F480048

General Info

Members Datasets Scaffolds Average Seq Length
770 308 1540 118

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0173177|Ga0466967_0173177_1115_1492
Length 125
Sequence VSVAHIVAAIGLGVVAGILAGMFGVGGGILFVPTLTWLGLTQLHAEATSLLAIIPTVLVGVWRHNQQGNVRFRSAIVIGLASVGAAVGGAQVAESLPESTLRRLFAVLLLFTAAQIAWRARGPQQ

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
88 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 8.96
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0173177 3300045976 Bacteria 2032
2 Ga0070658_10003218 3300005327 Bacteria 13483
3 Ga0070658_10094616 3300005327 Bacteria 2465
4 Ga0070658_10305778 3300005327 Archaea 1356
5 Ga0070658_10568368 3300005327 Bacteria 982
6 Ga0070658_10767255 3300005327 Bacteria 837
7 Ga0070683_100045570 3300005329 Bacteria 4048
8 Ga0070683_100293169 3300005329 Bacteria 1547
9 Ga0070683_100399211 3300005329 Bacteria 1311
10 Ga0070690_101295781 3300005330 Bacteria 584
11 Ga0070677_10657400 3300005333 Bacteria 586
12 Ga0068869_100906230 3300005334 Bacteria 763
13 Ga0070680_100013061 3300005336 Bacteria 6465
14 Ga0070680_100143926 3300005336 Bacteria 2000
15 Ga0070680_100173766 3300005336 Bacteria 1814
16 Ga0070680_100314209 3300005336 Bacteria 1330
17 Ga0070680_101081576 3300005336 Bacteria 693
18 Ga0070680_101263963 3300005336 Bacteria 639
19 Ga0070680_101521460 3300005336 Unclassified 580
20 Ga0070682_100137372 3300005337 Bacteria 1662
21 Ga0068868_100144853 3300005338 Bacteria 1953
22 Ga0068868_100313169 3300005338 Bacteria 1336
23 Ga0068868_100772891 3300005338 Bacteria 865
24 Ga0068868_101309897 3300005338 Bacteria 673
25 Ga0068868_101326481 3300005338 Unclassified 669
26 Ga0070660_100003398 3300005339 Bacteria 10953
27 Ga0070660_100008279 3300005339 Bacteria 7266
28 Ga0070660_100014577 3300005339 Bacteria 5669
29 Ga0070660_100093203 3300005339 Bacteria 2378
30 Ga0070660_100381206 3300005339 Bacteria 1164
31 Ga0070660_100425802 3300005339 Bacteria 1099
32 Ga0070660_101156429 3300005339 Bacteria 656
33 Ga0070689_100069489 3300005340 Bacteria 2748
34 Ga0070691_10059987 3300005341 Bacteria 1828
35 Ga0070691_10073533 3300005341 Unclassified 1662
36 Ga0070691_10268612 3300005341 Unclassified 921
37 Ga0070691_10416975 3300005341 Bacteria 760
38 Ga0070687_101302564 3300005343 Bacteria 540
39 Ga0070661_100080732 3300005344 Bacteria 2400
40 Ga0070661_100601541 3300005344 Bacteria 889
41 Ga0070692_10039401 3300005345 Bacteria 2412
42 Ga0070668_100019875 3300005347 Bacteria 5060
43 Ga0070668_100858671 3300005347 Bacteria 809
44 Ga0070669_100123725 3300005353 Bacteria 1977
45 Ga0070671_100060932 3300005355 Bacteria 3142
46 Ga0070671_100289163 3300005355 Unclassified 1395
47 Ga0070674_100484900 3300005356 Bacteria 1027
48 Ga0070673_101883879 3300005364 Bacteria 567
49 Ga0070659_100057173 3300005366 Bacteria 3075
50 Ga0070709_10040745 3300005434 Bacteria 2857
51 Ga0070709_10077780 3300005434 Bacteria 2157
52 Ga0070709_10198908 3300005434 Unclassified 1418
53 Ga0070714_100018069 3300005435 Bacteria 5720
54 Ga0070714_100024674 3300005435 Bacteria 4955
55 Ga0070714_100030318 3300005435 Bacteria 4501
56 Ga0070714_100035545 3300005435 Bacteria 4177
57 Ga0070714_100119582 3300005435 Bacteria 2342
58 Ga0070714_100256614 3300005435 Bacteria 1618
59 Ga0070714_101220652 3300005435 Bacteria 734
60 Ga0070714_101578220 3300005435 Unclassified 641
61 Ga0070713_100296490 3300005436 Bacteria 1487
62 Ga0070713_100342805 3300005436 Bacteria 1385
63 Ga0070710_10045750 3300005437 Bacteria 2434
64 Ga0070710_10513919 3300005437 Bacteria 822
65 Ga0070711_100078760 3300005439 Bacteria 2342
66 Ga0070711_100360379 3300005439 Bacteria 1171
67 Ga0070711_100612138 3300005439 Bacteria 910
68 Ga0070705_100258474 3300005440 Bacteria 1227
69 Ga0070705_100402868 3300005440 Bacteria 1014
70 Ga0070700_100428213 3300005441 Bacteria 1001
71 Ga0070708_100306729 3300005445 Bacteria 1495
72 Ga0070708_100731123 3300005445 Bacteria 931
73 Ga0070708_100822560 3300005445 Bacteria 873
74 Ga0070708_101491997 3300005445 Bacteria 630
75 Ga0070663_101374832 3300005455 Bacteria 625
76 Ga0070678_100200701 3300005456 Bacteria 1646
77 Ga0070678_100618380 3300005456 Bacteria 969
78 Ga0070662_100046652 3300005457 Bacteria 3114
79 Ga0070662_100074932 3300005457 Unclassified 2505
80 Ga0070662_100152082 3300005457 Unclassified 1803
81 Ga0070681_10035668 3300005458 Bacteria 4995
82 Ga0070681_10057340 3300005458 Bacteria 3875
83 Ga0070681_10062107 3300005458 Bacteria 3710
84 Ga0070681_10187155 3300005458 Bacteria 1990
85 Ga0070681_10676536 3300005458 Unclassified 947
86 Ga0070681_11444649 3300005458 Bacteria 612
87 Ga0070681_11512988 3300005458 Bacteria 596
88 Ga0070681_11991516 3300005458 Bacteria 509
89 Ga0068867_100091334 3300005459 Unclassified 2311
90 Ga0068867_100115010 3300005459 Bacteria 2071
91 Ga0070685_10065218 3300005466 Bacteria 2143
92 Ga0070706_100157724 3300005467 Bacteria 2118
93 Ga0070707_100711845 3300005468 Bacteria 967
94 Ga0070707_101173846 3300005468 Bacteria 734
95 Ga0070698_100026743 3300005471 Bacteria 6002
96 Ga0070698_100037141 3300005471 Bacteria 5024
97 Ga0070698_100185544 3300005471 Bacteria 2018
98 Ga0070698_100318600 3300005471 Bacteria 1485
99 Ga0070698_100341617 3300005471 Bacteria 1428
100 Ga0070698_100435026 3300005471 Bacteria 1247
101 Ga0070699_100103626 3300005518 Bacteria 2495
102 Ga0070679_100075139 3300005530 Bacteria 3369
103 Ga0070679_100081103 3300005530 Bacteria 3233
104 Ga0070679_100096451 3300005530 Bacteria 2945
105 Ga0070679_100250426 3300005530 Bacteria 1728
106 Ga0070679_100305134 3300005530 Bacteria 1542
107 Ga0070679_100393177 3300005530 Bacteria 1333
108 Ga0070679_100434760 3300005530 Bacteria 1257
109 Ga0070679_100434811 3300005530 Unclassified 1257
110 Ga0070679_100783726 3300005530 Unclassified 896
111 Ga0070679_101331789 3300005530 Bacteria 664
112 Ga0070684_100073429 3300005535 Bacteria 3014
113 Ga0070684_100137723 3300005535 Bacteria 2206
114 Ga0070684_100358654 3300005535 Bacteria 1342
115 Ga0070684_100375971 3300005535 Bacteria 1308
116 Ga0070697_100366520 3300005536 Unclassified 1246
117 Ga0068853_100381824 3300005539 Bacteria 1316
118 Ga0068853_101088034 3300005539 Unclassified 771
119 Ga0068853_101103958 3300005539 Bacteria 765
120 Ga0068853_102248181 3300005539 Bacteria 529
121 Ga0070695_100017880 3300005545 Bacteria 4301
122 Ga0070695_101122636 3300005545 Bacteria 644
123 Ga0070696_100038290 3300005546 Bacteria 3309
124 Ga0070696_100100208 3300005546 Bacteria 2074
125 Ga0070693_100019865 3300005547 Bacteria 3532
126 Ga0070693_100051739 3300005547 Bacteria 2353
127 Ga0070665_101217316 3300005548 Bacteria 764
128 Ga0070665_101964303 3300005548 Bacteria 590
129 Ga0070704_100078786 3300005549 Bacteria 2418
130 Ga0070704_100181183 3300005549 Bacteria 1685
131 Ga0070704_100602545 3300005549 Bacteria 966
132 Ga0070704_100783335 3300005549 Unclassified 851
133 Ga0068855_100041774 3300005563 Bacteria 5433
134 Ga0068855_100144185 3300005563 Bacteria 2713
135 Ga0068855_100158466 3300005563 Bacteria 2571
136 Ga0068855_100395390 3300005563 Unclassified 1516
137 Ga0068855_101076583 3300005563 Bacteria 841
138 Ga0068855_101911481 3300005563 Bacteria 601
139 Ga0070664_100758281 3300005564 Bacteria 906
140 Ga0070664_100783414 3300005564 Bacteria 891
141 Ga0068857_100707450 3300005577 Bacteria 957
142 Ga0068854_100302177 3300005578 Bacteria 1295
143 Ga0068854_101464569 3300005578 Bacteria 619
144 Ga0068856_100301589 3300005614 Bacteria 1620
145 Ga0068856_100457030 3300005614 Bacteria 1298
146 Ga0068856_100496879 3300005614 Unclassified 1241
147 Ga0068856_100551253 3300005614 Bacteria 1174
148 Ga0068856_100818730 3300005614 Unclassified 951
149 Ga0068856_101129360 3300005614 Unclassified 801
150 Ga0068856_101539571 3300005614 Bacteria 678
151 Ga0070702_100111354 3300005615 Bacteria 1697
152 Ga0070702_100243114 3300005615 Bacteria 1216
153 Ga0070702_100672278 3300005615 Bacteria 786
154 Ga0068852_100090411 3300005616 Bacteria 2738
155 Ga0068852_100336607 3300005616 Bacteria 1470
156 Ga0068859_100131031 3300005617 Bacteria 2579
157 Ga0068864_100383087 3300005618 Bacteria 1333
158 Ga0068866_10677763 3300005718 Bacteria 705
159 Ga0068861_100006190 3300005719 Bacteria 8144
160 Ga0068861_100032457 3300005719 Bacteria 3844
161 Ga0068863_100190836 3300005841 Bacteria 1969
162 Ga0068860_100446185 3300005843 Bacteria 1286
163 Ga0068862_100813902 3300005844 Bacteria 913
164 Ga0081455_10021136 3300005937 Bacteria 6112
165 Ga0081455_10043634 3300005937 Bacteria 3920
166 Ga0081540_1011397 3300005983 Bacteria 5944
167 Ga0081540_1027675 3300005983 Bacteria 3205
168 Ga0070717_10045439 3300006028 Bacteria 3591
169 Ga0070717_10094164 3300006028 Bacteria 2533
170 Ga0070717_10155388 3300006028 Bacteria 1981
171 Ga0070717_10952153 3300006028 Bacteria 782
172 Ga0070717_11027783 3300006028 Bacteria 751
173 Ga0075432_10004713 3300006058 Bacteria 4642
174 Ga0070712_100035356 3300006175 Bacteria 3391
175 Ga0070712_100090356 3300006175 Bacteria 2242
176 Ga0070712_100220790 3300006175 Bacteria 1500
177 Ga0075428_100063600 3300006844 Bacteria 4040
178 Ga0075428_100176345 3300006844 Bacteria 2315
179 Ga0075428_100236449 3300006844 Bacteria 1971
180 Ga0075431_100301701 3300006847 Unclassified 1618
181 Ga0075433_10036455 3300006852 Bacteria 4237
182 Ga0075433_10526852 3300006852 Bacteria 1039
183 Ga0075434_100399955 3300006871 Bacteria 1394
184 Ga0075429_100113492 3300006880 Bacteria 2368
185 Ga0075429_101789308 3300006880 Unclassified 533
186 Ga0075436_100109147 3300006914 Bacteria 1930
187 Ga0075436_100206475 3300006914 Bacteria 1392
188 Ga0075436_101034629 3300006914 Bacteria 617
189 Ga0097620_100131032 3300006931 Bacteria 2579
190 Ga0075435_100064738 3300007076 Bacteria 2971
191 Ga0075435_100786950 3300007076 Bacteria 828
192 Ga0105240_10061052 3300009093 Bacteria 4698
193 Ga0105240_10099400 3300009093 Unclassified 3541
194 Ga0105240_10227646 3300009093 Bacteria 2168
195 Ga0105240_10465146 3300009093 Bacteria 1412
196 Ga0105240_10793002 3300009093 Unclassified 1027
197 Ga0105240_12250690 3300009093 Bacteria 565
198 Ga0105245_10040524 3300009098 Bacteria 4150
199 Ga0105245_10051571 3300009098 Bacteria 3688
200 Ga0105245_10122482 3300009098 Bacteria 2431
201 Ga0105245_10686217 3300009098 Unclassified 1056
202 Ga0105245_11002447 3300009098 Unclassified 880
203 Ga0114129_10119783 3300009147 Bacteria 3625
204 Ga0114129_10397853 3300009147 Bacteria 1816
205 Ga0114129_10461223 3300009147 Bacteria 1665
206 Ga0114129_11242441 3300009147 Unclassified 926
207 Ga0105243_10181986 3300009148 Bacteria 1828
208 Ga0105243_10310718 3300009148 Bacteria 1432
209 Ga0105243_11050426 3300009148 Bacteria 820
210 Ga0105241_10615659 3300009174 Bacteria 982
211 Ga0105242_10133186 3300009176 Bacteria 2148
212 Ga0105242_10151976 3300009176 Bacteria 2019
213 Ga0105237_10046647 3300009545 Bacteria 4358
214 Ga0105238_10347766 3300009551 Unclassified 1471
215 Ga0105238_11353581 3300009551 Bacteria 738
216 Ga0105249_10048178 3300009553 Bacteria 3885
217 Ga0105249_10146985 3300009553 Bacteria 2265
218 Ga0105249_10149139 3300009553 Bacteria 2250
219 Ga0105239_10019915 3300010375 Bacteria 7405
220 Ga0105239_10155029 3300010375 Unclassified 2558
221 Ga0105239_10157729 3300010375 Bacteria 2535
222 Ga0105246_10612037 3300011119 Bacteria 943
223 Ga0105246_10957268 3300011119 Unclassified 772
224 Ga0157325_1008432 3300012485 Bacteria 715
225 Ga0157321_1005684 3300012487 Bacteria 826
226 Ga0157373_10102639 3300013100 Bacteria 2012
227 Ga0157373_10126113 3300013100 Bacteria 1800
228 Ga0157373_10226484 3300013100 Bacteria 1320
229 Ga0157371_10143827 3300013102 Bacteria 1699
230 Ga0157370_10018694 3300013104 Bacteria 6968
231 Ga0157370_10109603 3300013104 Bacteria 2581
232 Ga0157370_10356077 3300013104 Bacteria 1349
233 Ga0157370_10429379 3300013104 Bacteria 1215
234 Ga0157370_10464438 3300013104 Bacteria 1163
235 Ga0157370_10953144 3300013104 Bacteria 778
236 Ga0157369_10002303 3300013105 Bacteria 22963
237 Ga0157369_10006178 3300013105 Bacteria 13900
238 Ga0157369_10012052 3300013105 Bacteria 9817
239 Ga0157369_10030501 3300013105 Bacteria 5946
240 Ga0157369_10061676 3300013105 Bacteria 4041
241 Ga0157369_10348917 3300013105 Bacteria 1537
242 Ga0157369_10393767 3300013105 Bacteria 1437
243 Ga0157369_11282794 3300013105 Bacteria 747
244 Ga0157378_10172644 3300013297 Bacteria 2028
245 Ga0163162_10023066 3300013306 Bacteria 6139
246 Ga0163162_10179058 3300013306 Bacteria 2246
247 Ga0163162_11210419 3300013306 Bacteria 857
248 Ga0163162_12537523 3300013306 Unclassified 589
249 Ga0157372_10204328 3300013307 Bacteria 2289
250 Ga0157372_10329597 3300013307 Bacteria 1778
251 Ga0157372_11293649 3300013307 Unclassified 841
252 Ga0157372_11374266 3300013307 Unclassified 814
253 Ga0157372_11379033 3300013307 Bacteria 813
254 Ga0157372_11500325 3300013307 Unclassified 777
255 Ga0157372_13470130 3300013307 Unclassified 501
256 Ga0157375_10119033 3300013308 Bacteria 2748
257 Ga0157375_10135997 3300013308 Bacteria 2581
258 Ga0157375_10324739 3300013308 Bacteria 1704
259 Ga0163163_10013038 3300014325 Bacteria 7589
260 Ga0157380_10146969 3300014326 Bacteria 2032
261 Ga0182008_10001010 3300014497 Bacteria 19546
262 Ga0182008_10085595 3300014497 Bacteria 1553
263 Ga0182008_10150851 3300014497 Bacteria 1166
264 Ga0182008_10919850 3300014497 Bacteria 516
265 Ga0157377_10086977 3300014745 Unclassified 1838
266 Ga0182006_1016684 3300015261 Bacteria 3130
267 Ga0182007_10015408 3300015262 Bacteria 2853
268 Ga0163161_10016676 3300017792 Bacteria 5132
269 Ga0163161_10097993 3300017792 Unclassified 2178
270 Ga0163161_10431851 3300017792 Bacteria 1062
271 Ga0197907_10725116 3300020069 Bacteria 965
272 Ga0206356_10240272 3300020070 Bacteria 1323
273 Ga0206356_10946499 3300020070 Bacteria 1079
274 Ga0206356_11704471 3300020070 Bacteria 3774
275 Ga0206354_10358543 3300020081 Bacteria 3540
276 Ga0206354_10477547 3300020081 Bacteria 652
277 Ga0206354_10637849 3300020081 Bacteria 804
278 Ga0206354_11240988 3300020081 Bacteria 3606
279 Ga0206353_10234536 3300020082 Bacteria 3461
280 Ga0206353_10804099 3300020082 Bacteria 9328
281 Ga0206353_11969477 3300020082 Bacteria 4482
282 Ga0213871_10148915 3300021441 Bacteria 711
283 Ga0224712_10077727 3300022467 Bacteria 1363
284 Ga0207653_10015924 3300025885 Bacteria 2360
285 Ga0207692_10062056 3300025898 Bacteria 1939
286 Ga0207642_10030722 3300025899 Bacteria 2241
287 Ga0207688_11053151 3300025901 Bacteria 514
288 Ga0207647_10422111 3300025904 Bacteria 750
289 Ga0207699_10075966 3300025906 Bacteria 2068
290 Ga0207699_10208037 3300025906 Bacteria 1329
291 Ga0207705_10005200 3300025909 Bacteria 9755
292 Ga0207705_10209113 3300025909 Bacteria 1480
293 Ga0207705_10222330 3300025909 Bacteria 1435
294 Ga0207684_10150995 3300025910 Bacteria 1999
295 Ga0207684_10242473 3300025910 Bacteria 1555
296 Ga0207707_10080669 3300025912 Bacteria 2841
297 Ga0207707_10112059 3300025912 Bacteria 2385
298 Ga0207707_10224896 3300025912 Bacteria 1633
299 Ga0207707_10708860 3300025912 Bacteria 844
300 Ga0207695_10097899 3300025913 Bacteria 2934
301 Ga0207695_10120036 3300025913 Bacteria 2598
302 Ga0207671_10154157 3300025914 Bacteria 1776
303 Ga0207693_10083211 3300025915 Bacteria 2506
304 Ga0207693_10298938 3300025915 Bacteria 1261
305 Ga0207693_10907481 3300025915 Bacteria 676
306 Ga0207663_10280103 3300025916 Bacteria 1238
307 Ga0207663_10894330 3300025916 Unclassified 710
308 Ga0207660_10074951 3300025917 Bacteria 2470
309 Ga0207660_10116430 3300025917 Bacteria 2019
310 Ga0207660_10254056 3300025917 Bacteria 1388
311 Ga0207660_10280935 3300025917 Unclassified 1321
312 Ga0207660_10617029 3300025917 Bacteria 884
313 Ga0207660_10640965 3300025917 Bacteria 866
314 Ga0207660_10755609 3300025917 Unclassified 793
315 Ga0207660_10911716 3300025917 Bacteria 717
316 Ga0207662_10029152 3300025918 Bacteria 3195
317 Ga0207657_10000388 3300025919 Bacteria 46370
318 Ga0207657_10010339 3300025919 Bacteria 9313
319 Ga0207657_10041066 3300025919 Bacteria 4092
320 Ga0207657_10083380 3300025919 Bacteria 2682
321 Ga0207657_10090125 3300025919 Bacteria 2560
322 Ga0207657_10102133 3300025919 Bacteria 2378
323 Ga0207657_10845407 3300025919 Unclassified 706
324 Ga0207657_10889562 3300025919 Bacteria 686
325 Ga0207657_11206898 3300025919 Bacteria 575
326 Ga0207649_11569643 3300025920 Bacteria 521
327 Ga0207652_10007590 3300025921 Bacteria 8733
328 Ga0207652_10061251 3300025921 Bacteria 3249
329 Ga0207652_10083152 3300025921 Bacteria 2802
330 Ga0207652_10091565 3300025921 Bacteria 2674
331 Ga0207652_10097733 3300025921 Bacteria 2589
332 Ga0207652_10307250 3300025921 Bacteria 1431
333 Ga0207652_10461065 3300025921 Unclassified 1145
334 Ga0207646_10660505 3300025922 Bacteria 936
335 Ga0207646_11452729 3300025922 Bacteria 595
336 Ga0207694_10207330 3300025924 Bacteria 1596
337 Ga0207694_10450495 3300025924 Bacteria 1074
338 Ga0207687_10168528 3300025927 Unclassified 1687
339 Ga0207687_10589877 3300025927 Unclassified 936
340 Ga0207687_11256370 3300025927 Bacteria 637
341 Ga0207700_10200310 3300025928 Bacteria 1682
342 Ga0207700_10571886 3300025928 Unclassified 1004
343 Ga0207664_10007814 3300025929 Bacteria 7429
344 Ga0207664_10022812 3300025929 Bacteria 4681
345 Ga0207664_10025226 3300025929 Bacteria 4475
346 Ga0207664_10058978 3300025929 Bacteria 3056
347 Ga0207664_10099886 3300025929 Bacteria 2395
348 Ga0207664_10169968 3300025929 Bacteria 1865
349 Ga0207664_10287848 3300025929 Bacteria 1443
350 Ga0207664_10338397 3300025929 Bacteria 1330
351 Ga0207644_10061440 3300025931 Bacteria 2721
352 Ga0207644_10343614 3300025931 Bacteria 1211
353 Ga0207690_10303491 3300025932 Bacteria 1250
354 Ga0207706_10009052 3300025933 Bacteria 9160
355 Ga0207706_10023685 3300025933 Bacteria 5511
356 Ga0207706_10088959 3300025933 Bacteria 2715
357 Ga0207686_10150293 3300025934 Bacteria 1620
358 Ga0207686_10174929 3300025934 Bacteria 1517
359 Ga0207709_10360677 3300025935 Bacteria 1100
360 Ga0207709_10531873 3300025935 Bacteria 922
361 Ga0207669_11467807 3300025937 Bacteria 581
362 Ga0207704_10119235 3300025938 Bacteria 1801
363 Ga0207704_10332509 3300025938 Bacteria 1176
364 Ga0207665_10478272 3300025939 Bacteria 959
365 Ga0207689_10224937 3300025942 Bacteria 1551
366 Ga0207661_10030134 3300025944 Bacteria 4175
367 Ga0207661_10076157 3300025944 Bacteria 2755
368 Ga0207661_10121846 3300025944 Bacteria 2221
369 Ga0207661_10390781 3300025944 Bacteria 1260
370 Ga0207679_10738909 3300025945 Bacteria 895
371 Ga0207679_11121957 3300025945 Bacteria 721
372 Ga0207667_10014195 3300025949 Bacteria 9090
373 Ga0207667_10535524 3300025949 Unclassified 1185
374 Ga0207667_10700774 3300025949 Bacteria 1015
375 Ga0207651_10346454 3300025960 Bacteria 1250
376 Ga0207712_10309335 3300025961 Bacteria 1300
377 Ga0207668_10080642 3300025972 Unclassified 2358
378 Ga0207668_11171775 3300025972 Bacteria 690
379 Ga0207640_10055421 3300025981 Bacteria 2597
380 Ga0207640_10086107 3300025981 Bacteria 2162
381 Ga0207640_10200078 3300025981 Bacteria 1513
382 Ga0207640_11426837 3300025981 Unclassified 621
383 Ga0207658_10759062 3300025986 Bacteria 879
384 Ga0207677_10054541 3300026023 Bacteria 2729
385 Ga0207677_10405126 3300026023 Bacteria 1158
386 Ga0207677_10726536 3300026023 Unclassified 883
387 Ga0207677_11905665 3300026023 Unclassified 552
388 Ga0207703_10496262 3300026035 Bacteria 1145
389 Ga0207639_10063676 3300026041 Bacteria 2856
390 Ga0207708_10037668 3300026075 Bacteria 3683
391 Ga0207702_10112952 3300026078 Bacteria 2419
392 Ga0207702_10193378 3300026078 Bacteria 1881
393 Ga0207702_10386042 3300026078 Bacteria 1347
394 Ga0207702_10451429 3300026078 Bacteria 1247
395 Ga0207702_10779296 3300026078 Bacteria 945
396 Ga0207702_11203114 3300026078 Bacteria 752
397 Ga0207702_11944980 3300026078 Bacteria 579
398 Ga0207648_10002280 3300026089 Bacteria 20731
399 Ga0207648_10146569 3300026089 Unclassified 2082
400 Ga0207676_10665805 3300026095 Bacteria 1006
401 Ga0207674_10402805 3300026116 Bacteria 1322
402 Ga0207675_100000962 3300026118 Bacteria 28741
403 Ga0207675_100016465 3300026118 Bacteria 6906
404 Ga0207675_100472986 3300026118 Bacteria 1244
405 Ga0207683_10120432 3300026121 Bacteria 2355
406 Ga0207683_10134164 3300026121 Bacteria 2228
407 Ga0207698_10390674 3300026142 Bacteria 1326
408 Ga0207428_10009640 3300027907 Bacteria 8648
409 Ga0268265_10760841 3300028380 Bacteria 941
410 Ga0268264_10221343 3300028381 Unclassified 1742
411 Ga0268264_10546650 3300028381 Bacteria 1135
412 Ga0265319_1137482 3300028563 Bacteria 759
413 Ga0265334_10023620 3300028573 Bacteria 2499
414 Ga0265318_10002578 3300028577 Bacteria 9601
415 Ga0265318_10171486 3300028577 Bacteria 795
416 Ga0265318_10330900 3300028577 Unclassified 556
417 Ga0265318_10398728 3300028577 Bacteria 503
418 Ga0265322_10032908 3300028654 Bacteria 1478
419 Ga0265336_10023824 3300028666 Bacteria 1938
420 Ga0265338_10007351 3300028800 Bacteria 13717
421 Ga0265338_10011362 3300028800 Bacteria 10293
422 Ga0265338_10223104 3300028800 Bacteria 1406
423 Ga0265338_10258498 3300028800 Bacteria 1281
424 Ga0265330_10122547 3300031235 Bacteria 1107
425 Ga0265320_10022368 3300031240 Bacteria 3383
426 Ga0265320_10189525 3300031240 Unclassified 920
427 Ga0265320_10226301 3300031240 Bacteria 832
428 Ga0265325_10057518 3300031241 Bacteria 1983
429 Ga0265340_10044224 3300031247 Bacteria 2179
430 Ga0265340_10114392 3300031247 Bacteria 1245
431 Ga0265339_10010628 3300031249 Bacteria 5707
432 Ga0265339_10098825 3300031249 Bacteria 1522
433 Ga0265339_10105639 3300031249 Bacteria 1462
434 Ga0265339_10164204 3300031249 Bacteria 1116
435 Ga0265327_10040184 3300031251 Bacteria 2532
436 Ga0265316_10005504 3300031344 Bacteria 12296
437 Ga0265316_10124633 3300031344 Bacteria 1944
438 Ga0265316_10264469 3300031344 Bacteria 1260
439 Ga0307408_100125368 3300031548 Bacteria 1996
440 Ga0307408_101425677 3300031548 Unclassified 653
441 Ga0265313_10039611 3300031595 Bacteria 2336
442 Ga0265314_10013969 3300031711 Bacteria 6456
443 Ga0265314_10072160 3300031711 Bacteria 2307
444 Ga0265314_10466568 3300031711 Bacteria 670
445 Ga0265342_10032409 3300031712 Bacteria 3223
446 Ga0265342_10066700 3300031712 Bacteria 2107
447 Ga0265342_10282914 3300031712 Bacteria 877
448 Ga0307405_11315318 3300031731 Bacteria 629
449 Ga0307406_10598243 3300031901 Unclassified 909
450 Ga0307407_10503554 3300031903 Bacteria 888
451 Ga0307412_10535733 3300031911 Bacteria 981
452 Ga0307415_100196978 3300032126 Bacteria 1595
453 Ga0307415_100989864 3300032126 Bacteria 781
454 Ga0373938_0148281 3300034957 Bacteria 623
455 Ga0373944_0087505 3300035089 Bacteria 1037
456 Ga0373941_0044140 3300035115 Bacteria 1390
457 Ga0373946_0194208 3300035171 Bacteria 969
458 Ga0373962_0019317 3300035242 Bacteria 1782
459 Ga0373962_0038575 3300035242 Bacteria 1338
460 Ga0373931_0304975 3300035691 Bacteria 984
461 Ga0373931_0763117 3300035691 Bacteria 643
462 Ga0373947_0000918 3300035725 Bacteria 17889
463 Ga0373947_0029763 3300035725 Unclassified 3205
464 Ga0373925_0169027 3300037068 Bacteria 1725
465 Ga0395899_0004887 3300037312 Bacteria 10436
466 Ga0395899_0009076 3300037312 Bacteria 7639
467 Ga0395899_0034242 3300037312 Bacteria 3813
468 Ga0395899_0104355 3300037312 Bacteria 2043
469 Ga0395900_0053378 3300037418 Bacteria 4160
470 Ga0395900_0087713 3300037418 Bacteria 3197
471 Ga0395900_0197714 3300037418 Bacteria 2036
472 Ga0395900_0239362 3300037418 Bacteria 1821
473 Ga0395900_0254506 3300037418 Bacteria 1756
474 Ga0395900_0397638 3300037418 Bacteria 1343
475 Ga0395900_0400346 3300037418 Bacteria 1337
476 Ga0395900_0438157 3300037418 Unclassified 1265
477 Ga0395900_0705694 3300037418 Bacteria 942
478 Ga0395900_1460892 3300037418 Bacteria 596
479 Ga0395898_0003001 3300037466 Bacteria 19133
480 Ga0395898_0037254 3300037466 Bacteria 4826
481 Ga0395898_0044034 3300037466 Bacteria 4396
482 Ga0395898_0143640 3300037466 Bacteria 2284
483 Ga0395898_0159219 3300037466 Bacteria 2159
484 Ga0395898_0180977 3300037466 Bacteria 2015
485 Ga0395898_0198660 3300037466 Bacteria 1915
486 Ga0395898_0524571 3300037466 Bacteria 1126
487 Ga0395898_0680017 3300037466 Unclassified 971
488 Ga0395898_1132144 3300037466 Unclassified 715
489 Ga0395898_1707056 3300037466 Bacteria 552
490 Ga0395898_1865803 3300037466 Bacteria 521
491 Ga0395905_0006030 3300037471 Bacteria 12272
492 Ga0395905_0046287 3300037471 Bacteria 4079
493 Ga0395905_0091348 3300037471 Bacteria 2854
494 Ga0395905_0169880 3300037471 Bacteria 2048
495 Ga0395905_0192572 3300037471 Bacteria 1912
496 Ga0395901_0033143 3300038443 Bacteria 5330
497 Ga0395901_0047926 3300038443 Bacteria 4437
498 Ga0395901_0080202 3300038443 Bacteria 3407
499 Ga0395901_0154805 3300038443 Bacteria 2408
500 Ga0395901_0161734 3300038443 Bacteria 2351
501 Ga0395901_0328377 3300038443 Unclassified 1582
502 Ga0395901_0351305 3300038443 Bacteria 1521
503 Ga0395901_0481439 3300038443 Bacteria 1266
504 Ga0395901_0550864 3300038443 Unclassified 1169
505 Ga0395901_0637691 3300038443 Bacteria 1070
506 Ga0395901_0850625 3300038443 Bacteria 897
507 Ga0395901_1012343 3300038443 Bacteria 806
508 Ga0395901_1280393 3300038443 Bacteria 696
509 Ga0395901_1997657 3300038443 Bacteria 526
510 Ga0242420_129380 3300038996 Bacteria 556
511 Ga0436360_0975496 3300039438 Bacteria 2482
512 Ga0451853_0158545 3300041512 Bacteria 2730
513 Ga0466972_0213033 3300044658 Bacteria 904
514 Ga0466972_0328302 3300044658 Bacteria 715
515 Ga0466965_0145522 3300044683 Bacteria 1236
516 Ga0466966_0028061 3300044684 Bacteria 3667
517 Ga0466966_0180906 3300044684 Bacteria 1279
518 Ga0466966_0680627 3300044684 Bacteria 620
519 Ga0466961_0003168 3300044693 Bacteria 10245
520 Ga0466961_0145035 3300044693 Bacteria 1485
521 Ga0466961_0621643 3300044693 Bacteria 649
522 Ga0466963_0003845 3300044694 Bacteria 8660
523 Ga0466963_0005592 3300044694 Bacteria 7372
524 Ga0466963_0025377 3300044694 Bacteria 3779
525 Ga0466963_0046731 3300044694 Bacteria 2855
526 Ga0466963_0071351 3300044694 Bacteria 2338
527 Ga0466963_0071480 3300044694 Bacteria 2335
528 Ga0466963_0102783 3300044694 Bacteria 1957
529 Ga0466963_0160614 3300044694 Bacteria 1564
530 Ga0466963_0285925 3300044694 Unclassified 1159
531 Ga0466963_0432060 3300044694 Bacteria 929
532 Ga0466963_0498225 3300044694 Bacteria 860
533 Ga0466964_0056279 3300044706 Bacteria 1626
534 Ga0466964_0115300 3300044706 Unclassified 1203
535 Ga0466964_0141190 3300044706 Unclassified 1107
536 Ga0466964_0394775 3300044706 Bacteria 721
537 Ga0466964_0484686 3300044706 Bacteria 661
538 Ga0466964_0694294 3300044706 Bacteria 567
539 Ga0466971_0018695 3300044719 Bacteria 3072
540 Ga0466971_0022425 3300044719 Bacteria 2814
541 Ga0466971_0024818 3300044719 Bacteria 2676
542 Ga0466971_0045941 3300044719 Bacteria 1962
543 Ga0466971_0185127 3300044719 Bacteria 980
544 Ga0466971_0271397 3300044719 Bacteria 811
545 Ga0466971_0497933 3300044719 Bacteria 601
546 Ga0466968_0045555 3300044735 Bacteria 1862
547 Ga0466968_0214899 3300044735 Bacteria 904
548 Ga0466970_0021149 3300044765 Bacteria 3387
549 Ga0466970_0157873 3300044765 Bacteria 1254
550 Ga0466957_0004517 3300044842 Bacteria 7766
551 Ga0466957_0036211 3300044842 Bacteria 2966
552 Ga0466957_0037927 3300044842 Bacteria 2902
553 Ga0466957_0060644 3300044842 Bacteria 2320
554 Ga0466957_0063369 3300044842 Bacteria 2272
555 Ga0466957_0255344 3300044842 Bacteria 1167
556 Ga0466957_0295586 3300044842 Bacteria 1087
557 Ga0466957_0645255 3300044842 Unclassified 744
558 Ga0466957_0743127 3300044842 Bacteria 694
559 Ga0466957_0859189 3300044842 Unclassified 647
560 Ga0466960_0834068 3300044901 Bacteria 560
561 Ga0466959_0341577 3300045049 Bacteria 1021
562 Ga0466959_1190682 3300045049 Archaea 506
563 Ga0451576_0171276 3300045051 Bacteria 2266
564 Ga0451576_0755929 3300045051 Bacteria 1021
565 Ga0451576_1869539 3300045051 Bacteria 620
566 Ga0466958_0010746 3300045836 Bacteria 5135
567 Ga0466958_0011649 3300045836 Bacteria 4957
568 Ga0466958_0034402 3300045836 Bacteria 3023
569 Ga0466958_0041096 3300045836 Bacteria 2781
570 Ga0466958_0116942 3300045836 Bacteria 1667
571 Ga0466958_0253141 3300045836 Bacteria 1127
572 Ga0466958_0344353 3300045836 Bacteria 959
573 Ga0466958_0346291 3300045836 Bacteria 956
574 Ga0466958_0468958 3300045836 Bacteria 816
575 Ga0466967_0005509 3300045976 Bacteria 8785
576 Ga0466967_0025009 3300045976 Bacteria 4917
577 Ga0466967_0031365 3300045976 Bacteria 4473
578 Ga0466967_0041018 3300045976 Bacteria 3987
579 Ga0466967_0046656 3300045976 Unclassified 3773
580 Ga0466967_0090183 3300045976 Bacteria 2784
581 Ga0466967_0100797 3300045976 Bacteria 2639
582 Ga0466967_0124924 3300045976 Bacteria 2382
583 Ga0466967_0168812 3300045976 Bacteria 2057
584 Ga0466967_0286870 3300045976 Bacteria 1580
585 Ga0466967_0485236 3300045976 Bacteria 1211
586 Ga0466967_0563109 3300045976 Unclassified 1122
587 Ga0466967_0653199 3300045976 Bacteria 1040
588 Ga0466967_0788411 3300045976 Unclassified 943
589 Ga0495592_0330803 3300046454 Bacteria 982
590 Ga0495603_0000315 3300046455 Bacteria 25931
591 Ga0495629_0075516 3300046459 Unclassified 2354
592 Ga0495629_0076374 3300046459 Bacteria 2339
593 Ga0495641_0002640 3300046461 Bacteria 14008
594 Ga0495641_0022803 3300046461 Unclassified 3125
595 Ga0495641_0297432 3300046461 Bacteria 727
596 Ga0495653_0031425 3300046463 Bacteria 4220
597 Ga0495580_0279778 3300046472 Bacteria 1138
598 Ga0495582_0010033 3300046473 Bacteria 5212
599 Ga0495605_0416647 3300046474 Bacteria 557
600 Ga0495639_0249185 3300046475 Bacteria 878
601 Ga0495639_0652745 3300046475 Bacteria 542
602 Ga0495584_0057441 3300046491 Bacteria 1958
603 Ga0495584_0097952 3300046491 Bacteria 1482
604 Ga0495584_0161974 3300046491 Bacteria 1137
605 Ga0495594_0001557 3300046499 Bacteria 11915
606 Ga0495594_0019914 3300046499 Unclassified 3570
607 Ga0495628_0269162 3300046516 Bacteria 1268
608 Ga0495630_0365748 3300046517 Bacteria 1104
609 Ga0495631_0358847 3300046518 Bacteria 620
610 Ga0495663_0231165 3300046525 Bacteria 652
611 Ga0495666_0029399 3300046526 Bacteria 2703
612 Ga0495652_0126969 3300046529 Bacteria 2025
613 Ga0495665_0107891 3300046531 Unclassified 1461
614 Ga0495586_0029827 3300046535 Unclassified 2920
615 Ga0495609_0108835 3300046538 Bacteria 1197
616 Ga0495621_0262656 3300046539 Bacteria 708
617 Ga0495645_0520457 3300046543 Bacteria 741
618 Ga0495622_0044021 3300046557 Bacteria 2075
619 Ga0495667_0104095 3300046559 Bacteria 1835
620 Ga0495656_0334170 3300046615 Bacteria 783
621 Ga0495668_0202507 3300046616 Bacteria 1087
622 Ga0495668_0709142 3300046616 Bacteria 557
623 Ga0495634_0123904 3300046642 Bacteria 1653
624 Ga0495634_0178818 3300046642 Unclassified 1329
625 Ga0495635_0339624 3300046663 Bacteria 1003
626 Ga0495659_0077440 3300046664 Bacteria 1256
627 Ga0495588_0001006 3300046674 Bacteria 12276
628 Ga0495657_0456238 3300046675 Bacteria 748
629 Ga0495647_0001825 3300046681 Bacteria 6589
630 Ga0495647_0084839 3300046681 Bacteria 1290
631 Ga0495658_0046804 3300046683 Bacteria 2433
632 Ga0495613_0078401 3300046689 Bacteria 2403
633 Ga0495613_0168991 3300046689 Bacteria 1553
634 Ga0495600_0120450 3300046809 Bacteria 1707
635 Ga0495581_0168860 3300047315 Bacteria 1279
636 Ga0495581_0332045 3300047315 Bacteria 888
637 Ga0495604_0133708 3300047317 Bacteria 1780
638 Ga0495674_0146217 3300047319 Bacteria 1984
639 Ga0495676_0056087 3300047321 Unclassified 3118
640 Ga0495676_0080563 3300047321 Bacteria 2472
641 Ga0495680_0397953 3300047322 Bacteria 951
642 Ga0495684_0389441 3300047471 Bacteria 981
643 Ga0495593_0082362 3300047673 Bacteria 1663
644 Ga0495602_0706429 3300048088 Bacteria 684
645 Ga0496100_0128246 3300048903 Bacteria 1783
646 Ga0496100_0266342 3300048903 Bacteria 1272
647 Ga0496101_0017380 3300048904 Bacteria 4880
648 Ga0496101_0178131 3300048904 Bacteria 1636
649 Ga0496101_0343955 3300048904 Bacteria 1172
650 Ga0496102_0122377 3300048905 Bacteria 2430
651 Ga0496102_0201641 3300048905 Bacteria 1875
652 Ga0496102_0307827 3300048905 Unclassified 1493
653 Ga0496103_0114775 3300048906 Bacteria 1713
654 Ga0496103_0258570 3300048906 Bacteria 1120
655 Ga0496103_0306261 3300048906 Bacteria 1022
656 Ga0496104_0005360 3300048907 Bacteria 11225
657 Ga0496104_0039743 3300048907 Bacteria 4405
658 Ga0496104_0313705 3300048907 Bacteria 1481
659 Ga0496104_0661872 3300048907 Bacteria 953
660 Ga0496104_1072165 3300048907 Bacteria 709
661 Ga0496105_0003157 3300048908 Bacteria 12134
662 Ga0496105_0147064 3300048908 Bacteria 1937
663 Ga0496105_0483997 3300048908 Bacteria 973
664 Ga0496105_0744832 3300048908 Unclassified 749
665 Ga0496106_0001856 3300048909 Bacteria 15812
666 Ga0496106_0267337 3300048909 Unclassified 1369
667 Ga0496106_0336544 3300048909 Bacteria 1212
668 Ga0496106_1498883 3300048909 Bacteria 519
669 Ga0496107_0029123 3300048910 Bacteria 3926
670 Ga0496107_0173205 3300048910 Bacteria 1602
671 Ga0496108_0015483 3300048911 Bacteria 6220
672 Ga0496108_0054439 3300048911 Bacteria 3357
673 Ga0496108_0165659 3300048911 Bacteria 1911
674 Ga0496108_0457624 3300048911 Bacteria 1115
675 Ga0496108_0458672 3300048911 Bacteria 1113
676 Ga0496108_0860132 3300048911 Bacteria 780
677 Ga0496109_0016861 3300048912 Bacteria 6391
678 Ga0496109_0061176 3300048912 Bacteria 3442
679 Ga0496109_0086040 3300048912 Bacteria 2903
680 Ga0496109_0100769 3300048912 Bacteria 2680
681 Ga0496109_0128873 3300048912 Bacteria 2360
682 Ga0496109_0130074 3300048912 Unclassified 2349
683 Ga0496109_0546121 3300048912 Bacteria 1093
684 Ga0496110_0003586 3300048913 Bacteria 11931
685 Ga0496110_0009997 3300048913 Bacteria 7696
686 Ga0496110_0014829 3300048913 Bacteria 6476
687 Ga0496110_0181900 3300048913 Bacteria 1909
688 Ga0496110_0241981 3300048913 Unclassified 1642
689 Ga0496111_0004255 3300048914 Bacteria 9020
690 Ga0496111_0010141 3300048914 Bacteria 6308
691 Ga0496111_0323827 3300048914 Bacteria 1141
692 Ga0496112_0000307 3300048915 Bacteria 31590
693 Ga0496112_0022546 3300048915 Bacteria 6001
694 Ga0496112_0028506 3300048915 Bacteria 5390
695 Ga0496112_0047386 3300048915 Bacteria 4216
696 Ga0496112_0107315 3300048915 Bacteria 2762
697 Ga0496112_0208500 3300048915 Bacteria 1912
698 Ga0496112_0309667 3300048915 Bacteria 1524
699 Ga0496112_0442967 3300048915 Bacteria 1237
700 Ga0496112_0475203 3300048915 Bacteria 1187
701 Ga0496112_0969410 3300048915 Bacteria 771
702 Ga0496112_1005770 3300048915 Bacteria 753
703 Ga0496112_1920347 3300048915 Bacteria 503
704 Ga0496113_0000192 3300048916 Bacteria 27861
705 Ga0496113_0021667 3300048916 Bacteria 4535
706 Ga0496113_0187245 3300048916 Bacteria 1642
707 Ga0496113_0187751 3300048916 Bacteria 1640
708 Ga0496113_0214715 3300048916 Bacteria 1532
709 Ga0496114_0068553 3300048917 Bacteria 2978
710 Ga0496114_0116450 3300048917 Bacteria 2294
711 Ga0496114_0732730 3300048917 Bacteria 865
712 Ga0496115_0042155 3300048918 Bacteria 3635
713 Ga0496115_0194156 3300048918 Bacteria 1677
714 Ga0501034_0051076 3300049571 Bacteria 4170
715 Ga0501041_0109290 3300049577 Bacteria 1715
716 Ga0501043_0727036 3300049579 Bacteria 723
717 Ga0501046_0972302 3300049580 Bacteria 590
718 Ga0501048_0384956 3300049582 Bacteria 1002
719 Ga0501067_0086812 3300049583 Bacteria 1736
720 Ga0501067_0177230 3300049583 Bacteria 1187
721 Ga0501067_0569895 3300049583 Bacteria 634
722 Ga0501068_0738751 3300049584 Bacteria 644
723 Ga0501068_0915609 3300049584 Bacteria 577
724 Ga0501068_1113612 3300049584 Bacteria 522
725 Ga0501069_0123102 3300049585 Bacteria 1482
726 Ga0501070_0002719 3300049586 Bacteria 15433
727 Ga0501070_0007864 3300049586 Bacteria 9035
728 Ga0501072_0095044 3300049588 Bacteria 2368
729 Ga0501072_0467823 3300049588 Bacteria 998
730 Ga0501073_0025021 3300049589 Bacteria 4284
731 Ga0501073_0710240 3300049589 Bacteria 693
732 Ga0501074_0000736 3300049590 Bacteria 20545
733 Ga0501074_0056120 3300049590 Bacteria 2838
734 Ga0501074_0134059 3300049590 Bacteria 1772
735 Ga0501075_0180259 3300049591 Bacteria 1612
736 Ga0501079_0090973 3300049741 Bacteria 2364
737 Ga0501079_0151104 3300049741 Bacteria 1810
738 Ga0501080_0000499 3300049742 Bacteria 30720
739 Ga0501080_0008878 3300049742 Bacteria 9138
740 Ga0501083_0000893 3300049744 Bacteria 19783
741 Ga0501035_1296154 3300049822 Bacteria 562
742 nmdc:mga05p37_349744_c1 3300050507 Bacteria 1740
743 nmdc:mga05p37_4070_c1 3300050507 Bacteria 17093
744 nmdc:mga05p37_51178_c1 3300050507 Bacteria 5080
745 nmdc:mga09592_159327_c1 3300050508 Bacteria 1949
746 nmdc:mga06r32_499587_c1 3300050510 Unclassified 1193
747 nmdc:mga06r32_88253_c1 3300050510 Bacteria 3027
748 nmdc:mga08y16_1645879_c1 3300050511 Unclassified 599
749 nmdc:mga0n895_38057_c1 3300050512 Bacteria 4659
750 nmdc:mga0rr50_1387720_c1 3300050513 Bacteria 595
751 nmdc:mga0rr50_29022_c1 3300050513 Bacteria 3896
752 nmdc:mga08x19_212835_c1 3300050514 Bacteria 1327
753 nmdc:mga08x19_454491_c1 3300050514 Unclassified 902
754 nmdc:mga08x19_972390_c1 3300050514 Bacteria 603
755 nmdc:mga0a205_1404869_c1 3300050515 Unclassified 546
756 nmdc:mga0a205_34720_c1 3300050515 Bacteria 4840
757 Ga0495601_0833559 3300053077 Bacteria 584
758 Ga0495655_0027026 3300053083 Bacteria 1357
759 Ga0495595_0182394 3300053084 Bacteria 1041
760 Ga0495595_0507152 3300053084 Bacteria 615
761 Ga0495619_0011494 3300053085 Bacteria 5581
762 Ga0500566_0262559 3300053094 Bacteria 833
763 Ga0501084_0998500 3300054114 Bacteria 703
764 Ga0501082_0309379 3300060353 Bacteria 1376
765 Ga0501082_0345127 3300060353 Bacteria 1297
766 Ga0466962_0020288 3300061719 Bacteria 3194
767 Ga0466962_0039457 3300061719 Bacteria 2261
768 Ga0466962_0109376 3300061719 Bacteria 1330
769 Ga0466962_0336536 3300061719 Bacteria 750
770 Ga0530510_0349355 3300061734 Bacteria 1111
771 Ga0466967_0173177
772 Ga0070658_10003218
773 Ga0070658_10094616
774 Ga0070658_10305778
775 Ga0070658_10568368
776 Ga0070658_10767255
777 Ga0070683_100045570
778 Ga0070683_100293169
779 Ga0070683_100399211
780 Ga0070690_101295781
781 Ga0070677_10657400
782 Ga0068869_100906230
783 Ga0070680_100013061
784 Ga0070680_100143926
785 Ga0070680_100173766
786 Ga0070680_100314209
787 Ga0070680_101081576
788 Ga0070680_101263963
789 Ga0070680_101521460
790 Ga0070682_100137372
791 Ga0068868_100144853
792 Ga0068868_100313169
793 Ga0068868_100772891
794 Ga0068868_101309897
795 Ga0068868_101326481
796 Ga0070660_100003398
797 Ga0070660_100008279
798 Ga0070660_100014577
799 Ga0070660_100093203
800 Ga0070660_100381206
801 Ga0070660_100425802
802 Ga0070660_101156429
803 Ga0070689_100069489
804 Ga0070691_10059987
805 Ga0070691_10073533
806 Ga0070691_10268612
807 Ga0070691_10416975
808 Ga0070687_101302564
809 Ga0070661_100080732
810 Ga0070661_100601541
811 Ga0070692_10039401
812 Ga0070668_100019875
813 Ga0070668_100858671
814 Ga0070669_100123725
815 Ga0070671_100060932
816 Ga0070671_100289163
817 Ga0070674_100484900
818 Ga0070673_101883879
819 Ga0070659_100057173
820 Ga0070709_10040745
821 Ga0070709_10077780
822 Ga0070709_10198908
823 Ga0070714_100018069
824 Ga0070714_100024674
825 Ga0070714_100030318
826 Ga0070714_100035545
827 Ga0070714_100119582
828 Ga0070714_100256614
829 Ga0070714_101220652
830 Ga0070714_101578220
831 Ga0070713_100296490
832 Ga0070713_100342805
833 Ga0070710_10045750
834 Ga0070710_10513919
835 Ga0070711_100078760
836 Ga0070711_100360379
837 Ga0070711_100612138
838 Ga0070705_100258474
839 Ga0070705_100402868
840 Ga0070700_100428213
841 Ga0070708_100306729
842 Ga0070708_100731123
843 Ga0070708_100822560
844 Ga0070708_101491997
845 Ga0070663_101374832
846 Ga0070678_100200701
847 Ga0070678_100618380
848 Ga0070662_100046652
849 Ga0070662_100074932
850 Ga0070662_100152082
851 Ga0070681_10035668
852 Ga0070681_10057340
853 Ga0070681_10062107
854 Ga0070681_10187155
855 Ga0070681_10676536
856 Ga0070681_11444649
857 Ga0070681_11512988
858 Ga0070681_11991516
859 Ga0068867_100091334
860 Ga0068867_100115010
861 Ga0070685_10065218
862 Ga0070706_100157724
863 Ga0070707_100711845
864 Ga0070707_101173846
865 Ga0070698_100026743
866 Ga0070698_100037141
867 Ga0070698_100185544
868 Ga0070698_100318600
869 Ga0070698_100341617
870 Ga0070698_100435026
871 Ga0070699_100103626
872 Ga0070679_100075139
873 Ga0070679_100081103
874 Ga0070679_100096451
875 Ga0070679_100250426
876 Ga0070679_100305134
877 Ga0070679_100393177
878 Ga0070679_100434760
879 Ga0070679_100434811
880 Ga0070679_100783726
881 Ga0070679_101331789
882 Ga0070684_100073429
883 Ga0070684_100137723
884 Ga0070684_100358654
885 Ga0070684_100375971
886 Ga0070697_100366520
887 Ga0068853_100381824
888 Ga0068853_101088034
889 Ga0068853_101103958
890 Ga0068853_102248181
891 Ga0070695_100017880
892 Ga0070695_101122636
893 Ga0070696_100038290
894 Ga0070696_100100208
895 Ga0070693_100019865
896 Ga0070693_100051739
897 Ga0070665_101217316
898 Ga0070665_101964303
899 Ga0070704_100078786
900 Ga0070704_100181183
901 Ga0070704_100602545
902 Ga0070704_100783335
903 Ga0068855_100041774
904 Ga0068855_100144185
905 Ga0068855_100158466
906 Ga0068855_100395390
907 Ga0068855_101076583
908 Ga0068855_101911481
909 Ga0070664_100758281
910 Ga0070664_100783414
911 Ga0068857_100707450
912 Ga0068854_100302177
913 Ga0068854_101464569
914 Ga0068856_100301589
915 Ga0068856_100457030
916 Ga0068856_100496879
917 Ga0068856_100551253
918 Ga0068856_100818730
919 Ga0068856_101129360
920 Ga0068856_101539571
921 Ga0070702_100111354
922 Ga0070702_100243114
923 Ga0070702_100672278
924 Ga0068852_100090411
925 Ga0068852_100336607
926 Ga0068859_100131031
927 Ga0068864_100383087
928 Ga0068866_10677763
929 Ga0068861_100006190
930 Ga0068861_100032457
931 Ga0068863_100190836
932 Ga0068860_100446185
933 Ga0068862_100813902
934 Ga0081455_10021136
935 Ga0081455_10043634
936 Ga0081540_1011397
937 Ga0081540_1027675
938 Ga0070717_10045439
939 Ga0070717_10094164
940 Ga0070717_10155388
941 Ga0070717_10952153
942 Ga0070717_11027783
943 Ga0075432_10004713
944 Ga0070712_100035356
945 Ga0070712_100090356
946 Ga0070712_100220790
947 Ga0075428_100063600
948 Ga0075428_100176345
949 Ga0075428_100236449
950 Ga0075431_100301701
951 Ga0075433_10036455
952 Ga0075433_10526852
953 Ga0075434_100399955
954 Ga0075429_100113492
955 Ga0075429_101789308
956 Ga0075436_100109147
957 Ga0075436_100206475
958 Ga0075436_101034629
959 Ga0097620_100131032
960 Ga0075435_100064738
961 Ga0075435_100786950
962 Ga0105240_10061052
963 Ga0105240_10099400
964 Ga0105240_10227646
965 Ga0105240_10465146
966 Ga0105240_10793002
967 Ga0105240_12250690
968 Ga0105245_10040524
969 Ga0105245_10051571
970 Ga0105245_10122482
971 Ga0105245_10686217
972 Ga0105245_11002447
973 Ga0114129_10119783
974 Ga0114129_10397853
975 Ga0114129_10461223
976 Ga0114129_11242441
977 Ga0105243_10181986
978 Ga0105243_10310718
979 Ga0105243_11050426
980 Ga0105241_10615659
981 Ga0105242_10133186
982 Ga0105242_10151976
983 Ga0105237_10046647
984 Ga0105238_10347766
985 Ga0105238_11353581
986 Ga0105249_10048178
987 Ga0105249_10146985
988 Ga0105249_10149139
989 Ga0105239_10019915
990 Ga0105239_10155029
991 Ga0105239_10157729
992 Ga0105246_10612037
993 Ga0105246_10957268
994 Ga0157325_1008432
995 Ga0157321_1005684
996 Ga0157373_10102639
997 Ga0157373_10126113
998 Ga0157373_10226484
999 Ga0157371_10143827
1000 Ga0157370_10018694
1001 Ga0157370_10109603
1002 Ga0157370_10356077
1003 Ga0157370_10429379
1004 Ga0157370_10464438
1005 Ga0157370_10953144
1006 Ga0157369_10002303
1007 Ga0157369_10006178
1008 Ga0157369_10012052
1009 Ga0157369_10030501
1010 Ga0157369_10061676
1011 Ga0157369_10348917
1012 Ga0157369_10393767
1013 Ga0157369_11282794
1014 Ga0157378_10172644
1015 Ga0163162_10023066
1016 Ga0163162_10179058
1017 Ga0163162_11210419
1018 Ga0163162_12537523
1019 Ga0157372_10204328
1020 Ga0157372_10329597
1021 Ga0157372_11293649
1022 Ga0157372_11374266
1023 Ga0157372_11379033
1024 Ga0157372_11500325
1025 Ga0157372_13470130
1026 Ga0157375_10119033
1027 Ga0157375_10135997
1028 Ga0157375_10324739
1029 Ga0163163_10013038
1030 Ga0157380_10146969
1031 Ga0182008_10001010
1032 Ga0182008_10085595
1033 Ga0182008_10150851
1034 Ga0182008_10919850
1035 Ga0157377_10086977
1036 Ga0182006_1016684
1037 Ga0182007_10015408
1038 Ga0163161_10016676
1039 Ga0163161_10097993
1040 Ga0163161_10431851
1041 Ga0197907_10725116
1042 Ga0206356_10240272
1043 Ga0206356_10946499
1044 Ga0206356_11704471
1045 Ga0206354_10358543
1046 Ga0206354_10477547
1047 Ga0206354_10637849
1048 Ga0206354_11240988
1049 Ga0206353_10234536
1050 Ga0206353_10804099
1051 Ga0206353_11969477
1052 Ga0213871_10148915
1053 Ga0224712_10077727
1054 Ga0207653_10015924
1055 Ga0207692_10062056
1056 Ga0207642_10030722
1057 Ga0207688_11053151
1058 Ga0207647_10422111
1059 Ga0207699_10075966
1060 Ga0207699_10208037
1061 Ga0207705_10005200
1062 Ga0207705_10209113
1063 Ga0207705_10222330
1064 Ga0207684_10150995
1065 Ga0207684_10242473
1066 Ga0207707_10080669
1067 Ga0207707_10112059
1068 Ga0207707_10224896
1069 Ga0207707_10708860
1070 Ga0207695_10097899
1071 Ga0207695_10120036
1072 Ga0207671_10154157
1073 Ga0207693_10083211
1074 Ga0207693_10298938
1075 Ga0207693_10907481
1076 Ga0207663_10280103
1077 Ga0207663_10894330
1078 Ga0207660_10074951
1079 Ga0207660_10116430
1080 Ga0207660_10254056
1081 Ga0207660_10280935
1082 Ga0207660_10617029
1083 Ga0207660_10640965
1084 Ga0207660_10755609
1085 Ga0207660_10911716
1086 Ga0207662_10029152
1087 Ga0207657_10000388
1088 Ga0207657_10010339
1089 Ga0207657_10041066
1090 Ga0207657_10083380
1091 Ga0207657_10090125
1092 Ga0207657_10102133
1093 Ga0207657_10845407
1094 Ga0207657_10889562
1095 Ga0207657_11206898
1096 Ga0207649_11569643
1097 Ga0207652_10007590
1098 Ga0207652_10061251
1099 Ga0207652_10083152
1100 Ga0207652_10091565
1101 Ga0207652_10097733
1102 Ga0207652_10307250
1103 Ga0207652_10461065
1104 Ga0207646_10660505
1105 Ga0207646_11452729
1106 Ga0207694_10207330
1107 Ga0207694_10450495
1108 Ga0207687_10168528
1109 Ga0207687_10589877
1110 Ga0207687_11256370
1111 Ga0207700_10200310
1112 Ga0207700_10571886
1113 Ga0207664_10007814
1114 Ga0207664_10022812
1115 Ga0207664_10025226
1116 Ga0207664_10058978
1117 Ga0207664_10099886
1118 Ga0207664_10169968
1119 Ga0207664_10287848
1120 Ga0207664_10338397
1121 Ga0207644_10061440
1122 Ga0207644_10343614
1123 Ga0207690_10303491
1124 Ga0207706_10009052
1125 Ga0207706_10023685
1126 Ga0207706_10088959
1127 Ga0207686_10150293
1128 Ga0207686_10174929
1129 Ga0207709_10360677
1130 Ga0207709_10531873
1131 Ga0207669_11467807
1132 Ga0207704_10119235
1133 Ga0207704_10332509
1134 Ga0207665_10478272
1135 Ga0207689_10224937
1136 Ga0207661_10030134
1137 Ga0207661_10076157
1138 Ga0207661_10121846
1139 Ga0207661_10390781
1140 Ga0207679_10738909
1141 Ga0207679_11121957
1142 Ga0207667_10014195
1143 Ga0207667_10535524
1144 Ga0207667_10700774
1145 Ga0207651_10346454
1146 Ga0207712_10309335
1147 Ga0207668_10080642
1148 Ga0207668_11171775
1149 Ga0207640_10055421
1150 Ga0207640_10086107
1151 Ga0207640_10200078
1152 Ga0207640_11426837
1153 Ga0207658_10759062
1154 Ga0207677_10054541
1155 Ga0207677_10405126
1156 Ga0207677_10726536
1157 Ga0207677_11905665
1158 Ga0207703_10496262
1159 Ga0207639_10063676
1160 Ga0207708_10037668
1161 Ga0207702_10112952
1162 Ga0207702_10193378
1163 Ga0207702_10386042
1164 Ga0207702_10451429
1165 Ga0207702_10779296
1166 Ga0207702_11203114
1167 Ga0207702_11944980
1168 Ga0207648_10002280
1169 Ga0207648_10146569
1170 Ga0207676_10665805
1171 Ga0207674_10402805
1172 Ga0207675_100000962
1173 Ga0207675_100016465
1174 Ga0207675_100472986
1175 Ga0207683_10120432
1176 Ga0207683_10134164
1177 Ga0207698_10390674
1178 Ga0207428_10009640
1179 Ga0268265_10760841
1180 Ga0268264_10221343
1181 Ga0268264_10546650
1182 Ga0265319_1137482
1183 Ga0265334_10023620
1184 Ga0265318_10002578
1185 Ga0265318_10171486
1186 Ga0265318_10330900
1187 Ga0265318_10398728
1188 Ga0265322_10032908
1189 Ga0265336_10023824
1190 Ga0265338_10007351
1191 Ga0265338_10011362
1192 Ga0265338_10223104
1193 Ga0265338_10258498
1194 Ga0265330_10122547
1195 Ga0265320_10022368
1196 Ga0265320_10189525
1197 Ga0265320_10226301
1198 Ga0265325_10057518
1199 Ga0265340_10044224
1200 Ga0265340_10114392
1201 Ga0265339_10010628
1202 Ga0265339_10098825
1203 Ga0265339_10105639
1204 Ga0265339_10164204
1205 Ga0265327_10040184
1206 Ga0265316_10005504
1207 Ga0265316_10124633
1208 Ga0265316_10264469
1209 Ga0307408_100125368
1210 Ga0307408_101425677
1211 Ga0265313_10039611
1212 Ga0265314_10013969
1213 Ga0265314_10072160
1214 Ga0265314_10466568
1215 Ga0265342_10032409
1216 Ga0265342_10066700
1217 Ga0265342_10282914
1218 Ga0307405_11315318
1219 Ga0307406_10598243
1220 Ga0307407_10503554
1221 Ga0307412_10535733
1222 Ga0307415_100196978
1223 Ga0307415_100989864
1224 Ga0373938_0148281
1225 Ga0373944_0087505
1226 Ga0373941_0044140
1227 Ga0373946_0194208
1228 Ga0373962_0019317
1229 Ga0373962_0038575
1230 Ga0373931_0304975
1231 Ga0373931_0763117
1232 Ga0373947_0000918
1233 Ga0373947_0029763
1234 Ga0373925_0169027
1235 Ga0395899_0004887
1236 Ga0395899_0009076
1237 Ga0395899_0034242
1238 Ga0395899_0104355
1239 Ga0395900_0053378
1240 Ga0395900_0087713
1241 Ga0395900_0197714
1242 Ga0395900_0239362
1243 Ga0395900_0254506
1244 Ga0395900_0397638
1245 Ga0395900_0400346
1246 Ga0395900_0438157
1247 Ga0395900_0705694
1248 Ga0395900_1460892
1249 Ga0395898_0003001
1250 Ga0395898_0037254
1251 Ga0395898_0044034
1252 Ga0395898_0143640
1253 Ga0395898_0159219
1254 Ga0395898_0180977
1255 Ga0395898_0198660
1256 Ga0395898_0524571
1257 Ga0395898_0680017
1258 Ga0395898_1132144
1259 Ga0395898_1707056
1260 Ga0395898_1865803
1261 Ga0395905_0006030
1262 Ga0395905_0046287
1263 Ga0395905_0091348
1264 Ga0395905_0169880
1265 Ga0395905_0192572
1266 Ga0395901_0033143
1267 Ga0395901_0047926
1268 Ga0395901_0080202
1269 Ga0395901_0154805
1270 Ga0395901_0161734
1271 Ga0395901_0328377
1272 Ga0395901_0351305
1273 Ga0395901_0481439
1274 Ga0395901_0550864
1275 Ga0395901_0637691
1276 Ga0395901_0850625
1277 Ga0395901_1012343
1278 Ga0395901_1280393
1279 Ga0395901_1997657
1280 Ga0242420_129380
1281 Ga0436360_0975496
1282 Ga0451853_0158545
1283 Ga0466972_0213033
1284 Ga0466972_0328302
1285 Ga0466965_0145522
1286 Ga0466966_0028061
1287 Ga0466966_0180906
1288 Ga0466966_0680627
1289 Ga0466961_0003168
1290 Ga0466961_0145035
1291 Ga0466961_0621643
1292 Ga0466963_0003845
1293 Ga0466963_0005592
1294 Ga0466963_0025377
1295 Ga0466963_0046731
1296 Ga0466963_0071351
1297 Ga0466963_0071480
1298 Ga0466963_0102783
1299 Ga0466963_0160614
1300 Ga0466963_0285925
1301 Ga0466963_0432060
1302 Ga0466963_0498225
1303 Ga0466964_0056279
1304 Ga0466964_0115300
1305 Ga0466964_0141190
1306 Ga0466964_0394775
1307 Ga0466964_0484686
1308 Ga0466964_0694294
1309 Ga0466971_0018695
1310 Ga0466971_0022425
1311 Ga0466971_0024818
1312 Ga0466971_0045941
1313 Ga0466971_0185127
1314 Ga0466971_0271397
1315 Ga0466971_0497933
1316 Ga0466968_0045555
1317 Ga0466968_0214899
1318 Ga0466970_0021149
1319 Ga0466970_0157873
1320 Ga0466957_0004517
1321 Ga0466957_0036211
1322 Ga0466957_0037927
1323 Ga0466957_0060644
1324 Ga0466957_0063369
1325 Ga0466957_0255344
1326 Ga0466957_0295586
1327 Ga0466957_0645255
1328 Ga0466957_0743127
1329 Ga0466957_0859189
1330 Ga0466960_0834068
1331 Ga0466959_0341577
1332 Ga0466959_1190682
1333 Ga0451576_0171276
1334 Ga0451576_0755929
1335 Ga0451576_1869539
1336 Ga0466958_0010746
1337 Ga0466958_0011649
1338 Ga0466958_0034402
1339 Ga0466958_0041096
1340 Ga0466958_0116942
1341 Ga0466958_0253141
1342 Ga0466958_0344353
1343 Ga0466958_0346291
1344 Ga0466958_0468958
1345 Ga0466967_0005509
1346 Ga0466967_0025009
1347 Ga0466967_0031365
1348 Ga0466967_0041018
1349 Ga0466967_0046656
1350 Ga0466967_0090183
1351 Ga0466967_0100797
1352 Ga0466967_0124924
1353 Ga0466967_0168812
1354 Ga0466967_0286870
1355 Ga0466967_0485236
1356 Ga0466967_0563109
1357 Ga0466967_0653199
1358 Ga0466967_0788411
1359 Ga0495592_0330803
1360 Ga0495603_0000315
1361 Ga0495629_0075516
1362 Ga0495629_0076374
1363 Ga0495641_0002640
1364 Ga0495641_0022803
1365 Ga0495641_0297432
1366 Ga0495653_0031425
1367 Ga0495580_0279778
1368 Ga0495582_0010033
1369 Ga0495605_0416647
1370 Ga0495639_0249185
1371 Ga0495639_0652745
1372 Ga0495584_0057441
1373 Ga0495584_0097952
1374 Ga0495584_0161974
1375 Ga0495594_0001557
1376 Ga0495594_0019914
1377 Ga0495628_0269162
1378 Ga0495630_0365748
1379 Ga0495631_0358847
1380 Ga0495663_0231165
1381 Ga0495666_0029399
1382 Ga0495652_0126969
1383 Ga0495665_0107891
1384 Ga0495586_0029827
1385 Ga0495609_0108835
1386 Ga0495621_0262656
1387 Ga0495645_0520457
1388 Ga0495622_0044021
1389 Ga0495667_0104095
1390 Ga0495656_0334170
1391 Ga0495668_0202507
1392 Ga0495668_0709142
1393 Ga0495634_0123904
1394 Ga0495634_0178818
1395 Ga0495635_0339624
1396 Ga0495659_0077440
1397 Ga0495588_0001006
1398 Ga0495657_0456238
1399 Ga0495647_0001825
1400 Ga0495647_0084839
1401 Ga0495658_0046804
1402 Ga0495613_0078401
1403 Ga0495613_0168991
1404 Ga0495600_0120450
1405 Ga0495581_0168860
1406 Ga0495581_0332045
1407 Ga0495604_0133708
1408 Ga0495674_0146217
1409 Ga0495676_0056087
1410 Ga0495676_0080563
1411 Ga0495680_0397953
1412 Ga0495684_0389441
1413 Ga0495593_0082362
1414 Ga0495602_0706429
1415 Ga0496100_0128246
1416 Ga0496100_0266342
1417 Ga0496101_0017380
1418 Ga0496101_0178131
1419 Ga0496101_0343955
1420 Ga0496102_0122377
1421 Ga0496102_0201641
1422 Ga0496102_0307827
1423 Ga0496103_0114775
1424 Ga0496103_0258570
1425 Ga0496103_0306261
1426 Ga0496104_0005360
1427 Ga0496104_0039743
1428 Ga0496104_0313705
1429 Ga0496104_0661872
1430 Ga0496104_1072165
1431 Ga0496105_0003157
1432 Ga0496105_0147064
1433 Ga0496105_0483997
1434 Ga0496105_0744832
1435 Ga0496106_0001856
1436 Ga0496106_0267337
1437 Ga0496106_0336544
1438 Ga0496106_1498883
1439 Ga0496107_0029123
1440 Ga0496107_0173205
1441 Ga0496108_0015483
1442 Ga0496108_0054439
1443 Ga0496108_0165659
1444 Ga0496108_0457624
1445 Ga0496108_0458672
1446 Ga0496108_0860132
1447 Ga0496109_0016861
1448 Ga0496109_0061176
1449 Ga0496109_0086040
1450 Ga0496109_0100769
1451 Ga0496109_0128873
1452 Ga0496109_0130074
1453 Ga0496109_0546121
1454 Ga0496110_0003586
1455 Ga0496110_0009997
1456 Ga0496110_0014829
1457 Ga0496110_0181900
1458 Ga0496110_0241981
1459 Ga0496111_0004255
1460 Ga0496111_0010141
1461 Ga0496111_0323827
1462 Ga0496112_0000307
1463 Ga0496112_0022546
1464 Ga0496112_0028506
1465 Ga0496112_0047386
1466 Ga0496112_0107315
1467 Ga0496112_0208500
1468 Ga0496112_0309667
1469 Ga0496112_0442967
1470 Ga0496112_0475203
1471 Ga0496112_0969410
1472 Ga0496112_1005770
1473 Ga0496112_1920347
1474 Ga0496113_0000192
1475 Ga0496113_0021667
1476 Ga0496113_0187245
1477 Ga0496113_0187751
1478 Ga0496113_0214715
1479 Ga0496114_0068553
1480 Ga0496114_0116450
1481 Ga0496114_0732730
1482 Ga0496115_0042155
1483 Ga0496115_0194156
1484 Ga0501034_0051076
1485 Ga0501041_0109290
1486 Ga0501043_0727036
1487 Ga0501046_0972302
1488 Ga0501048_0384956
1489 Ga0501067_0086812
1490 Ga0501067_0177230
1491 Ga0501067_0569895
1492 Ga0501068_0738751
1493 Ga0501068_0915609
1494 Ga0501068_1113612
1495 Ga0501069_0123102
1496 Ga0501070_0002719
1497 Ga0501070_0007864
1498 Ga0501072_0095044
1499 Ga0501072_0467823
1500 Ga0501073_0025021
1501 Ga0501073_0710240
1502 Ga0501074_0000736
1503 Ga0501074_0056120
1504 Ga0501074_0134059
1505 Ga0501075_0180259
1506 Ga0501079_0090973
1507 Ga0501079_0151104
1508 Ga0501080_0000499
1509 Ga0501080_0008878
1510 Ga0501083_0000893
1511 Ga0501035_1296154
1512 nmdc:mga05p37_349744_c1
1513 nmdc:mga05p37_4070_c1
1514 nmdc:mga05p37_51178_c1
1515 nmdc:mga09592_159327_c1
1516 nmdc:mga06r32_499587_c1
1517 nmdc:mga06r32_88253_c1
1518 nmdc:mga08y16_1645879_c1
1519 nmdc:mga0n895_38057_c1
1520 nmdc:mga0rr50_1387720_c1
1521 nmdc:mga0rr50_29022_c1
1522 nmdc:mga08x19_212835_c1
1523 nmdc:mga08x19_454491_c1
1524 nmdc:mga08x19_972390_c1
1525 nmdc:mga0a205_1404869_c1
1526 nmdc:mga0a205_34720_c1
1527 Ga0495601_0833559
1528 Ga0495655_0027026
1529 Ga0495595_0182394
1530 Ga0495595_0507152
1531 Ga0495619_0011494
1532 Ga0500566_0262559
1533 Ga0501084_0998500
1534 Ga0501082_0309379
1535 Ga0501082_0345127
1536 Ga0466962_0020288
1537 Ga0466962_0039457
1538 Ga0466962_0109376
1539 Ga0466962_0336536
1540 Ga0530510_0349355

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

9

125

0.95

Map