F480048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 770 | 308 | 1540 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0173177|Ga0466967_0173177_1115_1492 |
| Length | 125 |
| Sequence | VSVAHIVAAIGLGVVAGILAGMFGVGGGILFVPTLTWLGLTQLHAEATSLLAIIPTVLVGVWRHNQQGNVRFRSAIVIGLASVGAAVGGAQVAESLPESTLRRLFAVLLLFTAAQIAWRARGPQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 88 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.44 |
| Metatranscriptomes | 1.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 8.96 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0173177 | 3300045976 | Bacteria | 2032 |
| 2 | Ga0070658_10003218 | 3300005327 | Bacteria | 13483 |
| 3 | Ga0070658_10094616 | 3300005327 | Bacteria | 2465 |
| 4 | Ga0070658_10305778 | 3300005327 | Archaea | 1356 |
| 5 | Ga0070658_10568368 | 3300005327 | Bacteria | 982 |
| 6 | Ga0070658_10767255 | 3300005327 | Bacteria | 837 |
| 7 | Ga0070683_100045570 | 3300005329 | Bacteria | 4048 |
| 8 | Ga0070683_100293169 | 3300005329 | Bacteria | 1547 |
| 9 | Ga0070683_100399211 | 3300005329 | Bacteria | 1311 |
| 10 | Ga0070690_101295781 | 3300005330 | Bacteria | 584 |
| 11 | Ga0070677_10657400 | 3300005333 | Bacteria | 586 |
| 12 | Ga0068869_100906230 | 3300005334 | Bacteria | 763 |
| 13 | Ga0070680_100013061 | 3300005336 | Bacteria | 6465 |
| 14 | Ga0070680_100143926 | 3300005336 | Bacteria | 2000 |
| 15 | Ga0070680_100173766 | 3300005336 | Bacteria | 1814 |
| 16 | Ga0070680_100314209 | 3300005336 | Bacteria | 1330 |
| 17 | Ga0070680_101081576 | 3300005336 | Bacteria | 693 |
| 18 | Ga0070680_101263963 | 3300005336 | Bacteria | 639 |
| 19 | Ga0070680_101521460 | 3300005336 | Unclassified | 580 |
| 20 | Ga0070682_100137372 | 3300005337 | Bacteria | 1662 |
| 21 | Ga0068868_100144853 | 3300005338 | Bacteria | 1953 |
| 22 | Ga0068868_100313169 | 3300005338 | Bacteria | 1336 |
| 23 | Ga0068868_100772891 | 3300005338 | Bacteria | 865 |
| 24 | Ga0068868_101309897 | 3300005338 | Bacteria | 673 |
| 25 | Ga0068868_101326481 | 3300005338 | Unclassified | 669 |
| 26 | Ga0070660_100003398 | 3300005339 | Bacteria | 10953 |
| 27 | Ga0070660_100008279 | 3300005339 | Bacteria | 7266 |
| 28 | Ga0070660_100014577 | 3300005339 | Bacteria | 5669 |
| 29 | Ga0070660_100093203 | 3300005339 | Bacteria | 2378 |
| 30 | Ga0070660_100381206 | 3300005339 | Bacteria | 1164 |
| 31 | Ga0070660_100425802 | 3300005339 | Bacteria | 1099 |
| 32 | Ga0070660_101156429 | 3300005339 | Bacteria | 656 |
| 33 | Ga0070689_100069489 | 3300005340 | Bacteria | 2748 |
| 34 | Ga0070691_10059987 | 3300005341 | Bacteria | 1828 |
| 35 | Ga0070691_10073533 | 3300005341 | Unclassified | 1662 |
| 36 | Ga0070691_10268612 | 3300005341 | Unclassified | 921 |
| 37 | Ga0070691_10416975 | 3300005341 | Bacteria | 760 |
| 38 | Ga0070687_101302564 | 3300005343 | Bacteria | 540 |
| 39 | Ga0070661_100080732 | 3300005344 | Bacteria | 2400 |
| 40 | Ga0070661_100601541 | 3300005344 | Bacteria | 889 |
| 41 | Ga0070692_10039401 | 3300005345 | Bacteria | 2412 |
| 42 | Ga0070668_100019875 | 3300005347 | Bacteria | 5060 |
| 43 | Ga0070668_100858671 | 3300005347 | Bacteria | 809 |
| 44 | Ga0070669_100123725 | 3300005353 | Bacteria | 1977 |
| 45 | Ga0070671_100060932 | 3300005355 | Bacteria | 3142 |
| 46 | Ga0070671_100289163 | 3300005355 | Unclassified | 1395 |
| 47 | Ga0070674_100484900 | 3300005356 | Bacteria | 1027 |
| 48 | Ga0070673_101883879 | 3300005364 | Bacteria | 567 |
| 49 | Ga0070659_100057173 | 3300005366 | Bacteria | 3075 |
| 50 | Ga0070709_10040745 | 3300005434 | Bacteria | 2857 |
| 51 | Ga0070709_10077780 | 3300005434 | Bacteria | 2157 |
| 52 | Ga0070709_10198908 | 3300005434 | Unclassified | 1418 |
| 53 | Ga0070714_100018069 | 3300005435 | Bacteria | 5720 |
| 54 | Ga0070714_100024674 | 3300005435 | Bacteria | 4955 |
| 55 | Ga0070714_100030318 | 3300005435 | Bacteria | 4501 |
| 56 | Ga0070714_100035545 | 3300005435 | Bacteria | 4177 |
| 57 | Ga0070714_100119582 | 3300005435 | Bacteria | 2342 |
| 58 | Ga0070714_100256614 | 3300005435 | Bacteria | 1618 |
| 59 | Ga0070714_101220652 | 3300005435 | Bacteria | 734 |
| 60 | Ga0070714_101578220 | 3300005435 | Unclassified | 641 |
| 61 | Ga0070713_100296490 | 3300005436 | Bacteria | 1487 |
| 62 | Ga0070713_100342805 | 3300005436 | Bacteria | 1385 |
| 63 | Ga0070710_10045750 | 3300005437 | Bacteria | 2434 |
| 64 | Ga0070710_10513919 | 3300005437 | Bacteria | 822 |
| 65 | Ga0070711_100078760 | 3300005439 | Bacteria | 2342 |
| 66 | Ga0070711_100360379 | 3300005439 | Bacteria | 1171 |
| 67 | Ga0070711_100612138 | 3300005439 | Bacteria | 910 |
| 68 | Ga0070705_100258474 | 3300005440 | Bacteria | 1227 |
| 69 | Ga0070705_100402868 | 3300005440 | Bacteria | 1014 |
| 70 | Ga0070700_100428213 | 3300005441 | Bacteria | 1001 |
| 71 | Ga0070708_100306729 | 3300005445 | Bacteria | 1495 |
| 72 | Ga0070708_100731123 | 3300005445 | Bacteria | 931 |
| 73 | Ga0070708_100822560 | 3300005445 | Bacteria | 873 |
| 74 | Ga0070708_101491997 | 3300005445 | Bacteria | 630 |
| 75 | Ga0070663_101374832 | 3300005455 | Bacteria | 625 |
| 76 | Ga0070678_100200701 | 3300005456 | Bacteria | 1646 |
| 77 | Ga0070678_100618380 | 3300005456 | Bacteria | 969 |
| 78 | Ga0070662_100046652 | 3300005457 | Bacteria | 3114 |
| 79 | Ga0070662_100074932 | 3300005457 | Unclassified | 2505 |
| 80 | Ga0070662_100152082 | 3300005457 | Unclassified | 1803 |
| 81 | Ga0070681_10035668 | 3300005458 | Bacteria | 4995 |
| 82 | Ga0070681_10057340 | 3300005458 | Bacteria | 3875 |
| 83 | Ga0070681_10062107 | 3300005458 | Bacteria | 3710 |
| 84 | Ga0070681_10187155 | 3300005458 | Bacteria | 1990 |
| 85 | Ga0070681_10676536 | 3300005458 | Unclassified | 947 |
| 86 | Ga0070681_11444649 | 3300005458 | Bacteria | 612 |
| 87 | Ga0070681_11512988 | 3300005458 | Bacteria | 596 |
| 88 | Ga0070681_11991516 | 3300005458 | Bacteria | 509 |
| 89 | Ga0068867_100091334 | 3300005459 | Unclassified | 2311 |
| 90 | Ga0068867_100115010 | 3300005459 | Bacteria | 2071 |
| 91 | Ga0070685_10065218 | 3300005466 | Bacteria | 2143 |
| 92 | Ga0070706_100157724 | 3300005467 | Bacteria | 2118 |
| 93 | Ga0070707_100711845 | 3300005468 | Bacteria | 967 |
| 94 | Ga0070707_101173846 | 3300005468 | Bacteria | 734 |
| 95 | Ga0070698_100026743 | 3300005471 | Bacteria | 6002 |
| 96 | Ga0070698_100037141 | 3300005471 | Bacteria | 5024 |
| 97 | Ga0070698_100185544 | 3300005471 | Bacteria | 2018 |
| 98 | Ga0070698_100318600 | 3300005471 | Bacteria | 1485 |
| 99 | Ga0070698_100341617 | 3300005471 | Bacteria | 1428 |
| 100 | Ga0070698_100435026 | 3300005471 | Bacteria | 1247 |
| 101 | Ga0070699_100103626 | 3300005518 | Bacteria | 2495 |
| 102 | Ga0070679_100075139 | 3300005530 | Bacteria | 3369 |
| 103 | Ga0070679_100081103 | 3300005530 | Bacteria | 3233 |
| 104 | Ga0070679_100096451 | 3300005530 | Bacteria | 2945 |
| 105 | Ga0070679_100250426 | 3300005530 | Bacteria | 1728 |
| 106 | Ga0070679_100305134 | 3300005530 | Bacteria | 1542 |
| 107 | Ga0070679_100393177 | 3300005530 | Bacteria | 1333 |
| 108 | Ga0070679_100434760 | 3300005530 | Bacteria | 1257 |
| 109 | Ga0070679_100434811 | 3300005530 | Unclassified | 1257 |
| 110 | Ga0070679_100783726 | 3300005530 | Unclassified | 896 |
| 111 | Ga0070679_101331789 | 3300005530 | Bacteria | 664 |
| 112 | Ga0070684_100073429 | 3300005535 | Bacteria | 3014 |
| 113 | Ga0070684_100137723 | 3300005535 | Bacteria | 2206 |
| 114 | Ga0070684_100358654 | 3300005535 | Bacteria | 1342 |
| 115 | Ga0070684_100375971 | 3300005535 | Bacteria | 1308 |
| 116 | Ga0070697_100366520 | 3300005536 | Unclassified | 1246 |
| 117 | Ga0068853_100381824 | 3300005539 | Bacteria | 1316 |
| 118 | Ga0068853_101088034 | 3300005539 | Unclassified | 771 |
| 119 | Ga0068853_101103958 | 3300005539 | Bacteria | 765 |
| 120 | Ga0068853_102248181 | 3300005539 | Bacteria | 529 |
| 121 | Ga0070695_100017880 | 3300005545 | Bacteria | 4301 |
| 122 | Ga0070695_101122636 | 3300005545 | Bacteria | 644 |
| 123 | Ga0070696_100038290 | 3300005546 | Bacteria | 3309 |
| 124 | Ga0070696_100100208 | 3300005546 | Bacteria | 2074 |
| 125 | Ga0070693_100019865 | 3300005547 | Bacteria | 3532 |
| 126 | Ga0070693_100051739 | 3300005547 | Bacteria | 2353 |
| 127 | Ga0070665_101217316 | 3300005548 | Bacteria | 764 |
| 128 | Ga0070665_101964303 | 3300005548 | Bacteria | 590 |
| 129 | Ga0070704_100078786 | 3300005549 | Bacteria | 2418 |
| 130 | Ga0070704_100181183 | 3300005549 | Bacteria | 1685 |
| 131 | Ga0070704_100602545 | 3300005549 | Bacteria | 966 |
| 132 | Ga0070704_100783335 | 3300005549 | Unclassified | 851 |
| 133 | Ga0068855_100041774 | 3300005563 | Bacteria | 5433 |
| 134 | Ga0068855_100144185 | 3300005563 | Bacteria | 2713 |
| 135 | Ga0068855_100158466 | 3300005563 | Bacteria | 2571 |
| 136 | Ga0068855_100395390 | 3300005563 | Unclassified | 1516 |
| 137 | Ga0068855_101076583 | 3300005563 | Bacteria | 841 |
| 138 | Ga0068855_101911481 | 3300005563 | Bacteria | 601 |
| 139 | Ga0070664_100758281 | 3300005564 | Bacteria | 906 |
| 140 | Ga0070664_100783414 | 3300005564 | Bacteria | 891 |
| 141 | Ga0068857_100707450 | 3300005577 | Bacteria | 957 |
| 142 | Ga0068854_100302177 | 3300005578 | Bacteria | 1295 |
| 143 | Ga0068854_101464569 | 3300005578 | Bacteria | 619 |
| 144 | Ga0068856_100301589 | 3300005614 | Bacteria | 1620 |
| 145 | Ga0068856_100457030 | 3300005614 | Bacteria | 1298 |
| 146 | Ga0068856_100496879 | 3300005614 | Unclassified | 1241 |
| 147 | Ga0068856_100551253 | 3300005614 | Bacteria | 1174 |
| 148 | Ga0068856_100818730 | 3300005614 | Unclassified | 951 |
| 149 | Ga0068856_101129360 | 3300005614 | Unclassified | 801 |
| 150 | Ga0068856_101539571 | 3300005614 | Bacteria | 678 |
| 151 | Ga0070702_100111354 | 3300005615 | Bacteria | 1697 |
| 152 | Ga0070702_100243114 | 3300005615 | Bacteria | 1216 |
| 153 | Ga0070702_100672278 | 3300005615 | Bacteria | 786 |
| 154 | Ga0068852_100090411 | 3300005616 | Bacteria | 2738 |
| 155 | Ga0068852_100336607 | 3300005616 | Bacteria | 1470 |
| 156 | Ga0068859_100131031 | 3300005617 | Bacteria | 2579 |
| 157 | Ga0068864_100383087 | 3300005618 | Bacteria | 1333 |
| 158 | Ga0068866_10677763 | 3300005718 | Bacteria | 705 |
| 159 | Ga0068861_100006190 | 3300005719 | Bacteria | 8144 |
| 160 | Ga0068861_100032457 | 3300005719 | Bacteria | 3844 |
| 161 | Ga0068863_100190836 | 3300005841 | Bacteria | 1969 |
| 162 | Ga0068860_100446185 | 3300005843 | Bacteria | 1286 |
| 163 | Ga0068862_100813902 | 3300005844 | Bacteria | 913 |
| 164 | Ga0081455_10021136 | 3300005937 | Bacteria | 6112 |
| 165 | Ga0081455_10043634 | 3300005937 | Bacteria | 3920 |
| 166 | Ga0081540_1011397 | 3300005983 | Bacteria | 5944 |
| 167 | Ga0081540_1027675 | 3300005983 | Bacteria | 3205 |
| 168 | Ga0070717_10045439 | 3300006028 | Bacteria | 3591 |
| 169 | Ga0070717_10094164 | 3300006028 | Bacteria | 2533 |
| 170 | Ga0070717_10155388 | 3300006028 | Bacteria | 1981 |
| 171 | Ga0070717_10952153 | 3300006028 | Bacteria | 782 |
| 172 | Ga0070717_11027783 | 3300006028 | Bacteria | 751 |
| 173 | Ga0075432_10004713 | 3300006058 | Bacteria | 4642 |
| 174 | Ga0070712_100035356 | 3300006175 | Bacteria | 3391 |
| 175 | Ga0070712_100090356 | 3300006175 | Bacteria | 2242 |
| 176 | Ga0070712_100220790 | 3300006175 | Bacteria | 1500 |
| 177 | Ga0075428_100063600 | 3300006844 | Bacteria | 4040 |
| 178 | Ga0075428_100176345 | 3300006844 | Bacteria | 2315 |
| 179 | Ga0075428_100236449 | 3300006844 | Bacteria | 1971 |
| 180 | Ga0075431_100301701 | 3300006847 | Unclassified | 1618 |
| 181 | Ga0075433_10036455 | 3300006852 | Bacteria | 4237 |
| 182 | Ga0075433_10526852 | 3300006852 | Bacteria | 1039 |
| 183 | Ga0075434_100399955 | 3300006871 | Bacteria | 1394 |
| 184 | Ga0075429_100113492 | 3300006880 | Bacteria | 2368 |
| 185 | Ga0075429_101789308 | 3300006880 | Unclassified | 533 |
| 186 | Ga0075436_100109147 | 3300006914 | Bacteria | 1930 |
| 187 | Ga0075436_100206475 | 3300006914 | Bacteria | 1392 |
| 188 | Ga0075436_101034629 | 3300006914 | Bacteria | 617 |
| 189 | Ga0097620_100131032 | 3300006931 | Bacteria | 2579 |
| 190 | Ga0075435_100064738 | 3300007076 | Bacteria | 2971 |
| 191 | Ga0075435_100786950 | 3300007076 | Bacteria | 828 |
| 192 | Ga0105240_10061052 | 3300009093 | Bacteria | 4698 |
| 193 | Ga0105240_10099400 | 3300009093 | Unclassified | 3541 |
| 194 | Ga0105240_10227646 | 3300009093 | Bacteria | 2168 |
| 195 | Ga0105240_10465146 | 3300009093 | Bacteria | 1412 |
| 196 | Ga0105240_10793002 | 3300009093 | Unclassified | 1027 |
| 197 | Ga0105240_12250690 | 3300009093 | Bacteria | 565 |
| 198 | Ga0105245_10040524 | 3300009098 | Bacteria | 4150 |
| 199 | Ga0105245_10051571 | 3300009098 | Bacteria | 3688 |
| 200 | Ga0105245_10122482 | 3300009098 | Bacteria | 2431 |
| 201 | Ga0105245_10686217 | 3300009098 | Unclassified | 1056 |
| 202 | Ga0105245_11002447 | 3300009098 | Unclassified | 880 |
| 203 | Ga0114129_10119783 | 3300009147 | Bacteria | 3625 |
| 204 | Ga0114129_10397853 | 3300009147 | Bacteria | 1816 |
| 205 | Ga0114129_10461223 | 3300009147 | Bacteria | 1665 |
| 206 | Ga0114129_11242441 | 3300009147 | Unclassified | 926 |
| 207 | Ga0105243_10181986 | 3300009148 | Bacteria | 1828 |
| 208 | Ga0105243_10310718 | 3300009148 | Bacteria | 1432 |
| 209 | Ga0105243_11050426 | 3300009148 | Bacteria | 820 |
| 210 | Ga0105241_10615659 | 3300009174 | Bacteria | 982 |
| 211 | Ga0105242_10133186 | 3300009176 | Bacteria | 2148 |
| 212 | Ga0105242_10151976 | 3300009176 | Bacteria | 2019 |
| 213 | Ga0105237_10046647 | 3300009545 | Bacteria | 4358 |
| 214 | Ga0105238_10347766 | 3300009551 | Unclassified | 1471 |
| 215 | Ga0105238_11353581 | 3300009551 | Bacteria | 738 |
| 216 | Ga0105249_10048178 | 3300009553 | Bacteria | 3885 |
| 217 | Ga0105249_10146985 | 3300009553 | Bacteria | 2265 |
| 218 | Ga0105249_10149139 | 3300009553 | Bacteria | 2250 |
| 219 | Ga0105239_10019915 | 3300010375 | Bacteria | 7405 |
| 220 | Ga0105239_10155029 | 3300010375 | Unclassified | 2558 |
| 221 | Ga0105239_10157729 | 3300010375 | Bacteria | 2535 |
| 222 | Ga0105246_10612037 | 3300011119 | Bacteria | 943 |
| 223 | Ga0105246_10957268 | 3300011119 | Unclassified | 772 |
| 224 | Ga0157325_1008432 | 3300012485 | Bacteria | 715 |
| 225 | Ga0157321_1005684 | 3300012487 | Bacteria | 826 |
| 226 | Ga0157373_10102639 | 3300013100 | Bacteria | 2012 |
| 227 | Ga0157373_10126113 | 3300013100 | Bacteria | 1800 |
| 228 | Ga0157373_10226484 | 3300013100 | Bacteria | 1320 |
| 229 | Ga0157371_10143827 | 3300013102 | Bacteria | 1699 |
| 230 | Ga0157370_10018694 | 3300013104 | Bacteria | 6968 |
| 231 | Ga0157370_10109603 | 3300013104 | Bacteria | 2581 |
| 232 | Ga0157370_10356077 | 3300013104 | Bacteria | 1349 |
| 233 | Ga0157370_10429379 | 3300013104 | Bacteria | 1215 |
| 234 | Ga0157370_10464438 | 3300013104 | Bacteria | 1163 |
| 235 | Ga0157370_10953144 | 3300013104 | Bacteria | 778 |
| 236 | Ga0157369_10002303 | 3300013105 | Bacteria | 22963 |
| 237 | Ga0157369_10006178 | 3300013105 | Bacteria | 13900 |
| 238 | Ga0157369_10012052 | 3300013105 | Bacteria | 9817 |
| 239 | Ga0157369_10030501 | 3300013105 | Bacteria | 5946 |
| 240 | Ga0157369_10061676 | 3300013105 | Bacteria | 4041 |
| 241 | Ga0157369_10348917 | 3300013105 | Bacteria | 1537 |
| 242 | Ga0157369_10393767 | 3300013105 | Bacteria | 1437 |
| 243 | Ga0157369_11282794 | 3300013105 | Bacteria | 747 |
| 244 | Ga0157378_10172644 | 3300013297 | Bacteria | 2028 |
| 245 | Ga0163162_10023066 | 3300013306 | Bacteria | 6139 |
| 246 | Ga0163162_10179058 | 3300013306 | Bacteria | 2246 |
| 247 | Ga0163162_11210419 | 3300013306 | Bacteria | 857 |
| 248 | Ga0163162_12537523 | 3300013306 | Unclassified | 589 |
| 249 | Ga0157372_10204328 | 3300013307 | Bacteria | 2289 |
| 250 | Ga0157372_10329597 | 3300013307 | Bacteria | 1778 |
| 251 | Ga0157372_11293649 | 3300013307 | Unclassified | 841 |
| 252 | Ga0157372_11374266 | 3300013307 | Unclassified | 814 |
| 253 | Ga0157372_11379033 | 3300013307 | Bacteria | 813 |
| 254 | Ga0157372_11500325 | 3300013307 | Unclassified | 777 |
| 255 | Ga0157372_13470130 | 3300013307 | Unclassified | 501 |
| 256 | Ga0157375_10119033 | 3300013308 | Bacteria | 2748 |
| 257 | Ga0157375_10135997 | 3300013308 | Bacteria | 2581 |
| 258 | Ga0157375_10324739 | 3300013308 | Bacteria | 1704 |
| 259 | Ga0163163_10013038 | 3300014325 | Bacteria | 7589 |
| 260 | Ga0157380_10146969 | 3300014326 | Bacteria | 2032 |
| 261 | Ga0182008_10001010 | 3300014497 | Bacteria | 19546 |
| 262 | Ga0182008_10085595 | 3300014497 | Bacteria | 1553 |
| 263 | Ga0182008_10150851 | 3300014497 | Bacteria | 1166 |
| 264 | Ga0182008_10919850 | 3300014497 | Bacteria | 516 |
| 265 | Ga0157377_10086977 | 3300014745 | Unclassified | 1838 |
| 266 | Ga0182006_1016684 | 3300015261 | Bacteria | 3130 |
| 267 | Ga0182007_10015408 | 3300015262 | Bacteria | 2853 |
| 268 | Ga0163161_10016676 | 3300017792 | Bacteria | 5132 |
| 269 | Ga0163161_10097993 | 3300017792 | Unclassified | 2178 |
| 270 | Ga0163161_10431851 | 3300017792 | Bacteria | 1062 |
| 271 | Ga0197907_10725116 | 3300020069 | Bacteria | 965 |
| 272 | Ga0206356_10240272 | 3300020070 | Bacteria | 1323 |
| 273 | Ga0206356_10946499 | 3300020070 | Bacteria | 1079 |
| 274 | Ga0206356_11704471 | 3300020070 | Bacteria | 3774 |
| 275 | Ga0206354_10358543 | 3300020081 | Bacteria | 3540 |
| 276 | Ga0206354_10477547 | 3300020081 | Bacteria | 652 |
| 277 | Ga0206354_10637849 | 3300020081 | Bacteria | 804 |
| 278 | Ga0206354_11240988 | 3300020081 | Bacteria | 3606 |
| 279 | Ga0206353_10234536 | 3300020082 | Bacteria | 3461 |
| 280 | Ga0206353_10804099 | 3300020082 | Bacteria | 9328 |
| 281 | Ga0206353_11969477 | 3300020082 | Bacteria | 4482 |
| 282 | Ga0213871_10148915 | 3300021441 | Bacteria | 711 |
| 283 | Ga0224712_10077727 | 3300022467 | Bacteria | 1363 |
| 284 | Ga0207653_10015924 | 3300025885 | Bacteria | 2360 |
| 285 | Ga0207692_10062056 | 3300025898 | Bacteria | 1939 |
| 286 | Ga0207642_10030722 | 3300025899 | Bacteria | 2241 |
| 287 | Ga0207688_11053151 | 3300025901 | Bacteria | 514 |
| 288 | Ga0207647_10422111 | 3300025904 | Bacteria | 750 |
| 289 | Ga0207699_10075966 | 3300025906 | Bacteria | 2068 |
| 290 | Ga0207699_10208037 | 3300025906 | Bacteria | 1329 |
| 291 | Ga0207705_10005200 | 3300025909 | Bacteria | 9755 |
| 292 | Ga0207705_10209113 | 3300025909 | Bacteria | 1480 |
| 293 | Ga0207705_10222330 | 3300025909 | Bacteria | 1435 |
| 294 | Ga0207684_10150995 | 3300025910 | Bacteria | 1999 |
| 295 | Ga0207684_10242473 | 3300025910 | Bacteria | 1555 |
| 296 | Ga0207707_10080669 | 3300025912 | Bacteria | 2841 |
| 297 | Ga0207707_10112059 | 3300025912 | Bacteria | 2385 |
| 298 | Ga0207707_10224896 | 3300025912 | Bacteria | 1633 |
| 299 | Ga0207707_10708860 | 3300025912 | Bacteria | 844 |
| 300 | Ga0207695_10097899 | 3300025913 | Bacteria | 2934 |
| 301 | Ga0207695_10120036 | 3300025913 | Bacteria | 2598 |
| 302 | Ga0207671_10154157 | 3300025914 | Bacteria | 1776 |
| 303 | Ga0207693_10083211 | 3300025915 | Bacteria | 2506 |
| 304 | Ga0207693_10298938 | 3300025915 | Bacteria | 1261 |
| 305 | Ga0207693_10907481 | 3300025915 | Bacteria | 676 |
| 306 | Ga0207663_10280103 | 3300025916 | Bacteria | 1238 |
| 307 | Ga0207663_10894330 | 3300025916 | Unclassified | 710 |
| 308 | Ga0207660_10074951 | 3300025917 | Bacteria | 2470 |
| 309 | Ga0207660_10116430 | 3300025917 | Bacteria | 2019 |
| 310 | Ga0207660_10254056 | 3300025917 | Bacteria | 1388 |
| 311 | Ga0207660_10280935 | 3300025917 | Unclassified | 1321 |
| 312 | Ga0207660_10617029 | 3300025917 | Bacteria | 884 |
| 313 | Ga0207660_10640965 | 3300025917 | Bacteria | 866 |
| 314 | Ga0207660_10755609 | 3300025917 | Unclassified | 793 |
| 315 | Ga0207660_10911716 | 3300025917 | Bacteria | 717 |
| 316 | Ga0207662_10029152 | 3300025918 | Bacteria | 3195 |
| 317 | Ga0207657_10000388 | 3300025919 | Bacteria | 46370 |
| 318 | Ga0207657_10010339 | 3300025919 | Bacteria | 9313 |
| 319 | Ga0207657_10041066 | 3300025919 | Bacteria | 4092 |
| 320 | Ga0207657_10083380 | 3300025919 | Bacteria | 2682 |
| 321 | Ga0207657_10090125 | 3300025919 | Bacteria | 2560 |
| 322 | Ga0207657_10102133 | 3300025919 | Bacteria | 2378 |
| 323 | Ga0207657_10845407 | 3300025919 | Unclassified | 706 |
| 324 | Ga0207657_10889562 | 3300025919 | Bacteria | 686 |
| 325 | Ga0207657_11206898 | 3300025919 | Bacteria | 575 |
| 326 | Ga0207649_11569643 | 3300025920 | Bacteria | 521 |
| 327 | Ga0207652_10007590 | 3300025921 | Bacteria | 8733 |
| 328 | Ga0207652_10061251 | 3300025921 | Bacteria | 3249 |
| 329 | Ga0207652_10083152 | 3300025921 | Bacteria | 2802 |
| 330 | Ga0207652_10091565 | 3300025921 | Bacteria | 2674 |
| 331 | Ga0207652_10097733 | 3300025921 | Bacteria | 2589 |
| 332 | Ga0207652_10307250 | 3300025921 | Bacteria | 1431 |
| 333 | Ga0207652_10461065 | 3300025921 | Unclassified | 1145 |
| 334 | Ga0207646_10660505 | 3300025922 | Bacteria | 936 |
| 335 | Ga0207646_11452729 | 3300025922 | Bacteria | 595 |
| 336 | Ga0207694_10207330 | 3300025924 | Bacteria | 1596 |
| 337 | Ga0207694_10450495 | 3300025924 | Bacteria | 1074 |
| 338 | Ga0207687_10168528 | 3300025927 | Unclassified | 1687 |
| 339 | Ga0207687_10589877 | 3300025927 | Unclassified | 936 |
| 340 | Ga0207687_11256370 | 3300025927 | Bacteria | 637 |
| 341 | Ga0207700_10200310 | 3300025928 | Bacteria | 1682 |
| 342 | Ga0207700_10571886 | 3300025928 | Unclassified | 1004 |
| 343 | Ga0207664_10007814 | 3300025929 | Bacteria | 7429 |
| 344 | Ga0207664_10022812 | 3300025929 | Bacteria | 4681 |
| 345 | Ga0207664_10025226 | 3300025929 | Bacteria | 4475 |
| 346 | Ga0207664_10058978 | 3300025929 | Bacteria | 3056 |
| 347 | Ga0207664_10099886 | 3300025929 | Bacteria | 2395 |
| 348 | Ga0207664_10169968 | 3300025929 | Bacteria | 1865 |
| 349 | Ga0207664_10287848 | 3300025929 | Bacteria | 1443 |
| 350 | Ga0207664_10338397 | 3300025929 | Bacteria | 1330 |
| 351 | Ga0207644_10061440 | 3300025931 | Bacteria | 2721 |
| 352 | Ga0207644_10343614 | 3300025931 | Bacteria | 1211 |
| 353 | Ga0207690_10303491 | 3300025932 | Bacteria | 1250 |
| 354 | Ga0207706_10009052 | 3300025933 | Bacteria | 9160 |
| 355 | Ga0207706_10023685 | 3300025933 | Bacteria | 5511 |
| 356 | Ga0207706_10088959 | 3300025933 | Bacteria | 2715 |
| 357 | Ga0207686_10150293 | 3300025934 | Bacteria | 1620 |
| 358 | Ga0207686_10174929 | 3300025934 | Bacteria | 1517 |
| 359 | Ga0207709_10360677 | 3300025935 | Bacteria | 1100 |
| 360 | Ga0207709_10531873 | 3300025935 | Bacteria | 922 |
| 361 | Ga0207669_11467807 | 3300025937 | Bacteria | 581 |
| 362 | Ga0207704_10119235 | 3300025938 | Bacteria | 1801 |
| 363 | Ga0207704_10332509 | 3300025938 | Bacteria | 1176 |
| 364 | Ga0207665_10478272 | 3300025939 | Bacteria | 959 |
| 365 | Ga0207689_10224937 | 3300025942 | Bacteria | 1551 |
| 366 | Ga0207661_10030134 | 3300025944 | Bacteria | 4175 |
| 367 | Ga0207661_10076157 | 3300025944 | Bacteria | 2755 |
| 368 | Ga0207661_10121846 | 3300025944 | Bacteria | 2221 |
| 369 | Ga0207661_10390781 | 3300025944 | Bacteria | 1260 |
| 370 | Ga0207679_10738909 | 3300025945 | Bacteria | 895 |
| 371 | Ga0207679_11121957 | 3300025945 | Bacteria | 721 |
| 372 | Ga0207667_10014195 | 3300025949 | Bacteria | 9090 |
| 373 | Ga0207667_10535524 | 3300025949 | Unclassified | 1185 |
| 374 | Ga0207667_10700774 | 3300025949 | Bacteria | 1015 |
| 375 | Ga0207651_10346454 | 3300025960 | Bacteria | 1250 |
| 376 | Ga0207712_10309335 | 3300025961 | Bacteria | 1300 |
| 377 | Ga0207668_10080642 | 3300025972 | Unclassified | 2358 |
| 378 | Ga0207668_11171775 | 3300025972 | Bacteria | 690 |
| 379 | Ga0207640_10055421 | 3300025981 | Bacteria | 2597 |
| 380 | Ga0207640_10086107 | 3300025981 | Bacteria | 2162 |
| 381 | Ga0207640_10200078 | 3300025981 | Bacteria | 1513 |
| 382 | Ga0207640_11426837 | 3300025981 | Unclassified | 621 |
| 383 | Ga0207658_10759062 | 3300025986 | Bacteria | 879 |
| 384 | Ga0207677_10054541 | 3300026023 | Bacteria | 2729 |
| 385 | Ga0207677_10405126 | 3300026023 | Bacteria | 1158 |
| 386 | Ga0207677_10726536 | 3300026023 | Unclassified | 883 |
| 387 | Ga0207677_11905665 | 3300026023 | Unclassified | 552 |
| 388 | Ga0207703_10496262 | 3300026035 | Bacteria | 1145 |
| 389 | Ga0207639_10063676 | 3300026041 | Bacteria | 2856 |
| 390 | Ga0207708_10037668 | 3300026075 | Bacteria | 3683 |
| 391 | Ga0207702_10112952 | 3300026078 | Bacteria | 2419 |
| 392 | Ga0207702_10193378 | 3300026078 | Bacteria | 1881 |
| 393 | Ga0207702_10386042 | 3300026078 | Bacteria | 1347 |
| 394 | Ga0207702_10451429 | 3300026078 | Bacteria | 1247 |
| 395 | Ga0207702_10779296 | 3300026078 | Bacteria | 945 |
| 396 | Ga0207702_11203114 | 3300026078 | Bacteria | 752 |
| 397 | Ga0207702_11944980 | 3300026078 | Bacteria | 579 |
| 398 | Ga0207648_10002280 | 3300026089 | Bacteria | 20731 |
| 399 | Ga0207648_10146569 | 3300026089 | Unclassified | 2082 |
| 400 | Ga0207676_10665805 | 3300026095 | Bacteria | 1006 |
| 401 | Ga0207674_10402805 | 3300026116 | Bacteria | 1322 |
| 402 | Ga0207675_100000962 | 3300026118 | Bacteria | 28741 |
| 403 | Ga0207675_100016465 | 3300026118 | Bacteria | 6906 |
| 404 | Ga0207675_100472986 | 3300026118 | Bacteria | 1244 |
| 405 | Ga0207683_10120432 | 3300026121 | Bacteria | 2355 |
| 406 | Ga0207683_10134164 | 3300026121 | Bacteria | 2228 |
| 407 | Ga0207698_10390674 | 3300026142 | Bacteria | 1326 |
| 408 | Ga0207428_10009640 | 3300027907 | Bacteria | 8648 |
| 409 | Ga0268265_10760841 | 3300028380 | Bacteria | 941 |
| 410 | Ga0268264_10221343 | 3300028381 | Unclassified | 1742 |
| 411 | Ga0268264_10546650 | 3300028381 | Bacteria | 1135 |
| 412 | Ga0265319_1137482 | 3300028563 | Bacteria | 759 |
| 413 | Ga0265334_10023620 | 3300028573 | Bacteria | 2499 |
| 414 | Ga0265318_10002578 | 3300028577 | Bacteria | 9601 |
| 415 | Ga0265318_10171486 | 3300028577 | Bacteria | 795 |
| 416 | Ga0265318_10330900 | 3300028577 | Unclassified | 556 |
| 417 | Ga0265318_10398728 | 3300028577 | Bacteria | 503 |
| 418 | Ga0265322_10032908 | 3300028654 | Bacteria | 1478 |
| 419 | Ga0265336_10023824 | 3300028666 | Bacteria | 1938 |
| 420 | Ga0265338_10007351 | 3300028800 | Bacteria | 13717 |
| 421 | Ga0265338_10011362 | 3300028800 | Bacteria | 10293 |
| 422 | Ga0265338_10223104 | 3300028800 | Bacteria | 1406 |
| 423 | Ga0265338_10258498 | 3300028800 | Bacteria | 1281 |
| 424 | Ga0265330_10122547 | 3300031235 | Bacteria | 1107 |
| 425 | Ga0265320_10022368 | 3300031240 | Bacteria | 3383 |
| 426 | Ga0265320_10189525 | 3300031240 | Unclassified | 920 |
| 427 | Ga0265320_10226301 | 3300031240 | Bacteria | 832 |
| 428 | Ga0265325_10057518 | 3300031241 | Bacteria | 1983 |
| 429 | Ga0265340_10044224 | 3300031247 | Bacteria | 2179 |
| 430 | Ga0265340_10114392 | 3300031247 | Bacteria | 1245 |
| 431 | Ga0265339_10010628 | 3300031249 | Bacteria | 5707 |
| 432 | Ga0265339_10098825 | 3300031249 | Bacteria | 1522 |
| 433 | Ga0265339_10105639 | 3300031249 | Bacteria | 1462 |
| 434 | Ga0265339_10164204 | 3300031249 | Bacteria | 1116 |
| 435 | Ga0265327_10040184 | 3300031251 | Bacteria | 2532 |
| 436 | Ga0265316_10005504 | 3300031344 | Bacteria | 12296 |
| 437 | Ga0265316_10124633 | 3300031344 | Bacteria | 1944 |
| 438 | Ga0265316_10264469 | 3300031344 | Bacteria | 1260 |
| 439 | Ga0307408_100125368 | 3300031548 | Bacteria | 1996 |
| 440 | Ga0307408_101425677 | 3300031548 | Unclassified | 653 |
| 441 | Ga0265313_10039611 | 3300031595 | Bacteria | 2336 |
| 442 | Ga0265314_10013969 | 3300031711 | Bacteria | 6456 |
| 443 | Ga0265314_10072160 | 3300031711 | Bacteria | 2307 |
| 444 | Ga0265314_10466568 | 3300031711 | Bacteria | 670 |
| 445 | Ga0265342_10032409 | 3300031712 | Bacteria | 3223 |
| 446 | Ga0265342_10066700 | 3300031712 | Bacteria | 2107 |
| 447 | Ga0265342_10282914 | 3300031712 | Bacteria | 877 |
| 448 | Ga0307405_11315318 | 3300031731 | Bacteria | 629 |
| 449 | Ga0307406_10598243 | 3300031901 | Unclassified | 909 |
| 450 | Ga0307407_10503554 | 3300031903 | Bacteria | 888 |
| 451 | Ga0307412_10535733 | 3300031911 | Bacteria | 981 |
| 452 | Ga0307415_100196978 | 3300032126 | Bacteria | 1595 |
| 453 | Ga0307415_100989864 | 3300032126 | Bacteria | 781 |
| 454 | Ga0373938_0148281 | 3300034957 | Bacteria | 623 |
| 455 | Ga0373944_0087505 | 3300035089 | Bacteria | 1037 |
| 456 | Ga0373941_0044140 | 3300035115 | Bacteria | 1390 |
| 457 | Ga0373946_0194208 | 3300035171 | Bacteria | 969 |
| 458 | Ga0373962_0019317 | 3300035242 | Bacteria | 1782 |
| 459 | Ga0373962_0038575 | 3300035242 | Bacteria | 1338 |
| 460 | Ga0373931_0304975 | 3300035691 | Bacteria | 984 |
| 461 | Ga0373931_0763117 | 3300035691 | Bacteria | 643 |
| 462 | Ga0373947_0000918 | 3300035725 | Bacteria | 17889 |
| 463 | Ga0373947_0029763 | 3300035725 | Unclassified | 3205 |
| 464 | Ga0373925_0169027 | 3300037068 | Bacteria | 1725 |
| 465 | Ga0395899_0004887 | 3300037312 | Bacteria | 10436 |
| 466 | Ga0395899_0009076 | 3300037312 | Bacteria | 7639 |
| 467 | Ga0395899_0034242 | 3300037312 | Bacteria | 3813 |
| 468 | Ga0395899_0104355 | 3300037312 | Bacteria | 2043 |
| 469 | Ga0395900_0053378 | 3300037418 | Bacteria | 4160 |
| 470 | Ga0395900_0087713 | 3300037418 | Bacteria | 3197 |
| 471 | Ga0395900_0197714 | 3300037418 | Bacteria | 2036 |
| 472 | Ga0395900_0239362 | 3300037418 | Bacteria | 1821 |
| 473 | Ga0395900_0254506 | 3300037418 | Bacteria | 1756 |
| 474 | Ga0395900_0397638 | 3300037418 | Bacteria | 1343 |
| 475 | Ga0395900_0400346 | 3300037418 | Bacteria | 1337 |
| 476 | Ga0395900_0438157 | 3300037418 | Unclassified | 1265 |
| 477 | Ga0395900_0705694 | 3300037418 | Bacteria | 942 |
| 478 | Ga0395900_1460892 | 3300037418 | Bacteria | 596 |
| 479 | Ga0395898_0003001 | 3300037466 | Bacteria | 19133 |
| 480 | Ga0395898_0037254 | 3300037466 | Bacteria | 4826 |
| 481 | Ga0395898_0044034 | 3300037466 | Bacteria | 4396 |
| 482 | Ga0395898_0143640 | 3300037466 | Bacteria | 2284 |
| 483 | Ga0395898_0159219 | 3300037466 | Bacteria | 2159 |
| 484 | Ga0395898_0180977 | 3300037466 | Bacteria | 2015 |
| 485 | Ga0395898_0198660 | 3300037466 | Bacteria | 1915 |
| 486 | Ga0395898_0524571 | 3300037466 | Bacteria | 1126 |
| 487 | Ga0395898_0680017 | 3300037466 | Unclassified | 971 |
| 488 | Ga0395898_1132144 | 3300037466 | Unclassified | 715 |
| 489 | Ga0395898_1707056 | 3300037466 | Bacteria | 552 |
| 490 | Ga0395898_1865803 | 3300037466 | Bacteria | 521 |
| 491 | Ga0395905_0006030 | 3300037471 | Bacteria | 12272 |
| 492 | Ga0395905_0046287 | 3300037471 | Bacteria | 4079 |
| 493 | Ga0395905_0091348 | 3300037471 | Bacteria | 2854 |
| 494 | Ga0395905_0169880 | 3300037471 | Bacteria | 2048 |
| 495 | Ga0395905_0192572 | 3300037471 | Bacteria | 1912 |
| 496 | Ga0395901_0033143 | 3300038443 | Bacteria | 5330 |
| 497 | Ga0395901_0047926 | 3300038443 | Bacteria | 4437 |
| 498 | Ga0395901_0080202 | 3300038443 | Bacteria | 3407 |
| 499 | Ga0395901_0154805 | 3300038443 | Bacteria | 2408 |
| 500 | Ga0395901_0161734 | 3300038443 | Bacteria | 2351 |
| 501 | Ga0395901_0328377 | 3300038443 | Unclassified | 1582 |
| 502 | Ga0395901_0351305 | 3300038443 | Bacteria | 1521 |
| 503 | Ga0395901_0481439 | 3300038443 | Bacteria | 1266 |
| 504 | Ga0395901_0550864 | 3300038443 | Unclassified | 1169 |
| 505 | Ga0395901_0637691 | 3300038443 | Bacteria | 1070 |
| 506 | Ga0395901_0850625 | 3300038443 | Bacteria | 897 |
| 507 | Ga0395901_1012343 | 3300038443 | Bacteria | 806 |
| 508 | Ga0395901_1280393 | 3300038443 | Bacteria | 696 |
| 509 | Ga0395901_1997657 | 3300038443 | Bacteria | 526 |
| 510 | Ga0242420_129380 | 3300038996 | Bacteria | 556 |
| 511 | Ga0436360_0975496 | 3300039438 | Bacteria | 2482 |
| 512 | Ga0451853_0158545 | 3300041512 | Bacteria | 2730 |
| 513 | Ga0466972_0213033 | 3300044658 | Bacteria | 904 |
| 514 | Ga0466972_0328302 | 3300044658 | Bacteria | 715 |
| 515 | Ga0466965_0145522 | 3300044683 | Bacteria | 1236 |
| 516 | Ga0466966_0028061 | 3300044684 | Bacteria | 3667 |
| 517 | Ga0466966_0180906 | 3300044684 | Bacteria | 1279 |
| 518 | Ga0466966_0680627 | 3300044684 | Bacteria | 620 |
| 519 | Ga0466961_0003168 | 3300044693 | Bacteria | 10245 |
| 520 | Ga0466961_0145035 | 3300044693 | Bacteria | 1485 |
| 521 | Ga0466961_0621643 | 3300044693 | Bacteria | 649 |
| 522 | Ga0466963_0003845 | 3300044694 | Bacteria | 8660 |
| 523 | Ga0466963_0005592 | 3300044694 | Bacteria | 7372 |
| 524 | Ga0466963_0025377 | 3300044694 | Bacteria | 3779 |
| 525 | Ga0466963_0046731 | 3300044694 | Bacteria | 2855 |
| 526 | Ga0466963_0071351 | 3300044694 | Bacteria | 2338 |
| 527 | Ga0466963_0071480 | 3300044694 | Bacteria | 2335 |
| 528 | Ga0466963_0102783 | 3300044694 | Bacteria | 1957 |
| 529 | Ga0466963_0160614 | 3300044694 | Bacteria | 1564 |
| 530 | Ga0466963_0285925 | 3300044694 | Unclassified | 1159 |
| 531 | Ga0466963_0432060 | 3300044694 | Bacteria | 929 |
| 532 | Ga0466963_0498225 | 3300044694 | Bacteria | 860 |
| 533 | Ga0466964_0056279 | 3300044706 | Bacteria | 1626 |
| 534 | Ga0466964_0115300 | 3300044706 | Unclassified | 1203 |
| 535 | Ga0466964_0141190 | 3300044706 | Unclassified | 1107 |
| 536 | Ga0466964_0394775 | 3300044706 | Bacteria | 721 |
| 537 | Ga0466964_0484686 | 3300044706 | Bacteria | 661 |
| 538 | Ga0466964_0694294 | 3300044706 | Bacteria | 567 |
| 539 | Ga0466971_0018695 | 3300044719 | Bacteria | 3072 |
| 540 | Ga0466971_0022425 | 3300044719 | Bacteria | 2814 |
| 541 | Ga0466971_0024818 | 3300044719 | Bacteria | 2676 |
| 542 | Ga0466971_0045941 | 3300044719 | Bacteria | 1962 |
| 543 | Ga0466971_0185127 | 3300044719 | Bacteria | 980 |
| 544 | Ga0466971_0271397 | 3300044719 | Bacteria | 811 |
| 545 | Ga0466971_0497933 | 3300044719 | Bacteria | 601 |
| 546 | Ga0466968_0045555 | 3300044735 | Bacteria | 1862 |
| 547 | Ga0466968_0214899 | 3300044735 | Bacteria | 904 |
| 548 | Ga0466970_0021149 | 3300044765 | Bacteria | 3387 |
| 549 | Ga0466970_0157873 | 3300044765 | Bacteria | 1254 |
| 550 | Ga0466957_0004517 | 3300044842 | Bacteria | 7766 |
| 551 | Ga0466957_0036211 | 3300044842 | Bacteria | 2966 |
| 552 | Ga0466957_0037927 | 3300044842 | Bacteria | 2902 |
| 553 | Ga0466957_0060644 | 3300044842 | Bacteria | 2320 |
| 554 | Ga0466957_0063369 | 3300044842 | Bacteria | 2272 |
| 555 | Ga0466957_0255344 | 3300044842 | Bacteria | 1167 |
| 556 | Ga0466957_0295586 | 3300044842 | Bacteria | 1087 |
| 557 | Ga0466957_0645255 | 3300044842 | Unclassified | 744 |
| 558 | Ga0466957_0743127 | 3300044842 | Bacteria | 694 |
| 559 | Ga0466957_0859189 | 3300044842 | Unclassified | 647 |
| 560 | Ga0466960_0834068 | 3300044901 | Bacteria | 560 |
| 561 | Ga0466959_0341577 | 3300045049 | Bacteria | 1021 |
| 562 | Ga0466959_1190682 | 3300045049 | Archaea | 506 |
| 563 | Ga0451576_0171276 | 3300045051 | Bacteria | 2266 |
| 564 | Ga0451576_0755929 | 3300045051 | Bacteria | 1021 |
| 565 | Ga0451576_1869539 | 3300045051 | Bacteria | 620 |
| 566 | Ga0466958_0010746 | 3300045836 | Bacteria | 5135 |
| 567 | Ga0466958_0011649 | 3300045836 | Bacteria | 4957 |
| 568 | Ga0466958_0034402 | 3300045836 | Bacteria | 3023 |
| 569 | Ga0466958_0041096 | 3300045836 | Bacteria | 2781 |
| 570 | Ga0466958_0116942 | 3300045836 | Bacteria | 1667 |
| 571 | Ga0466958_0253141 | 3300045836 | Bacteria | 1127 |
| 572 | Ga0466958_0344353 | 3300045836 | Bacteria | 959 |
| 573 | Ga0466958_0346291 | 3300045836 | Bacteria | 956 |
| 574 | Ga0466958_0468958 | 3300045836 | Bacteria | 816 |
| 575 | Ga0466967_0005509 | 3300045976 | Bacteria | 8785 |
| 576 | Ga0466967_0025009 | 3300045976 | Bacteria | 4917 |
| 577 | Ga0466967_0031365 | 3300045976 | Bacteria | 4473 |
| 578 | Ga0466967_0041018 | 3300045976 | Bacteria | 3987 |
| 579 | Ga0466967_0046656 | 3300045976 | Unclassified | 3773 |
| 580 | Ga0466967_0090183 | 3300045976 | Bacteria | 2784 |
| 581 | Ga0466967_0100797 | 3300045976 | Bacteria | 2639 |
| 582 | Ga0466967_0124924 | 3300045976 | Bacteria | 2382 |
| 583 | Ga0466967_0168812 | 3300045976 | Bacteria | 2057 |
| 584 | Ga0466967_0286870 | 3300045976 | Bacteria | 1580 |
| 585 | Ga0466967_0485236 | 3300045976 | Bacteria | 1211 |
| 586 | Ga0466967_0563109 | 3300045976 | Unclassified | 1122 |
| 587 | Ga0466967_0653199 | 3300045976 | Bacteria | 1040 |
| 588 | Ga0466967_0788411 | 3300045976 | Unclassified | 943 |
| 589 | Ga0495592_0330803 | 3300046454 | Bacteria | 982 |
| 590 | Ga0495603_0000315 | 3300046455 | Bacteria | 25931 |
| 591 | Ga0495629_0075516 | 3300046459 | Unclassified | 2354 |
| 592 | Ga0495629_0076374 | 3300046459 | Bacteria | 2339 |
| 593 | Ga0495641_0002640 | 3300046461 | Bacteria | 14008 |
| 594 | Ga0495641_0022803 | 3300046461 | Unclassified | 3125 |
| 595 | Ga0495641_0297432 | 3300046461 | Bacteria | 727 |
| 596 | Ga0495653_0031425 | 3300046463 | Bacteria | 4220 |
| 597 | Ga0495580_0279778 | 3300046472 | Bacteria | 1138 |
| 598 | Ga0495582_0010033 | 3300046473 | Bacteria | 5212 |
| 599 | Ga0495605_0416647 | 3300046474 | Bacteria | 557 |
| 600 | Ga0495639_0249185 | 3300046475 | Bacteria | 878 |
| 601 | Ga0495639_0652745 | 3300046475 | Bacteria | 542 |
| 602 | Ga0495584_0057441 | 3300046491 | Bacteria | 1958 |
| 603 | Ga0495584_0097952 | 3300046491 | Bacteria | 1482 |
| 604 | Ga0495584_0161974 | 3300046491 | Bacteria | 1137 |
| 605 | Ga0495594_0001557 | 3300046499 | Bacteria | 11915 |
| 606 | Ga0495594_0019914 | 3300046499 | Unclassified | 3570 |
| 607 | Ga0495628_0269162 | 3300046516 | Bacteria | 1268 |
| 608 | Ga0495630_0365748 | 3300046517 | Bacteria | 1104 |
| 609 | Ga0495631_0358847 | 3300046518 | Bacteria | 620 |
| 610 | Ga0495663_0231165 | 3300046525 | Bacteria | 652 |
| 611 | Ga0495666_0029399 | 3300046526 | Bacteria | 2703 |
| 612 | Ga0495652_0126969 | 3300046529 | Bacteria | 2025 |
| 613 | Ga0495665_0107891 | 3300046531 | Unclassified | 1461 |
| 614 | Ga0495586_0029827 | 3300046535 | Unclassified | 2920 |
| 615 | Ga0495609_0108835 | 3300046538 | Bacteria | 1197 |
| 616 | Ga0495621_0262656 | 3300046539 | Bacteria | 708 |
| 617 | Ga0495645_0520457 | 3300046543 | Bacteria | 741 |
| 618 | Ga0495622_0044021 | 3300046557 | Bacteria | 2075 |
| 619 | Ga0495667_0104095 | 3300046559 | Bacteria | 1835 |
| 620 | Ga0495656_0334170 | 3300046615 | Bacteria | 783 |
| 621 | Ga0495668_0202507 | 3300046616 | Bacteria | 1087 |
| 622 | Ga0495668_0709142 | 3300046616 | Bacteria | 557 |
| 623 | Ga0495634_0123904 | 3300046642 | Bacteria | 1653 |
| 624 | Ga0495634_0178818 | 3300046642 | Unclassified | 1329 |
| 625 | Ga0495635_0339624 | 3300046663 | Bacteria | 1003 |
| 626 | Ga0495659_0077440 | 3300046664 | Bacteria | 1256 |
| 627 | Ga0495588_0001006 | 3300046674 | Bacteria | 12276 |
| 628 | Ga0495657_0456238 | 3300046675 | Bacteria | 748 |
| 629 | Ga0495647_0001825 | 3300046681 | Bacteria | 6589 |
| 630 | Ga0495647_0084839 | 3300046681 | Bacteria | 1290 |
| 631 | Ga0495658_0046804 | 3300046683 | Bacteria | 2433 |
| 632 | Ga0495613_0078401 | 3300046689 | Bacteria | 2403 |
| 633 | Ga0495613_0168991 | 3300046689 | Bacteria | 1553 |
| 634 | Ga0495600_0120450 | 3300046809 | Bacteria | 1707 |
| 635 | Ga0495581_0168860 | 3300047315 | Bacteria | 1279 |
| 636 | Ga0495581_0332045 | 3300047315 | Bacteria | 888 |
| 637 | Ga0495604_0133708 | 3300047317 | Bacteria | 1780 |
| 638 | Ga0495674_0146217 | 3300047319 | Bacteria | 1984 |
| 639 | Ga0495676_0056087 | 3300047321 | Unclassified | 3118 |
| 640 | Ga0495676_0080563 | 3300047321 | Bacteria | 2472 |
| 641 | Ga0495680_0397953 | 3300047322 | Bacteria | 951 |
| 642 | Ga0495684_0389441 | 3300047471 | Bacteria | 981 |
| 643 | Ga0495593_0082362 | 3300047673 | Bacteria | 1663 |
| 644 | Ga0495602_0706429 | 3300048088 | Bacteria | 684 |
| 645 | Ga0496100_0128246 | 3300048903 | Bacteria | 1783 |
| 646 | Ga0496100_0266342 | 3300048903 | Bacteria | 1272 |
| 647 | Ga0496101_0017380 | 3300048904 | Bacteria | 4880 |
| 648 | Ga0496101_0178131 | 3300048904 | Bacteria | 1636 |
| 649 | Ga0496101_0343955 | 3300048904 | Bacteria | 1172 |
| 650 | Ga0496102_0122377 | 3300048905 | Bacteria | 2430 |
| 651 | Ga0496102_0201641 | 3300048905 | Bacteria | 1875 |
| 652 | Ga0496102_0307827 | 3300048905 | Unclassified | 1493 |
| 653 | Ga0496103_0114775 | 3300048906 | Bacteria | 1713 |
| 654 | Ga0496103_0258570 | 3300048906 | Bacteria | 1120 |
| 655 | Ga0496103_0306261 | 3300048906 | Bacteria | 1022 |
| 656 | Ga0496104_0005360 | 3300048907 | Bacteria | 11225 |
| 657 | Ga0496104_0039743 | 3300048907 | Bacteria | 4405 |
| 658 | Ga0496104_0313705 | 3300048907 | Bacteria | 1481 |
| 659 | Ga0496104_0661872 | 3300048907 | Bacteria | 953 |
| 660 | Ga0496104_1072165 | 3300048907 | Bacteria | 709 |
| 661 | Ga0496105_0003157 | 3300048908 | Bacteria | 12134 |
| 662 | Ga0496105_0147064 | 3300048908 | Bacteria | 1937 |
| 663 | Ga0496105_0483997 | 3300048908 | Bacteria | 973 |
| 664 | Ga0496105_0744832 | 3300048908 | Unclassified | 749 |
| 665 | Ga0496106_0001856 | 3300048909 | Bacteria | 15812 |
| 666 | Ga0496106_0267337 | 3300048909 | Unclassified | 1369 |
| 667 | Ga0496106_0336544 | 3300048909 | Bacteria | 1212 |
| 668 | Ga0496106_1498883 | 3300048909 | Bacteria | 519 |
| 669 | Ga0496107_0029123 | 3300048910 | Bacteria | 3926 |
| 670 | Ga0496107_0173205 | 3300048910 | Bacteria | 1602 |
| 671 | Ga0496108_0015483 | 3300048911 | Bacteria | 6220 |
| 672 | Ga0496108_0054439 | 3300048911 | Bacteria | 3357 |
| 673 | Ga0496108_0165659 | 3300048911 | Bacteria | 1911 |
| 674 | Ga0496108_0457624 | 3300048911 | Bacteria | 1115 |
| 675 | Ga0496108_0458672 | 3300048911 | Bacteria | 1113 |
| 676 | Ga0496108_0860132 | 3300048911 | Bacteria | 780 |
| 677 | Ga0496109_0016861 | 3300048912 | Bacteria | 6391 |
| 678 | Ga0496109_0061176 | 3300048912 | Bacteria | 3442 |
| 679 | Ga0496109_0086040 | 3300048912 | Bacteria | 2903 |
| 680 | Ga0496109_0100769 | 3300048912 | Bacteria | 2680 |
| 681 | Ga0496109_0128873 | 3300048912 | Bacteria | 2360 |
| 682 | Ga0496109_0130074 | 3300048912 | Unclassified | 2349 |
| 683 | Ga0496109_0546121 | 3300048912 | Bacteria | 1093 |
| 684 | Ga0496110_0003586 | 3300048913 | Bacteria | 11931 |
| 685 | Ga0496110_0009997 | 3300048913 | Bacteria | 7696 |
| 686 | Ga0496110_0014829 | 3300048913 | Bacteria | 6476 |
| 687 | Ga0496110_0181900 | 3300048913 | Bacteria | 1909 |
| 688 | Ga0496110_0241981 | 3300048913 | Unclassified | 1642 |
| 689 | Ga0496111_0004255 | 3300048914 | Bacteria | 9020 |
| 690 | Ga0496111_0010141 | 3300048914 | Bacteria | 6308 |
| 691 | Ga0496111_0323827 | 3300048914 | Bacteria | 1141 |
| 692 | Ga0496112_0000307 | 3300048915 | Bacteria | 31590 |
| 693 | Ga0496112_0022546 | 3300048915 | Bacteria | 6001 |
| 694 | Ga0496112_0028506 | 3300048915 | Bacteria | 5390 |
| 695 | Ga0496112_0047386 | 3300048915 | Bacteria | 4216 |
| 696 | Ga0496112_0107315 | 3300048915 | Bacteria | 2762 |
| 697 | Ga0496112_0208500 | 3300048915 | Bacteria | 1912 |
| 698 | Ga0496112_0309667 | 3300048915 | Bacteria | 1524 |
| 699 | Ga0496112_0442967 | 3300048915 | Bacteria | 1237 |
| 700 | Ga0496112_0475203 | 3300048915 | Bacteria | 1187 |
| 701 | Ga0496112_0969410 | 3300048915 | Bacteria | 771 |
| 702 | Ga0496112_1005770 | 3300048915 | Bacteria | 753 |
| 703 | Ga0496112_1920347 | 3300048915 | Bacteria | 503 |
| 704 | Ga0496113_0000192 | 3300048916 | Bacteria | 27861 |
| 705 | Ga0496113_0021667 | 3300048916 | Bacteria | 4535 |
| 706 | Ga0496113_0187245 | 3300048916 | Bacteria | 1642 |
| 707 | Ga0496113_0187751 | 3300048916 | Bacteria | 1640 |
| 708 | Ga0496113_0214715 | 3300048916 | Bacteria | 1532 |
| 709 | Ga0496114_0068553 | 3300048917 | Bacteria | 2978 |
| 710 | Ga0496114_0116450 | 3300048917 | Bacteria | 2294 |
| 711 | Ga0496114_0732730 | 3300048917 | Bacteria | 865 |
| 712 | Ga0496115_0042155 | 3300048918 | Bacteria | 3635 |
| 713 | Ga0496115_0194156 | 3300048918 | Bacteria | 1677 |
| 714 | Ga0501034_0051076 | 3300049571 | Bacteria | 4170 |
| 715 | Ga0501041_0109290 | 3300049577 | Bacteria | 1715 |
| 716 | Ga0501043_0727036 | 3300049579 | Bacteria | 723 |
| 717 | Ga0501046_0972302 | 3300049580 | Bacteria | 590 |
| 718 | Ga0501048_0384956 | 3300049582 | Bacteria | 1002 |
| 719 | Ga0501067_0086812 | 3300049583 | Bacteria | 1736 |
| 720 | Ga0501067_0177230 | 3300049583 | Bacteria | 1187 |
| 721 | Ga0501067_0569895 | 3300049583 | Bacteria | 634 |
| 722 | Ga0501068_0738751 | 3300049584 | Bacteria | 644 |
| 723 | Ga0501068_0915609 | 3300049584 | Bacteria | 577 |
| 724 | Ga0501068_1113612 | 3300049584 | Bacteria | 522 |
| 725 | Ga0501069_0123102 | 3300049585 | Bacteria | 1482 |
| 726 | Ga0501070_0002719 | 3300049586 | Bacteria | 15433 |
| 727 | Ga0501070_0007864 | 3300049586 | Bacteria | 9035 |
| 728 | Ga0501072_0095044 | 3300049588 | Bacteria | 2368 |
| 729 | Ga0501072_0467823 | 3300049588 | Bacteria | 998 |
| 730 | Ga0501073_0025021 | 3300049589 | Bacteria | 4284 |
| 731 | Ga0501073_0710240 | 3300049589 | Bacteria | 693 |
| 732 | Ga0501074_0000736 | 3300049590 | Bacteria | 20545 |
| 733 | Ga0501074_0056120 | 3300049590 | Bacteria | 2838 |
| 734 | Ga0501074_0134059 | 3300049590 | Bacteria | 1772 |
| 735 | Ga0501075_0180259 | 3300049591 | Bacteria | 1612 |
| 736 | Ga0501079_0090973 | 3300049741 | Bacteria | 2364 |
| 737 | Ga0501079_0151104 | 3300049741 | Bacteria | 1810 |
| 738 | Ga0501080_0000499 | 3300049742 | Bacteria | 30720 |
| 739 | Ga0501080_0008878 | 3300049742 | Bacteria | 9138 |
| 740 | Ga0501083_0000893 | 3300049744 | Bacteria | 19783 |
| 741 | Ga0501035_1296154 | 3300049822 | Bacteria | 562 |
| 742 | nmdc:mga05p37_349744_c1 | 3300050507 | Bacteria | 1740 |
| 743 | nmdc:mga05p37_4070_c1 | 3300050507 | Bacteria | 17093 |
| 744 | nmdc:mga05p37_51178_c1 | 3300050507 | Bacteria | 5080 |
| 745 | nmdc:mga09592_159327_c1 | 3300050508 | Bacteria | 1949 |
| 746 | nmdc:mga06r32_499587_c1 | 3300050510 | Unclassified | 1193 |
| 747 | nmdc:mga06r32_88253_c1 | 3300050510 | Bacteria | 3027 |
| 748 | nmdc:mga08y16_1645879_c1 | 3300050511 | Unclassified | 599 |
| 749 | nmdc:mga0n895_38057_c1 | 3300050512 | Bacteria | 4659 |
| 750 | nmdc:mga0rr50_1387720_c1 | 3300050513 | Bacteria | 595 |
| 751 | nmdc:mga0rr50_29022_c1 | 3300050513 | Bacteria | 3896 |
| 752 | nmdc:mga08x19_212835_c1 | 3300050514 | Bacteria | 1327 |
| 753 | nmdc:mga08x19_454491_c1 | 3300050514 | Unclassified | 902 |
| 754 | nmdc:mga08x19_972390_c1 | 3300050514 | Bacteria | 603 |
| 755 | nmdc:mga0a205_1404869_c1 | 3300050515 | Unclassified | 546 |
| 756 | nmdc:mga0a205_34720_c1 | 3300050515 | Bacteria | 4840 |
| 757 | Ga0495601_0833559 | 3300053077 | Bacteria | 584 |
| 758 | Ga0495655_0027026 | 3300053083 | Bacteria | 1357 |
| 759 | Ga0495595_0182394 | 3300053084 | Bacteria | 1041 |
| 760 | Ga0495595_0507152 | 3300053084 | Bacteria | 615 |
| 761 | Ga0495619_0011494 | 3300053085 | Bacteria | 5581 |
| 762 | Ga0500566_0262559 | 3300053094 | Bacteria | 833 |
| 763 | Ga0501084_0998500 | 3300054114 | Bacteria | 703 |
| 764 | Ga0501082_0309379 | 3300060353 | Bacteria | 1376 |
| 765 | Ga0501082_0345127 | 3300060353 | Bacteria | 1297 |
| 766 | Ga0466962_0020288 | 3300061719 | Bacteria | 3194 |
| 767 | Ga0466962_0039457 | 3300061719 | Bacteria | 2261 |
| 768 | Ga0466962_0109376 | 3300061719 | Bacteria | 1330 |
| 769 | Ga0466962_0336536 | 3300061719 | Bacteria | 750 |
| 770 | Ga0530510_0349355 | 3300061734 | Bacteria | 1111 |
| 771 | Ga0466967_0173177 | |||
| 772 | Ga0070658_10003218 | |||
| 773 | Ga0070658_10094616 | |||
| 774 | Ga0070658_10305778 | |||
| 775 | Ga0070658_10568368 | |||
| 776 | Ga0070658_10767255 | |||
| 777 | Ga0070683_100045570 | |||
| 778 | Ga0070683_100293169 | |||
| 779 | Ga0070683_100399211 | |||
| 780 | Ga0070690_101295781 | |||
| 781 | Ga0070677_10657400 | |||
| 782 | Ga0068869_100906230 | |||
| 783 | Ga0070680_100013061 | |||
| 784 | Ga0070680_100143926 | |||
| 785 | Ga0070680_100173766 | |||
| 786 | Ga0070680_100314209 | |||
| 787 | Ga0070680_101081576 | |||
| 788 | Ga0070680_101263963 | |||
| 789 | Ga0070680_101521460 | |||
| 790 | Ga0070682_100137372 | |||
| 791 | Ga0068868_100144853 | |||
| 792 | Ga0068868_100313169 | |||
| 793 | Ga0068868_100772891 | |||
| 794 | Ga0068868_101309897 | |||
| 795 | Ga0068868_101326481 | |||
| 796 | Ga0070660_100003398 | |||
| 797 | Ga0070660_100008279 | |||
| 798 | Ga0070660_100014577 | |||
| 799 | Ga0070660_100093203 | |||
| 800 | Ga0070660_100381206 | |||
| 801 | Ga0070660_100425802 | |||
| 802 | Ga0070660_101156429 | |||
| 803 | Ga0070689_100069489 | |||
| 804 | Ga0070691_10059987 | |||
| 805 | Ga0070691_10073533 | |||
| 806 | Ga0070691_10268612 | |||
| 807 | Ga0070691_10416975 | |||
| 808 | Ga0070687_101302564 | |||
| 809 | Ga0070661_100080732 | |||
| 810 | Ga0070661_100601541 | |||
| 811 | Ga0070692_10039401 | |||
| 812 | Ga0070668_100019875 | |||
| 813 | Ga0070668_100858671 | |||
| 814 | Ga0070669_100123725 | |||
| 815 | Ga0070671_100060932 | |||
| 816 | Ga0070671_100289163 | |||
| 817 | Ga0070674_100484900 | |||
| 818 | Ga0070673_101883879 | |||
| 819 | Ga0070659_100057173 | |||
| 820 | Ga0070709_10040745 | |||
| 821 | Ga0070709_10077780 | |||
| 822 | Ga0070709_10198908 | |||
| 823 | Ga0070714_100018069 | |||
| 824 | Ga0070714_100024674 | |||
| 825 | Ga0070714_100030318 | |||
| 826 | Ga0070714_100035545 | |||
| 827 | Ga0070714_100119582 | |||
| 828 | Ga0070714_100256614 | |||
| 829 | Ga0070714_101220652 | |||
| 830 | Ga0070714_101578220 | |||
| 831 | Ga0070713_100296490 | |||
| 832 | Ga0070713_100342805 | |||
| 833 | Ga0070710_10045750 | |||
| 834 | Ga0070710_10513919 | |||
| 835 | Ga0070711_100078760 | |||
| 836 | Ga0070711_100360379 | |||
| 837 | Ga0070711_100612138 | |||
| 838 | Ga0070705_100258474 | |||
| 839 | Ga0070705_100402868 | |||
| 840 | Ga0070700_100428213 | |||
| 841 | Ga0070708_100306729 | |||
| 842 | Ga0070708_100731123 | |||
| 843 | Ga0070708_100822560 | |||
| 844 | Ga0070708_101491997 | |||
| 845 | Ga0070663_101374832 | |||
| 846 | Ga0070678_100200701 | |||
| 847 | Ga0070678_100618380 | |||
| 848 | Ga0070662_100046652 | |||
| 849 | Ga0070662_100074932 | |||
| 850 | Ga0070662_100152082 | |||
| 851 | Ga0070681_10035668 | |||
| 852 | Ga0070681_10057340 | |||
| 853 | Ga0070681_10062107 | |||
| 854 | Ga0070681_10187155 | |||
| 855 | Ga0070681_10676536 | |||
| 856 | Ga0070681_11444649 | |||
| 857 | Ga0070681_11512988 | |||
| 858 | Ga0070681_11991516 | |||
| 859 | Ga0068867_100091334 | |||
| 860 | Ga0068867_100115010 | |||
| 861 | Ga0070685_10065218 | |||
| 862 | Ga0070706_100157724 | |||
| 863 | Ga0070707_100711845 | |||
| 864 | Ga0070707_101173846 | |||
| 865 | Ga0070698_100026743 | |||
| 866 | Ga0070698_100037141 | |||
| 867 | Ga0070698_100185544 | |||
| 868 | Ga0070698_100318600 | |||
| 869 | Ga0070698_100341617 | |||
| 870 | Ga0070698_100435026 | |||
| 871 | Ga0070699_100103626 | |||
| 872 | Ga0070679_100075139 | |||
| 873 | Ga0070679_100081103 | |||
| 874 | Ga0070679_100096451 | |||
| 875 | Ga0070679_100250426 | |||
| 876 | Ga0070679_100305134 | |||
| 877 | Ga0070679_100393177 | |||
| 878 | Ga0070679_100434760 | |||
| 879 | Ga0070679_100434811 | |||
| 880 | Ga0070679_100783726 | |||
| 881 | Ga0070679_101331789 | |||
| 882 | Ga0070684_100073429 | |||
| 883 | Ga0070684_100137723 | |||
| 884 | Ga0070684_100358654 | |||
| 885 | Ga0070684_100375971 | |||
| 886 | Ga0070697_100366520 | |||
| 887 | Ga0068853_100381824 | |||
| 888 | Ga0068853_101088034 | |||
| 889 | Ga0068853_101103958 | |||
| 890 | Ga0068853_102248181 | |||
| 891 | Ga0070695_100017880 | |||
| 892 | Ga0070695_101122636 | |||
| 893 | Ga0070696_100038290 | |||
| 894 | Ga0070696_100100208 | |||
| 895 | Ga0070693_100019865 | |||
| 896 | Ga0070693_100051739 | |||
| 897 | Ga0070665_101217316 | |||
| 898 | Ga0070665_101964303 | |||
| 899 | Ga0070704_100078786 | |||
| 900 | Ga0070704_100181183 | |||
| 901 | Ga0070704_100602545 | |||
| 902 | Ga0070704_100783335 | |||
| 903 | Ga0068855_100041774 | |||
| 904 | Ga0068855_100144185 | |||
| 905 | Ga0068855_100158466 | |||
| 906 | Ga0068855_100395390 | |||
| 907 | Ga0068855_101076583 | |||
| 908 | Ga0068855_101911481 | |||
| 909 | Ga0070664_100758281 | |||
| 910 | Ga0070664_100783414 | |||
| 911 | Ga0068857_100707450 | |||
| 912 | Ga0068854_100302177 | |||
| 913 | Ga0068854_101464569 | |||
| 914 | Ga0068856_100301589 | |||
| 915 | Ga0068856_100457030 | |||
| 916 | Ga0068856_100496879 | |||
| 917 | Ga0068856_100551253 | |||
| 918 | Ga0068856_100818730 | |||
| 919 | Ga0068856_101129360 | |||
| 920 | Ga0068856_101539571 | |||
| 921 | Ga0070702_100111354 | |||
| 922 | Ga0070702_100243114 | |||
| 923 | Ga0070702_100672278 | |||
| 924 | Ga0068852_100090411 | |||
| 925 | Ga0068852_100336607 | |||
| 926 | Ga0068859_100131031 | |||
| 927 | Ga0068864_100383087 | |||
| 928 | Ga0068866_10677763 | |||
| 929 | Ga0068861_100006190 | |||
| 930 | Ga0068861_100032457 | |||
| 931 | Ga0068863_100190836 | |||
| 932 | Ga0068860_100446185 | |||
| 933 | Ga0068862_100813902 | |||
| 934 | Ga0081455_10021136 | |||
| 935 | Ga0081455_10043634 | |||
| 936 | Ga0081540_1011397 | |||
| 937 | Ga0081540_1027675 | |||
| 938 | Ga0070717_10045439 | |||
| 939 | Ga0070717_10094164 | |||
| 940 | Ga0070717_10155388 | |||
| 941 | Ga0070717_10952153 | |||
| 942 | Ga0070717_11027783 | |||
| 943 | Ga0075432_10004713 | |||
| 944 | Ga0070712_100035356 | |||
| 945 | Ga0070712_100090356 | |||
| 946 | Ga0070712_100220790 | |||
| 947 | Ga0075428_100063600 | |||
| 948 | Ga0075428_100176345 | |||
| 949 | Ga0075428_100236449 | |||
| 950 | Ga0075431_100301701 | |||
| 951 | Ga0075433_10036455 | |||
| 952 | Ga0075433_10526852 | |||
| 953 | Ga0075434_100399955 | |||
| 954 | Ga0075429_100113492 | |||
| 955 | Ga0075429_101789308 | |||
| 956 | Ga0075436_100109147 | |||
| 957 | Ga0075436_100206475 | |||
| 958 | Ga0075436_101034629 | |||
| 959 | Ga0097620_100131032 | |||
| 960 | Ga0075435_100064738 | |||
| 961 | Ga0075435_100786950 | |||
| 962 | Ga0105240_10061052 | |||
| 963 | Ga0105240_10099400 | |||
| 964 | Ga0105240_10227646 | |||
| 965 | Ga0105240_10465146 | |||
| 966 | Ga0105240_10793002 | |||
| 967 | Ga0105240_12250690 | |||
| 968 | Ga0105245_10040524 | |||
| 969 | Ga0105245_10051571 | |||
| 970 | Ga0105245_10122482 | |||
| 971 | Ga0105245_10686217 | |||
| 972 | Ga0105245_11002447 | |||
| 973 | Ga0114129_10119783 | |||
| 974 | Ga0114129_10397853 | |||
| 975 | Ga0114129_10461223 | |||
| 976 | Ga0114129_11242441 | |||
| 977 | Ga0105243_10181986 | |||
| 978 | Ga0105243_10310718 | |||
| 979 | Ga0105243_11050426 | |||
| 980 | Ga0105241_10615659 | |||
| 981 | Ga0105242_10133186 | |||
| 982 | Ga0105242_10151976 | |||
| 983 | Ga0105237_10046647 | |||
| 984 | Ga0105238_10347766 | |||
| 985 | Ga0105238_11353581 | |||
| 986 | Ga0105249_10048178 | |||
| 987 | Ga0105249_10146985 | |||
| 988 | Ga0105249_10149139 | |||
| 989 | Ga0105239_10019915 | |||
| 990 | Ga0105239_10155029 | |||
| 991 | Ga0105239_10157729 | |||
| 992 | Ga0105246_10612037 | |||
| 993 | Ga0105246_10957268 | |||
| 994 | Ga0157325_1008432 | |||
| 995 | Ga0157321_1005684 | |||
| 996 | Ga0157373_10102639 | |||
| 997 | Ga0157373_10126113 | |||
| 998 | Ga0157373_10226484 | |||
| 999 | Ga0157371_10143827 | |||
| 1000 | Ga0157370_10018694 | |||
| 1001 | Ga0157370_10109603 | |||
| 1002 | Ga0157370_10356077 | |||
| 1003 | Ga0157370_10429379 | |||
| 1004 | Ga0157370_10464438 | |||
| 1005 | Ga0157370_10953144 | |||
| 1006 | Ga0157369_10002303 | |||
| 1007 | Ga0157369_10006178 | |||
| 1008 | Ga0157369_10012052 | |||
| 1009 | Ga0157369_10030501 | |||
| 1010 | Ga0157369_10061676 | |||
| 1011 | Ga0157369_10348917 | |||
| 1012 | Ga0157369_10393767 | |||
| 1013 | Ga0157369_11282794 | |||
| 1014 | Ga0157378_10172644 | |||
| 1015 | Ga0163162_10023066 | |||
| 1016 | Ga0163162_10179058 | |||
| 1017 | Ga0163162_11210419 | |||
| 1018 | Ga0163162_12537523 | |||
| 1019 | Ga0157372_10204328 | |||
| 1020 | Ga0157372_10329597 | |||
| 1021 | Ga0157372_11293649 | |||
| 1022 | Ga0157372_11374266 | |||
| 1023 | Ga0157372_11379033 | |||
| 1024 | Ga0157372_11500325 | |||
| 1025 | Ga0157372_13470130 | |||
| 1026 | Ga0157375_10119033 | |||
| 1027 | Ga0157375_10135997 | |||
| 1028 | Ga0157375_10324739 | |||
| 1029 | Ga0163163_10013038 | |||
| 1030 | Ga0157380_10146969 | |||
| 1031 | Ga0182008_10001010 | |||
| 1032 | Ga0182008_10085595 | |||
| 1033 | Ga0182008_10150851 | |||
| 1034 | Ga0182008_10919850 | |||
| 1035 | Ga0157377_10086977 | |||
| 1036 | Ga0182006_1016684 | |||
| 1037 | Ga0182007_10015408 | |||
| 1038 | Ga0163161_10016676 | |||
| 1039 | Ga0163161_10097993 | |||
| 1040 | Ga0163161_10431851 | |||
| 1041 | Ga0197907_10725116 | |||
| 1042 | Ga0206356_10240272 | |||
| 1043 | Ga0206356_10946499 | |||
| 1044 | Ga0206356_11704471 | |||
| 1045 | Ga0206354_10358543 | |||
| 1046 | Ga0206354_10477547 | |||
| 1047 | Ga0206354_10637849 | |||
| 1048 | Ga0206354_11240988 | |||
| 1049 | Ga0206353_10234536 | |||
| 1050 | Ga0206353_10804099 | |||
| 1051 | Ga0206353_11969477 | |||
| 1052 | Ga0213871_10148915 | |||
| 1053 | Ga0224712_10077727 | |||
| 1054 | Ga0207653_10015924 | |||
| 1055 | Ga0207692_10062056 | |||
| 1056 | Ga0207642_10030722 | |||
| 1057 | Ga0207688_11053151 | |||
| 1058 | Ga0207647_10422111 | |||
| 1059 | Ga0207699_10075966 | |||
| 1060 | Ga0207699_10208037 | |||
| 1061 | Ga0207705_10005200 | |||
| 1062 | Ga0207705_10209113 | |||
| 1063 | Ga0207705_10222330 | |||
| 1064 | Ga0207684_10150995 | |||
| 1065 | Ga0207684_10242473 | |||
| 1066 | Ga0207707_10080669 | |||
| 1067 | Ga0207707_10112059 | |||
| 1068 | Ga0207707_10224896 | |||
| 1069 | Ga0207707_10708860 | |||
| 1070 | Ga0207695_10097899 | |||
| 1071 | Ga0207695_10120036 | |||
| 1072 | Ga0207671_10154157 | |||
| 1073 | Ga0207693_10083211 | |||
| 1074 | Ga0207693_10298938 | |||
| 1075 | Ga0207693_10907481 | |||
| 1076 | Ga0207663_10280103 | |||
| 1077 | Ga0207663_10894330 | |||
| 1078 | Ga0207660_10074951 | |||
| 1079 | Ga0207660_10116430 | |||
| 1080 | Ga0207660_10254056 | |||
| 1081 | Ga0207660_10280935 | |||
| 1082 | Ga0207660_10617029 | |||
| 1083 | Ga0207660_10640965 | |||
| 1084 | Ga0207660_10755609 | |||
| 1085 | Ga0207660_10911716 | |||
| 1086 | Ga0207662_10029152 | |||
| 1087 | Ga0207657_10000388 | |||
| 1088 | Ga0207657_10010339 | |||
| 1089 | Ga0207657_10041066 | |||
| 1090 | Ga0207657_10083380 | |||
| 1091 | Ga0207657_10090125 | |||
| 1092 | Ga0207657_10102133 | |||
| 1093 | Ga0207657_10845407 | |||
| 1094 | Ga0207657_10889562 | |||
| 1095 | Ga0207657_11206898 | |||
| 1096 | Ga0207649_11569643 | |||
| 1097 | Ga0207652_10007590 | |||
| 1098 | Ga0207652_10061251 | |||
| 1099 | Ga0207652_10083152 | |||
| 1100 | Ga0207652_10091565 | |||
| 1101 | Ga0207652_10097733 | |||
| 1102 | Ga0207652_10307250 | |||
| 1103 | Ga0207652_10461065 | |||
| 1104 | Ga0207646_10660505 | |||
| 1105 | Ga0207646_11452729 | |||
| 1106 | Ga0207694_10207330 | |||
| 1107 | Ga0207694_10450495 | |||
| 1108 | Ga0207687_10168528 | |||
| 1109 | Ga0207687_10589877 | |||
| 1110 | Ga0207687_11256370 | |||
| 1111 | Ga0207700_10200310 | |||
| 1112 | Ga0207700_10571886 | |||
| 1113 | Ga0207664_10007814 | |||
| 1114 | Ga0207664_10022812 | |||
| 1115 | Ga0207664_10025226 | |||
| 1116 | Ga0207664_10058978 | |||
| 1117 | Ga0207664_10099886 | |||
| 1118 | Ga0207664_10169968 | |||
| 1119 | Ga0207664_10287848 | |||
| 1120 | Ga0207664_10338397 | |||
| 1121 | Ga0207644_10061440 | |||
| 1122 | Ga0207644_10343614 | |||
| 1123 | Ga0207690_10303491 | |||
| 1124 | Ga0207706_10009052 | |||
| 1125 | Ga0207706_10023685 | |||
| 1126 | Ga0207706_10088959 | |||
| 1127 | Ga0207686_10150293 | |||
| 1128 | Ga0207686_10174929 | |||
| 1129 | Ga0207709_10360677 | |||
| 1130 | Ga0207709_10531873 | |||
| 1131 | Ga0207669_11467807 | |||
| 1132 | Ga0207704_10119235 | |||
| 1133 | Ga0207704_10332509 | |||
| 1134 | Ga0207665_10478272 | |||
| 1135 | Ga0207689_10224937 | |||
| 1136 | Ga0207661_10030134 | |||
| 1137 | Ga0207661_10076157 | |||
| 1138 | Ga0207661_10121846 | |||
| 1139 | Ga0207661_10390781 | |||
| 1140 | Ga0207679_10738909 | |||
| 1141 | Ga0207679_11121957 | |||
| 1142 | Ga0207667_10014195 | |||
| 1143 | Ga0207667_10535524 | |||
| 1144 | Ga0207667_10700774 | |||
| 1145 | Ga0207651_10346454 | |||
| 1146 | Ga0207712_10309335 | |||
| 1147 | Ga0207668_10080642 | |||
| 1148 | Ga0207668_11171775 | |||
| 1149 | Ga0207640_10055421 | |||
| 1150 | Ga0207640_10086107 | |||
| 1151 | Ga0207640_10200078 | |||
| 1152 | Ga0207640_11426837 | |||
| 1153 | Ga0207658_10759062 | |||
| 1154 | Ga0207677_10054541 | |||
| 1155 | Ga0207677_10405126 | |||
| 1156 | Ga0207677_10726536 | |||
| 1157 | Ga0207677_11905665 | |||
| 1158 | Ga0207703_10496262 | |||
| 1159 | Ga0207639_10063676 | |||
| 1160 | Ga0207708_10037668 | |||
| 1161 | Ga0207702_10112952 | |||
| 1162 | Ga0207702_10193378 | |||
| 1163 | Ga0207702_10386042 | |||
| 1164 | Ga0207702_10451429 | |||
| 1165 | Ga0207702_10779296 | |||
| 1166 | Ga0207702_11203114 | |||
| 1167 | Ga0207702_11944980 | |||
| 1168 | Ga0207648_10002280 | |||
| 1169 | Ga0207648_10146569 | |||
| 1170 | Ga0207676_10665805 | |||
| 1171 | Ga0207674_10402805 | |||
| 1172 | Ga0207675_100000962 | |||
| 1173 | Ga0207675_100016465 | |||
| 1174 | Ga0207675_100472986 | |||
| 1175 | Ga0207683_10120432 | |||
| 1176 | Ga0207683_10134164 | |||
| 1177 | Ga0207698_10390674 | |||
| 1178 | Ga0207428_10009640 | |||
| 1179 | Ga0268265_10760841 | |||
| 1180 | Ga0268264_10221343 | |||
| 1181 | Ga0268264_10546650 | |||
| 1182 | Ga0265319_1137482 | |||
| 1183 | Ga0265334_10023620 | |||
| 1184 | Ga0265318_10002578 | |||
| 1185 | Ga0265318_10171486 | |||
| 1186 | Ga0265318_10330900 | |||
| 1187 | Ga0265318_10398728 | |||
| 1188 | Ga0265322_10032908 | |||
| 1189 | Ga0265336_10023824 | |||
| 1190 | Ga0265338_10007351 | |||
| 1191 | Ga0265338_10011362 | |||
| 1192 | Ga0265338_10223104 | |||
| 1193 | Ga0265338_10258498 | |||
| 1194 | Ga0265330_10122547 | |||
| 1195 | Ga0265320_10022368 | |||
| 1196 | Ga0265320_10189525 | |||
| 1197 | Ga0265320_10226301 | |||
| 1198 | Ga0265325_10057518 | |||
| 1199 | Ga0265340_10044224 | |||
| 1200 | Ga0265340_10114392 | |||
| 1201 | Ga0265339_10010628 | |||
| 1202 | Ga0265339_10098825 | |||
| 1203 | Ga0265339_10105639 | |||
| 1204 | Ga0265339_10164204 | |||
| 1205 | Ga0265327_10040184 | |||
| 1206 | Ga0265316_10005504 | |||
| 1207 | Ga0265316_10124633 | |||
| 1208 | Ga0265316_10264469 | |||
| 1209 | Ga0307408_100125368 | |||
| 1210 | Ga0307408_101425677 | |||
| 1211 | Ga0265313_10039611 | |||
| 1212 | Ga0265314_10013969 | |||
| 1213 | Ga0265314_10072160 | |||
| 1214 | Ga0265314_10466568 | |||
| 1215 | Ga0265342_10032409 | |||
| 1216 | Ga0265342_10066700 | |||
| 1217 | Ga0265342_10282914 | |||
| 1218 | Ga0307405_11315318 | |||
| 1219 | Ga0307406_10598243 | |||
| 1220 | Ga0307407_10503554 | |||
| 1221 | Ga0307412_10535733 | |||
| 1222 | Ga0307415_100196978 | |||
| 1223 | Ga0307415_100989864 | |||
| 1224 | Ga0373938_0148281 | |||
| 1225 | Ga0373944_0087505 | |||
| 1226 | Ga0373941_0044140 | |||
| 1227 | Ga0373946_0194208 | |||
| 1228 | Ga0373962_0019317 | |||
| 1229 | Ga0373962_0038575 | |||
| 1230 | Ga0373931_0304975 | |||
| 1231 | Ga0373931_0763117 | |||
| 1232 | Ga0373947_0000918 | |||
| 1233 | Ga0373947_0029763 | |||
| 1234 | Ga0373925_0169027 | |||
| 1235 | Ga0395899_0004887 | |||
| 1236 | Ga0395899_0009076 | |||
| 1237 | Ga0395899_0034242 | |||
| 1238 | Ga0395899_0104355 | |||
| 1239 | Ga0395900_0053378 | |||
| 1240 | Ga0395900_0087713 | |||
| 1241 | Ga0395900_0197714 | |||
| 1242 | Ga0395900_0239362 | |||
| 1243 | Ga0395900_0254506 | |||
| 1244 | Ga0395900_0397638 | |||
| 1245 | Ga0395900_0400346 | |||
| 1246 | Ga0395900_0438157 | |||
| 1247 | Ga0395900_0705694 | |||
| 1248 | Ga0395900_1460892 | |||
| 1249 | Ga0395898_0003001 | |||
| 1250 | Ga0395898_0037254 | |||
| 1251 | Ga0395898_0044034 | |||
| 1252 | Ga0395898_0143640 | |||
| 1253 | Ga0395898_0159219 | |||
| 1254 | Ga0395898_0180977 | |||
| 1255 | Ga0395898_0198660 | |||
| 1256 | Ga0395898_0524571 | |||
| 1257 | Ga0395898_0680017 | |||
| 1258 | Ga0395898_1132144 | |||
| 1259 | Ga0395898_1707056 | |||
| 1260 | Ga0395898_1865803 | |||
| 1261 | Ga0395905_0006030 | |||
| 1262 | Ga0395905_0046287 | |||
| 1263 | Ga0395905_0091348 | |||
| 1264 | Ga0395905_0169880 | |||
| 1265 | Ga0395905_0192572 | |||
| 1266 | Ga0395901_0033143 | |||
| 1267 | Ga0395901_0047926 | |||
| 1268 | Ga0395901_0080202 | |||
| 1269 | Ga0395901_0154805 | |||
| 1270 | Ga0395901_0161734 | |||
| 1271 | Ga0395901_0328377 | |||
| 1272 | Ga0395901_0351305 | |||
| 1273 | Ga0395901_0481439 | |||
| 1274 | Ga0395901_0550864 | |||
| 1275 | Ga0395901_0637691 | |||
| 1276 | Ga0395901_0850625 | |||
| 1277 | Ga0395901_1012343 | |||
| 1278 | Ga0395901_1280393 | |||
| 1279 | Ga0395901_1997657 | |||
| 1280 | Ga0242420_129380 | |||
| 1281 | Ga0436360_0975496 | |||
| 1282 | Ga0451853_0158545 | |||
| 1283 | Ga0466972_0213033 | |||
| 1284 | Ga0466972_0328302 | |||
| 1285 | Ga0466965_0145522 | |||
| 1286 | Ga0466966_0028061 | |||
| 1287 | Ga0466966_0180906 | |||
| 1288 | Ga0466966_0680627 | |||
| 1289 | Ga0466961_0003168 | |||
| 1290 | Ga0466961_0145035 | |||
| 1291 | Ga0466961_0621643 | |||
| 1292 | Ga0466963_0003845 | |||
| 1293 | Ga0466963_0005592 | |||
| 1294 | Ga0466963_0025377 | |||
| 1295 | Ga0466963_0046731 | |||
| 1296 | Ga0466963_0071351 | |||
| 1297 | Ga0466963_0071480 | |||
| 1298 | Ga0466963_0102783 | |||
| 1299 | Ga0466963_0160614 | |||
| 1300 | Ga0466963_0285925 | |||
| 1301 | Ga0466963_0432060 | |||
| 1302 | Ga0466963_0498225 | |||
| 1303 | Ga0466964_0056279 | |||
| 1304 | Ga0466964_0115300 | |||
| 1305 | Ga0466964_0141190 | |||
| 1306 | Ga0466964_0394775 | |||
| 1307 | Ga0466964_0484686 | |||
| 1308 | Ga0466964_0694294 | |||
| 1309 | Ga0466971_0018695 | |||
| 1310 | Ga0466971_0022425 | |||
| 1311 | Ga0466971_0024818 | |||
| 1312 | Ga0466971_0045941 | |||
| 1313 | Ga0466971_0185127 | |||
| 1314 | Ga0466971_0271397 | |||
| 1315 | Ga0466971_0497933 | |||
| 1316 | Ga0466968_0045555 | |||
| 1317 | Ga0466968_0214899 | |||
| 1318 | Ga0466970_0021149 | |||
| 1319 | Ga0466970_0157873 | |||
| 1320 | Ga0466957_0004517 | |||
| 1321 | Ga0466957_0036211 | |||
| 1322 | Ga0466957_0037927 | |||
| 1323 | Ga0466957_0060644 | |||
| 1324 | Ga0466957_0063369 | |||
| 1325 | Ga0466957_0255344 | |||
| 1326 | Ga0466957_0295586 | |||
| 1327 | Ga0466957_0645255 | |||
| 1328 | Ga0466957_0743127 | |||
| 1329 | Ga0466957_0859189 | |||
| 1330 | Ga0466960_0834068 | |||
| 1331 | Ga0466959_0341577 | |||
| 1332 | Ga0466959_1190682 | |||
| 1333 | Ga0451576_0171276 | |||
| 1334 | Ga0451576_0755929 | |||
| 1335 | Ga0451576_1869539 | |||
| 1336 | Ga0466958_0010746 | |||
| 1337 | Ga0466958_0011649 | |||
| 1338 | Ga0466958_0034402 | |||
| 1339 | Ga0466958_0041096 | |||
| 1340 | Ga0466958_0116942 | |||
| 1341 | Ga0466958_0253141 | |||
| 1342 | Ga0466958_0344353 | |||
| 1343 | Ga0466958_0346291 | |||
| 1344 | Ga0466958_0468958 | |||
| 1345 | Ga0466967_0005509 | |||
| 1346 | Ga0466967_0025009 | |||
| 1347 | Ga0466967_0031365 | |||
| 1348 | Ga0466967_0041018 | |||
| 1349 | Ga0466967_0046656 | |||
| 1350 | Ga0466967_0090183 | |||
| 1351 | Ga0466967_0100797 | |||
| 1352 | Ga0466967_0124924 | |||
| 1353 | Ga0466967_0168812 | |||
| 1354 | Ga0466967_0286870 | |||
| 1355 | Ga0466967_0485236 | |||
| 1356 | Ga0466967_0563109 | |||
| 1357 | Ga0466967_0653199 | |||
| 1358 | Ga0466967_0788411 | |||
| 1359 | Ga0495592_0330803 | |||
| 1360 | Ga0495603_0000315 | |||
| 1361 | Ga0495629_0075516 | |||
| 1362 | Ga0495629_0076374 | |||
| 1363 | Ga0495641_0002640 | |||
| 1364 | Ga0495641_0022803 | |||
| 1365 | Ga0495641_0297432 | |||
| 1366 | Ga0495653_0031425 | |||
| 1367 | Ga0495580_0279778 | |||
| 1368 | Ga0495582_0010033 | |||
| 1369 | Ga0495605_0416647 | |||
| 1370 | Ga0495639_0249185 | |||
| 1371 | Ga0495639_0652745 | |||
| 1372 | Ga0495584_0057441 | |||
| 1373 | Ga0495584_0097952 | |||
| 1374 | Ga0495584_0161974 | |||
| 1375 | Ga0495594_0001557 | |||
| 1376 | Ga0495594_0019914 | |||
| 1377 | Ga0495628_0269162 | |||
| 1378 | Ga0495630_0365748 | |||
| 1379 | Ga0495631_0358847 | |||
| 1380 | Ga0495663_0231165 | |||
| 1381 | Ga0495666_0029399 | |||
| 1382 | Ga0495652_0126969 | |||
| 1383 | Ga0495665_0107891 | |||
| 1384 | Ga0495586_0029827 | |||
| 1385 | Ga0495609_0108835 | |||
| 1386 | Ga0495621_0262656 | |||
| 1387 | Ga0495645_0520457 | |||
| 1388 | Ga0495622_0044021 | |||
| 1389 | Ga0495667_0104095 | |||
| 1390 | Ga0495656_0334170 | |||
| 1391 | Ga0495668_0202507 | |||
| 1392 | Ga0495668_0709142 | |||
| 1393 | Ga0495634_0123904 | |||
| 1394 | Ga0495634_0178818 | |||
| 1395 | Ga0495635_0339624 | |||
| 1396 | Ga0495659_0077440 | |||
| 1397 | Ga0495588_0001006 | |||
| 1398 | Ga0495657_0456238 | |||
| 1399 | Ga0495647_0001825 | |||
| 1400 | Ga0495647_0084839 | |||
| 1401 | Ga0495658_0046804 | |||
| 1402 | Ga0495613_0078401 | |||
| 1403 | Ga0495613_0168991 | |||
| 1404 | Ga0495600_0120450 | |||
| 1405 | Ga0495581_0168860 | |||
| 1406 | Ga0495581_0332045 | |||
| 1407 | Ga0495604_0133708 | |||
| 1408 | Ga0495674_0146217 | |||
| 1409 | Ga0495676_0056087 | |||
| 1410 | Ga0495676_0080563 | |||
| 1411 | Ga0495680_0397953 | |||
| 1412 | Ga0495684_0389441 | |||
| 1413 | Ga0495593_0082362 | |||
| 1414 | Ga0495602_0706429 | |||
| 1415 | Ga0496100_0128246 | |||
| 1416 | Ga0496100_0266342 | |||
| 1417 | Ga0496101_0017380 | |||
| 1418 | Ga0496101_0178131 | |||
| 1419 | Ga0496101_0343955 | |||
| 1420 | Ga0496102_0122377 | |||
| 1421 | Ga0496102_0201641 | |||
| 1422 | Ga0496102_0307827 | |||
| 1423 | Ga0496103_0114775 | |||
| 1424 | Ga0496103_0258570 | |||
| 1425 | Ga0496103_0306261 | |||
| 1426 | Ga0496104_0005360 | |||
| 1427 | Ga0496104_0039743 | |||
| 1428 | Ga0496104_0313705 | |||
| 1429 | Ga0496104_0661872 | |||
| 1430 | Ga0496104_1072165 | |||
| 1431 | Ga0496105_0003157 | |||
| 1432 | Ga0496105_0147064 | |||
| 1433 | Ga0496105_0483997 | |||
| 1434 | Ga0496105_0744832 | |||
| 1435 | Ga0496106_0001856 | |||
| 1436 | Ga0496106_0267337 | |||
| 1437 | Ga0496106_0336544 | |||
| 1438 | Ga0496106_1498883 | |||
| 1439 | Ga0496107_0029123 | |||
| 1440 | Ga0496107_0173205 | |||
| 1441 | Ga0496108_0015483 | |||
| 1442 | Ga0496108_0054439 | |||
| 1443 | Ga0496108_0165659 | |||
| 1444 | Ga0496108_0457624 | |||
| 1445 | Ga0496108_0458672 | |||
| 1446 | Ga0496108_0860132 | |||
| 1447 | Ga0496109_0016861 | |||
| 1448 | Ga0496109_0061176 | |||
| 1449 | Ga0496109_0086040 | |||
| 1450 | Ga0496109_0100769 | |||
| 1451 | Ga0496109_0128873 | |||
| 1452 | Ga0496109_0130074 | |||
| 1453 | Ga0496109_0546121 | |||
| 1454 | Ga0496110_0003586 | |||
| 1455 | Ga0496110_0009997 | |||
| 1456 | Ga0496110_0014829 | |||
| 1457 | Ga0496110_0181900 | |||
| 1458 | Ga0496110_0241981 | |||
| 1459 | Ga0496111_0004255 | |||
| 1460 | Ga0496111_0010141 | |||
| 1461 | Ga0496111_0323827 | |||
| 1462 | Ga0496112_0000307 | |||
| 1463 | Ga0496112_0022546 | |||
| 1464 | Ga0496112_0028506 | |||
| 1465 | Ga0496112_0047386 | |||
| 1466 | Ga0496112_0107315 | |||
| 1467 | Ga0496112_0208500 | |||
| 1468 | Ga0496112_0309667 | |||
| 1469 | Ga0496112_0442967 | |||
| 1470 | Ga0496112_0475203 | |||
| 1471 | Ga0496112_0969410 | |||
| 1472 | Ga0496112_1005770 | |||
| 1473 | Ga0496112_1920347 | |||
| 1474 | Ga0496113_0000192 | |||
| 1475 | Ga0496113_0021667 | |||
| 1476 | Ga0496113_0187245 | |||
| 1477 | Ga0496113_0187751 | |||
| 1478 | Ga0496113_0214715 | |||
| 1479 | Ga0496114_0068553 | |||
| 1480 | Ga0496114_0116450 | |||
| 1481 | Ga0496114_0732730 | |||
| 1482 | Ga0496115_0042155 | |||
| 1483 | Ga0496115_0194156 | |||
| 1484 | Ga0501034_0051076 | |||
| 1485 | Ga0501041_0109290 | |||
| 1486 | Ga0501043_0727036 | |||
| 1487 | Ga0501046_0972302 | |||
| 1488 | Ga0501048_0384956 | |||
| 1489 | Ga0501067_0086812 | |||
| 1490 | Ga0501067_0177230 | |||
| 1491 | Ga0501067_0569895 | |||
| 1492 | Ga0501068_0738751 | |||
| 1493 | Ga0501068_0915609 | |||
| 1494 | Ga0501068_1113612 | |||
| 1495 | Ga0501069_0123102 | |||
| 1496 | Ga0501070_0002719 | |||
| 1497 | Ga0501070_0007864 | |||
| 1498 | Ga0501072_0095044 | |||
| 1499 | Ga0501072_0467823 | |||
| 1500 | Ga0501073_0025021 | |||
| 1501 | Ga0501073_0710240 | |||
| 1502 | Ga0501074_0000736 | |||
| 1503 | Ga0501074_0056120 | |||
| 1504 | Ga0501074_0134059 | |||
| 1505 | Ga0501075_0180259 | |||
| 1506 | Ga0501079_0090973 | |||
| 1507 | Ga0501079_0151104 | |||
| 1508 | Ga0501080_0000499 | |||
| 1509 | Ga0501080_0008878 | |||
| 1510 | Ga0501083_0000893 | |||
| 1511 | Ga0501035_1296154 | |||
| 1512 | nmdc:mga05p37_349744_c1 | |||
| 1513 | nmdc:mga05p37_4070_c1 | |||
| 1514 | nmdc:mga05p37_51178_c1 | |||
| 1515 | nmdc:mga09592_159327_c1 | |||
| 1516 | nmdc:mga06r32_499587_c1 | |||
| 1517 | nmdc:mga06r32_88253_c1 | |||
| 1518 | nmdc:mga08y16_1645879_c1 | |||
| 1519 | nmdc:mga0n895_38057_c1 | |||
| 1520 | nmdc:mga0rr50_1387720_c1 | |||
| 1521 | nmdc:mga0rr50_29022_c1 | |||
| 1522 | nmdc:mga08x19_212835_c1 | |||
| 1523 | nmdc:mga08x19_454491_c1 | |||
| 1524 | nmdc:mga08x19_972390_c1 | |||
| 1525 | nmdc:mga0a205_1404869_c1 | |||
| 1526 | nmdc:mga0a205_34720_c1 | |||
| 1527 | Ga0495601_0833559 | |||
| 1528 | Ga0495655_0027026 | |||
| 1529 | Ga0495595_0182394 | |||
| 1530 | Ga0495595_0507152 | |||
| 1531 | Ga0495619_0011494 | |||
| 1532 | Ga0500566_0262559 | |||
| 1533 | Ga0501084_0998500 | |||
| 1534 | Ga0501082_0309379 | |||
| 1535 | Ga0501082_0345127 | |||
| 1536 | Ga0466962_0020288 | |||
| 1537 | Ga0466962_0039457 | |||
| 1538 | Ga0466962_0109376 | |||
| 1539 | Ga0466962_0336536 | |||
| 1540 | Ga0530510_0349355 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy