdc:mga0yw44_185192_c1 | 3300050492 | Bacteria | 1372 |
| 678 | nmdc:mga0yw44_228152_c1 | 3300050492 | Bacteria | 1236 |
| 679 | nmdc:mga0yw44_47938_c1 | 3300050492 | Bacteria | 2574 |
| 680 | nmdc:mga06z11_2940_c1 | 3300050494 | Bacteria | 6558 |
| 681 | nmdc:mga06z11_335727_c1 | 3300050494 | Bacteria | 903 |
| 682 | nmdc:mga04h51_45179_c1 | 3300050495 | Bacteria | 1456 |
| 683 | nmdc:mga07m45_105530_c1 | 3300050496 | Bacteria | 1621 |
| 684 | nmdc:mga07m45_45718_c1 | 3300050496 | Bacteria | 2458 |
| 685 | nmdc:mga07m45_66878_c1 | 3300050496 | Bacteria | 2042 |
| 686 | nmdc:mga05p37_57183_c1 | 3300050507 | Bacteria | 4803 |
| 687 | nmdc:mga0n895_206416_c1 | 3300050512 | Bacteria | 1995 |
| 688 | nmdc:mga0n895_61527_c1 | 3300050512 | Bacteria | 3707 |
| 689 | nmdc:mga0n895_806596_c1 | 3300050512 | Bacteria | 929 |
| 690 | nmdc:mga0rr50_423583_c1 | 3300050513 | Bacteria | 1126 |
| 691 | nmdc:mga0a205_333403_c1 | 3300050515 | Bacteria | 1386 |
| 692 | nmdc:mga0sz30_221674_c1 | 3300050516 | Bacteria | 841 |
| 693 | nmdc:mga0sz30_28917_c2 | 3300050516 | Bacteria | 1506 |
| 694 | Ga0500635_0000894 | 3300053080 | Bacteria | 7242 |
| 695 | Ga0495655_0029188 | 3300053083 | Bacteria | 1324 |
| 696 | Ga0495595_0004191 | 3300053084 | Bacteria | 5799 |
| 697 | Ga0495619_0195611 | 3300053085 | Bacteria | 1400 |
| 698 | Ga0500644_0184926 | 3300053088 | Bacteria | 855 |
| 699 | Ga0500583_0155906 | 3300053092 | Bacteria | 1137 |
| 700 | Ga0500566_0039553 | 3300053094 | Bacteria | 2726 |
| 701 | Ga0500650_0190306 | 3300053098 | Bacteria | 937 |
| 702 | Ga0500650_0190624 | 3300053098 | Bacteria | 936 |
| 703 | Ga0500554_062200 | 3300053102 | Bacteria | 1200 |
| 704 | Ga0500572_000383 | 3300053111 | Bacteria | 15750 |
| 705 | Ga0500594_0046224 | 3300053118 | Bacteria | 1210 |
| 706 | Ga0500595_000730 | 3300053119 | Bacteria | 19558 |
| 707 | Ga0500595_010244 | 3300053119 | Bacteria | 3733 |
| 708 | Ga0500595_018807 | 3300053119 | Bacteria | 2519 |
| 709 | Ga0500618_012347 | 3300053125 | Bacteria | 2238 |
| 710 | Ga0500642_0044293 | 3300053130 | Bacteria | 1937 |
| 711 | Ga0500642_0224041 | 3300053130 | Bacteria | 870 |
| 712 | Ga0500655_020538 | 3300053133 | Bacteria | 1234 |
| 713 | Ga0500559_0000486 | 3300053136 | Bacteria | 28052 |
| 714 | Ga0500559_0083822 | 3300053136 | Bacteria | 1452 |
| 715 | Ga0500559_0113643 | 3300053136 | Bacteria | 1256 |
| 716 | Ga0500568_0008112 | 3300053139 | Bacteria | 5092 |
| 717 | Ga0500568_0072064 | 3300053139 | Bacteria | 1322 |
| 718 | Ga0500573_0130733 | 3300053140 | Bacteria | 1390 |
| 719 | Ga0500603_000741 | 3300053150 | Bacteria | 7961 |
| 720 | Ga0500603_036444 | 3300053150 | Bacteria | 1294 |
| 721 | Ga0500604_0267764 | 3300053151 | Bacteria | 592 |
| 722 | Ga0500627_0110097 | 3300053158 | Bacteria | 1240 |
| 723 | Ga0500627_0236034 | 3300053158 | Bacteria | 812 |
| 724 | Ga0500638_000379 | 3300053162 | Bacteria | 10416 |
| 725 | Ga0500639_118147 | 3300053163 | Bacteria | 1278 |
| 726 | Ga0500637_0001280 | 3300053178 | Bacteria | 10539 |
| 727 | Ga0500576_065937 | 3300053725 | Bacteria | 1570 |
| 728 | Ga0500645_066633 | 3300053730 | Bacteria | 1036 |
| 729 | Ga0500609_014367 | 3300053731 | Bacteria | 1073 |
| 730 | Ga0500596_000696 | 3300053735 | Bacteria | 6550 |
| 731 | Ga0500661_000550 | 3300055283 | Bacteria | 7001 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0662466 | Ga0495600_0662466_64_570 | 165 |
| 2 | 3300048089 | Ga0495614_0332308 | Ga0495614_0332308_20_526 | 165 |
| 3 | 3300028380 | Ga0268265_10491556 | Ga0268265_104915562 | 169 |
| 4 | 3300053151 | Ga0500604_0267764 | Ga0500604_0267764_61_576 | 170 |
| 5 | 3300031235 | Ga0265330_10037350 | Ga0265330_100373501 | 174 |
| 6 | 3300031238 | Ga0265332_10011294 | Ga0265332_100112945 | 174 |
| 7 | 3300031241 | Ga0265325_10012010 | Ga0265325_100120104 | 174 |
| 8 | 3300031250 | Ga0265331_10036612 | Ga0265331_100366123 | 174 |
| 9 | 3300031712 | Ga0265342_10045287 | Ga0265342_100452872 | 174 |
| 10 | 3300005331 | Ga0070670_100151800 | Ga0070670_1001518002 | 183 |
| 11 | 3300005367 | Ga0070667_100316757 | Ga0070667_1003167572 | 183 |
| 12 | 3300005617 | Ga0068859_100217700 | Ga0068859_1002177003 | 183 |
| 13 | 3300005618 | Ga0068864_100086324 | Ga0068864_1000863242 | 183 |
| 14 | 3300005842 | Ga0068858_100133876 | Ga0068858_1001338763 | 183 |
| 15 | 3300006931 | Ga0097620_100217712 | Ga0097620_1002177123 | 183 |
| 16 | 3300009098 | Ga0105245_11171872 | Ga0105245_111718722 | 183 |
| 17 | 3300013308 | Ga0157375_11613687 | Ga0157375_116136871 | 183 |
| 18 | 3300025927 | Ga0207687_10815748 | Ga0207687_108157481 | 183 |
| 19 | 3300026035 | Ga0207703_10508128 | Ga0207703_105081282 | 183 |
| 20 | 3300026095 | Ga0207676_10119335 | Ga0207676_101193352 | 183 |
| 21 | 3300026118 | Ga0207675_100333972 | Ga0207675_1003339721 | 183 |
| 22 | 3300026067 | Ga0207678_10011560 | Ga0207678_100115602 | 185 |
| 23 | 3300031731 | Ga0307405_10014534 | Ga0307405_100145346 | 200 |
| 24 | 3300032004 | Ga0307414_10333713 | Ga0307414_103337132 | 200 |
| 25 | 3300005438 | Ga0070701_10111907 | Ga0070701_101119071 | 201 |
| 26 | 3300005455 | Ga0070663_100371471 | Ga0070663_1003714711 | 201 |
| 27 | 3300032005 | Ga0307411_10115547 | Ga0307411_101155472 | 201 |
| 28 | 3300048905 | Ga0496102_0102484 | Ga0496102_0102484_543_1190 | 201 |
| 29 | 3300005336 | Ga0070680_100202121 | Ga0070680_1002021212 | 202 |
| 30 | 3300005458 | Ga0070681_10535506 | Ga0070681_105355061 | 202 |
| 31 | 3300025912 | Ga0207707_10050125 | Ga0207707_100501254 | 202 |
| 32 | 3300025917 | Ga0207660_10546688 | Ga0207660_105466881 | 202 |
| 33 | 3300049575 | Ga0501039_0728620 | Ga0501039_0728620_55_690 | 202 |
| 34 | 3300049823 | Ga0501044_0177873 | Ga0501044_0177873_725_1360 | 202 |
| 35 | 3300005471 | Ga0070698_100624788 | Ga0070698_1006247881 | 203 |
| 36 | 3300005549 | Ga0070704_100017490 | Ga0070704_1000174907 | 203 |
| 37 | 3300005617 | Ga0068859_100151549 | Ga0068859_1001515492 | 203 |
| 38 | 3300006931 | Ga0097620_100151548 | Ga0097620_1001515482 | 203 |
| 39 | 3300013297 | Ga0157378_10019128 | Ga0157378_100191285 | 204 |
| 40 | 3300005331 | Ga0070670_100263660 | Ga0070670_1002636601 | 206 |
| 41 | 3300005618 | Ga0068864_100024533 | Ga0068864_1000245336 | 206 |
| 42 | 3300005841 | Ga0068863_100015678 | Ga0068863_1000156785 | 206 |
| 43 | 3300009553 | Ga0105249_10052668 | Ga0105249_100526684 | 206 |
| 44 | 3300025925 | Ga0207650_10251201 | Ga0207650_102512013 | 206 |
| 45 | 3300025926 | Ga0207659_10312598 | Ga0207659_103125982 | 206 |
| 46 | 3300025961 | Ga0207712_10204638 | Ga0207712_102046383 | 206 |
| 47 | 3300026088 | Ga0207641_10037960 | Ga0207641_100379605 | 206 |
| 48 | 3300026095 | Ga0207676_10019011 | Ga0207676_100190113 | 206 |
| 49 | 3300028380 | Ga0268265_10072063 | Ga0268265_100720633 | 206 |
| 50 | 3300037068 | Ga0373925_0594519 | Ga0373925_0594519_102_731 | 206 |
| 51 | 3300046499 | Ga0495594_0298837 | Ga0495594_0298837_241_870 | 206 |
| 52 | 3300046689 | Ga0495613_0455745 | Ga0495613_0455745_162_791 | 206 |
| 53 | 3300047322 | Ga0495680_0035877 | Ga0495680_0035877_2564_3193 | 206 |
| 54 | 3300003316 | rootH1_10063808 | rootH1_100638082 | 207 |
| 55 | 3300003323 | rootH1_10046565 | rootH1_100465653 | 207 |
| 56 | 3300005547 | Ga0070693_100416569 | Ga0070693_1004165691 | 207 |
| 57 | 3300005843 | Ga0068860_100000441 | Ga0068860_1000004419 | 207 |
| 58 | 3300006871 | Ga0075434_100013575 | Ga0075434_1000135752 | 207 |
| 59 | 3300007076 | Ga0075435_100086681 | Ga0075435_1000866813 | 207 |
| 60 | 3300009098 | Ga0105245_10082796 | Ga0105245_100827963 | 207 |
| 61 | 3300021361 | Ga0213872_10089598 | Ga0213872_100895981 | 207 |
| 62 | 3300025303 | Ga0209051_1003827 | Ga0209051_10038273 | 207 |
| 63 | 3300025927 | Ga0207687_10102900 | Ga0207687_101029002 | 207 |
| 64 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004258 | 207 |
| 65 | 3300031507 | Ga0307509_10224214 | Ga0307509_102242142 | 207 |
| 66 | 3300039447 | Ga0436361_0629207 | Ga0436361_0629207_4437_5069 | 207 |
| 67 | 3300039447 | Ga0436361_1049914 | Ga0436361_1049914_4131_4763 | 207 |
| 68 | 3300045051 | Ga0451576_0496485 | Ga0451576_0496485_73_705 | 207 |
| 69 | 3300046681 | Ga0495647_0284000 | Ga0495647_0284000_32_664 | 207 |
| 70 | 3300048927 | Ga0496124_0235348 | Ga0496124_0235348_550_1179 | 207 |
| 71 | iso_pu_bacteria | 2513237096 | 2513655415 | 207 |
| 72 | iso_pu_bacteria | 2513237137 | 2513860021 | 207 |
| 73 | iso_pu_bacteria | 2513237145 | 2513916507 | 207 |
| 74 | iso_pu_bacteria | 2517572143 | 2517889902 | 207 |
| 75 | iso_pu_bacteria | 2524023210 | 2524470519 | 207 |
| 76 | iso_pu_bacteria | 2667528175 | 2671121074 | 207 |
| 77 | iso_pu_bacteria | 2728368998 | 2728751700 | 207 |
| 78 | iso_pu_bacteria | 2791355197 | 2793068150 | 207 |
| 79 | iso_pu_bacteria | 2885374607 | 2885379430 | 207 |
| 80 | iso_pu_bacteria | 2903748898 | 2903750749 | 207 |
| 81 | iso_pu_bacteria | 2904690495 | 2904692660 | 207 |
| 82 | iso_pu_bacteria | 2906610324 | 2906612360 | 207 |
| 83 | iso_pu_bacteria | 2906635258 | 2906638314 | 207 |
| 84 | iso_pu_bacteria | 2906660503 | 2906663401 | 207 |
| 85 | iso_pu_bacteria | 2908739725 | 2908739767 | 207 |
| 86 | iso_pu_bacteria | 2908756301 | 2908757872 | 207 |
| 87 | iso_pu_bacteria | 2922425934 | 2922426935 | 207 |
| 88 | iso_pu_bacteria | 2935630451 | 2935633094 | 207 |
| 89 | iso_pu_bacteria | 2941507105 | 2941509604 | 207 |
| 90 | iso_pu_bacteria | 2941515067 | 2941517433 | 207 |
| 91 | iso_pu_bacteria | 2941523033 | 2941526614 | 207 |
| 92 | iso_pu_bacteria | 3005474847 | 3005476119 | 207 |
| 93 | iso_pu_bacteria | 8006933436 | 8006937433 | 207 |
| 94 | iso_pu_bacteria | 8006973647 | 8006977462 | 207 |
| 95 | iso_pu_bacteria | 8019555841 | 8019561192 | 207 |
| 96 | iso_pu_bacteria | 8019565922 | 8019571282 | 207 |
| 97 | iso_pu_bacteria | 8056681323 | 8056685981 | 207 |
| 98 | 3300005328 | Ga0070676_10001300 | Ga0070676_100013002 | 208 |
| 99 | 3300005330 | Ga0070690_100613710 | Ga0070690_1006137102 | 208 |
| 100 | 3300005331 | Ga0070670_100289949 | Ga0070670_1002899491 | 208 |
| 101 | 3300005333 | Ga0070677_10003729 | Ga0070677_100037292 | 208 |
| 102 | 3300005334 | Ga0068869_100006393 | Ga0068869_10000639310 | 208 |
| 103 | 3300005335 | Ga0070666_10001057 | Ga0070666_1000105716 | 208 |
| 104 | 3300005338 | Ga0068868_100013250 | Ga0068868_1000132502 | 208 |
| 105 | 3300005347 | Ga0070668_100004548 | Ga0070668_1000045482 | 208 |
| 106 | 3300005347 | Ga0070668_100185959 | Ga0070668_1001859592 | 208 |
| 107 | 3300005347 | Ga0070668_100253439 | Ga0070668_1002534392 | 208 |
| 108 | 3300005347 | Ga0070668_100321353 | Ga0070668_1003213532 | 208 |
| 109 | 3300005347 | Ga0070668_100592773 | Ga0070668_1005927732 | 208 |
| 110 | 3300005353 | Ga0070669_100009203 | Ga0070669_1000092036 | 208 |
| 111 | 3300005354 | Ga0070675_100001972 | Ga0070675_10000197214 | 208 |
| 112 | 3300005355 | Ga0070671_100001035 | Ga0070671_10000103517 | 208 |
| 113 | 3300005356 | Ga0070674_100001310 | Ga0070674_10000131013 | 208 |
| 114 | 3300005364 | Ga0070673_100001352 | Ga0070673_10000135216 | 208 |
| 115 | 3300005366 | Ga0070659_100273058 | Ga0070659_1002730582 | 208 |
| 116 | 3300005367 | Ga0070667_100002933 | Ga0070667_10000293311 | 208 |
| 117 | 3300005367 | Ga0070667_100439515 | Ga0070667_1004395152 | 208 |
| 118 | 3300005455 | Ga0070663_100034595 | Ga0070663_1000345953 | 208 |
| 119 | 3300005456 | Ga0070678_100001003 | Ga0070678_1000010035 | 208 |
| 120 | 3300005456 | Ga0070678_100311781 | Ga0070678_1003117811 | 208 |
| 121 | 3300005459 | Ga0068867_100010975 | Ga0068867_1000109752 | 208 |
| 122 | 3300005539 | Ga0068853_100016152 | Ga0068853_1000161522 | 208 |
| 123 | 3300005543 | Ga0070672_100004801 | Ga0070672_1000048017 | 208 |
| 124 | 3300005548 | Ga0070665_100038313 | Ga0070665_1000383132 | 208 |
| 125 | 3300005548 | Ga0070665_100418625 | Ga0070665_1004186252 | 208 |
| 126 | 3300005564 | Ga0070664_100445627 | Ga0070664_1004456272 | 208 |
| 127 | 3300005615 | Ga0070702_100269726 | Ga0070702_1002697261 | 208 |
| 128 | 3300005615 | Ga0070702_100391619 | Ga0070702_1003916191 | 208 |
| 129 | 3300005616 | Ga0068852_100001098 | Ga0068852_1000010988 | 208 |
| 130 | 3300005618 | Ga0068864_100031446 | Ga0068864_1000314465 | 208 |
| 131 | 3300005618 | Ga0068864_100227737 | Ga0068864_1002277372 | 208 |
| 132 | 3300005834 | Ga0068851_10000852 | Ga0068851_100008522 | 208 |
| 133 | 3300005840 | Ga0068870_10007499 | Ga0068870_100074995 | 208 |
| 134 | 3300005842 | Ga0068858_100234024 | Ga0068858_1002340242 | 208 |
| 135 | 3300005843 | Ga0068860_100006265 | Ga0068860_1000062658 | 208 |
| 136 | 3300006038 | Ga0075365_10189448 | Ga0075365_101894482 | 208 |
| 137 | 3300006038 | Ga0075365_10273506 | Ga0075365_102735062 | 208 |
| 138 | 3300006042 | Ga0075368_10009758 | Ga0075368_100097582 | 208 |
| 139 | 3300006048 | Ga0075363_100001726 | Ga0075363_1000017262 | 208 |
| 140 | 3300006177 | Ga0075362_10172111 | Ga0075362_101721112 | 208 |
| 141 | 3300006178 | Ga0075367_10074104 | Ga0075367_100741042 | 208 |
| 142 | 3300006237 | Ga0097621_100072169 | Ga0097621_1000721695 | 208 |
| 143 | 3300006353 | Ga0075370_10056009 | Ga0075370_100560092 | 208 |
| 144 | 3300006353 | Ga0075370_10106289 | Ga0075370_101062892 | 208 |
| 145 | 3300006358 | Ga0068871_100017539 | Ga0068871_1000175392 | 208 |
| 146 | 3300006844 | Ga0075428_100051259 | Ga0075428_1000512596 | 208 |
| 147 | 3300006871 | Ga0075434_100375451 | Ga0075434_1003754512 | 208 |
| 148 | 3300006871 | Ga0075434_100922435 | Ga0075434_1009224351 | 208 |
| 149 | 3300009101 | Ga0105247_10338387 | Ga0105247_103383871 | 208 |
| 150 | 3300009174 | Ga0105241_10414686 | Ga0105241_104146861 | 208 |
| 151 | 3300011119 | Ga0105246_10191870 | Ga0105246_101918702 | 208 |
| 152 | 3300013296 | Ga0157374_10074206 | Ga0157374_100742062 | 208 |
| 153 | 3300013306 | Ga0163162_10206640 | Ga0163162_102066402 | 208 |
| 154 | 3300013306 | Ga0163162_10968636 | Ga0163162_109686362 | 208 |
| 155 | 3300013308 | Ga0157375_10003835 | Ga0157375_100038356 | 208 |
| 156 | 3300013308 | Ga0157375_10242492 | Ga0157375_102424923 | 208 |
| 157 | 3300013308 | Ga0157375_10271555 | Ga0157375_102715552 | 208 |
| 158 | 3300014325 | Ga0163163_10339241 | Ga0163163_103392412 | 208 |
| 159 | 3300014969 | Ga0157376_10038264 | Ga0157376_100382642 | 208 |
| 160 | 3300025321 | Ga0207656_10017624 | Ga0207656_100176242 | 208 |
| 161 | 3300025893 | Ga0207682_10000243 | Ga0207682_100002432 | 208 |
| 162 | 3300025901 | Ga0207688_10042147 | Ga0207688_100421471 | 208 |
| 163 | 3300025907 | Ga0207645_10000045 | Ga0207645_1000004517 | 208 |
| 164 | 3300025908 | Ga0207643_10012247 | Ga0207643_100122475 | 208 |
| 165 | 3300025923 | Ga0207681_10023123 | Ga0207681_100231231 | 208 |
| 166 | 3300025925 | Ga0207650_10245564 | Ga0207650_102455641 | 208 |
| 167 | 3300025926 | Ga0207659_10029878 | Ga0207659_100298783 | 208 |
| 168 | 3300025931 | Ga0207644_10119886 | Ga0207644_101198862 | 208 |
| 169 | 3300025933 | Ga0207706_10144647 | Ga0207706_101446474 | 208 |
| 170 | 3300025937 | Ga0207669_10016576 | Ga0207669_100165763 | 208 |
| 171 | 3300025940 | Ga0207691_10000452 | Ga0207691_1000045227 | 208 |
| 172 | 3300025942 | Ga0207689_10305825 | Ga0207689_103058252 | 208 |
| 173 | 3300025945 | Ga0207679_10446928 | Ga0207679_104469282 | 208 |
| 174 | 3300025960 | Ga0207651_10060266 | Ga0207651_100602662 | 208 |
| 175 | 3300025972 | Ga0207668_10036661 | Ga0207668_100366613 | 208 |
| 176 | 3300025972 | Ga0207668_10085658 | Ga0207668_100856582 | 208 |
| 177 | 3300025986 | Ga0207658_10010640 | Ga0207658_100106402 | 208 |
| 178 | 3300025986 | Ga0207658_10125546 | Ga0207658_101255462 | 208 |
| 179 | 3300026023 | Ga0207677_10225264 | Ga0207677_102252642 | 208 |
| 180 | 3300026023 | Ga0207677_10508390 | Ga0207677_105083902 | 208 |
| 181 | 3300026041 | Ga0207639_10047484 | Ga0207639_100474842 | 208 |
| 182 | 3300026067 | Ga0207678_10048025 | Ga0207678_100480252 | 208 |
| 183 | 3300026088 | Ga0207641_10883131 | Ga0207641_108831311 | 208 |
| 184 | 3300026089 | Ga0207648_10009278 | Ga0207648_100092786 | 208 |
| 185 | 3300026095 | Ga0207676_10063106 | Ga0207676_100631062 | 208 |
| 186 | 3300026095 | Ga0207676_10574965 | Ga0207676_105749651 | 208 |
| 187 | 3300026118 | Ga0207675_100183530 | Ga0207675_1001835302 | 208 |
| 188 | 3300026121 | Ga0207683_10000003 | Ga0207683_1000000382 | 208 |
| 189 | 3300026121 | Ga0207683_10282643 | Ga0207683_102826432 | 208 |
| 190 | 3300026142 | Ga0207698_10191598 | Ga0207698_101915982 | 208 |
| 191 | 3300028379 | Ga0268266_10009316 | Ga0268266_100093163 | 208 |
| 192 | 3300028379 | Ga0268266_10013890 | Ga0268266_100138906 | 208 |
| 193 | 3300028381 | Ga0268264_10025888 | Ga0268264_100258884 | 208 |
| 194 | 3300031548 | Ga0307408_100002235 | Ga0307408_10000223510 | 208 |
| 195 | 3300031731 | Ga0307405_10044058 | Ga0307405_100440582 | 208 |
| 196 | 3300031824 | Ga0307413_10005415 | Ga0307413_100054157 | 208 |
| 197 | 3300031901 | Ga0307406_10019997 | Ga0307406_100199976 | 208 |
| 198 | 3300031903 | Ga0307407_10004562 | Ga0307407_100045622 | 208 |
| 199 | 3300031911 | Ga0307412_10022144 | Ga0307412_100221442 | 208 |
| 200 | 3300032002 | Ga0307416_100005572 | Ga0307416_1000055727 | 208 |
| 201 | 3300032002 | Ga0307416_100535872 | Ga0307416_1005358722 | 208 |
| 202 | 3300032005 | Ga0307411_10239180 | Ga0307411_102391802 | 208 |
| 203 | 3300032126 | Ga0307415_100156380 | Ga0307415_1001563802 | 208 |
| 204 | 3300042876 | Ga0451577_0610604 | Ga0451577_0610604_334_963 | 208 |
| 205 | 3300042876 | Ga0451577_0775739 | Ga0451577_0775739_68_697 | 208 |
| 206 | 3300044683 | Ga0466965_0019706 | Ga0466965_0019706_1464_2099 | 208 |
| 207 | 3300044712 | Ga0453684_0076227 | Ga0453684_0076227_1971_2600 | 208 |
| 208 | 3300044712 | Ga0453684_0099213 | Ga0453684_0099213_2189_2818 | 208 |
| 209 | 3300044735 | Ga0466968_0105687 | Ga0466968_0105687_443_1078 | 208 |
| 210 | 3300046452 | Ga0495617_058697 | Ga0495617_058697_450_1094 | 208 |
| 211 | 3300046491 | Ga0495584_0063036 | Ga0495584_0063036_601_1245 | 208 |
| 212 | 3300046660 | Ga0495625_0115314 | Ga0495625_0115314_633_1277 | 208 |
| 213 | 3300048907 | Ga0496104_0182611 | Ga0496104_0182611_389_1030 | 208 |
| 214 | 3300048916 | Ga0496113_0299625 | Ga0496113_0299625_318_959 | 208 |
| 215 | 3300048918 | Ga0496115_0136545 | Ga0496115_0136545_735_1376 | 208 |
| 216 | 3300049572 | Ga0501036_0722202 | Ga0501036_0722202_99_728 | 208 |
| 217 | 3300050490 | nmdc:mga03n38_50524_c1 | nmdc:mga03n38_50524_c1_976_1617 | 208 |
| 218 | 3300050492 | nmdc:mga0yw44_102000_c1 | nmdc:mga0yw44_102000_c1_237_878 | 208 |
| 219 | 3300050492 | nmdc:mga0yw44_47938_c1 | nmdc:mga0yw44_47938_c1_52_696 | 208 |
| 220 | 3300050494 | nmdc:mga06z11_2940_c1 | nmdc:mga06z11_2940_c1_4033_4674 | 208 |
| 221 | 3300050496 | nmdc:mga07m45_105530_c1 | nmdc:mga07m45_105530_c1_306_947 | 208 |
| 222 | 3300050496 | nmdc:mga07m45_66878_c1 | nmdc:mga07m45_66878_c1_391_1035 | 208 |
| 223 | 3300050512 | nmdc:mga0n895_206416_c1 | nmdc:mga0n895_206416_c1_788_1429 | 208 |
| 224 | 3300053098 | Ga0500650_0190306 | Ga0500650_0190306_275_916 | 208 |
| 225 | iso_pu_bacteria | 8006984368 | 8006986206 | 208 |
| 226 | 3300005436 | Ga0070713_100040144 | Ga0070713_1000401442 | 209 |
| 227 | 3300005842 | Ga0068858_100056847 | Ga0068858_1000568472 | 209 |
| 228 | 3300009101 | Ga0105247_10027309 | Ga0105247_100273093 | 209 |
| 229 | 3300025906 | Ga0207699_10060197 | Ga0207699_100601973 | 209 |
| 230 | 3300025914 | Ga0207671_10322646 | Ga0207671_103226462 | 209 |
| 231 | 3300025928 | Ga0207700_10126299 | Ga0207700_101262992 | 209 |
| 232 | 3300048929 | Ga0496126_0502682 | Ga0496126_0502682_166_798 | 209 |
| 233 | iso_pu_bacteria | 2513237098 | 2513672485 | 209 |
| 234 | iso_pu_bacteria | 2885383462 | 2885388233 | 209 |
| 235 | 3300005456 | Ga0070678_100450918 | Ga0070678_1004509181 | 210 |
| 236 | 3300009551 | Ga0105238_10042360 | Ga0105238_100423602 | 210 |
| 237 | 3300010375 | Ga0105239_10025843 | Ga0105239_100258432 | 210 |
| 238 | 3300014325 | Ga0163163_10798352 | Ga0163163_107983522 | 210 |
| 239 | 3300025924 | Ga0207694_10037563 | Ga0207694_100375632 | 210 |
| 240 | 3300026121 | Ga0207683_10694538 | Ga0207683_106945381 | 210 |
| 241 | 3300031247 | Ga0265340_10005142 | Ga0265340_100051427 | 210 |
| 242 | 3300031344 | Ga0265316_10229073 | Ga0265316_102290732 | 210 |
| 243 | 3300032126 | Ga0307415_100156458 | Ga0307415_1001564582 | 210 |
| 244 | 3300035086 | Ga0373934_0049906 | Ga0373934_0049906_438_1073 | 210 |
| 245 | 3300035695 | Ga0373927_0027614 | Ga0373927_0027614_1471_2106 | 210 |
| 246 | 3300035725 | Ga0373947_0061128 | Ga0373947_0061128_1285_1920 | 210 |
| 247 | 3300046462 | Ga0495651_0016759 | Ga0495651_0016759_3154_3801 | 210 |
| 248 | 3300048921 | Ga0496118_0189289 | Ga0496118_0189289_484_1128 | 210 |
| 249 | 3300048923 | Ga0496120_0106206 | Ga0496120_0106206_70_732 | 210 |
| 250 | 3300048925 | Ga0496122_0044528 | Ga0496122_0044528_2429_3064 | 210 |
| 251 | 3300048927 | Ga0496124_0115446 | Ga0496124_0115446_741_1385 | 210 |
| 252 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_45847_46509 | 210 |
| 253 | 3300048928 | Ga0496125_0002791 | Ga0496125_0002791_14587_15222 | 210 |
| 254 | 3300048928 | Ga0496125_0262094 | Ga0496125_0262094_115_759 | 210 |
| 255 | 3300048929 | Ga0496126_0031094 | Ga0496126_0031094_2711_3346 | 210 |
| 256 | 3300053111 | Ga0500572_000383 | Ga0500572_000383_6762_7400 | 210 |
| 257 | 3300053136 | Ga0500559_0000486 | Ga0500559_0000486_11147_11785 | 210 |
| 258 | 3300053163 | Ga0500639_118147 | Ga0500639_118147_56_694 | 210 |
| 259 | 3300053725 | Ga0500576_065937 | Ga0500576_065937_330_968 | 210 |
| 260 | iso_pu_bacteria | 2513237101 | 2513697533 | 210 |
| 261 | iso_pu_bacteria | 2791355199 | 2793078546 | 210 |
| 262 | iso_pu_bacteria | 2874604998 | 2874606732 | 210 |
| 263 | iso_pu_bacteria | 2889033259 | 2889034132 | 210 |
| 264 | iso_pu_bacteria | 2903768456 | 2903774576 | 210 |
| 265 | iso_pu_bacteria | 2922361189 | 2922367530 | 210 |
| 266 | iso_pu_bacteria | 2922386360 | 2922391505 | 210 |
| 267 | iso_pu_bacteria | 8056673599 | 8056678859 | 210 |
| 268 | 3300003203 | JGI25406J46586_10000118 | JGI25406J46586_1000011811 | 211 |
| 269 | 3300003203 | JGI25406J46586_10007912 | JGI25406J46586_100079123 | 211 |
| 270 | 3300003215 | JGI25153J46596_10013940 | JGI25153J46596_100139401 | 211 |
| 271 | 3300003323 | rootH1_10341204 | rootH1_103412042 | 211 |
| 272 | 3300003659 | JGI25404J52841_10006748 | JGI25404J52841_100067482 | 211 |
| 273 | 3300003659 | JGI25404J52841_10018718 | JGI25404J52841_100187182 | 211 |
| 274 | 3300003659 | JGI25404J52841_10035704 | JGI25404J52841_100357041 | 211 |
| 275 | 3300003911 | JGI25405J52794_10002640 | JGI25405J52794_100026402 | 211 |
| 276 | 3300005328 | Ga0070676_10084486 | Ga0070676_100844862 | 211 |
| 277 | 3300005329 | Ga0070683_100373843 | Ga0070683_1003738431 | 211 |
| 278 | 3300005331 | Ga0070670_100460507 | Ga0070670_1004605071 | 211 |
| 279 | 3300005334 | Ga0068869_100044270 | Ga0068869_1000442703 | 211 |
| 280 | 3300005334 | Ga0068869_100301500 | Ga0068869_1003015002 | 211 |
| 281 | 3300005335 | Ga0070666_10593548 | Ga0070666_105935481 | 211 |
| 282 | 3300005338 | Ga0068868_100021214 | Ga0068868_1000212144 | 211 |
| 283 | 3300005338 | Ga0068868_100051092 | Ga0068868_1000510923 | 211 |
| 284 | 3300005338 | Ga0068868_100420164 | Ga0068868_1004201641 | 211 |
| 285 | 3300005339 | Ga0070660_100122715 | Ga0070660_1001227153 | 211 |
| 286 | 3300005340 | Ga0070689_100248302 | Ga0070689_1002483022 | 211 |
| 287 | 3300005343 | Ga0070687_100444505 | Ga0070687_1004445051 | 211 |
| 288 | 3300005344 | Ga0070661_100186210 | Ga0070661_1001862102 | 211 |
| 289 | 3300005347 | Ga0070668_100028324 | Ga0070668_1000283242 | 211 |
| 290 | 3300005347 | Ga0070668_100190092 | Ga0070668_1001900921 | 211 |
| 291 | 3300005347 | Ga0070668_100295341 | Ga0070668_1002953412 | 211 |
| 292 | 3300005347 | Ga0070668_100353994 | Ga0070668_1003539941 | 211 |
| 293 | 3300005353 | Ga0070669_100242431 | Ga0070669_1002424311 | 211 |
| 294 | 3300005353 | Ga0070669_100267094 | Ga0070669_1002670942 | 211 |
| 295 | 3300005355 | Ga0070671_100049679 | Ga0070671_1000496792 | 211 |
| 296 | 3300005355 | Ga0070671_100845689 | Ga0070671_1008456891 | 211 |
| 297 | 3300005364 | Ga0070673_100476928 | Ga0070673_1004769281 | 211 |
| 298 | 3300005366 | Ga0070659_100091560 | Ga0070659_1000915602 | 211 |
| 299 | 3300005366 | Ga0070659_100282229 | Ga0070659_1002822292 | 211 |
| 300 | 3300005367 | Ga0070667_100516654 | Ga0070667_1005166541 | 211 |
| 301 | 3300005367 | Ga0070667_100522228 | Ga0070667_1005222281 | 211 |
| 302 | 3300005437 | Ga0070710_10300917 | Ga0070710_103009172 | 211 |
| 303 | 3300005441 | Ga0070700_100100500 | Ga0070700_1001005001 | 211 |
| 304 | 3300005441 | Ga0070700_100171527 | Ga0070700_1001715272 | 211 |
| 305 | 3300005455 | Ga0070663_100007686 | Ga0070663_1000076862 | 211 |
| 306 | 3300005455 | Ga0070663_100033040 | Ga0070663_1000330402 | 211 |
| 307 | 3300005455 | Ga0070663_100125533 | Ga0070663_1001255332 | 211 |
| 308 | 3300005455 | Ga0070663_100176076 | Ga0070663_1001760762 | 211 |
| 309 | 3300005456 | Ga0070678_100014577 | Ga0070678_1000145772 | 211 |
| 310 | 3300005456 | Ga0070678_100138931 | Ga0070678_1001389311 | 211 |
| 311 | 3300005456 | Ga0070678_100176810 | Ga0070678_1001768102 | 211 |
| 312 | 3300005456 | Ga0070678_100227783 | Ga0070678_1002277832 | 211 |
| 313 | 3300005457 | Ga0070662_100146530 | Ga0070662_1001465302 | 211 |
| 314 | 3300005459 | Ga0068867_100037083 | Ga0068867_1000370832 | 211 |
| 315 | 3300005459 | Ga0068867_100135545 | Ga0068867_1001355452 | 211 |
| 316 | 3300005459 | Ga0068867_100793598 | Ga0068867_1007935981 | 211 |
| 317 | 3300005466 | Ga0070685_10061983 | Ga0070685_100619831 | 211 |
| 318 | 3300005466 | Ga0070685_10286807 | Ga0070685_102868072 | 211 |
| 319 | 3300005471 | Ga0070698_100142039 | Ga0070698_1001420392 | 211 |
| 320 | 3300005518 | Ga0070699_100488680 | Ga0070699_1004886801 | 211 |
| 321 | 3300005535 | Ga0070684_100056843 | Ga0070684_1000568432 | 211 |
| 322 | 3300005539 | Ga0068853_100115628 | Ga0068853_1001156283 | 211 |
| 323 | 3300005543 | Ga0070672_100199132 | Ga0070672_1001991322 | 211 |
| 324 | 3300005544 | Ga0070686_100060417 | Ga0070686_1000604172 | 211 |
| 325 | 3300005544 | Ga0070686_100095240 | Ga0070686_1000952402 | 211 |
| 326 | 3300005544 | Ga0070686_100168594 | Ga0070686_1001685942 | 211 |
| 327 | 3300005548 | Ga0070665_100015092 | Ga0070665_1000150922 | 211 |
| 328 | 3300005548 | Ga0070665_100111611 | Ga0070665_1001116112 | 211 |
| 329 | 3300005548 | Ga0070665_100125570 | Ga0070665_1001255702 | 211 |
| 330 | 3300005563 | Ga0068855_100036624 | Ga0068855_1000366246 | 211 |
| 331 | 3300005578 | Ga0068854_100691293 | Ga0068854_1006912932 | 211 |
| 332 | 3300005614 | Ga0068856_100142783 | Ga0068856_1001427832 | 211 |
| 333 | 3300005615 | Ga0070702_100020928 | Ga0070702_1000209283 | 211 |
| 334 | 3300005615 | Ga0070702_100207577 | Ga0070702_1002075771 | 211 |
| 335 | 3300005616 | Ga0068852_100052442 | Ga0068852_1000524422 | 211 |
| 336 | 3300005616 | Ga0068852_100054448 | Ga0068852_1000544482 | 211 |
| 337 | 3300005616 | Ga0068852_100373304 | Ga0068852_1003733042 | 211 |
| 338 | 3300005617 | Ga0068859_100048748 | Ga0068859_1000487482 | 211 |
| 339 | 3300005617 | Ga0068859_100167592 | Ga0068859_1001675922 | 211 |
| 340 | 3300005617 | Ga0068859_100578577 | Ga0068859_1005785772 | 211 |
| 341 | 3300005618 | Ga0068864_100033384 | Ga0068864_1000333844 | 211 |
| 342 | 3300005718 | Ga0068866_10052283 | Ga0068866_100522832 | 211 |
| 343 | 3300005718 | Ga0068866_10117677 | Ga0068866_101176772 | 211 |
| 344 | 3300005719 | Ga0068861_100074575 | Ga0068861_1000745752 | 211 |
| 345 | 3300005719 | Ga0068861_100172531 | Ga0068861_1001725311 | 211 |
| 346 | 3300005841 | Ga0068863_100196706 | Ga0068863_1001967063 | 211 |
| 347 | 3300005841 | Ga0068863_100274055 | Ga0068863_1002740551 | 211 |
| 348 | 3300005841 | Ga0068863_100672786 | Ga0068863_1006727862 | 211 |
| 349 | 3300005842 | Ga0068858_100154554 | Ga0068858_1001545542 | 211 |
| 350 | 3300005842 | Ga0068858_100286387 | Ga0068858_1002863872 | 211 |
| 351 | 3300005842 | Ga0068858_100478475 | Ga0068858_1004784751 | 211 |
| 352 | 3300005842 | Ga0068858_100652142 | Ga0068858_1006521421 | 211 |
| 353 | 3300005842 | Ga0068858_100723654 | Ga0068858_1007236542 | 211 |
| 354 | 3300005843 | Ga0068860_100122368 | Ga0068860_1001223682 | 211 |
| 355 | 3300005843 | Ga0068860_100330277 | Ga0068860_1003302772 | 211 |
| 356 | 3300005844 | Ga0068862_100053367 | Ga0068862_1000533673 | 211 |
| 357 | 3300005844 | Ga0068862_100083397 | Ga0068862_1000833972 | 211 |
| 358 | 3300005844 | Ga0068862_100179877 | Ga0068862_1001798773 | 211 |
| 359 | 3300005844 | Ga0068862_100210527 | Ga0068862_1002105272 | 211 |
| 360 | 3300005844 | Ga0068862_100265761 | Ga0068862_1002657612 | 211 |
| 361 | 3300005937 | Ga0081455_10013479 | Ga0081455_100134795 | 211 |
| 362 | 3300005937 | Ga0081455_10023557 | Ga0081455_100235573 | 211 |
| 363 | 3300005937 | Ga0081455_10041472 | Ga0081455_100414724 | 211 |
| 364 | 3300005937 | Ga0081455_10066358 | Ga0081455_100663582 | 211 |
| 365 | 3300005937 | Ga0081455_10410493 | Ga0081455_104104932 | 211 |
| 366 | 3300005981 | Ga0081538_10018308 | Ga0081538_100183082 | 211 |
| 367 | 3300005983 | Ga0081540_1002251 | Ga0081540_100225110 | 211 |
| 368 | 3300005983 | Ga0081540_1003941 | Ga0081540_10039419 | 211 |
| 369 | 3300005983 | Ga0081540_1004960 | Ga0081540_10049606 | 211 |
| 370 | 3300005983 | Ga0081540_1006444 | Ga0081540_10064443 | 211 |
| 371 | 3300005983 | Ga0081540_1014502 | Ga0081540_10145023 | 211 |
| 372 | 3300005983 | Ga0081540_1046725 | Ga0081540_10467252 | 211 |
| 373 | 3300005985 | Ga0081539_10000425 | Ga0081539_1000042567 | 211 |
| 374 | 3300005985 | Ga0081539_10001114 | Ga0081539_1000111444 | 211 |
| 375 | 3300005985 | Ga0081539_10012644 | Ga0081539_100126442 | 211 |
| 376 | 3300005985 | Ga0081539_10018715 | Ga0081539_100187153 | 211 |
| 377 | 3300005985 | Ga0081539_10106778 | Ga0081539_101067782 | 211 |
| 378 | 3300006028 | Ga0070717_10310303 | Ga0070717_103103032 | 211 |
| 379 | 3300006038 | Ga0075365_10111769 | Ga0075365_101117693 | 211 |
| 380 | 3300006038 | Ga0075365_10192026 | Ga0075365_101920262 | 211 |
| 381 | 3300006038 | Ga0075365_10300082 | Ga0075365_103000822 | 211 |
| 382 | 3300006042 | Ga0075368_10029321 | Ga0075368_100293211 | 211 |
| 383 | 3300006051 | Ga0075364_10286232 | Ga0075364_102862322 | 211 |
| 384 | 3300006051 | Ga0075364_10292558 | Ga0075364_102925582 | 211 |
| 385 | 3300006173 | Ga0070716_100221232 | Ga0070716_1002212322 | 211 |
| 386 | 3300006177 | Ga0075362_10021395 | Ga0075362_100213952 | 211 |
| 387 | 3300006177 | Ga0075362_10106050 | Ga0075362_101060502 | 211 |
| 388 | 3300006177 | Ga0075362_10172008 | Ga0075362_101720081 | 211 |
| 389 | 3300006186 | Ga0075369_10138245 | Ga0075369_101382451 | 211 |
| 390 | 3300006186 | Ga0075369_10148347 | Ga0075369_101483471 | 211 |
| 391 | 3300006195 | Ga0075366_10074192 | Ga0075366_100741922 | 211 |
| 392 | 3300006237 | Ga0097621_100255131 | Ga0097621_1002551312 | 211 |
| 393 | 3300006353 | Ga0075370_10102902 | Ga0075370_101029022 | 211 |
| 394 | 3300006358 | Ga0068871_100087537 | Ga0068871_1000875372 | 211 |
| 395 | 3300006358 | Ga0068871_100092844 | Ga0068871_1000928442 | 211 |
| 396 | 3300006358 | Ga0068871_100208226 | Ga0068871_1002082262 | 211 |
| 397 | 3300006358 | Ga0068871_100864221 | Ga0068871_1008642211 | 211 |
| 398 | 3300006844 | Ga0075428_100472359 | Ga0075428_1004723592 | 211 |
| 399 | 3300006871 | Ga0075434_100178919 | Ga0075434_1001789192 | 211 |
| 400 | 3300006880 | Ga0075429_100583237 | Ga0075429_1005832372 | 211 |
| 401 | 3300006881 | Ga0068865_100044397 | Ga0068865_1000443972 | 211 |
| 402 | 3300006881 | Ga0068865_100051818 | Ga0068865_1000518183 | 211 |
| 403 | 3300006881 | Ga0068865_100222558 | Ga0068865_1002225582 | 211 |
| 404 | 3300006881 | Ga0068865_100294011 | Ga0068865_1002940112 | 211 |
| 405 | 3300006931 | Ga0097620_100048746 | Ga0097620_1000487464 | 211 |
| 406 | 3300006931 | Ga0097620_100167594 | Ga0097620_1001675942 | 211 |
| 407 | 3300006931 | Ga0097620_100578562 | Ga0097620_1005785621 | 211 |
| 408 | 3300007265 | Ga0099794_10062285 | Ga0099794_100622852 | 211 |
| 409 | 3300009093 | Ga0105240_10334243 | Ga0105240_103342431 | 211 |
| 410 | 3300009094 | Ga0111539_10126858 | Ga0111539_101268583 | 211 |
| 411 | 3300009094 | Ga0111539_10255949 | Ga0111539_102559492 | 211 |
| 412 | 3300009098 | Ga0105245_10011836 | Ga0105245_100118365 | 211 |
| 413 | 3300009098 | Ga0105245_10349267 | Ga0105245_103492672 | 211 |
| 414 | 3300009098 | Ga0105245_10899099 | Ga0105245_108990991 | 211 |
| 415 | 3300009101 | Ga0105247_10007548 | Ga0105247_100075483 | 211 |
| 416 | 3300009101 | Ga0105247_10026077 | Ga0105247_100260773 | 211 |
| 417 | 3300009147 | Ga0114129_10527373 | Ga0114129_105273731 | 211 |
| 418 | 3300009148 | Ga0105243_10152324 | Ga0105243_101523242 | 211 |
| 419 | 3300009148 | Ga0105243_10292936 | Ga0105243_102929362 | 211 |
| 420 | 3300009148 | Ga0105243_10522079 | Ga0105243_105220791 | 211 |
| 421 | 3300009174 | Ga0105241_10023322 | Ga0105241_100233222 | 211 |
| 422 | 3300009174 | Ga0105241_10178089 | Ga0105241_101780892 | 211 |
| 423 | 3300009176 | Ga0105242_10034607 | Ga0105242_100346074 | 211 |
| 424 | 3300009176 | Ga0105242_10459247 | Ga0105242_104592472 | 211 |
| 425 | 3300009177 | Ga0105248_10050803 | Ga0105248_100508032 | 211 |
| 426 | 3300009177 | Ga0105248_10221292 | Ga0105248_102212922 | 211 |
| 427 | 3300009177 | Ga0105248_10612209 | Ga0105248_106122091 | 211 |
| 428 | 3300009545 | Ga0105237_10009401 | Ga0105237_100094015 | 211 |
| 429 | 3300009545 | Ga0105237_10033756 | Ga0105237_100337563 | 211 |
| 430 | 3300009545 | Ga0105237_10160609 | Ga0105237_101606091 | 211 |
| 431 | 3300009545 | Ga0105237_10959832 | Ga0105237_109598322 | 211 |
| 432 | 3300009545 | Ga0105237_11215742 | Ga0105237_112157421 | 211 |
| 433 | 3300009551 | Ga0105238_10049191 | Ga0105238_100491912 | 211 |
| 434 | 3300009551 | Ga0105238_10225883 | Ga0105238_102258832 | 211 |
| 435 | 3300009551 | Ga0105238_10242274 | Ga0105238_102422742 | 211 |
| 436 | 3300009551 | Ga0105238_10605773 | Ga0105238_106057732 | 211 |
| 437 | 3300009553 | Ga0105249_10043356 | Ga0105249_100433563 | 211 |
| 438 | 3300009553 | Ga0105249_10282383 | Ga0105249_102823832 | 211 |
| 439 | 3300009553 | Ga0105249_10618845 | Ga0105249_106188452 | 211 |
| 440 | 3300010375 | Ga0105239_10006226 | Ga0105239_1000622610 | 211 |
| 441 | 3300010375 | Ga0105239_10032597 | Ga0105239_100325972 | 211 |
| 442 | 3300010375 | Ga0105239_10054201 | Ga0105239_100542014 | 211 |
| 443 | 3300010375 | Ga0105239_10294287 | Ga0105239_102942872 | 211 |
| 444 | 3300010375 | Ga0105239_10324233 | Ga0105239_103242332 | 211 |
| 445 | 3300011119 | Ga0105246_10006538 | Ga0105246_100065384 | 211 |
| 446 | 3300011119 | Ga0105246_10059478 | Ga0105246_100594782 | 211 |
| 447 | 3300011119 | Ga0105246_10421170 | Ga0105246_104211702 | 211 |
| 448 | 3300011119 | Ga0105246_10483753 | Ga0105246_104837531 | 211 |
| 449 | 3300013296 | Ga0157374_10025945 | Ga0157374_100259455 | 211 |
| 450 | 3300013297 | Ga0157378_10087727 | Ga0157378_100877273 | 211 |
| 451 | 3300013297 | Ga0157378_10101599 | Ga0157378_101015992 | 211 |
| 452 | 3300013306 | Ga0163162_10050121 | Ga0163162_100501215 | 211 |
| 453 | 3300013306 | Ga0163162_10262948 | Ga0163162_102629481 | 211 |
| 454 | 3300013306 | Ga0163162_10405715 | Ga0163162_104057152 | 211 |
| 455 | 3300013308 | Ga0157375_10016660 | Ga0157375_100166602 | 211 |
| 456 | 3300013308 | Ga0157375_10060282 | Ga0157375_100602823 | 211 |
| 457 | 3300013308 | Ga0157375_10118395 | Ga0157375_101183952 | 211 |
| 458 | 3300014325 | Ga0163163_10040677 | Ga0163163_100406772 | 211 |
| 459 | 3300014325 | Ga0163163_10134877 | Ga0163163_101348772 | 211 |
| 460 | 3300014325 | Ga0163163_11491717 | Ga0163163_114917171 | 211 |
| 461 | 3300014326 | Ga0157380_10264581 | Ga0157380_102645812 | 211 |
| 462 | 3300014745 | Ga0157377_10278377 | Ga0157377_102783771 | 211 |
| 463 | 3300014968 | Ga0157379_10602264 | Ga0157379_106022641 | 211 |
| 464 | 3300014969 | Ga0157376_10021798 | Ga0157376_100217985 | 211 |
| 465 | 3300014969 | Ga0157376_10794706 | Ga0157376_107947061 | 211 |
| 466 | 3300017792 | Ga0163161_10045299 | Ga0163161_100452993 | 211 |
| 467 | 3300017792 | Ga0163161_10083802 | Ga0163161_100838022 | 211 |
| 468 | 3300017792 | Ga0163161_10197527 | Ga0163161_101975272 | 211 |
| 469 | 3300025261 | Ga0209233_1006541 | Ga0209233_10065413 | 211 |
| 470 | 3300025297 | Ga0209758_1017706 | Ga0209758_10177063 | 211 |
| 471 | 3300025899 | Ga0207642_10023155 | Ga0207642_100231552 | 211 |
| 472 | 3300025899 | Ga0207642_10108073 | Ga0207642_101080732 | 211 |
| 473 | 3300025900 | Ga0207710_10129305 | Ga0207710_101293052 | 211 |
| 474 | 3300025901 | Ga0207688_10011640 | Ga0207688_100116403 | 211 |
| 475 | 3300025903 | Ga0207680_10279251 | Ga0207680_102792512 | 211 |
| 476 | 3300025904 | Ga0207647_10103374 | Ga0207647_101033742 | 211 |
| 477 | 3300025907 | Ga0207645_10107330 | Ga0207645_101073302 | 211 |
| 478 | 3300025909 | Ga0207705_10449524 | Ga0207705_104495241 | 211 |
| 479 | 3300025911 | Ga0207654_10019526 | Ga0207654_100195263 | 211 |
| 480 | 3300025913 | Ga0207695_10469495 | Ga0207695_104694952 | 211 |
| 481 | 3300025914 | Ga0207671_10123853 | Ga0207671_101238532 | 211 |
| 482 | 3300025914 | Ga0207671_10179010 | Ga0207671_101790102 | 211 |
| 483 | 3300025919 | Ga0207657_10226004 | Ga0207657_102260042 | 211 |
| 484 | 3300025920 | Ga0207649_10014137 | Ga0207649_100141374 | 211 |
| 485 | 3300025920 | Ga0207649_10020501 | Ga0207649_100205013 | 211 |
| 486 | 3300025921 | Ga0207652_10016146 | Ga0207652_100161465 | 211 |
| 487 | 3300025923 | Ga0207681_10476931 | Ga0207681_104769311 | 211 |
| 488 | 3300025924 | Ga0207694_10054759 | Ga0207694_100547592 | 211 |
| 489 | 3300025924 | Ga0207694_10441105 | Ga0207694_104411052 | 211 |
| 490 | 3300025927 | Ga0207687_10020088 | Ga0207687_100200883 | 211 |
| 491 | 3300025927 | Ga0207687_10052337 | Ga0207687_100523372 | 211 |
| 492 | 3300025927 | Ga0207687_10197857 | Ga0207687_101978572 | 211 |
| 493 | 3300025933 | Ga0207706_10016793 | Ga0207706_100167933 | 211 |
| 494 | 3300025934 | Ga0207686_10052617 | Ga0207686_100526173 | 211 |
| 495 | 3300025935 | Ga0207709_10388716 | Ga0207709_103887162 | 211 |
| 496 | 3300025935 | Ga0207709_10613168 | Ga0207709_106131681 | 211 |
| 497 | 3300025936 | Ga0207670_10184269 | Ga0207670_101842692 | 211 |
| 498 | 3300025936 | Ga0207670_10329894 | Ga0207670_103298942 | 211 |
| 499 | 3300025937 | Ga0207669_10018879 | Ga0207669_100188791 | 211 |
| 500 | 3300025937 | Ga0207669_10188622 | Ga0207669_101886222 | 211 |
| 501 | 3300025937 | Ga0207669_10313558 | Ga0207669_103135581 | 211 |
| 502 | 3300025938 | Ga0207704_10051040 | Ga0207704_100510402 | 211 |
| 503 | 3300025938 | Ga0207704_10079846 | Ga0207704_100798462 | 211 |
| 504 | 3300025938 | Ga0207704_10282098 | Ga0207704_102820982 | 211 |
| 505 | 3300025940 | Ga0207691_10113142 | Ga0207691_101131422 | 211 |
| 506 | 3300025940 | Ga0207691_10133622 | Ga0207691_101336221 | 211 |
| 507 | 3300025940 | Ga0207691_10165000 | Ga0207691_101650002 | 211 |
| 508 | 3300025941 | Ga0207711_10041346 | Ga0207711_100413464 | 211 |
| 509 | 3300025941 | Ga0207711_10046143 | Ga0207711_100461431 | 211 |
| 510 | 3300025941 | Ga0207711_10346544 | Ga0207711_103465442 | 211 |
| 511 | 3300025942 | Ga0207689_10029882 | Ga0207689_100298822 | 211 |
| 512 | 3300025942 | Ga0207689_10156187 | Ga0207689_101561872 | 211 |
| 513 | 3300025942 | Ga0207689_10325189 | Ga0207689_103251892 | 211 |
| 514 | 3300025944 | Ga0207661_10048891 | Ga0207661_100488913 | 211 |
| 515 | 3300025945 | Ga0207679_10031548 | Ga0207679_100315483 | 211 |
| 516 | 3300025949 | Ga0207667_10034096 | Ga0207667_100340966 | 211 |
| 517 | 3300025960 | Ga0207651_10037748 | Ga0207651_100377482 | 211 |
| 518 | 3300025960 | Ga0207651_10799250 | Ga0207651_107992501 | 211 |
| 519 | 3300025961 | Ga0207712_10334286 | Ga0207712_103342862 | 211 |
| 520 | 3300025961 | Ga0207712_10407817 | Ga0207712_104078172 | 211 |
| 521 | 3300025961 | Ga0207712_10542904 | Ga0207712_105429042 | 211 |
| 522 | 3300025972 | Ga0207668_10019309 | Ga0207668_100193092 | 211 |
| 523 | 3300025972 | Ga0207668_10086905 | Ga0207668_100869052 | 211 |
| 524 | 3300025986 | Ga0207658_10344876 | Ga0207658_103448761 | 211 |
| 525 | 3300026023 | Ga0207677_10031617 | Ga0207677_100316172 | 211 |
| 526 | 3300026023 | Ga0207677_10319270 | Ga0207677_103192701 | 211 |
| 527 | 3300026023 | Ga0207677_10791596 | Ga0207677_107915961 | 211 |
| 528 | 3300026035 | Ga0207703_10073183 | Ga0207703_100731832 | 211 |
| 529 | 3300026035 | Ga0207703_10414020 | Ga0207703_104140202 | 211 |
| 530 | 3300026035 | Ga0207703_10429583 | Ga0207703_104295831 | 211 |
| 531 | 3300026041 | Ga0207639_10051305 | Ga0207639_100513053 | 211 |
| 532 | 3300026041 | Ga0207639_10083373 | Ga0207639_100833732 | 211 |
| 533 | 3300026067 | Ga0207678_10006080 | Ga0207678_100060805 | 211 |
| 534 | 3300026067 | Ga0207678_10026460 | Ga0207678_100264604 | 211 |
| 535 | 3300026067 | Ga0207678_10071566 | Ga0207678_100715662 | 211 |
| 536 | 3300026067 | Ga0207678_10152734 | Ga0207678_101527342 | 211 |
| 537 | 3300026075 | Ga0207708_10014165 | Ga0207708_100141653 | 211 |
| 538 | 3300026075 | Ga0207708_10250326 | Ga0207708_102503262 | 211 |
| 539 | 3300026075 | Ga0207708_10861147 | Ga0207708_108611471 | 211 |
| 540 | 3300026088 | Ga0207641_10269196 | Ga0207641_102691961 | 211 |
| 541 | 3300026088 | Ga0207641_10360263 | Ga0207641_103602632 | 211 |
| 542 | 3300026088 | Ga0207641_10519386 | Ga0207641_105193861 | 211 |
| 543 | 3300026089 | Ga0207648_10011805 | Ga0207648_100118054 | 211 |
| 544 | 3300026089 | Ga0207648_10226751 | Ga0207648_102267512 | 211 |
| 545 | 3300026089 | Ga0207648_10291036 | Ga0207648_102910362 | 211 |
| 546 | 3300026095 | Ga0207676_10029628 | Ga0207676_100296283 | 211 |
| 547 | 3300026118 | Ga0207675_100087515 | Ga0207675_1000875152 | 211 |
| 548 | 3300026118 | Ga0207675_100338360 | Ga0207675_1003383602 | 211 |
| 549 | 3300026118 | Ga0207675_100405315 | Ga0207675_1004053152 | 211 |
| 550 | 3300026121 | Ga0207683_10017266 | Ga0207683_100172665 | 211 |
| 551 | 3300026121 | Ga0207683_10075559 | Ga0207683_100755592 | 211 |
| 552 | 3300026121 | Ga0207683_10097079 | Ga0207683_100970792 | 211 |
| 553 | 3300026121 | Ga0207683_10438286 | Ga0207683_104382862 | 211 |
| 554 | 3300027671 | Ga0209588_1038165 | Ga0209588_10381652 | 211 |
| 555 | 3300027907 | Ga0207428_10133454 | Ga0207428_101334543 | 211 |
| 556 | 3300028379 | Ga0268266_10027089 | Ga0268266_100270893 | 211 |
| 557 | 3300028379 | Ga0268266_10051282 | Ga0268266_100512823 | 211 |
| 558 | 3300028379 | Ga0268266_10064139 | Ga0268266_100641392 | 211 |
| 559 | 3300028379 | Ga0268266_10569258 | Ga0268266_105692581 | 211 |
| 560 | 3300028380 | Ga0268265_10051545 | Ga0268265_100515452 | 211 |
| 561 | 3300028380 | Ga0268265_10235763 | Ga0268265_102357632 | 211 |
| 562 | 3300028380 | Ga0268265_10315022 | Ga0268265_103150222 | 211 |
| 563 | 3300028380 | Ga0268265_10482457 | Ga0268265_104824572 | 211 |
| 564 | 3300028380 | Ga0268265_10537737 | Ga0268265_105377371 | 211 |
| 565 | 3300028381 | Ga0268264_10108789 | Ga0268264_101087892 | 211 |
| 566 | 3300028381 | Ga0268264_10206537 | Ga0268264_102065372 | 211 |
| 567 | 3300028786 | Ga0307517_10000176 | Ga0307517_1000017625 | 211 |
| 568 | 3300028786 | Ga0307517_10125173 | Ga0307517_101251732 | 211 |
| 569 | 3300028794 | Ga0307515_10024761 | Ga0307515_100247619 | 211 |
| 570 | 3300028794 | Ga0307515_10276368 | Ga0307515_102763682 | 211 |
| 571 | 3300031250 | Ga0265331_10142252 | Ga0265331_101422522 | 211 |
| 572 | 3300031456 | Ga0307513_10224786 | Ga0307513_102247862 | 211 |
| 573 | 3300031507 | Ga0307509_10030286 | Ga0307509_100302865 | 211 |
| 574 | 3300031507 | Ga0307509_10041504 | Ga0307509_100415042 | 211 |
| 575 | 3300031507 | Ga0307509_10237301 | Ga0307509_102373012 | 211 |
| 576 | 3300031507 | Ga0307509_10237995 | Ga0307509_102379951 | 211 |
| 577 | 3300031730 | Ga0307516_10043260 | Ga0307516_100432603 | 211 |
| 578 | 3300031731 | Ga0307405_10055101 | Ga0307405_100551013 | 211 |
| 579 | 3300031824 | Ga0307413_10096382 | Ga0307413_100963822 | 211 |
| 580 | 3300031852 | Ga0307410_10136364 | Ga0307410_101363641 | 211 |
| 581 | 3300031911 | Ga0307412_10055269 | Ga0307412_100552692 | 211 |
| 582 | 3300032002 | Ga0307416_100419617 | Ga0307416_1004196172 | 211 |
| 583 | 3300032002 | Ga0307416_100714652 | Ga0307416_1007146522 | 211 |
| 584 | 3300033180 | Ga0307510_10010093 | Ga0307510_100100936 | 211 |
| 585 | 3300033180 | Ga0307510_10061429 | Ga0307510_100614292 | 211 |
| 586 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005300 | 211 |
| 587 | 3300034816 | Ga0373930_0003404 | Ga0373930_0003404_170_832 | 211 |
| 588 | 3300035112 | Ga0373932_0130591 | Ga0373932_0130591_106_768 | 211 |
| 589 | 3300035207 | Ga0373942_0011619 | Ga0373942_0011619_1346_2008 | 211 |
| 590 | 3300035241 | Ga0373961_0141103 | Ga0373961_0141103_96_758 | 211 |
| 591 | 3300035691 | Ga0373931_0007598 | Ga0373931_0007598_1863_2525 | 211 |
| 592 | 3300035691 | Ga0373931_0046305 | Ga0373931_0046305_200_883 | 211 |
| 593 | 3300035691 | Ga0373931_0491480 | Ga0373931_0491480_39_686 | 211 |
| 594 | 3300035692 | Ga0373935_0271445 | Ga0373935_0271445_455_1117 | 211 |
| 595 | 3300036459 | Ga0372808_025793 | Ga0372808_025793_135_773 | 211 |
| 596 | 3300037471 | Ga0395905_0101761 | Ga0395905_0101761_1081_1716 | 211 |
| 597 | 3300037471 | Ga0395905_0838266 | Ga0395905_0838266_163_804 | 211 |
| 598 | 3300041451 | Ga0451791_0193268 | Ga0451791_0193268_137_799 | 211 |
| 599 | 3300041494 | Ga0451837_1135996 | Ga0451837_1135996_11_673 | 211 |
| 600 | 3300046452 | Ga0495617_018296 | Ga0495617_018296_402_1049 | 211 |
| 601 | 3300046452 | Ga0495617_061020 | Ga0495617_061020_154_804 | 211 |
| 602 | 3300046455 | Ga0495603_0008200 | Ga0495603_0008200_250_885 | 211 |
| 603 | 3300046455 | Ga0495603_0078051 | Ga0495603_0078051_551_1204 | 211 |
| 604 | 3300046455 | Ga0495603_0117661 | Ga0495603_0117661_618_1280 | 211 |
| 605 | 3300046455 | Ga0495603_0229043 | Ga0495603_0229043_42_689 | 211 |
| 606 | 3300046457 | Ga0495590_0038754 | Ga0495590_0038754_43_705 | 211 |
| 607 | 3300046459 | Ga0495629_0473373 | Ga0495629_0473373_53_805 | 211 |
| 608 | 3300046460 | Ga0495638_0182573 | Ga0495638_0182573_240_890 | 211 |
| 609 | 3300046460 | Ga0495638_0243303 | Ga0495638_0243303_96_743 | 211 |
| 610 | 3300046472 | Ga0495580_0106199 | Ga0495580_0106199_675_1325 | 211 |
| 611 | 3300046474 | Ga0495605_0186327 | Ga0495605_0186327_17_661 | 211 |
| 612 | 3300046475 | Ga0495639_0076640 | Ga0495639_0076640_842_1480 | 211 |
| 613 | 3300046475 | Ga0495639_0078937 | Ga0495639_0078937_17_661 | 211 |
| 614 | 3300046477 | Ga0495664_0162528 | Ga0495664_0162528_183_827 | 211 |
| 615 | 3300046491 | Ga0495584_0274249 | Ga0495584_0274249_18_665 | 211 |
| 616 | 3300046491 | Ga0495584_0336603 | Ga0495584_0336603_58_705 | 211 |
| 617 | 3300046492 | Ga0495585_0019464 | Ga0495585_0019464_475_1125 | 211 |
| 618 | 3300046492 | Ga0495585_0164826 | Ga0495585_0164826_204_941 | 211 |
| 619 | 3300046500 | Ga0495596_0036720 | Ga0495596_0036720_281_1033 | 211 |
| 620 | 3300046501 | Ga0495607_0182961 | Ga0495607_0182961_24_761 | 211 |
| 621 | 3300046515 | Ga0495620_0086193 | Ga0495620_0086193_187_834 | 211 |
| 622 | 3300046522 | Ga0495643_0039389 | Ga0495643_0039389_1650_2402 | 211 |
| 623 | 3300046523 | Ga0495644_0090437 | Ga0495644_0090437_106_753 | 211 |
| 624 | 3300046523 | Ga0495644_0145615 | Ga0495644_0145615_32_679 | 211 |
| 625 | 3300046524 | Ga0495648_0219814 | Ga0495648_0219814_26_673 | 211 |
| 626 | 3300046525 | Ga0495663_0037812 | Ga0495663_0037812_689_1336 | 211 |
| 627 | 3300046526 | Ga0495666_0054648 | Ga0495666_0054648_403_1053 | 211 |
| 628 | 3300046530 | Ga0495654_0092055 | Ga0495654_0092055_79_843 | 211 |
| 629 | 3300046537 | Ga0495598_0004565 | Ga0495598_0004565_1403_2140 | 211 |
| 630 | 3300046537 | Ga0495598_0004693 | Ga0495598_0004693_1321_1968 | 211 |
| 631 | 3300046537 | Ga0495598_0019118 | Ga0495598_0019118_49_705 | 211 |
| 632 | 3300046539 | Ga0495621_0009869 | Ga0495621_0009869_2071_2721 | 211 |
| 633 | 3300046542 | Ga0495597_0179144 | Ga0495597_0179144_152_799 | 211 |
| 634 | 3300046557 | Ga0495622_0015323 | Ga0495622_0015323_164_811 | 211 |
| 635 | 3300046557 | Ga0495622_0036962 | Ga0495622_0036962_490_1152 | 211 |
| 636 | 3300046615 | Ga0495656_0007640 | Ga0495656_0007640_2881_3618 | 211 |
| 637 | 3300046615 | Ga0495656_0060480 | Ga0495656_0060480_985_1632 | 211 |
| 638 | 3300046615 | Ga0495656_0091525 | Ga0495656_0091525_449_1201 | 211 |
| 639 | 3300046615 | Ga0495656_0211994 | Ga0495656_0211994_132_779 | 211 |
| 640 | 3300046616 | Ga0495668_0030525 | Ga0495668_0030525_1858_2520 | 211 |
| 641 | 3300046616 | Ga0495668_0066743 | Ga0495668_0066743_331_1005 | 211 |
| 642 | 3300046616 | Ga0495668_0303940 | Ga0495668_0303940_74_730 | 211 |
| 643 | 3300046648 | Ga0495611_0048349 | Ga0495611_0048349_957_1619 | 211 |
| 644 | 3300046660 | Ga0495625_0162019 | Ga0495625_0162019_23_667 | 211 |
| 645 | 3300046674 | Ga0495588_0049033 | Ga0495588_0049033_1068_1715 | 211 |
| 646 | 3300046690 | Ga0495624_0116002 | Ga0495624_0116002_585_1229 | 211 |
| 647 | 3300046691 | Ga0495670_0100193 | Ga0495670_0100193_519_1256 | 211 |
| 648 | 3300046691 | Ga0495670_0121937 | Ga0495670_0121937_584_1231 | 211 |
| 649 | 3300046794 | Ga0495589_0028532 | Ga0495589_0028532_678_1325 | 211 |
| 650 | 3300047315 | Ga0495581_0261150 | Ga0495581_0261150_157_807 | 211 |
| 651 | 3300047318 | Ga0495636_0011302 | Ga0495636_0011302_1169_1819 | 211 |
| 652 | 3300047318 | Ga0495636_0064953 | Ga0495636_0064953_315_965 | 211 |
| 653 | 3300047320 | Ga0495672_0044747 | Ga0495672_0044747_1289_1942 | 211 |
| 654 | 3300047445 | Ga0495677_0042356 | Ga0495677_0042356_140_787 | 211 |
| 655 | 3300047469 | Ga0495673_0064792 | Ga0495673_0064792_530_1204 | 211 |
| 656 | 3300047472 | Ga0495686_0086805 | Ga0495686_0086805_899_1573 | 211 |
| 657 | 3300048091 | Ga0495626_0133456 | Ga0495626_0133456_35_682 | 211 |
| 658 | 3300048903 | Ga0496100_0056515 | Ga0496100_0056515_816_1478 | 211 |
| 659 | 3300048903 | Ga0496100_0317561 | Ga0496100_0317561_404_1063 | 211 |
| 660 | 3300048904 | Ga0496101_0040142 | Ga0496101_0040142_612_1274 | 211 |
| 661 | 3300048904 | Ga0496101_0188718 | Ga0496101_0188718_656_1303 | 211 |
| 662 | 3300048905 | Ga0496102_0006184 | Ga0496102_0006184_7742_8401 | 211 |
| 663 | 3300048905 | Ga0496102_0055839 | Ga0496102_0055839_640_1287 | 211 |
| 664 | 3300048905 | Ga0496102_0107367 | Ga0496102_0107367_460_1122 | 211 |
| 665 | 3300048906 | Ga0496103_0006862 | Ga0496103_0006862_609_1268 | 211 |
| 666 | 3300048908 | Ga0496105_0015812 | Ga0496105_0015812_275_937 | 211 |
| 667 | 3300048909 | Ga0496106_0002146 | Ga0496106_0002146_2296_2937 | 211 |
| 668 | 3300048909 | Ga0496106_0009940 | Ga0496106_0009940_6167_6829 | 211 |
| 669 | 3300048909 | Ga0496106_0112826 | Ga0496106_0112826_393_1052 | 211 |
| 670 | 3300048909 | Ga0496106_0151221 | Ga0496106_0151221_323_970 | 211 |
| 671 | 3300048909 | Ga0496106_0255960 | Ga0496106_0255960_612_1259 | 211 |
| 672 | 3300048910 | Ga0496107_0026018 | Ga0496107_0026018_2936_3595 | 211 |
| 673 | 3300048910 | Ga0496107_0192009 | Ga0496107_0192009_607_1269 | 211 |
| 674 | 3300048911 | Ga0496108_0024899 | Ga0496108_0024899_27_674 | 211 |
| 675 | 3300048911 | Ga0496108_0054602 | Ga0496108_0054602_250_909 | 211 |
| 676 | 3300048912 | Ga0496109_0010481 | Ga0496109_0010481_1915_2574 | 211 |
| 677 | 3300048912 | Ga0496109_0016308 | Ga0496109_0016308_900_1544 | 211 |
| 678 | 3300048912 | Ga0496109_0705350 | Ga0496109_0705350_259_921 | 211 |
| 679 | 3300048913 | Ga0496110_0033478 | Ga0496110_0033478_487_1146 | 211 |
| 680 | 3300048914 | Ga0496111_0011084 | Ga0496111_0011084_2039_2701 | 211 |
| 681 | 3300048914 | Ga0496111_0024988 | Ga0496111_0024988_659_1318 | 211 |
| 682 | 3300048915 | Ga0496112_0000022 | Ga0496112_0000022_20799_21461 | 211 |
| 683 | 3300048915 | Ga0496112_0008650 | Ga0496112_0008650_6742_7389 | 211 |
| 684 | 3300048915 | Ga0496112_0008856 | Ga0496112_0008856_6170_6832 | 211 |
| 685 | 3300048916 | Ga0496113_0012773 | Ga0496113_0012773_2325_2987 | 211 |
| 686 | 3300048916 | Ga0496113_0144243 | Ga0496113_0144243_1014_1658 | 211 |
| 687 | 3300048916 | Ga0496113_0253076 | Ga0496113_0253076_226_885 | 211 |
| 688 | 3300048917 | Ga0496114_0018024 | Ga0496114_0018024_2994_3653 | 211 |
| 689 | 3300048917 | Ga0496114_0025976 | Ga0496114_0025976_3363_4025 | 211 |
| 690 | 3300048917 | Ga0496114_0583679 | Ga0496114_0583679_274_918 | 211 |
| 691 | 3300048918 | Ga0496115_0015540 | Ga0496115_0015540_2113_2772 | 211 |
| 692 | 3300048918 | Ga0496115_0076300 | Ga0496115_0076300_969_1616 | 211 |
| 693 | 3300048919 | Ga0496116_0133859 | Ga0496116_0133859_495_1157 | 211 |
| 694 | 3300048920 | Ga0496117_0072389 | Ga0496117_0072389_775_1416 | 211 |
| 695 | 3300048920 | Ga0496117_0090274 | Ga0496117_0090274_702_1340 | 211 |
| 696 | 3300048920 | Ga0496117_0113366 | Ga0496117_0113366_799_1461 | 211 |
| 697 | 3300048921 | Ga0496118_0006640 | Ga0496118_0006640_10186_10827 | 211 |
| 698 | 3300048921 | Ga0496118_0031958 | Ga0496118_0031958_1835_2473 | 211 |
| 699 | 3300048921 | Ga0496118_0173273 | Ga0496118_0173273_441_1103 | 211 |
| 700 | 3300048922 | Ga0496119_0154557 | Ga0496119_0154557_516_1154 | 211 |
| 701 | 3300048922 | Ga0496119_0276498 | Ga0496119_0276498_32_670 | 211 |
| 702 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_11101_11742 | 211 |
| 703 | 3300048924 | Ga0496121_0000254 | Ga0496121_0000254_66637_67290 | 211 |
| 704 | 3300048924 | Ga0496121_0012395 | Ga0496121_0012395_7010_7648 | 211 |
| 705 | 3300048924 | Ga0496121_0027341 | Ga0496121_0027341_2821_3483 | 211 |
| 706 | 3300048924 | Ga0496121_0036689 | Ga0496121_0036689_452_1114 | 211 |
| 707 | 3300048924 | Ga0496121_0101064 | Ga0496121_0101064_550_1191 | 211 |
| 708 | 3300048924 | Ga0496121_0121575 | Ga0496121_0121575_902_1546 | 211 |
| 709 | 3300048924 | Ga0496121_0201148 | Ga0496121_0201148_560_1204 | 211 |
| 710 | 3300048927 | Ga0496124_0001236 | Ga0496124_0001236_11878_12519 | 211 |
| 711 | 3300048927 | Ga0496124_0021839 | Ga0496124_0021839_2111_2773 | 211 |
| 712 | 3300048928 | Ga0496125_0013848 | Ga0496125_0013848_3528_4190 | 211 |
| 713 | 3300048928 | Ga0496125_0196049 | Ga0496125_0196049_408_1136 | 211 |
| 714 | 3300048929 | Ga0496126_0013383 | Ga0496126_0013383_2746_3468 | 211 |
| 715 | 3300048929 | Ga0496126_0080959 | Ga0496126_0080959_1144_1788 | 211 |
| 716 | 3300048929 | Ga0496126_0094722 | Ga0496126_0094722_881_1522 | 211 |
| 717 | 3300048929 | Ga0496126_0114563 | Ga0496126_0114563_683_1345 | 211 |
| 718 | 3300048929 | Ga0496126_0141195 | Ga0496126_0141195_1361_2005 | 211 |
| 719 | 3300048929 | Ga0496126_0186516 | Ga0496126_0186516_650_1285 | 211 |
| 720 | 3300048929 | Ga0496126_0534551 | Ga0496126_0534551_44_682 | 211 |
| 721 | 3300049459 | Ga0495678_065081 | Ga0495678_065081_541_1188 | 211 |
| 722 | 3300049589 | Ga0501073_0534933 | Ga0501073_0534933_35_670 | 211 |
| 723 | 3300050489 | nmdc:mga03683_140166_c1 | nmdc:mga03683_140166_c1_66_713 | 211 |
| 724 | 3300050489 | nmdc:mga03683_171936_c1 | nmdc:mga03683_171936_c1_220_855 | 211 |
| 725 | 3300050491 | nmdc:mga00v17_79997_c1 | nmdc:mga00v17_79997_c1_19_666 | 211 |
| 726 | 3300050492 | nmdc:mga0yw44_185192_c1 | nmdc:mga0yw44_185192_c1_225_869 | 211 |
| 727 | 3300050492 | nmdc:mga0yw44_228152_c1 | nmdc:mga0yw44_228152_c1_343_990 | 211 |
| 728 | 3300050494 | nmdc:mga06z11_335727_c1 | nmdc:mga06z11_335727_c1_93_755 | 211 |
| 729 | 3300050495 | nmdc:mga04h51_45179_c1 | nmdc:mga04h51_45179_c1_495_1139 | 211 |
| 730 | 3300050496 | nmdc:mga07m45_45718_c1 | nmdc:mga07m45_45718_c1_905_1567 | 211 |
| 731 | 3300050507 | nmdc:mga05p37_57183_c1 | nmdc:mga05p37_57183_c1_3536_4183 | 211 |
| 732 | 3300050512 | nmdc:mga0n895_61527_c1 | nmdc:mga0n895_61527_c1_3038_3685 | 211 |
| 733 | 3300050512 | nmdc:mga0n895_806596_c1 | nmdc:mga0n895_806596_c1_129_812 | 211 |
| 734 | 3300050513 | nmdc:mga0rr50_423583_c1 | nmdc:mga0rr50_423583_c1_397_1080 | 211 |
| 735 | 3300050515 | nmdc:mga0a205_333403_c1 | nmdc:mga0a205_333403_c1_75_722 | 211 |
| 736 | 3300050516 | nmdc:mga0sz30_221674_c1 | nmdc:mga0sz30_221674_c1_179_826 | 211 |
| 737 | 3300050516 | nmdc:mga0sz30_28917_c2 | nmdc:mga0sz30_28917_c2_11_658 | 211 |
| 738 | 3300053080 | Ga0500635_0000894 | Ga0500635_0000894_6070_6723 | 211 |
| 739 | 3300053083 | Ga0495655_0029188 | Ga0495655_0029188_34_681 | 211 |
| 740 | 3300053084 | Ga0495595_0004191 | Ga0495595_0004191_1477_2121 | 211 |
| 741 | 3300053085 | Ga0495619_0195611 | Ga0495619_0195611_679_1323 | 211 |
| 742 | 3300053088 | Ga0500644_0184926 | Ga0500644_0184926_55_717 | 211 |
| 743 | 3300053092 | Ga0500583_0155906 | Ga0500583_0155906_312_956 | 211 |
| 744 | 3300053094 | Ga0500566_0039553 | Ga0500566_0039553_1092_1736 | 211 |
| 745 | 3300053098 | Ga0500650_0190624 | Ga0500650_0190624_136_798 | 211 |
| 746 | 3300053102 | Ga0500554_062200 | Ga0500554_062200_153_806 | 211 |
| 747 | 3300053118 | Ga0500594_0046224 | Ga0500594_0046224_493_1131 | 211 |
| 748 | 3300053119 | Ga0500595_000730 | Ga0500595_000730_246_890 | 211 |
| 749 | 3300053119 | Ga0500595_010244 | Ga0500595_010244_286_930 | 211 |
| 750 | 3300053119 | Ga0500595_018807 | Ga0500595_018807_1072_1710 | 211 |
| 751 | 3300053125 | Ga0500618_012347 | Ga0500618_012347_1352_1990 | 211 |
| 752 | 3300053130 | Ga0500642_0044293 | Ga0500642_0044293_276_923 | 211 |
| 753 | 3300053130 | Ga0500642_0224041 | Ga0500642_0224041_153_791 | 211 |
| 754 | 3300053133 | Ga0500655_020538 | Ga0500655_020538_144_806 | 211 |
| 755 | 3300053136 | Ga0500559_0083822 | Ga0500559_0083822_457_1098 | 211 |
| 756 | 3300053136 | Ga0500559_0113643 | Ga0500559_0113643_236_880 | 211 |
| 757 | 3300053139 | Ga0500568_0008112 | Ga0500568_0008112_3884_4537 | 211 |
| 758 | 3300053139 | Ga0500568_0072064 | Ga0500568_0072064_387_1049 | 211 |
| 759 | 3300053140 | Ga0500573_0130733 | Ga0500573_0130733_584_1225 | 211 |
| 760 | 3300053150 | Ga0500603_000741 | Ga0500603_000741_322_975 | 211 |
| 761 | 3300053150 | Ga0500603_036444 | Ga0500603_036444_52_696 | 211 |
| 762 | 3300053158 | Ga0500627_0110097 | Ga0500627_0110097_461_1105 | 211 |
| 763 | 3300053158 | Ga0500627_0236034 | Ga0500627_0236034_26_688 | 211 |
| 764 | 3300053162 | Ga0500638_000379 | Ga0500638_000379_3365_4009 | 211 |
| 765 | 3300053178 | Ga0500637_0001280 | Ga0500637_0001280_5982_6626 | 211 |
| 766 | 3300053730 | Ga0500645_066633 | Ga0500645_066633_181_843 | 211 |
| 767 | 3300053731 | Ga0500609_014367 | Ga0500609_014367_76_738 | 211 |
| 768 | 3300053735 | Ga0500596_000696 | Ga0500596_000696_3094_3735 | 211 |
| 769 | 3300055283 | Ga0500661_000550 | Ga0500661_000550_6020_6664 | 211 |
| 770 | iso_pu_bacteria | 8006964411 | 8006965882 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bp3-assembly1.cif.gz_B | cryo-em structure of the human mct2 | 0.4454 | 51 | 207 |
| 4jr9-assembly1.cif.gz_A | crystal structure of nitrate/nitrite exchanger nark | 0.4377 | 23 | 204 |
| 4u4w-assembly2.cif.gz_B | structure of a nitrate/nitrite antiporter nark in nitrate-bound occluded state | 0.4332 | 23 | 204 |
| 6rw3-assembly4.cif.gz_D | the molecular basis for sugar import in malaria parasites. | 0.4299 | 10 | 210 |
| 6e9n-assembly2.cif.gz_B | e. coli d-galactonate:proton symporter in the inward open form | 0.4252 | 7 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5706 | 9 | 209 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5601 | 9 | 209 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5415 | 9 | 209 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5372 | 9 | 209 | 1.20.1250.20 |
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4841 | 3 | 211 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1BCG1-F1-model_v4 | LysE family translocator | 0.9356 | 8 | 206 |
GO:0005886
GO:0015171 |
| AF-A0A6C1B1M2-F1-model_v4 | LysE family translocator | 0.9122 | 7 | 211 |
GO:0005886
GO:0015171 |
| AF-A4Z138-F1-model_v4 | Putative amino acid efflux protein, LysE family | 0.9109 | 1 | 211 |
GO:0005886
GO:0015171 |
| AF-A0A151FS10-F1-model_v4 | deleted | 0.9083 | 1 | 211 |
|
| AF-A0A7J5EDQ9-F1-model_v4 | LysE family translocator | 0.9044 | 7 | 210 |
GO:0005886
GO:0015171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar