F480003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 769 | 502 | 610 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0002088|Ga0495605_0002088_10531_11013 |
| Length | 160 |
| Sequence | LTFPPLPRYRTVDDMRRNRMTSPAYDDTNIFAKILRAEIPSHRVYEDEHTVALMDVMPQAPGHVLVVPKAPSRNIFDADPAVLSRTIPVVQKIANAVKEAFDADGVLVCQFNEPVAGQTIFHLHFHVIPRHEGVALKPHSGKMEDGAVLAANAEKIRAEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 6 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 7 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 8 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 11 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 12 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 17 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 18 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 19 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 20 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 21 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 22 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 23 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 24 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 25 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 26 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 27 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 28 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 29 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 30 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 31 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 32 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 33 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 34 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 35 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 36 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 37 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 38 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 39 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 40 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 41 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 42 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 43 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 44 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 45 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 46 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 47 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 48 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 49 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 50 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 51 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 52 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 53 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 54 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 55 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 56 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 57 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 58 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 59 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 60 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 61 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 62 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 63 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 64 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 65 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 66 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 67 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 68 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 69 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 70 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 71 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 72 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 73 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 74 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 75 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 76 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 77 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 78 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 79 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 80 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 81 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 82 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 83 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 84 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 85 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 86 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 87 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 88 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 89 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 90 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 91 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 92 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 93 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 94 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 95 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 96 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 97 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 98 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 99 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 100 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 101 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 102 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 103 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 104 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 105 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 106 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 107 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 108 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 109 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 110 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 111 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 112 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 113 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 114 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 115 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 116 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 117 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 118 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 119 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 120 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 121 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 122 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 123 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 124 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 125 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 126 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 127 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 128 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 129 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 130 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 131 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 132 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 133 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 134 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 135 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 136 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 137 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 138 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 139 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 140 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 141 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 142 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 143 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 144 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 145 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 146 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 147 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 148 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 149 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 150 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 151 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 152 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 153 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 154 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 155 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 156 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 157 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 160 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 161 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 162 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 163 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 164 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 165 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 178 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 180 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 182 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 185 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 186 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 187 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 188 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 189 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 191 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 192 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 193 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 194 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 195 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 196 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 197 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 198 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 199 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 200 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 201 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 202 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 203 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 204 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 214 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 215 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 218 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 223 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 225 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 226 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 227 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 228 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 229 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 230 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 231 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 241 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 244 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 270 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 276 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 278 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 279 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 280 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 285 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 286 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 288 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 289 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 290 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 292 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 302 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 310 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 314 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 315 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 316 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 317 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 320 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 321 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 322 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 323 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 324 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 328 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 329 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 330 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 333 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 334 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 335 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 402 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 411 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 412 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 413 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 414 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 415 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 416 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 417 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 418 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 419 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 420 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 421 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 422 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 435 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 442 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 455 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 456 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 457 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 459 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 460 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 461 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 462 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 463 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 466 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 468 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 470 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 474 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 476 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 477 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 481 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 483 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 484 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 485 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 487 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 488 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 489 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 490 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 491 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 492 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 493 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 494 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 495 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 496 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 497 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 498 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 499 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 500 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 501 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 502 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.41 |
| Metatranscriptomes | 0.91 |
| Isolates | 20.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.62 |
| Nodule | 14.3 |
| Rhizoplane | 3.12 |
| Rhizosphere | 40.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10228874 | 3300001989 | Bacteria | 545 |
| 2 | JGI24735J21928_10120957 | 3300002067 | Bacteria | 754 |
| 3 | JGI25158J39367_1000203 | 3300002739 | Bacteria | 14163 |
| 4 | JGI25152J39213_1007422 | 3300002773 | Bacteria | 2840 |
| 5 | JGI25152J39213_1010980 | 3300002773 | Bacteria | 2030 |
| 6 | JGI25152J39213_1011625 | 3300002773 | Bacteria | 1938 |
| 7 | JGI25150J39212_1000010 | 3300002774 | Bacteria | 236260 |
| 8 | JGI25150J39212_1002390 | 3300002774 | Bacteria | 4700 |
| 9 | JGI25159J45721_1000375 | 3300002987 | Bacteria | 20707 |
| 10 | JGI25159J45721_1001546 | 3300002987 | Bacteria | 9427 |
| 11 | JGI25151J46595_10000963 | 3300003187 | Bacteria | 21956 |
| 12 | JGI25151J46595_10023401 | 3300003187 | Bacteria | 2546 |
| 13 | JGI25151J46595_10023768 | 3300003187 | Bacteria | 2517 |
| 14 | JGI25151J46595_10123433 | 3300003187 | Bacteria | 656 |
| 15 | JGI25165J46597_1001522 | 3300003214 | Bacteria | 11697 |
| 16 | JGI25165J46597_1003278 | 3300003214 | Bacteria | 4175 |
| 17 | JGI25153J46596_10001154 | 3300003215 | Bacteria | 15990 |
| 18 | JGI25153J46596_10010280 | 3300003215 | Bacteria | 4250 |
| 19 | JGI25153J46596_10011377 | 3300003215 | Bacteria | 3936 |
| 20 | JGI25153J46596_10026844 | 3300003215 | Bacteria | 2030 |
| 21 | JGI25153J46596_10028546 | 3300003215 | Bacteria | 1932 |
| 22 | JGI25153J46596_10065176 | 3300003215 | Bacteria | 969 |
| 23 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 24 | JGI25160J50197_1001476 | 3300003354 | Bacteria | 11707 |
| 25 | JGI25160J50197_1003985 | 3300003354 | Bacteria | 6443 |
| 26 | JGI25160J50197_1006150 | 3300003354 | Bacteria | 4888 |
| 27 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 28 | JGI25161J50226_1000053 | 3300003374 | Bacteria | 106635 |
| 29 | Ga0006562J51391_1167839 | 3300003578 | Bacteria | 554 |
| 30 | Ga0055539_1005927 | 3300003752 | Bacteria | 1575 |
| 31 | Ga0055525_1013677 | 3300003759 | Bacteria | 687 |
| 32 | Ga0055526_1002763 | 3300003771 | Bacteria | 11629 |
| 33 | Ga0055526_1004529 | 3300003771 | Bacteria | 8309 |
| 34 | Ga0055526_1011035 | 3300003771 | Bacteria | 4124 |
| 35 | Ga0055526_1012038 | 3300003771 | Bacteria | 3821 |
| 36 | Ga0055524_1002391 | 3300003775 | Bacteria | 9723 |
| 37 | Ga0055524_1005341 | 3300003775 | Bacteria | 5758 |
| 38 | Ga0055524_1026057 | 3300003775 | Bacteria | 1817 |
| 39 | Ga0055524_1096043 | 3300003775 | Bacteria | 504 |
| 40 | Ga0055536_1019995 | 3300003781 | Bacteria | 2084 |
| 41 | Ga0055528_1001259 | 3300003790 | Bacteria | 16042 |
| 42 | Ga0055528_1007090 | 3300003790 | Bacteria | 5004 |
| 43 | Ga0055528_1008280 | 3300003790 | Bacteria | 4485 |
| 44 | Ga0055528_1015143 | 3300003790 | Bacteria | 2802 |
| 45 | Ga0055528_1045324 | 3300003790 | Bacteria | 938 |
| 46 | Ga0055528_1085874 | 3300003790 | Bacteria | 546 |
| 47 | Ga0055540_1004558 | 3300003792 | Bacteria | 6171 |
| 48 | Ga0055531_10001389 | 3300003794 | Bacteria | 17933 |
| 49 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 50 | Ga0055543_1000019 | 3300004625 | Bacteria | 161035 |
| 51 | Ga0055543_1022175 | 3300004625 | Bacteria | 1153 |
| 52 | Ga0065165_1000049 | 3300005262 | Bacteria | 195588 |
| 53 | Ga0065165_1003862 | 3300005262 | Bacteria | 9948 |
| 54 | Ga0065165_1016822 | 3300005262 | Bacteria | 2721 |
| 55 | Ga0065165_1059498 | 3300005262 | Bacteria | 1051 |
| 56 | Ga0070682_100363514 | 3300005337 | Bacteria | 1083 |
| 57 | Ga0070660_100123844 | 3300005339 | Bacteria | 2064 |
| 58 | Ga0070668_100523386 | 3300005347 | Bacteria | 1029 |
| 59 | Ga0070669_100202824 | 3300005353 | Bacteria | 1561 |
| 60 | Ga0070671_100009983 | 3300005355 | Bacteria | 7623 |
| 61 | Ga0070713_100082608 | 3300005436 | Bacteria | 2744 |
| 62 | Ga0070713_100872313 | 3300005436 | Bacteria | 865 |
| 63 | Ga0070663_100171354 | 3300005455 | Bacteria | 1678 |
| 64 | Ga0070662_101780103 | 3300005457 | Bacteria | 532 |
| 65 | Ga0070681_10071247 | 3300005458 | Bacteria | 3440 |
| 66 | Ga0070681_11243662 | 3300005458 | Bacteria | 667 |
| 67 | Ga0070706_100111430 | 3300005467 | Bacteria | 2546 |
| 68 | Ga0070684_100005060 | 3300005535 | Bacteria | 10067 |
| 69 | Ga0070697_100587092 | 3300005536 | Bacteria | 979 |
| 70 | Ga0068853_100342420 | 3300005539 | Bacteria | 1389 |
| 71 | Ga0070665_100124357 | 3300005548 | Bacteria | 2581 |
| 72 | Ga0070665_100147810 | 3300005548 | Bacteria | 2353 |
| 73 | Ga0068855_100421029 | 3300005563 | Bacteria | 1461 |
| 74 | Ga0070664_100855390 | 3300005564 | Bacteria | 852 |
| 75 | Ga0068857_100340023 | 3300005577 | Bacteria | 1388 |
| 76 | Ga0068856_100278750 | 3300005614 | Bacteria | 1688 |
| 77 | Ga0068856_100353269 | 3300005614 | Bacteria | 1488 |
| 78 | Ga0068856_101385914 | 3300005614 | Bacteria | 718 |
| 79 | Ga0068852_100707979 | 3300005616 | Bacteria | 1017 |
| 80 | Ga0068852_101551755 | 3300005616 | Bacteria | 685 |
| 81 | Ga0068864_100940407 | 3300005618 | Bacteria | 855 |
| 82 | Ga0068851_10229384 | 3300005834 | Bacteria | 1046 |
| 83 | Ga0068863_100937866 | 3300005841 | Bacteria | 867 |
| 84 | Ga0068858_100146089 | 3300005842 | Bacteria | 2221 |
| 85 | Ga0081540_1123679 | 3300005983 | Bacteria | 1068 |
| 86 | Ga0070717_10006449 | 3300006028 | Bacteria | 8633 |
| 87 | Ga0075365_10001979 | 3300006038 | Bacteria | 9686 |
| 88 | Ga0075365_10157443 | 3300006038 | Bacteria | 1581 |
| 89 | Ga0075365_10230129 | 3300006038 | Bacteria | 1301 |
| 90 | Ga0075365_10316749 | 3300006038 | Bacteria | 1098 |
| 91 | Ga0075368_10012039 | 3300006042 | Bacteria | 3159 |
| 92 | Ga0075368_10058033 | 3300006042 | Bacteria | 1546 |
| 93 | Ga0075363_100476658 | 3300006048 | Bacteria | 739 |
| 94 | Ga0075364_10009825 | 3300006051 | Bacteria | 5754 |
| 95 | Ga0075367_10037815 | 3300006178 | Bacteria | 2806 |
| 96 | Ga0075367_10239480 | 3300006178 | Bacteria | 1137 |
| 97 | Ga0075367_10341743 | 3300006178 | Bacteria | 944 |
| 98 | Ga0075369_10029415 | 3300006186 | Bacteria | 2307 |
| 99 | Ga0075369_10208988 | 3300006186 | Bacteria | 902 |
| 100 | Ga0075370_10044632 | 3300006353 | Bacteria | 2506 |
| 101 | Ga0075370_10173705 | 3300006353 | Bacteria | 1267 |
| 102 | Ga0075370_10292582 | 3300006353 | Bacteria | 968 |
| 103 | Ga0075428_100079024 | 3300006844 | Bacteria | 3590 |
| 104 | Ga0075431_100016823 | 3300006847 | Bacteria | 7428 |
| 105 | Ga0075429_100099505 | 3300006880 | Bacteria | 2537 |
| 106 | Ga0075436_100085391 | 3300006914 | Bacteria | 2191 |
| 107 | Ga0099825_1029852 | 3300006941 | Bacteria | 2480 |
| 108 | Ga0099824_1009133 | 3300006942 | Bacteria | 12334 |
| 109 | Ga0099794_10147829 | 3300007265 | Bacteria | 1192 |
| 110 | Ga0105251_10024498 | 3300009011 | Bacteria | 3099 |
| 111 | Ga0105244_10289759 | 3300009036 | Bacteria | 759 |
| 112 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 113 | Ga0105240_10014824 | 3300009093 | Bacteria | 10624 |
| 114 | Ga0105240_10950532 | 3300009093 | Bacteria | 922 |
| 115 | Ga0111539_10784921 | 3300009094 | Bacteria | 1109 |
| 116 | Ga0105247_10093931 | 3300009101 | Bacteria | 1907 |
| 117 | Ga0105247_10170980 | 3300009101 | Bacteria | 1445 |
| 118 | Ga0114129_10246561 | 3300009147 | Bacteria | 2399 |
| 119 | Ga0105248_10312069 | 3300009177 | Bacteria | 1771 |
| 120 | Ga0105248_10892933 | 3300009177 | Bacteria | 1003 |
| 121 | Ga0105237_10001912 | 3300009545 | Bacteria | 26585 |
| 122 | Ga0105237_10584035 | 3300009545 | Bacteria | 1124 |
| 123 | Ga0105237_11133290 | 3300009545 | Bacteria | 789 |
| 124 | Ga0105238_10184478 | 3300009551 | Bacteria | 2063 |
| 125 | Ga0105238_10304692 | 3300009551 | Bacteria | 1577 |
| 126 | Ga0105238_10927254 | 3300009551 | Bacteria | 890 |
| 127 | Ga0123342_1014422 | 3300009766 | Bacteria | 7541 |
| 128 | Ga0099796_10004763 | 3300010159 | Bacteria | 3316 |
| 129 | Ga0099796_10377253 | 3300010159 | Bacteria | 617 |
| 130 | Ga0105239_10025467 | 3300010375 | Bacteria | 6513 |
| 131 | Ga0105239_10094741 | 3300010375 | Bacteria | 3298 |
| 132 | Ga0105239_10516678 | 3300010375 | Bacteria | 1358 |
| 133 | Ga0105239_10663501 | 3300010375 | Bacteria | 1191 |
| 134 | Ga0105246_12444512 | 3300011119 | Bacteria | 513 |
| 135 | Ga0157326_1045089 | 3300012513 | Bacteria | 631 |
| 136 | Ga0157370_10012298 | 3300013104 | Bacteria | 8883 |
| 137 | Ga0157369_10004236 | 3300013105 | Bacteria | 16992 |
| 138 | Ga0157369_10015990 | 3300013105 | Bacteria | 8443 |
| 139 | Ga0157369_10177932 | 3300013105 | Bacteria | 2239 |
| 140 | Ga0157372_10102460 | 3300013307 | Bacteria | 3270 |
| 141 | Ga0157372_10145587 | 3300013307 | Bacteria | 2732 |
| 142 | Ga0163163_10795249 | 3300014325 | Bacteria | 1009 |
| 143 | Ga0163163_10900814 | 3300014325 | Bacteria | 948 |
| 144 | Ga0182008_10135671 | 3300014497 | Bacteria | 1229 |
| 145 | Ga0182005_1003211 | 3300015265 | Bacteria | 5594 |
| 146 | Ga0197907_10585868 | 3300020069 | Bacteria | 937 |
| 147 | Ga0206353_10443739 | 3300020082 | Bacteria | 1558 |
| 148 | Ga0206353_10983039 | 3300020082 | Bacteria | 1335 |
| 149 | Ga0213873_10010836 | 3300021358 | Bacteria | 1933 |
| 150 | Ga0213872_10113317 | 3300021361 | Bacteria | 1203 |
| 151 | Ga0213876_10010189 | 3300021384 | Bacteria | 5049 |
| 152 | Ga0213876_10275880 | 3300021384 | Bacteria | 894 |
| 153 | Ga0213876_10487603 | 3300021384 | Bacteria | 656 |
| 154 | Ga0213871_10057762 | 3300021441 | Bacteria | 1075 |
| 155 | Ga0224712_10072294 | 3300022467 | Bacteria | 1404 |
| 156 | Ga0224712_10102193 | 3300022467 | Bacteria | 1217 |
| 157 | Ga0209436_101419 | 3300025208 | Bacteria | 8408 |
| 158 | Ga0209436_102492 | 3300025208 | Bacteria | 5503 |
| 159 | Ga0209563_107655 | 3300025230 | Bacteria | 1757 |
| 160 | Ga0209437_100153 | 3300025233 | Bacteria | 154068 |
| 161 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 162 | Ga0207425_1001355 | 3300025245 | Bacteria | 10461 |
| 163 | Ga0207425_1016225 | 3300025245 | Bacteria | 1656 |
| 164 | Ga0207425_1022286 | 3300025245 | Bacteria | 1336 |
| 165 | Ga0209677_104516 | 3300025253 | Bacteria | 3979 |
| 166 | Ga0209129_1000099 | 3300025258 | Bacteria | 162471 |
| 167 | Ga0209129_1001480 | 3300025258 | Bacteria | 13053 |
| 168 | Ga0209129_1003212 | 3300025258 | Bacteria | 7299 |
| 169 | Ga0209129_1003724 | 3300025258 | Bacteria | 6454 |
| 170 | Ga0209233_1000603 | 3300025261 | Bacteria | 18548 |
| 171 | Ga0209233_1001023 | 3300025261 | Bacteria | 11892 |
| 172 | Ga0209233_1004384 | 3300025261 | Bacteria | 4809 |
| 173 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 174 | Ga0209673_1000456 | 3300025273 | Bacteria | 69267 |
| 175 | Ga0209673_1004030 | 3300025273 | Bacteria | 8133 |
| 176 | Ga0209673_1007166 | 3300025273 | Bacteria | 5207 |
| 177 | Ga0209673_1026893 | 3300025273 | Bacteria | 1881 |
| 178 | Ga0209673_1029066 | 3300025273 | Bacteria | 1766 |
| 179 | Ga0209673_1109705 | 3300025273 | Bacteria | 579 |
| 180 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 181 | Ga0209130_1000097 | 3300025284 | Bacteria | 143750 |
| 182 | Ga0209130_1034284 | 3300025284 | Bacteria | 1023 |
| 183 | Ga0209675_1042390 | 3300025291 | Bacteria | 987 |
| 184 | Ga0209676_1003690 | 3300025292 | Bacteria | 9152 |
| 185 | Ga0209676_1018072 | 3300025292 | Bacteria | 2470 |
| 186 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 187 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 188 | Ga0209025_1017508 | 3300025294 | Bacteria | 4129 |
| 189 | Ga0209025_1027572 | 3300025294 | Bacteria | 2813 |
| 190 | Ga0209025_1040416 | 3300025294 | Bacteria | 2017 |
| 191 | Ga0209025_1041227 | 3300025294 | Bacteria | 1981 |
| 192 | Ga0209025_1144202 | 3300025294 | Bacteria | 669 |
| 193 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 194 | Ga0209564_1000453 | 3300025295 | Bacteria | 69474 |
| 195 | Ga0209564_1002007 | 3300025295 | Bacteria | 17768 |
| 196 | Ga0209564_1005994 | 3300025295 | Bacteria | 6719 |
| 197 | Ga0209564_1010984 | 3300025295 | Bacteria | 4107 |
| 198 | Ga0209564_1049204 | 3300025295 | Bacteria | 1045 |
| 199 | Ga0209758_1000086 | 3300025297 | Bacteria | 254778 |
| 200 | Ga0209758_1000138 | 3300025297 | Bacteria | 175187 |
| 201 | Ga0209758_1002381 | 3300025297 | Bacteria | 19357 |
| 202 | Ga0209758_1004908 | 3300025297 | Bacteria | 10753 |
| 203 | Ga0209758_1010556 | 3300025297 | Bacteria | 5506 |
| 204 | Ga0209758_1010888 | 3300025297 | Bacteria | 5359 |
| 205 | Ga0209758_1011376 | 3300025297 | Bacteria | 5164 |
| 206 | Ga0209256_1000836 | 3300025299 | Bacteria | 38702 |
| 207 | Ga0209256_1001416 | 3300025299 | Bacteria | 24924 |
| 208 | Ga0209256_1006050 | 3300025299 | Bacteria | 6603 |
| 209 | Ga0209256_1009939 | 3300025299 | Bacteria | 4078 |
| 210 | Ga0209256_1018071 | 3300025299 | Bacteria | 2311 |
| 211 | Ga0209256_1024619 | 3300025299 | Bacteria | 1769 |
| 212 | Ga0209256_1026897 | 3300025299 | Bacteria | 1648 |
| 213 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 214 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 215 | Ga0207426_1000854 | 3300025302 | Bacteria | 32034 |
| 216 | Ga0207426_1070433 | 3300025302 | Bacteria | 977 |
| 217 | Ga0209051_1005436 | 3300025303 | Bacteria | 7448 |
| 218 | Ga0209051_1011889 | 3300025303 | Bacteria | 4256 |
| 219 | Ga0209257_1015246 | 3300025304 | Bacteria | 3217 |
| 220 | Ga0209257_1033722 | 3300025304 | Bacteria | 1606 |
| 221 | Ga0207656_10162050 | 3300025321 | Bacteria | 1065 |
| 222 | Ga0207710_10562915 | 3300025900 | Bacteria | 594 |
| 223 | Ga0207680_10811944 | 3300025903 | Bacteria | 670 |
| 224 | Ga0207647_10009466 | 3300025904 | Bacteria | 6921 |
| 225 | Ga0207705_10509204 | 3300025909 | Bacteria | 935 |
| 226 | Ga0207684_10169069 | 3300025910 | Bacteria | 1884 |
| 227 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 228 | Ga0207695_10119024 | 3300025913 | Bacteria | 2612 |
| 229 | Ga0207695_10218040 | 3300025913 | Bacteria | 1816 |
| 230 | Ga0207671_10017031 | 3300025914 | Bacteria | 5621 |
| 231 | Ga0207671_10287327 | 3300025914 | Bacteria | 1298 |
| 232 | Ga0207671_10689966 | 3300025914 | Bacteria | 812 |
| 233 | Ga0207649_10859823 | 3300025920 | Bacteria | 710 |
| 234 | Ga0207681_11072352 | 3300025923 | Bacteria | 676 |
| 235 | Ga0207694_10867041 | 3300025924 | Bacteria | 763 |
| 236 | Ga0207694_11101795 | 3300025924 | Bacteria | 672 |
| 237 | Ga0207694_11146646 | 3300025924 | Bacteria | 658 |
| 238 | Ga0207700_10134681 | 3300025928 | Bacteria | 2022 |
| 239 | Ga0207644_10046192 | 3300025931 | Bacteria | 3101 |
| 240 | Ga0207665_10815413 | 3300025939 | Bacteria | 738 |
| 241 | Ga0207711_10616777 | 3300025941 | Bacteria | 1012 |
| 242 | Ga0207711_10678077 | 3300025941 | Bacteria | 961 |
| 243 | Ga0207658_11629899 | 3300025986 | Bacteria | 590 |
| 244 | Ga0207639_10056367 | 3300026041 | Bacteria | 3012 |
| 245 | Ga0207639_10314688 | 3300026041 | Bacteria | 1388 |
| 246 | Ga0207678_10137526 | 3300026067 | Bacteria | 2084 |
| 247 | Ga0207702_10096960 | 3300026078 | Bacteria | 2594 |
| 248 | Ga0207698_11071290 | 3300026142 | Bacteria | 818 |
| 249 | Ga0209389_1000068 | 3300027296 | Bacteria | 98954 |
| 250 | Ga0209489_115015 | 3300027361 | Bacteria | 5028 |
| 251 | Ga0209700_100117 | 3300027363 | Bacteria | 115595 |
| 252 | Ga0209813_10068141 | 3300027866 | Bacteria | 1151 |
| 253 | Ga0209813_10305543 | 3300027866 | Bacteria | 619 |
| 254 | Ga0268266_10103826 | 3300028379 | Bacteria | 2509 |
| 255 | Ga0268266_10113172 | 3300028379 | Bacteria | 2406 |
| 256 | Ga0268266_10170818 | 3300028379 | Bacteria | 1973 |
| 257 | Ga0268266_10732581 | 3300028379 | Bacteria | 954 |
| 258 | Ga0265337_1028868 | 3300028556 | Bacteria | 1662 |
| 259 | Ga0265319_1013066 | 3300028563 | Bacteria | 3323 |
| 260 | Ga0265334_10049583 | 3300028573 | Bacteria | 1614 |
| 261 | Ga0265323_10020524 | 3300028653 | Bacteria | 2543 |
| 262 | Ga0265336_10002573 | 3300028666 | Bacteria | 7416 |
| 263 | Ga0307515_10000274 | 3300028794 | Bacteria | 126011 |
| 264 | Ga0265338_10000306 | 3300028800 | Bacteria | 88631 |
| 265 | Ga0265324_10031006 | 3300029957 | Bacteria | 1874 |
| 266 | Ga0265770_1032771 | 3300030878 | Bacteria | 878 |
| 267 | Ga0265339_10002239 | 3300031249 | Bacteria | 13983 |
| 268 | Ga0265339_10012914 | 3300031249 | Bacteria | 5076 |
| 269 | Ga0307513_10130415 | 3300031456 | Bacteria | 2460 |
| 270 | Ga0316579_10364317 | 3300031691 | Bacteria | 699 |
| 271 | Ga0265314_10006693 | 3300031711 | Bacteria | 10126 |
| 272 | Ga0265314_10016806 | 3300031711 | Bacteria | 5765 |
| 273 | Ga0265342_10002241 | 3300031712 | Bacteria | 16904 |
| 274 | Ga0316576_10207246 | 3300031727 | Bacteria | 1476 |
| 275 | Ga0316578_10016183 | 3300031728 | Bacteria | 4031 |
| 276 | Ga0307405_10145326 | 3300031731 | Bacteria | 1660 |
| 277 | Ga0307405_11872842 | 3300031731 | Bacteria | 535 |
| 278 | Ga0307406_10815341 | 3300031901 | Bacteria | 788 |
| 279 | Ga0307412_10006135 | 3300031911 | Bacteria | 6773 |
| 280 | Ga0307412_10516612 | 3300031911 | Bacteria | 997 |
| 281 | Ga0307510_10005071 | 3300033180 | Bacteria | 15630 |
| 282 | Ga0373950_0007064 | 3300034818 | Bacteria | 1732 |
| 283 | Ga0373934_0055497 | 3300035086 | Bacteria | 1574 |
| 284 | Ga0373923_0016942 | 3300035111 | Bacteria | 2779 |
| 285 | Ga0373945_0464526 | 3300035116 | Bacteria | 561 |
| 286 | Ga0373953_0062763 | 3300035117 | Bacteria | 1521 |
| 287 | Ga0373954_0006611 | 3300035118 | Bacteria | 5060 |
| 288 | Ga0373956_0030711 | 3300035119 | Bacteria | 2350 |
| 289 | Ga0373957_0006450 | 3300035120 | Bacteria | 3697 |
| 290 | Ga0373946_0769683 | 3300035171 | Bacteria | 506 |
| 291 | Ga0373955_0023150 | 3300035172 | Bacteria | 3160 |
| 292 | Ga0316574_0119291 | 3300035398 | Bacteria | 1693 |
| 293 | Ga0373924_0032178 | 3300035410 | Bacteria | 2112 |
| 294 | Ga0373935_0132812 | 3300035692 | Bacteria | 1674 |
| 295 | Ga0373933_0026183 | 3300035724 | Bacteria | 3348 |
| 296 | Ga0373937_0032086 | 3300036401 | Bacteria | 4762 |
| 297 | Ga0316584_0008552 | 3300036712 | Bacteria | 7055 |
| 298 | Ga0395899_0313179 | 3300037312 | Bacteria | 1059 |
| 299 | Ga0395900_0733119 | 3300037418 | Bacteria | 920 |
| 300 | Ga0395898_0057313 | 3300037466 | Bacteria | 3797 |
| 301 | Ga0395898_0078296 | 3300037466 | Bacteria | 3190 |
| 302 | Ga0395905_0404181 | 3300037471 | Bacteria | 1261 |
| 303 | Ga0436364_0233092 | 3300037853 | Bacteria | 804 |
| 304 | Ga0400485_00503 | 3300038735 | Bacteria | 2587 |
| 305 | Ga0400488_28184 | 3300038741 | Unclassified | 3960 |
| 306 | Ga0400486_21295 | 3300038742 | Bacteria | 1274 |
| 307 | Ga0400486_26461 | 3300038742 | Bacteria | 1992 |
| 308 | Ga0436365_0438663 | 3300039437 | Bacteria | 4625 |
| 309 | Ga0436365_0871323 | 3300039437 | Bacteria | 58014 |
| 310 | Ga0436365_1194219 | 3300039437 | Bacteria | 729 |
| 311 | Ga0436360_0694913 | 3300039438 | Bacteria | 2439 |
| 312 | Ga0436360_0844831 | 3300039438 | Bacteria | 3290 |
| 313 | Ga0436360_0908501 | 3300039438 | Bacteria | 1244 |
| 314 | Ga0436361_0048455 | 3300039447 | Bacteria | 1173 |
| 315 | Ga0436361_0526438 | 3300039447 | Bacteria | 1062 |
| 316 | Ga0436361_1012780 | 3300039447 | Bacteria | 1377 |
| 317 | Ga0436363_0933367 | 3300039450 | Bacteria | 2850 |
| 318 | Ga0436363_1129826 | 3300039450 | Bacteria | 584 |
| 319 | Ga0436363_1425956 | 3300039450 | Bacteria | 1305 |
| 320 | Ga0436362_0024952 | 3300039453 | Bacteria | 2455 |
| 321 | Ga0436362_0768214 | 3300039453 | Bacteria | 997 |
| 322 | Ga0439465_0015497 | 3300041413 | Bacteria | 2379 |
| 323 | Ga0451789_0078933 | 3300041443 | Bacteria | 848 |
| 324 | Ga0451793_1434131 | 3300041452 | Bacteria | 635 |
| 325 | Ga0451795_0917465 | 3300041456 | Bacteria | 2245 |
| 326 | Ga0451847_0657346 | 3300041503 | Bacteria | 627 |
| 327 | Ga0451843_0290270 | 3300041509 | Bacteria | 896 |
| 328 | Ga0439432_242193 | 3300042006 | Bacteria | 518 |
| 329 | Ga0439449_0034252 | 3300042007 | Bacteria | 1891 |
| 330 | Ga0466972_0000076 | 3300044658 | Bacteria | 92672 |
| 331 | Ga0466966_0331345 | 3300044684 | Bacteria | 915 |
| 332 | Ga0466961_0143191 | 3300044693 | Bacteria | 1496 |
| 333 | Ga0453684_1100793 | 3300044712 | Bacteria | 839 |
| 334 | Ga0466968_0023554 | 3300044735 | Bacteria | 2510 |
| 335 | Ga0466968_0195362 | 3300044735 | Bacteria | 946 |
| 336 | Ga0466960_0099571 | 3300044901 | Bacteria | 1495 |
| 337 | Ga0466959_0319596 | 3300045049 | Bacteria | 1061 |
| 338 | Ga0495592_0009044 | 3300046454 | Bacteria | 7487 |
| 339 | Ga0495603_0227817 | 3300046455 | Bacteria | 1075 |
| 340 | Ga0495590_0148034 | 3300046457 | Bacteria | 850 |
| 341 | Ga0495629_0057035 | 3300046459 | Bacteria | 2731 |
| 342 | Ga0495629_0276187 | 3300046459 | Bacteria | 1154 |
| 343 | Ga0495638_0000924 | 3300046460 | Bacteria | 29846 |
| 344 | Ga0495638_0005428 | 3300046460 | Bacteria | 9486 |
| 345 | Ga0495651_0040780 | 3300046462 | Bacteria | 3607 |
| 346 | Ga0495653_0005677 | 3300046463 | Bacteria | 10189 |
| 347 | Ga0495650_0176812 | 3300046471 | Bacteria | 753 |
| 348 | Ga0495605_0002088 | 3300046474 | Bacteria | 12551 |
| 349 | Ga0495664_0002486 | 3300046477 | Bacteria | 9915 |
| 350 | Ga0495585_0019211 | 3300046492 | Bacteria | 3943 |
| 351 | Ga0495585_0036462 | 3300046492 | Bacteria | 2773 |
| 352 | Ga0495585_0169541 | 3300046492 | Bacteria | 1128 |
| 353 | Ga0495607_0123602 | 3300046501 | Bacteria | 1355 |
| 354 | Ga0495607_0397603 | 3300046501 | Bacteria | 627 |
| 355 | Ga0495583_0008910 | 3300046506 | Bacteria | 6063 |
| 356 | Ga0495583_0020660 | 3300046506 | Bacteria | 3404 |
| 357 | Ga0495606_0155356 | 3300046507 | Bacteria | 1339 |
| 358 | Ga0495606_0198382 | 3300046507 | Bacteria | 1145 |
| 359 | Ga0495606_0490591 | 3300046507 | Bacteria | 622 |
| 360 | Ga0495608_0020322 | 3300046511 | Bacteria | 4564 |
| 361 | Ga0495610_0008057 | 3300046512 | Bacteria | 6891 |
| 362 | Ga0495610_0044905 | 3300046512 | Bacteria | 2190 |
| 363 | Ga0495610_0156580 | 3300046512 | Bacteria | 967 |
| 364 | Ga0495616_0042395 | 3300046513 | Bacteria | 2317 |
| 365 | Ga0495618_0006096 | 3300046514 | Bacteria | 7313 |
| 366 | Ga0495620_0155116 | 3300046515 | Bacteria | 891 |
| 367 | Ga0495628_0011244 | 3300046516 | Bacteria | 7575 |
| 368 | Ga0495630_0147053 | 3300046517 | Bacteria | 1792 |
| 369 | Ga0495631_0001767 | 3300046518 | Bacteria | 12813 |
| 370 | Ga0495632_0014213 | 3300046519 | Bacteria | 4512 |
| 371 | Ga0495632_0032163 | 3300046519 | Bacteria | 2706 |
| 372 | Ga0495632_0284424 | 3300046519 | Bacteria | 736 |
| 373 | Ga0495643_0063611 | 3300046522 | Bacteria | 1951 |
| 374 | Ga0495643_0195253 | 3300046522 | Bacteria | 975 |
| 375 | Ga0495643_0319325 | 3300046522 | Bacteria | 702 |
| 376 | Ga0495648_0323226 | 3300046524 | Bacteria | 714 |
| 377 | Ga0495652_0032345 | 3300046529 | Bacteria | 4575 |
| 378 | Ga0495654_0058513 | 3300046530 | Bacteria | 1859 |
| 379 | Ga0495640_0010256 | 3300046533 | Bacteria | 7249 |
| 380 | Ga0495640_0259611 | 3300046533 | Bacteria | 1086 |
| 381 | Ga0495586_0058305 | 3300046535 | Bacteria | 2096 |
| 382 | Ga0495587_0026476 | 3300046536 | Bacteria | 3536 |
| 383 | Ga0495609_0060724 | 3300046538 | Bacteria | 1671 |
| 384 | Ga0495645_0023868 | 3300046543 | Bacteria | 4433 |
| 385 | Ga0495633_0019885 | 3300046558 | Bacteria | 3387 |
| 386 | Ga0495667_0013520 | 3300046559 | Bacteria | 5523 |
| 387 | Ga0495656_0040691 | 3300046615 | Bacteria | 1938 |
| 388 | Ga0495668_0008078 | 3300046616 | Bacteria | 6627 |
| 389 | Ga0495668_0297096 | 3300046616 | Bacteria | 885 |
| 390 | Ga0495668_0830559 | 3300046616 | Bacteria | 512 |
| 391 | Ga0495634_0023026 | 3300046642 | Bacteria | 4384 |
| 392 | Ga0495611_0012991 | 3300046648 | Bacteria | 3541 |
| 393 | Ga0495625_0002947 | 3300046660 | Bacteria | 17740 |
| 394 | Ga0495625_0067482 | 3300046660 | Bacteria | 2517 |
| 395 | Ga0495625_0227821 | 3300046660 | Bacteria | 1218 |
| 396 | Ga0495625_0281404 | 3300046660 | Bacteria | 1070 |
| 397 | Ga0495635_0005046 | 3300046663 | Bacteria | 9181 |
| 398 | Ga0495661_0325889 | 3300046665 | Bacteria | 762 |
| 399 | Ga0495588_0076451 | 3300046674 | Bacteria | 1745 |
| 400 | Ga0495588_0091671 | 3300046674 | Bacteria | 1592 |
| 401 | Ga0495657_0006746 | 3300046675 | Bacteria | 8952 |
| 402 | Ga0495599_0018262 | 3300046678 | Bacteria | 4370 |
| 403 | Ga0495623_0028228 | 3300046679 | Bacteria | 3610 |
| 404 | Ga0495646_0059626 | 3300046680 | Bacteria | 2278 |
| 405 | Ga0495613_0079532 | 3300046689 | Bacteria | 2384 |
| 406 | Ga0495670_0067902 | 3300046691 | Bacteria | 1800 |
| 407 | Ga0495670_0135256 | 3300046691 | Bacteria | 1287 |
| 408 | Ga0495649_0426574 | 3300046694 | Bacteria | 664 |
| 409 | Ga0495600_0203521 | 3300046809 | Bacteria | 1270 |
| 410 | Ga0495660_0037984 | 3300046810 | Bacteria | 2680 |
| 411 | Ga0495604_0017273 | 3300047317 | Bacteria | 5774 |
| 412 | Ga0495674_0016021 | 3300047319 | Bacteria | 6995 |
| 413 | Ga0495672_0051214 | 3300047320 | Bacteria | 2433 |
| 414 | Ga0495680_0029968 | 3300047322 | Bacteria | 4448 |
| 415 | Ga0495675_0010988 | 3300047444 | Bacteria | 5675 |
| 416 | Ga0495673_0074912 | 3300047469 | Bacteria | 1415 |
| 417 | Ga0495673_0139694 | 3300047469 | Bacteria | 945 |
| 418 | Ga0495673_0316917 | 3300047469 | Bacteria | 556 |
| 419 | Ga0495681_0088898 | 3300047470 | Bacteria | 1367 |
| 420 | Ga0495684_0017339 | 3300047471 | Bacteria | 5543 |
| 421 | Ga0495686_0030036 | 3300047472 | Bacteria | 3532 |
| 422 | Ga0495686_0301838 | 3300047472 | Bacteria | 883 |
| 423 | Ga0495593_0063838 | 3300047673 | Bacteria | 1923 |
| 424 | Ga0495602_0024624 | 3300048088 | Bacteria | 5838 |
| 425 | Ga0496101_0107850 | 3300048904 | Bacteria | 2093 |
| 426 | Ga0496101_0136833 | 3300048904 | Bacteria | 1865 |
| 427 | Ga0496102_0180722 | 3300048905 | Bacteria | 1987 |
| 428 | Ga0496102_0316387 | 3300048905 | Bacteria | 1471 |
| 429 | Ga0496102_0680122 | 3300048905 | Bacteria | 952 |
| 430 | Ga0496103_0644673 | 3300048906 | Bacteria | 673 |
| 431 | Ga0496104_0183798 | 3300048907 | Bacteria | 2001 |
| 432 | Ga0496104_0669354 | 3300048907 | Bacteria | 946 |
| 433 | Ga0496105_0065235 | 3300048908 | Bacteria | 3005 |
| 434 | Ga0496106_0020301 | 3300048909 | Bacteria | 4930 |
| 435 | Ga0496107_0113748 | 3300048910 | Bacteria | 1991 |
| 436 | Ga0496107_0763152 | 3300048910 | Bacteria | 709 |
| 437 | Ga0496108_0413585 | 3300048911 | Bacteria | 1178 |
| 438 | Ga0496108_0546789 | 3300048911 | Bacteria | 1010 |
| 439 | Ga0496108_0943533 | 3300048911 | Bacteria | 739 |
| 440 | Ga0496110_0432169 | 3300048913 | Bacteria | 1200 |
| 441 | Ga0496110_1353795 | 3300048913 | Bacteria | 621 |
| 442 | Ga0496111_0243105 | 3300048914 | Bacteria | 1336 |
| 443 | Ga0496114_0801143 | 3300048917 | Unclassified | 821 |
| 444 | Ga0496114_1256261 | 3300048917 | Bacteria | 627 |
| 445 | Ga0496114_1355833 | 3300048917 | Bacteria | 598 |
| 446 | Ga0496116_0016230 | 3300048919 | Bacteria | 5839 |
| 447 | Ga0496116_0017063 | 3300048919 | Bacteria | 5655 |
| 448 | Ga0496116_0028311 | 3300048919 | Bacteria | 4062 |
| 449 | Ga0496116_0068234 | 3300048919 | Bacteria | 2266 |
| 450 | Ga0496116_0140463 | 3300048919 | Bacteria | 1360 |
| 451 | Ga0496116_0182505 | 3300048919 | Bacteria | 1121 |
| 452 | Ga0496116_0186017 | 3300048919 | Bacteria | 1105 |
| 453 | Ga0496116_0292112 | 3300048919 | Bacteria | 782 |
| 454 | Ga0496117_0019308 | 3300048920 | Bacteria | 5605 |
| 455 | Ga0496117_0028796 | 3300048920 | Bacteria | 4294 |
| 456 | Ga0496117_0036604 | 3300048920 | Bacteria | 3669 |
| 457 | Ga0496117_0053053 | 3300048920 | Bacteria | 2851 |
| 458 | Ga0496118_0045143 | 3300048921 | Bacteria | 3444 |
| 459 | Ga0496118_0053336 | 3300048921 | Bacteria | 3075 |
| 460 | Ga0496118_0089530 | 3300048921 | Bacteria | 2124 |
| 461 | Ga0496118_0171754 | 3300048921 | Bacteria | 1323 |
| 462 | Ga0496118_0278678 | 3300048921 | Bacteria | 932 |
| 463 | Ga0496119_0103330 | 3300048922 | Bacteria | 1596 |
| 464 | Ga0496119_0156515 | 3300048922 | Bacteria | 1216 |
| 465 | Ga0496119_0192971 | 3300048922 | Bacteria | 1060 |
| 466 | Ga0496119_0217924 | 3300048922 | Bacteria | 978 |
| 467 | Ga0496120_0044203 | 3300048923 | Bacteria | 2590 |
| 468 | Ga0496120_0095205 | 3300048923 | Bacteria | 1583 |
| 469 | Ga0496120_0233822 | 3300048923 | Bacteria | 871 |
| 470 | Ga0496120_0242703 | 3300048923 | Bacteria | 849 |
| 471 | Ga0496120_0287691 | 3300048923 | Bacteria | 757 |
| 472 | Ga0496121_0024624 | 3300048924 | Bacteria | 5747 |
| 473 | Ga0496121_0026935 | 3300048924 | Bacteria | 5396 |
| 474 | Ga0496121_0031852 | 3300048924 | Bacteria | 4808 |
| 475 | Ga0496121_0047386 | 3300048924 | Bacteria | 3667 |
| 476 | Ga0496121_0063557 | 3300048924 | Bacteria | 3015 |
| 477 | Ga0496121_0083709 | 3300048924 | Bacteria | 2517 |
| 478 | Ga0496121_0104740 | 3300048924 | Bacteria | 2172 |
| 479 | Ga0496121_0115298 | 3300048924 | Bacteria | 2040 |
| 480 | Ga0496121_0176439 | 3300048924 | Bacteria | 1546 |
| 481 | Ga0496121_0333464 | 3300048924 | Bacteria | 1016 |
| 482 | Ga0496121_0372974 | 3300048924 | Bacteria | 943 |
| 483 | Ga0496122_0018692 | 3300048925 | Bacteria | 6382 |
| 484 | Ga0496122_0133519 | 3300048925 | Bacteria | 1570 |
| 485 | Ga0496122_0157882 | 3300048925 | Bacteria | 1388 |
| 486 | Ga0496122_0232318 | 3300048925 | Bacteria | 1047 |
| 487 | Ga0496122_0444030 | 3300048925 | Bacteria | 645 |
| 488 | Ga0496123_0019646 | 3300048926 | Bacteria | 5320 |
| 489 | Ga0496123_0033047 | 3300048926 | Bacteria | 3730 |
| 490 | Ga0496123_0102808 | 3300048926 | Bacteria | 1657 |
| 491 | Ga0496123_0107142 | 3300048926 | Bacteria | 1608 |
| 492 | Ga0496123_0194328 | 3300048926 | Bacteria | 1046 |
| 493 | Ga0496123_0195585 | 3300048926 | Bacteria | 1042 |
| 494 | Ga0496124_0000740 | 3300048927 | Bacteria | 53495 |
| 495 | Ga0496124_0003528 | 3300048927 | Bacteria | 19047 |
| 496 | Ga0496124_0015170 | 3300048927 | Bacteria | 7400 |
| 497 | Ga0496124_0070523 | 3300048927 | Bacteria | 2898 |
| 498 | Ga0496124_0076882 | 3300048927 | Bacteria | 2754 |
| 499 | Ga0496124_0112962 | 3300048927 | Bacteria | 2183 |
| 500 | Ga0496124_0115460 | 3300048927 | Bacteria | 2154 |
| 501 | Ga0496124_0142400 | 3300048927 | Bacteria | 1890 |
| 502 | Ga0496124_0181096 | 3300048927 | Bacteria | 1621 |
| 503 | Ga0496124_0237326 | 3300048927 | Bacteria | 1358 |
| 504 | Ga0496124_0294641 | 3300048927 | Bacteria | 1175 |
| 505 | Ga0496124_0412763 | 3300048927 | Bacteria | 933 |
| 506 | Ga0496124_0631911 | 3300048927 | Bacteria | 691 |
| 507 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 508 | Ga0496125_0009489 | 3300048928 | Bacteria | 9988 |
| 509 | Ga0496125_0064559 | 3300048928 | Bacteria | 2908 |
| 510 | Ga0496125_0100953 | 3300048928 | Bacteria | 2125 |
| 511 | Ga0496125_0227912 | 3300048928 | Bacteria | 1194 |
| 512 | Ga0496125_0315875 | 3300048928 | Bacteria | 950 |
| 513 | Ga0496125_0479030 | 3300048928 | Bacteria | 706 |
| 514 | Ga0496125_0491878 | 3300048928 | Bacteria | 692 |
| 515 | Ga0496125_0543013 | 3300048928 | Bacteria | 645 |
| 516 | Ga0496126_0036666 | 3300048929 | Bacteria | 4582 |
| 517 | Ga0496126_0069234 | 3300048929 | Bacteria | 3148 |
| 518 | Ga0496126_0150953 | 3300048929 | Bacteria | 1991 |
| 519 | Ga0496126_0457760 | 3300048929 | Bacteria | 1026 |
| 520 | Ga0496126_0545355 | 3300048929 | Bacteria | 921 |
| 521 | Ga0496126_0796633 | 3300048929 | Bacteria | 725 |
| 522 | Ga0495678_036147 | 3300049459 | Bacteria | 2018 |
| 523 | Ga0495678_102061 | 3300049459 | Bacteria | 992 |
| 524 | Ga0495682_0082097 | 3300049460 | Bacteria | 1159 |
| 525 | Ga0501031_0388071 | 3300049568 | Bacteria | 903 |
| 526 | Ga0501032_0896568 | 3300049569 | Bacteria | 558 |
| 527 | Ga0501033_0621784 | 3300049570 | Bacteria | 739 |
| 528 | Ga0501034_0327332 | 3300049571 | Bacteria | 1464 |
| 529 | Ga0501037_0303866 | 3300049573 | Bacteria | 1107 |
| 530 | Ga0501038_0306378 | 3300049574 | Bacteria | 1245 |
| 531 | Ga0501047_0709454 | 3300049581 | Bacteria | 823 |
| 532 | Ga0501048_0252607 | 3300049582 | Bacteria | 1252 |
| 533 | Ga0501068_0594418 | 3300049584 | Bacteria | 721 |
| 534 | Ga0501073_0344337 | 3300049589 | Bacteria | 1029 |
| 535 | Ga0501073_0360914 | 3300049589 | Bacteria | 1003 |
| 536 | Ga0501249_209831 | 3300049679 | Bacteria | 515 |
| 537 | Ga0501080_0048758 | 3300049742 | Bacteria | 3941 |
| 538 | Ga0501083_0440314 | 3300049744 | Bacteria | 848 |
| 539 | Ga0501035_0821801 | 3300049822 | Bacteria | 741 |
| 540 | Ga0501044_0618194 | 3300049823 | Bacteria | 975 |
| 541 | nmdc:mga00v17_409228_c1 | 3300050491 | Bacteria | 881 |
| 542 | nmdc:mga00v17_89664_c1 | 3300050491 | Bacteria | 1930 |
| 543 | nmdc:mga0yw44_13202_c1 | 3300050492 | Bacteria | 4340 |
| 544 | nmdc:mga0yw44_471439_c1 | 3300050492 | Bacteria | 851 |
| 545 | nmdc:mga0k408_188285_c1 | 3300050493 | Bacteria | 1231 |
| 546 | nmdc:mga06z11_660996_c1 | 3300050494 | Bacteria | 636 |
| 547 | nmdc:mga04h51_81320_c1 | 3300050495 | Bacteria | 1150 |
| 548 | nmdc:mga07m45_140253_c1 | 3300050496 | Bacteria | 1400 |
| 549 | nmdc:mga07m45_402457_c1 | 3300050496 | Bacteria | 794 |
| 550 | nmdc:mga08x19_53446_c1 | 3300050514 | Bacteria | 2599 |
| 551 | nmdc:mga0sz30_128957_c1 | 3300050516 | Bacteria | 1114 |
| 552 | nmdc:mga0sz30_169687_c1 | 3300050516 | Bacteria | 967 |
| 553 | nmdc:mga0sz30_76189_c1 | 3300050516 | Bacteria | 1448 |
| 554 | Ga0495601_0023245 | 3300053077 | Bacteria | 3808 |
| 555 | Ga0495612_0004910 | 3300053078 | Bacteria | 5532 |
| 556 | Ga0500610_0039853 | 3300053079 | Bacteria | 2426 |
| 557 | Ga0495595_0013972 | 3300053084 | Bacteria | 3399 |
| 558 | Ga0495619_0059570 | 3300053085 | Bacteria | 2536 |
| 559 | Ga0500644_0185980 | 3300053088 | Bacteria | 853 |
| 560 | Ga0500644_0244704 | 3300053088 | Bacteria | 754 |
| 561 | Ga0500644_0318784 | 3300053088 | Bacteria | 668 |
| 562 | Ga0500647_0077502 | 3300053091 | Bacteria | 1594 |
| 563 | Ga0500651_0170834 | 3300053093 | Bacteria | 1296 |
| 564 | Ga0500566_0004992 | 3300053094 | Bacteria | 7900 |
| 565 | Ga0500650_0090027 | 3300053098 | Bacteria | 1436 |
| 566 | Ga0500556_0164648 | 3300053104 | Bacteria | 875 |
| 567 | Ga0500556_0341764 | 3300053104 | Bacteria | 581 |
| 568 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 569 | Ga0500557_009624 | 3300053105 | Bacteria | 2378 |
| 570 | Ga0500562_010892 | 3300053108 | Bacteria | 2307 |
| 571 | Ga0500562_034535 | 3300053108 | Bacteria | 1338 |
| 572 | Ga0500562_078000 | 3300053108 | Bacteria | 896 |
| 573 | Ga0500569_022939 | 3300053109 | Bacteria | 1670 |
| 574 | Ga0500594_0002914 | 3300053118 | Bacteria | 3735 |
| 575 | Ga0500594_0287001 | 3300053118 | Bacteria | 551 |
| 576 | Ga0500597_156333 | 3300053120 | Bacteria | 977 |
| 577 | Ga0500618_010538 | 3300053125 | Bacteria | 2478 |
| 578 | Ga0500618_027174 | 3300053125 | Bacteria | 1362 |
| 579 | Ga0500642_0000221 | 3300053130 | Bacteria | 22633 |
| 580 | Ga0500652_352014 | 3300053131 | Bacteria | 557 |
| 581 | Ga0500658_0094335 | 3300053134 | Bacteria | 1298 |
| 582 | Ga0500658_0266967 | 3300053134 | Bacteria | 787 |
| 583 | Ga0500559_0000205 | 3300053136 | Bacteria | 47084 |
| 584 | Ga0500568_0002640 | 3300053139 | Bacteria | 10411 |
| 585 | Ga0500568_0003244 | 3300053139 | Bacteria | 9191 |
| 586 | Ga0500568_0083766 | 3300053139 | Bacteria | 1208 |
| 587 | Ga0500588_0028853 | 3300053146 | Bacteria | 1577 |
| 588 | Ga0500603_025190 | 3300053150 | Bacteria | 1494 |
| 589 | Ga0500616_0003914 | 3300053153 | Bacteria | 10944 |
| 590 | Ga0500622_0003496 | 3300053156 | Bacteria | 10430 |
| 591 | Ga0500622_0044431 | 3300053156 | Bacteria | 2302 |
| 592 | Ga0500624_119333 | 3300053157 | Bacteria | 553 |
| 593 | Ga0500627_0168049 | 3300053158 | Bacteria | 989 |
| 594 | Ga0500633_0022893 | 3300053160 | Bacteria | 1920 |
| 595 | Ga0500633_0025087 | 3300053160 | Bacteria | 1860 |
| 596 | Ga0500633_0251869 | 3300053160 | Bacteria | 656 |
| 597 | Ga0500634_0017698 | 3300053161 | Bacteria | 3818 |
| 598 | Ga0500634_0301202 | 3300053161 | Bacteria | 636 |
| 599 | Ga0500639_156676 | 3300053163 | Bacteria | 1042 |
| 600 | Ga0500636_0027461 | 3300053177 | Bacteria | 3363 |
| 601 | Ga0500636_0340005 | 3300053177 | Bacteria | 721 |
| 602 | Ga0500576_065341 | 3300053725 | Bacteria | 1579 |
| 603 | Ga0500625_001974 | 3300053729 | Bacteria | 7428 |
| 604 | Ga0500645_051143 | 3300053730 | Bacteria | 1205 |
| 605 | Ga0500596_002653 | 3300053735 | Bacteria | 3508 |
| 606 | Ga0500599_002156 | 3300053736 | Bacteria | 2341 |
| 607 | Ga0500601_000068 | 3300053737 | Bacteria | 21333 |
| 608 | Ga0500601_008028 | 3300053737 | Bacteria | 1171 |
| 609 | Ga0501084_0164014 | 3300054114 | Bacteria | 1875 |
| 610 | Ga0501084_0872810 | 3300054114 | Bacteria | 757 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0801143 | Ga0496114_0801143_16_378 | 115 |
| 2 | iso_pu_bacteria | 2857349434 | 2857357590 | 127 |
| 3 | iso_pu_bacteria | 2989349275 | 2989353019 | 132 |
| 4 | iso_pu_bacteria | 2507262055 | 2507509559 | 133 |
| 5 | iso_pu_bacteria | 2508501009 | 2508543600 | 133 |
| 6 | iso_pu_bacteria | 2508501042 | 2508698609 | 133 |
| 7 | iso_pu_bacteria | 2508501128 | 2509149248 | 133 |
| 8 | iso_pu_bacteria | 2513237139 | 2513879392 | 133 |
| 9 | iso_pu_bacteria | 2513237141 | 2513889416 | 133 |
| 10 | iso_pu_bacteria | 2513237161 | 2514016698 | 133 |
| 11 | iso_pu_bacteria | 2513237305 | 2514421787 | 133 |
| 12 | iso_pu_bacteria | 2515154112 | 2515629031 | 133 |
| 13 | iso_pu_bacteria | 2643221637 | 2644210966 | 133 |
| 14 | iso_pu_bacteria | 2643221718 | 2644654621 | 133 |
| 15 | iso_pu_bacteria | 2721755686 | 2723576293 | 133 |
| 16 | iso_pu_bacteria | 2802429603 | 2805920290 | 133 |
| 17 | iso_pu_bacteria | 2824671348 | 2824676216 | 133 |
| 18 | iso_pu_bacteria | 2824687955 | 2824692326 | 133 |
| 19 | iso_pu_bacteria | 2824696289 | 2824700667 | 133 |
| 20 | iso_pu_bacteria | 2824704595 | 2824710531 | 133 |
| 21 | iso_pu_bacteria | 2824732956 | 2824735719 | 133 |
| 22 | iso_pu_bacteria | 2824753945 | 2824756714 | 133 |
| 23 | iso_pu_bacteria | 2824763712 | 2824770897 | 133 |
| 24 | iso_pu_bacteria | 2824773399 | 2824779028 | 133 |
| 25 | iso_pu_bacteria | 2838122688 | 2838128711 | 133 |
| 26 | iso_pu_bacteria | 2841949485 | 2841956398 | 133 |
| 27 | iso_pu_bacteria | 2841966195 | 2841967171 | 133 |
| 28 | iso_pu_bacteria | 2841983080 | 2841989908 | 133 |
| 29 | iso_pu_bacteria | 2842694124 | 2842695394 | 133 |
| 30 | iso_pu_bacteria | 2847939898 | 2847945618 | 133 |
| 31 | iso_pu_bacteria | 2849076700 | 2849080213 | 133 |
| 32 | iso_pu_bacteria | 2874590934 | 2874595329 | 133 |
| 33 | iso_pu_bacteria | 2874612657 | 2874613286 | 133 |
| 34 | iso_pu_bacteria | 2874645413 | 2874651168 | 133 |
| 35 | iso_pu_bacteria | 2876771140 | 2876775265 | 133 |
| 36 | iso_pu_bacteria | 2876818435 | 2876824080 | 133 |
| 37 | iso_pu_bacteria | 2879074833 | 2879080708 | 133 |
| 38 | iso_pu_bacteria | 2879127579 | 2879134709 | 133 |
| 39 | iso_pu_bacteria | 2879142872 | 2879144169 | 133 |
| 40 | iso_pu_bacteria | 2904711408 | 2904716926 | 133 |
| 41 | iso_pu_bacteria | 2909042592 | 2909043688 | 133 |
| 42 | iso_pu_bacteria | 2920760137 | 2920765603 | 133 |
| 43 | iso_pu_bacteria | 2935608549 | 2935611569 | 133 |
| 44 | iso_pu_bacteria | 2935648319 | 2935648941 | 133 |
| 45 | iso_pu_bacteria | 2935656913 | 2935656977 | 133 |
| 46 | iso_pu_bacteria | 2935819856 | 2935821046 | 133 |
| 47 | iso_pu_bacteria | 2935847175 | 2935850694 | 133 |
| 48 | iso_pu_bacteria | 2935908558 | 2935913937 | 133 |
| 49 | iso_pu_bacteria | 2935916978 | 2935920073 | 133 |
| 50 | iso_pu_bacteria | 2935926038 | 2935930412 | 133 |
| 51 | iso_pu_bacteria | 2935934488 | 2935939615 | 133 |
| 52 | iso_pu_bacteria | 2935942939 | 2935946564 | 133 |
| 53 | iso_pu_bacteria | 2935951376 | 2935955597 | 133 |
| 54 | iso_pu_bacteria | 2935967501 | 2935972693 | 133 |
| 55 | iso_pu_bacteria | 2935975950 | 2935981486 | 133 |
| 56 | iso_pu_bacteria | 2935984226 | 2935989122 | 133 |
| 57 | iso_pu_bacteria | 2936011229 | 2936011851 | 133 |
| 58 | iso_pu_bacteria | 2936019824 | 2936020446 | 133 |
| 59 | iso_pu_bacteria | 2936028420 | 2936029140 | 133 |
| 60 | iso_pu_bacteria | 2936046547 | 2936047169 | 133 |
| 61 | iso_pu_bacteria | 2936055302 | 2936061397 | 133 |
| 62 | iso_pu_bacteria | 8016630954 | 8016632094 | 133 |
| 63 | iso_pu_bacteria | 8019619141 | 8019627084 | 133 |
| 64 | iso_pu_bacteria | 8019629233 | 8019635465 | 133 |
| 65 | iso_pu_bacteria | 8019638758 | 8019644239 | 133 |
| 66 | iso_pu_bacteria | 8019659431 | 8019663273 | 133 |
| 67 | iso_pu_bacteria | 8019668869 | 8019672891 | 133 |
| 68 | iso_pu_bacteria | 8019678201 | 8019683252 | 133 |
| 69 | iso_pu_bacteria | 8019687851 | 8019688959 | 133 |
| 70 | 3300038735 | Ga0400485_00503 | Ga0400485_00503_229_669 | 134 |
| 71 | 3300038741 | Ga0400488_28184 | Ga0400488_28184_959_1399 | 134 |
| 72 | 3300038742 | Ga0400486_21295 | Ga0400486_21295_219_659 | 134 |
| 73 | 3300038742 | Ga0400486_26461 | Ga0400486_26461_1214_1654 | 134 |
| 74 | iso_pu_bacteria | 2511231027 | 2511392941 | 134 |
| 75 | iso_pu_bacteria | 2718218232 | 2720612897 | 134 |
| 76 | iso_pu_bacteria | 2718218233 | 2720619756 | 134 |
| 77 | iso_pu_bacteria | 2718218235 | 2720631187 | 134 |
| 78 | iso_pu_bacteria | 2718218269 | 2720774914 | 134 |
| 79 | iso_pu_bacteria | 2721755556 | 2723026551 | 134 |
| 80 | iso_pu_bacteria | 2721755684 | 2723560155 | 134 |
| 81 | iso_pu_bacteria | 2721755685 | 2723566713 | 134 |
| 82 | iso_pu_bacteria | 2721755819 | 2724089521 | 134 |
| 83 | iso_pu_bacteria | 2721755822 | 2724103978 | 134 |
| 84 | iso_pu_bacteria | 2728369352 | 2730107487 | 134 |
| 85 | iso_pu_bacteria | 2751185800 | 2753359509 | 134 |
| 86 | iso_pu_bacteria | 2838068647 | 2838071317 | 134 |
| 87 | iso_pu_bacteria | 2842422224 | 2842425026 | 134 |
| 88 | iso_pu_bacteria | 2842871566 | 2842872501 | 134 |
| 89 | iso_pu_bacteria | 2889016732 | 2889023363 | 134 |
| 90 | iso_pu_bacteria | 2906354277 | 2906360370 | 134 |
| 91 | iso_pu_bacteria | 2928521798 | 2928523412 | 134 |
| 92 | iso_pu_bacteria | 2933599457 | 2933602116 | 134 |
| 93 | iso_pu_bacteria | 2954011201 | 2954015683 | 134 |
| 94 | iso_pu_bacteria | 2958100919 | 2958107395 | 134 |
| 95 | iso_pu_bacteria | 2958172287 | 2958179245 | 134 |
| 96 | iso_pu_bacteria | 2965119406 | 2965124406 | 134 |
| 97 | iso_pu_bacteria | 2977971508 | 2977977079 | 134 |
| 98 | iso_pu_bacteria | 2979710463 | 2979712268 | 134 |
| 99 | iso_pu_bacteria | 2979742915 | 2979750739 | 134 |
| 100 | iso_pu_bacteria | 8005282627 | 8005288233 | 134 |
| 101 | iso_pu_bacteria | 8005497431 | 8005499854 | 134 |
| 102 | iso_pu_bacteria | 8005626139 | 8005631477 | 134 |
| 103 | iso_pu_bacteria | 8005668836 | 8005671272 | 134 |
| 104 | 3300003187 | JGI25151J46595_10023401 | JGI25151J46595_100234013 | 135 |
| 105 | 3300003771 | Ga0055526_1002763 | Ga0055526_10027639 | 135 |
| 106 | 3300003781 | Ga0055536_1019995 | Ga0055536_10199953 | 135 |
| 107 | 3300003794 | Ga0055531_10001389 | Ga0055531_1000138918 | 135 |
| 108 | 3300025208 | Ga0209436_102492 | Ga0209436_1024924 | 135 |
| 109 | 3300025292 | Ga0209676_1003690 | Ga0209676_10036902 | 135 |
| 110 | 3300025294 | Ga0209025_1000033 | Ga0209025_1000033379 | 135 |
| 111 | 3300025295 | Ga0209564_1000140 | Ga0209564_100014019 | 135 |
| 112 | 3300025299 | Ga0209256_1000836 | Ga0209256_100083624 | 135 |
| 113 | 3300025303 | Ga0209051_1011889 | Ga0209051_10118894 | 135 |
| 114 | 3300025304 | Ga0209257_1015246 | Ga0209257_10152463 | 135 |
| 115 | 3300031691 | Ga0316579_10364317 | Ga0316579_103643171 | 135 |
| 116 | 3300031727 | Ga0316576_10207246 | Ga0316576_102072462 | 135 |
| 117 | 3300031728 | Ga0316578_10016183 | Ga0316578_100161834 | 135 |
| 118 | 3300031731 | Ga0307405_11872842 | Ga0307405_118728421 | 135 |
| 119 | 3300035398 | Ga0316574_0119291 | Ga0316574_0119291_1042_1461 | 135 |
| 120 | 3300036712 | Ga0316584_0008552 | Ga0316584_0008552_302_721 | 135 |
| 121 | 3300044712 | Ga0453684_1100793 | Ga0453684_1100793_390_809 | 135 |
| 122 | 3300054114 | Ga0501084_0164014 | Ga0501084_0164014_308_742 | 135 |
| 123 | 3300054114 | Ga0501084_0872810 | Ga0501084_0872810_110_532 | 135 |
| 124 | iso_pu_bacteria | 2510917028 | 2511182729 | 135 |
| 125 | iso_pu_bacteria | 2510917030 | 2511200566 | 135 |
| 126 | iso_pu_bacteria | 2513237138 | 2513869335 | 135 |
| 127 | iso_pu_bacteria | 2513237144 | 2513909752 | 135 |
| 128 | iso_pu_bacteria | 2513237146 | 2513926522 | 135 |
| 129 | iso_pu_bacteria | 2534681796 | 2535516140 | 135 |
| 130 | iso_pu_bacteria | 2582581294 | 2585199859 | 135 |
| 131 | iso_pu_bacteria | 2582581298 | 2585225919 | 135 |
| 132 | iso_pu_bacteria | 2582581299 | 2585230079 | 135 |
| 133 | iso_pu_bacteria | 2582581304 | 2585254343 | 135 |
| 134 | iso_pu_bacteria | 2582581307 | 2585270565 | 135 |
| 135 | iso_pu_bacteria | 2582581315 | 2585324091 | 135 |
| 136 | iso_pu_bacteria | 2582581867 | 2585400696 | 135 |
| 137 | iso_pu_bacteria | 2585427529 | 2585546879 | 135 |
| 138 | iso_pu_bacteria | 2585427530 | 2585551766 | 135 |
| 139 | iso_pu_bacteria | 2585427531 | 2585558269 | 135 |
| 140 | iso_pu_bacteria | 2585427590 | 2585819744 | 135 |
| 141 | iso_pu_bacteria | 2585427594 | 2585845759 | 135 |
| 142 | iso_pu_bacteria | 2585427608 | 2585897663 | 135 |
| 143 | iso_pu_bacteria | 2585427609 | 2585904742 | 135 |
| 144 | iso_pu_bacteria | 2585428125 | 2587980142 | 135 |
| 145 | iso_pu_bacteria | 2599185170 | 2599418047 | 135 |
| 146 | iso_pu_bacteria | 2643221599 | 2644005901 | 135 |
| 147 | iso_pu_bacteria | 2643221607 | 2644049531 | 135 |
| 148 | iso_pu_bacteria | 2643221634 | 2644193126 | 135 |
| 149 | iso_pu_bacteria | 2643221636 | 2644204061 | 135 |
| 150 | iso_pu_bacteria | 2643221643 | 2644239232 | 135 |
| 151 | iso_pu_bacteria | 2643221686 | 2644482565 | 135 |
| 152 | iso_pu_bacteria | 2643221689 | 2644499067 | 135 |
| 153 | iso_pu_bacteria | 2738541293 | 2738799280 | 135 |
| 154 | iso_pu_bacteria | 2818991453 | 2819638206 | 135 |
| 155 | iso_pu_bacteria | 2838035591 | 2838040986 | 135 |
| 156 | iso_pu_bacteria | 2838661181 | 2838666169 | 135 |
| 157 | iso_pu_bacteria | 2842482326 | 2842487191 | 135 |
| 158 | iso_pu_bacteria | 2852387548 | 2852389559 | 135 |
| 159 | iso_pu_bacteria | 2871495908 | 2871500671 | 135 |
| 160 | iso_pu_bacteria | 2876392853 | 2876395047 | 135 |
| 161 | iso_pu_bacteria | 2878760144 | 2878764760 | 135 |
| 162 | iso_pu_bacteria | 2878767105 | 2878771861 | 135 |
| 163 | iso_pu_bacteria | 2903540706 | 2903545484 | 135 |
| 164 | iso_pu_bacteria | 2904659560 | 2904661678 | 135 |
| 165 | iso_pu_bacteria | 2919100787 | 2919107751 | 135 |
| 166 | iso_pu_bacteria | 2923556063 | 2923558184 | 135 |
| 167 | iso_pu_bacteria | 2937994558 | 2937999334 | 135 |
| 168 | iso_pu_bacteria | 2958165035 | 2958169808 | 135 |
| 169 | iso_pu_bacteria | 2961114664 | 2961116831 | 135 |
| 170 | iso_pu_bacteria | 2961163497 | 2961168268 | 135 |
| 171 | iso_pu_bacteria | 2965018300 | 2965023087 | 135 |
| 172 | iso_pu_bacteria | 2968110612 | 2968112738 | 135 |
| 173 | iso_pu_bacteria | 2968171901 | 2968176668 | 135 |
| 174 | iso_pu_bacteria | 2970554993 | 2970559607 | 135 |
| 175 | iso_pu_bacteria | 2987659509 | 2987664282 | 135 |
| 176 | iso_pu_bacteria | 2996887358 | 2996892396 | 135 |
| 177 | iso_pu_bacteria | 3004188549 | 3004193337 | 135 |
| 178 | iso_pu_bacteria | 3005445848 | 3005447206 | 135 |
| 179 | iso_pu_bacteria | 3005452660 | 3005453916 | 135 |
| 180 | iso_pu_bacteria | 8005258706 | 8005259678 | 135 |
| 181 | iso_pu_bacteria | 8005321885 | 8005326923 | 135 |
| 182 | iso_pu_bacteria | 8005542996 | 8005544835 | 135 |
| 183 | iso_pu_bacteria | 8046767195 | 8046770286 | 135 |
| 184 | iso_pu_bacteria | 8057575449 | 8057578214 | 135 |
| 185 | 3300002067 | JGI24735J21928_10120957 | JGI24735J21928_101209572 | 136 |
| 186 | 3300003215 | JGI25153J46596_10001154 | JGI25153J46596_1000115415 | 136 |
| 187 | 3300003215 | JGI25153J46596_10065176 | JGI25153J46596_100651761 | 136 |
| 188 | 3300003354 | JGI25160J50197_1001476 | JGI25160J50197_10014764 | 136 |
| 189 | 3300003752 | Ga0055539_1005927 | Ga0055539_10059271 | 136 |
| 190 | 3300003759 | Ga0055525_1013677 | Ga0055525_10136771 | 136 |
| 191 | 3300004625 | Ga0055543_1022175 | Ga0055543_10221751 | 136 |
| 192 | 3300005262 | Ga0065165_1059498 | Ga0065165_10594981 | 136 |
| 193 | 3300005339 | Ga0070660_100123844 | Ga0070660_1001238444 | 136 |
| 194 | 3300005436 | Ga0070713_100082608 | Ga0070713_1000826083 | 136 |
| 195 | 3300005436 | Ga0070713_100872313 | Ga0070713_1008723132 | 136 |
| 196 | 3300005458 | Ga0070681_10071247 | Ga0070681_100712471 | 136 |
| 197 | 3300005458 | Ga0070681_11243662 | Ga0070681_112436622 | 136 |
| 198 | 3300005467 | Ga0070706_100111430 | Ga0070706_1001114304 | 136 |
| 199 | 3300005535 | Ga0070684_100005060 | Ga0070684_1000050609 | 136 |
| 200 | 3300005536 | Ga0070697_100587092 | Ga0070697_1005870922 | 136 |
| 201 | 3300005539 | Ga0068853_100342420 | Ga0068853_1003424201 | 136 |
| 202 | 3300005563 | Ga0068855_100421029 | Ga0068855_1004210292 | 136 |
| 203 | 3300005564 | Ga0070664_100855390 | Ga0070664_1008553901 | 136 |
| 204 | 3300005577 | Ga0068857_100340023 | Ga0068857_1003400232 | 136 |
| 205 | 3300005614 | Ga0068856_100278750 | Ga0068856_1002787502 | 136 |
| 206 | 3300005614 | Ga0068856_101385914 | Ga0068856_1013859142 | 136 |
| 207 | 3300005616 | Ga0068852_100707979 | Ga0068852_1007079792 | 136 |
| 208 | 3300005616 | Ga0068852_101551755 | Ga0068852_1015517552 | 136 |
| 209 | 3300005841 | Ga0068863_100937866 | Ga0068863_1009378662 | 136 |
| 210 | 3300005842 | Ga0068858_100146089 | Ga0068858_1001460892 | 136 |
| 211 | 3300005983 | Ga0081540_1123679 | Ga0081540_11236792 | 136 |
| 212 | 3300006028 | Ga0070717_10006449 | Ga0070717_100064498 | 136 |
| 213 | 3300006038 | Ga0075365_10157443 | Ga0075365_101574432 | 136 |
| 214 | 3300006038 | Ga0075365_10230129 | Ga0075365_102301292 | 136 |
| 215 | 3300006038 | Ga0075365_10316749 | Ga0075365_103167492 | 136 |
| 216 | 3300006042 | Ga0075368_10058033 | Ga0075368_100580333 | 136 |
| 217 | 3300006051 | Ga0075364_10009825 | Ga0075364_100098256 | 136 |
| 218 | 3300006844 | Ga0075428_100079024 | Ga0075428_1000790244 | 136 |
| 219 | 3300006847 | Ga0075431_100016823 | Ga0075431_1000168237 | 136 |
| 220 | 3300006880 | Ga0075429_100099505 | Ga0075429_1000995053 | 136 |
| 221 | 3300006914 | Ga0075436_100085391 | Ga0075436_1000853912 | 136 |
| 222 | 3300006941 | Ga0099825_1029852 | Ga0099825_10298523 | 136 |
| 223 | 3300006942 | Ga0099824_1009133 | Ga0099824_10091339 | 136 |
| 224 | 3300007265 | Ga0099794_10147829 | Ga0099794_101478291 | 136 |
| 225 | 3300009093 | Ga0105240_10014824 | Ga0105240_100148243 | 136 |
| 226 | 3300009093 | Ga0105240_10950532 | Ga0105240_109505322 | 136 |
| 227 | 3300009094 | Ga0111539_10784921 | Ga0111539_107849212 | 136 |
| 228 | 3300009101 | Ga0105247_10093931 | Ga0105247_100939312 | 136 |
| 229 | 3300009147 | Ga0114129_10246561 | Ga0114129_102465613 | 136 |
| 230 | 3300009545 | Ga0105237_10584035 | Ga0105237_105840352 | 136 |
| 231 | 3300009545 | Ga0105237_11133290 | Ga0105237_111332902 | 136 |
| 232 | 3300009551 | Ga0105238_10184478 | Ga0105238_101844782 | 136 |
| 233 | 3300009551 | Ga0105238_10927254 | Ga0105238_109272542 | 136 |
| 234 | 3300010159 | Ga0099796_10004763 | Ga0099796_100047635 | 136 |
| 235 | 3300010159 | Ga0099796_10377253 | Ga0099796_103772531 | 136 |
| 236 | 3300010375 | Ga0105239_10516678 | Ga0105239_105166782 | 136 |
| 237 | 3300010375 | Ga0105239_10663501 | Ga0105239_106635012 | 136 |
| 238 | 3300012513 | Ga0157326_1045089 | Ga0157326_10450891 | 136 |
| 239 | 3300013105 | Ga0157369_10004236 | Ga0157369_1000423612 | 136 |
| 240 | 3300013105 | Ga0157369_10015990 | Ga0157369_1001599012 | 136 |
| 241 | 3300013307 | Ga0157372_10102460 | Ga0157372_101024604 | 136 |
| 242 | 3300013307 | Ga0157372_10145587 | Ga0157372_101455873 | 136 |
| 243 | 3300014325 | Ga0163163_10795249 | Ga0163163_107952492 | 136 |
| 244 | 3300014497 | Ga0182008_10135671 | Ga0182008_101356711 | 136 |
| 245 | 3300020069 | Ga0197907_10585868 | Ga0197907_105858682 | 136 |
| 246 | 3300020082 | Ga0206353_10443739 | Ga0206353_104437393 | 136 |
| 247 | 3300020082 | Ga0206353_10983039 | Ga0206353_109830392 | 136 |
| 248 | 3300021358 | Ga0213873_10010836 | Ga0213873_100108362 | 136 |
| 249 | 3300021361 | Ga0213872_10113317 | Ga0213872_101133172 | 136 |
| 250 | 3300021384 | Ga0213876_10010189 | Ga0213876_100101891 | 136 |
| 251 | 3300021384 | Ga0213876_10275880 | Ga0213876_102758801 | 136 |
| 252 | 3300021384 | Ga0213876_10487603 | Ga0213876_104876032 | 136 |
| 253 | 3300021441 | Ga0213871_10057762 | Ga0213871_100577623 | 136 |
| 254 | 3300022467 | Ga0224712_10072294 | Ga0224712_100722943 | 136 |
| 255 | 3300022467 | Ga0224712_10102193 | Ga0224712_101021932 | 136 |
| 256 | 3300025230 | Ga0209563_107655 | Ga0209563_1076552 | 136 |
| 257 | 3300025253 | Ga0209677_104516 | Ga0209677_1045162 | 136 |
| 258 | 3300025261 | Ga0209233_1004384 | Ga0209233_10043843 | 136 |
| 259 | 3300025297 | Ga0209758_1000138 | Ga0209758_1000138163 | 136 |
| 260 | 3300025297 | Ga0209758_1010556 | Ga0209758_10105563 | 136 |
| 261 | 3300025297 | Ga0209758_1011376 | Ga0209758_10113762 | 136 |
| 262 | 3300025302 | Ga0207426_1070433 | Ga0207426_10704331 | 136 |
| 263 | 3300025904 | Ga0207647_10009466 | Ga0207647_100094663 | 136 |
| 264 | 3300025909 | Ga0207705_10509204 | Ga0207705_105092041 | 136 |
| 265 | 3300025910 | Ga0207684_10169069 | Ga0207684_101690692 | 136 |
| 266 | 3300025913 | Ga0207695_10119024 | Ga0207695_101190243 | 136 |
| 267 | 3300025913 | Ga0207695_10218040 | Ga0207695_102180402 | 136 |
| 268 | 3300025914 | Ga0207671_10287327 | Ga0207671_102873272 | 136 |
| 269 | 3300025920 | Ga0207649_10859823 | Ga0207649_108598231 | 136 |
| 270 | 3300025924 | Ga0207694_10867041 | Ga0207694_108670412 | 136 |
| 271 | 3300025924 | Ga0207694_11101795 | Ga0207694_111017952 | 136 |
| 272 | 3300025928 | Ga0207700_10134681 | Ga0207700_101346813 | 136 |
| 273 | 3300025939 | Ga0207665_10815413 | Ga0207665_108154132 | 136 |
| 274 | 3300026041 | Ga0207639_10056367 | Ga0207639_100563672 | 136 |
| 275 | 3300026041 | Ga0207639_10314688 | Ga0207639_103146883 | 136 |
| 276 | 3300026067 | Ga0207678_10137526 | Ga0207678_101375262 | 136 |
| 277 | 3300026078 | Ga0207702_10096960 | Ga0207702_100969603 | 136 |
| 278 | 3300026142 | Ga0207698_11071290 | Ga0207698_110712902 | 136 |
| 279 | 3300027296 | Ga0209389_1000068 | Ga0209389_100006813 | 136 |
| 280 | 3300027361 | Ga0209489_115015 | Ga0209489_1150152 | 136 |
| 281 | 3300027363 | Ga0209700_100117 | Ga0209700_10011790 | 136 |
| 282 | 3300027866 | Ga0209813_10068141 | Ga0209813_100681413 | 136 |
| 283 | 3300028379 | Ga0268266_10113172 | Ga0268266_101131721 | 136 |
| 284 | 3300028379 | Ga0268266_10732581 | Ga0268266_107325812 | 136 |
| 285 | 3300028556 | Ga0265337_1028868 | Ga0265337_10288682 | 136 |
| 286 | 3300028563 | Ga0265319_1013066 | Ga0265319_10130663 | 136 |
| 287 | 3300028573 | Ga0265334_10049583 | Ga0265334_100495833 | 136 |
| 288 | 3300028653 | Ga0265323_10020524 | Ga0265323_100205242 | 136 |
| 289 | 3300028666 | Ga0265336_10002573 | Ga0265336_100025738 | 136 |
| 290 | 3300028800 | Ga0265338_10000306 | Ga0265338_1000030652 | 136 |
| 291 | 3300029957 | Ga0265324_10031006 | Ga0265324_100310062 | 136 |
| 292 | 3300030878 | Ga0265770_1032771 | Ga0265770_10327712 | 136 |
| 293 | 3300031249 | Ga0265339_10002239 | Ga0265339_100022398 | 136 |
| 294 | 3300031249 | Ga0265339_10012914 | Ga0265339_100129144 | 136 |
| 295 | 3300031711 | Ga0265314_10006693 | Ga0265314_100066935 | 136 |
| 296 | 3300031711 | Ga0265314_10016806 | Ga0265314_100168062 | 136 |
| 297 | 3300031712 | Ga0265342_10002241 | Ga0265342_100022413 | 136 |
| 298 | 3300033180 | Ga0307510_10005071 | Ga0307510_100050713 | 136 |
| 299 | 3300034818 | Ga0373950_0007064 | Ga0373950_0007064_1288_1710 | 136 |
| 300 | 3300035086 | Ga0373934_0055497 | Ga0373934_0055497_286_708 | 136 |
| 301 | 3300035111 | Ga0373923_0016942 | Ga0373923_0016942_954_1376 | 136 |
| 302 | 3300035116 | Ga0373945_0464526 | Ga0373945_0464526_38_460 | 136 |
| 303 | 3300035117 | Ga0373953_0062763 | Ga0373953_0062763_203_625 | 136 |
| 304 | 3300035118 | Ga0373954_0006611 | Ga0373954_0006611_3869_4291 | 136 |
| 305 | 3300035119 | Ga0373956_0030711 | Ga0373956_0030711_967_1389 | 136 |
| 306 | 3300035120 | Ga0373957_0006450 | Ga0373957_0006450_2317_2739 | 136 |
| 307 | 3300035171 | Ga0373946_0769683 | Ga0373946_0769683_24_446 | 136 |
| 308 | 3300035172 | Ga0373955_0023150 | Ga0373955_0023150_471_893 | 136 |
| 309 | 3300035410 | Ga0373924_0032178 | Ga0373924_0032178_578_1000 | 136 |
| 310 | 3300035692 | Ga0373935_0132812 | Ga0373935_0132812_474_896 | 136 |
| 311 | 3300035724 | Ga0373933_0026183 | Ga0373933_0026183_1972_2394 | 136 |
| 312 | 3300036401 | Ga0373937_0032086 | Ga0373937_0032086_2177_2599 | 136 |
| 313 | 3300037312 | Ga0395899_0313179 | Ga0395899_0313179_98_526 | 136 |
| 314 | 3300037418 | Ga0395900_0733119 | Ga0395900_0733119_71_496 | 136 |
| 315 | 3300037466 | Ga0395898_0057313 | Ga0395898_0057313_1361_1789 | 136 |
| 316 | 3300037466 | Ga0395898_0078296 | Ga0395898_0078296_194_616 | 136 |
| 317 | 3300037853 | Ga0436364_0233092 | Ga0436364_0233092_189_617 | 136 |
| 318 | 3300039437 | Ga0436365_0438663 | Ga0436365_0438663_216_644 | 136 |
| 319 | 3300039437 | Ga0436365_0871323 | Ga0436365_0871323_16668_17096 | 136 |
| 320 | 3300039437 | Ga0436365_1194219 | Ga0436365_1194219_233_688 | 136 |
| 321 | 3300039438 | Ga0436360_0694913 | Ga0436360_0694913_675_1097 | 136 |
| 322 | 3300039438 | Ga0436360_0844831 | Ga0436360_0844831_735_1163 | 136 |
| 323 | 3300039438 | Ga0436360_0908501 | Ga0436360_0908501_640_1068 | 136 |
| 324 | 3300039447 | Ga0436361_0048455 | Ga0436361_0048455_133_576 | 136 |
| 325 | 3300039447 | Ga0436361_0526438 | Ga0436361_0526438_32_460 | 136 |
| 326 | 3300039447 | Ga0436361_1012780 | Ga0436361_1012780_704_1132 | 136 |
| 327 | 3300039450 | Ga0436363_0933367 | Ga0436363_0933367_701_1183 | 136 |
| 328 | 3300039450 | Ga0436363_1129826 | Ga0436363_1129826_57_479 | 136 |
| 329 | 3300039450 | Ga0436363_1425956 | Ga0436363_1425956_519_950 | 136 |
| 330 | 3300039453 | Ga0436362_0024952 | Ga0436362_0024952_313_741 | 136 |
| 331 | 3300039453 | Ga0436362_0768214 | Ga0436362_0768214_52_480 | 136 |
| 332 | 3300041443 | Ga0451789_0078933 | Ga0451789_0078933_350_778 | 136 |
| 333 | 3300041452 | Ga0451793_1434131 | Ga0451793_1434131_137_565 | 136 |
| 334 | 3300041503 | Ga0451847_0657346 | Ga0451847_0657346_122_550 | 136 |
| 335 | 3300041509 | Ga0451843_0290270 | Ga0451843_0290270_95_523 | 136 |
| 336 | 3300044658 | Ga0466972_0000076 | Ga0466972_0000076_85442_85870 | 136 |
| 337 | 3300044684 | Ga0466966_0331345 | Ga0466966_0331345_363_791 | 136 |
| 338 | 3300044693 | Ga0466961_0143191 | Ga0466961_0143191_319_747 | 136 |
| 339 | 3300044735 | Ga0466968_0023554 | Ga0466968_0023554_379_807 | 136 |
| 340 | 3300044735 | Ga0466968_0195362 | Ga0466968_0195362_11_493 | 136 |
| 341 | 3300045049 | Ga0466959_0319596 | Ga0466959_0319596_297_725 | 136 |
| 342 | 3300046454 | Ga0495592_0009044 | Ga0495592_0009044_2436_2858 | 136 |
| 343 | 3300046459 | Ga0495629_0057035 | Ga0495629_0057035_1192_1614 | 136 |
| 344 | 3300046459 | Ga0495629_0276187 | Ga0495629_0276187_404_832 | 136 |
| 345 | 3300046460 | Ga0495638_0005428 | Ga0495638_0005428_5902_6330 | 136 |
| 346 | 3300046462 | Ga0495651_0040780 | Ga0495651_0040780_1875_2297 | 136 |
| 347 | 3300046463 | Ga0495653_0005677 | Ga0495653_0005677_3455_3877 | 136 |
| 348 | 3300046477 | Ga0495664_0002486 | Ga0495664_0002486_3668_4090 | 136 |
| 349 | 3300046511 | Ga0495608_0020322 | Ga0495608_0020322_976_1398 | 136 |
| 350 | 3300046514 | Ga0495618_0006096 | Ga0495618_0006096_5031_5453 | 136 |
| 351 | 3300046516 | Ga0495628_0011244 | Ga0495628_0011244_5000_5422 | 136 |
| 352 | 3300046517 | Ga0495630_0147053 | Ga0495630_0147053_248_670 | 136 |
| 353 | 3300046519 | Ga0495632_0284424 | Ga0495632_0284424_21_449 | 136 |
| 354 | 3300046529 | Ga0495652_0032345 | Ga0495652_0032345_2229_2651 | 136 |
| 355 | 3300046533 | Ga0495640_0010256 | Ga0495640_0010256_5372_5794 | 136 |
| 356 | 3300046533 | Ga0495640_0259611 | Ga0495640_0259611_568_996 | 136 |
| 357 | 3300046535 | Ga0495586_0058305 | Ga0495586_0058305_765_1187 | 136 |
| 358 | 3300046536 | Ga0495587_0026476 | Ga0495587_0026476_2344_2766 | 136 |
| 359 | 3300046543 | Ga0495645_0023868 | Ga0495645_0023868_2062_2484 | 136 |
| 360 | 3300046559 | Ga0495667_0013520 | Ga0495667_0013520_1092_1514 | 136 |
| 361 | 3300046616 | Ga0495668_0830559 | Ga0495668_0830559_39_467 | 136 |
| 362 | 3300046642 | Ga0495634_0023026 | Ga0495634_0023026_1993_2415 | 136 |
| 363 | 3300046660 | Ga0495625_0227821 | Ga0495625_0227821_111_536 | 136 |
| 364 | 3300046663 | Ga0495635_0005046 | Ga0495635_0005046_2124_2546 | 136 |
| 365 | 3300046675 | Ga0495657_0006746 | Ga0495657_0006746_7575_7997 | 136 |
| 366 | 3300046678 | Ga0495599_0018262 | Ga0495599_0018262_2060_2482 | 136 |
| 367 | 3300046679 | Ga0495623_0028228 | Ga0495623_0028228_2315_2737 | 136 |
| 368 | 3300046680 | Ga0495646_0059626 | Ga0495646_0059626_1027_1449 | 136 |
| 369 | 3300046689 | Ga0495613_0079532 | Ga0495613_0079532_1170_1592 | 136 |
| 370 | 3300046694 | Ga0495649_0426574 | Ga0495649_0426574_35_463 | 136 |
| 371 | 3300046809 | Ga0495600_0203521 | Ga0495600_0203521_784_1206 | 136 |
| 372 | 3300047317 | Ga0495604_0017273 | Ga0495604_0017273_2030_2452 | 136 |
| 373 | 3300047319 | Ga0495674_0016021 | Ga0495674_0016021_2243_2665 | 136 |
| 374 | 3300047322 | Ga0495680_0029968 | Ga0495680_0029968_1983_2405 | 136 |
| 375 | 3300047444 | Ga0495675_0010988 | Ga0495675_0010988_2265_2687 | 136 |
| 376 | 3300047471 | Ga0495684_0017339 | Ga0495684_0017339_4025_4447 | 136 |
| 377 | 3300047472 | Ga0495686_0301838 | Ga0495686_0301838_388_816 | 136 |
| 378 | 3300047673 | Ga0495593_0063838 | Ga0495593_0063838_771_1193 | 136 |
| 379 | 3300048088 | Ga0495602_0024624 | Ga0495602_0024624_2070_2492 | 136 |
| 380 | 3300048907 | Ga0496104_0183798 | Ga0496104_0183798_152_580 | 136 |
| 381 | 3300048911 | Ga0496108_0546789 | Ga0496108_0546789_512_940 | 136 |
| 382 | 3300048911 | Ga0496108_0943533 | Ga0496108_0943533_206_631 | 136 |
| 383 | 3300048913 | Ga0496110_0432169 | Ga0496110_0432169_210_638 | 136 |
| 384 | 3300048913 | Ga0496110_1353795 | Ga0496110_1353795_48_476 | 136 |
| 385 | 3300048917 | Ga0496114_1355833 | Ga0496114_1355833_52_480 | 136 |
| 386 | 3300048920 | Ga0496117_0019308 | Ga0496117_0019308_1355_1777 | 136 |
| 387 | 3300048921 | Ga0496118_0171754 | Ga0496118_0171754_365_793 | 136 |
| 388 | 3300048921 | Ga0496118_0278678 | Ga0496118_0278678_239_691 | 136 |
| 389 | 3300048922 | Ga0496119_0156515 | Ga0496119_0156515_368_796 | 136 |
| 390 | 3300048922 | Ga0496119_0192971 | Ga0496119_0192971_115_543 | 136 |
| 391 | 3300048923 | Ga0496120_0242703 | Ga0496120_0242703_297_719 | 136 |
| 392 | 3300048923 | Ga0496120_0287691 | Ga0496120_0287691_302_730 | 136 |
| 393 | 3300048924 | Ga0496121_0031852 | Ga0496121_0031852_3003_3428 | 136 |
| 394 | 3300048924 | Ga0496121_0047386 | Ga0496121_0047386_1912_2340 | 136 |
| 395 | 3300048927 | Ga0496124_0076882 | Ga0496124_0076882_1187_1612 | 136 |
| 396 | 3300048927 | Ga0496124_0631911 | Ga0496124_0631911_102_524 | 136 |
| 397 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1466490_1466912 | 136 |
| 398 | 3300048928 | Ga0496125_0315875 | Ga0496125_0315875_197_625 | 136 |
| 399 | 3300048929 | Ga0496126_0150953 | Ga0496126_0150953_642_1064 | 136 |
| 400 | 3300048929 | Ga0496126_0457760 | Ga0496126_0457760_225_653 | 136 |
| 401 | 3300050491 | nmdc:mga00v17_409228_c1 | nmdc:mga00v17_409228_c1_349_777 | 136 |
| 402 | 3300050491 | nmdc:mga00v17_89664_c1 | nmdc:mga00v17_89664_c1_565_987 | 136 |
| 403 | 3300050492 | nmdc:mga0yw44_13202_c1 | nmdc:mga0yw44_13202_c1_2112_2540 | 136 |
| 404 | 3300050493 | nmdc:mga0k408_188285_c1 | nmdc:mga0k408_188285_c1_283_708 | 136 |
| 405 | 3300050494 | nmdc:mga06z11_660996_c1 | nmdc:mga06z11_660996_c1_165_593 | 136 |
| 406 | 3300050495 | nmdc:mga04h51_81320_c1 | nmdc:mga04h51_81320_c1_690_1118 | 136 |
| 407 | 3300050496 | nmdc:mga07m45_140253_c1 | nmdc:mga07m45_140253_c1_953_1378 | 136 |
| 408 | 3300050514 | nmdc:mga08x19_53446_c1 | nmdc:mga08x19_53446_c1_1827_2255 | 136 |
| 409 | 3300050516 | nmdc:mga0sz30_128957_c1 | nmdc:mga0sz30_128957_c1_234_659 | 136 |
| 410 | 3300053077 | Ga0495601_0023245 | Ga0495601_0023245_2102_2524 | 136 |
| 411 | 3300053078 | Ga0495612_0004910 | Ga0495612_0004910_2122_2544 | 136 |
| 412 | 3300053084 | Ga0495595_0013972 | Ga0495595_0013972_1002_1424 | 136 |
| 413 | 3300053085 | Ga0495619_0059570 | Ga0495619_0059570_1002_1424 | 136 |
| 414 | 3300053088 | Ga0500644_0185980 | Ga0500644_0185980_297_725 | 136 |
| 415 | 3300053091 | Ga0500647_0077502 | Ga0500647_0077502_480_908 | 136 |
| 416 | 3300053094 | Ga0500566_0004992 | Ga0500566_0004992_1034_1462 | 136 |
| 417 | 3300053098 | Ga0500650_0090027 | Ga0500650_0090027_296_724 | 136 |
| 418 | 3300053104 | Ga0500556_0164648 | Ga0500556_0164648_422_850 | 136 |
| 419 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_153944_154372 | 136 |
| 420 | 3300053108 | Ga0500562_010892 | Ga0500562_010892_603_1031 | 136 |
| 421 | 3300053118 | Ga0500594_0287001 | Ga0500594_0287001_70_492 | 136 |
| 422 | 3300053120 | Ga0500597_156333 | Ga0500597_156333_480_908 | 136 |
| 423 | 3300053130 | Ga0500642_0000221 | Ga0500642_0000221_13172_13600 | 136 |
| 424 | 3300053131 | Ga0500652_352014 | Ga0500652_352014_98_526 | 136 |
| 425 | 3300053136 | Ga0500559_0000205 | Ga0500559_0000205_8415_8840 | 136 |
| 426 | 3300053150 | Ga0500603_025190 | Ga0500603_025190_420_845 | 136 |
| 427 | 3300053156 | Ga0500622_0044431 | Ga0500622_0044431_726_1154 | 136 |
| 428 | 3300053160 | Ga0500633_0025087 | Ga0500633_0025087_1370_1798 | 136 |
| 429 | 3300053163 | Ga0500639_156676 | Ga0500639_156676_412_837 | 136 |
| 430 | 3300053177 | Ga0500636_0027461 | Ga0500636_0027461_207_632 | 136 |
| 431 | 3300053177 | Ga0500636_0340005 | Ga0500636_0340005_256_684 | 136 |
| 432 | 3300053725 | Ga0500576_065341 | Ga0500576_065341_1019_1444 | 136 |
| 433 | 3300053729 | Ga0500625_001974 | Ga0500625_001974_2139_2567 | 136 |
| 434 | 3300053730 | Ga0500645_051143 | Ga0500645_051143_420_848 | 136 |
| 435 | 3300053735 | Ga0500596_002653 | Ga0500596_002653_633_1058 | 136 |
| 436 | 3300053736 | Ga0500599_002156 | Ga0500599_002156_1571_1999 | 136 |
| 437 | 3300053737 | Ga0500601_000068 | Ga0500601_000068_20847_21275 | 136 |
| 438 | 3300053737 | Ga0500601_008028 | Ga0500601_008028_373_798 | 136 |
| 439 | 3300001989 | JGI24739J22299_10228874 | JGI24739J22299_102288741 | 137 |
| 440 | 3300002739 | JGI25158J39367_1000203 | JGI25158J39367_100020311 | 137 |
| 441 | 3300002773 | JGI25152J39213_1007422 | JGI25152J39213_10074223 | 137 |
| 442 | 3300002773 | JGI25152J39213_1010980 | JGI25152J39213_10109802 | 137 |
| 443 | 3300002773 | JGI25152J39213_1011625 | JGI25152J39213_10116252 | 137 |
| 444 | 3300002774 | JGI25150J39212_1000010 | JGI25150J39212_100001014 | 137 |
| 445 | 3300002774 | JGI25150J39212_1002390 | JGI25150J39212_10023903 | 137 |
| 446 | 3300002987 | JGI25159J45721_1000375 | JGI25159J45721_10003759 | 137 |
| 447 | 3300002987 | JGI25159J45721_1001546 | JGI25159J45721_10015463 | 137 |
| 448 | 3300003187 | JGI25151J46595_10000963 | JGI25151J46595_1000096318 | 137 |
| 449 | 3300003187 | JGI25151J46595_10023768 | JGI25151J46595_100237683 | 137 |
| 450 | 3300003187 | JGI25151J46595_10123433 | JGI25151J46595_101234331 | 137 |
| 451 | 3300003214 | JGI25165J46597_1001522 | JGI25165J46597_10015222 | 137 |
| 452 | 3300003214 | JGI25165J46597_1003278 | JGI25165J46597_10032782 | 137 |
| 453 | 3300003215 | JGI25153J46596_10010280 | JGI25153J46596_100102803 | 137 |
| 454 | 3300003215 | JGI25153J46596_10011377 | JGI25153J46596_100113773 | 137 |
| 455 | 3300003215 | JGI25153J46596_10026844 | JGI25153J46596_100268442 | 137 |
| 456 | 3300003215 | JGI25153J46596_10028546 | JGI25153J46596_100285463 | 137 |
| 457 | 3300003354 | JGI25160J50197_1000004 | JGI25160J50197_1000004133 | 137 |
| 458 | 3300003354 | JGI25160J50197_1003985 | JGI25160J50197_10039853 | 137 |
| 459 | 3300003354 | JGI25160J50197_1006150 | JGI25160J50197_10061502 | 137 |
| 460 | 3300003374 | JGI25161J50226_1000003 | JGI25161J50226_1000003295 | 137 |
| 461 | 3300003374 | JGI25161J50226_1000053 | JGI25161J50226_100005385 | 137 |
| 462 | 3300003578 | Ga0006562J51391_1167839 | Ga0006562J51391_11678391 | 137 |
| 463 | 3300003771 | Ga0055526_1004529 | Ga0055526_10045297 | 137 |
| 464 | 3300003771 | Ga0055526_1011035 | Ga0055526_10110355 | 137 |
| 465 | 3300003771 | Ga0055526_1012038 | Ga0055526_10120384 | 137 |
| 466 | 3300003775 | Ga0055524_1002391 | Ga0055524_100239111 | 137 |
| 467 | 3300003775 | Ga0055524_1005341 | Ga0055524_10053415 | 137 |
| 468 | 3300003775 | Ga0055524_1026057 | Ga0055524_10260573 | 137 |
| 469 | 3300003775 | Ga0055524_1096043 | Ga0055524_10960431 | 137 |
| 470 | 3300003790 | Ga0055528_1001259 | Ga0055528_10012593 | 137 |
| 471 | 3300003790 | Ga0055528_1007090 | Ga0055528_10070904 | 137 |
| 472 | 3300003790 | Ga0055528_1008280 | Ga0055528_10082802 | 137 |
| 473 | 3300003790 | Ga0055528_1015143 | Ga0055528_10151432 | 137 |
| 474 | 3300003790 | Ga0055528_1045324 | Ga0055528_10453242 | 137 |
| 475 | 3300003790 | Ga0055528_1085874 | Ga0055528_10858741 | 137 |
| 476 | 3300003792 | Ga0055540_1004558 | Ga0055540_10045587 | 137 |
| 477 | 3300004625 | Ga0055543_1000001 | Ga0055543_1000001301 | 137 |
| 478 | 3300004625 | Ga0055543_1000019 | Ga0055543_100001973 | 137 |
| 479 | 3300005262 | Ga0065165_1000049 | Ga0065165_1000049111 | 137 |
| 480 | 3300005262 | Ga0065165_1003862 | Ga0065165_10038623 | 137 |
| 481 | 3300005262 | Ga0065165_1016822 | Ga0065165_10168222 | 137 |
| 482 | 3300005337 | Ga0070682_100363514 | Ga0070682_1003635142 | 137 |
| 483 | 3300005347 | Ga0070668_100523386 | Ga0070668_1005233862 | 137 |
| 484 | 3300005353 | Ga0070669_100202824 | Ga0070669_1002028242 | 137 |
| 485 | 3300005355 | Ga0070671_100009983 | Ga0070671_1000099834 | 137 |
| 486 | 3300005455 | Ga0070663_100171354 | Ga0070663_1001713542 | 137 |
| 487 | 3300005457 | Ga0070662_101780103 | Ga0070662_1017801031 | 137 |
| 488 | 3300005548 | Ga0070665_100124357 | Ga0070665_1001243573 | 137 |
| 489 | 3300005548 | Ga0070665_100147810 | Ga0070665_1001478103 | 137 |
| 490 | 3300005614 | Ga0068856_100353269 | Ga0068856_1003532692 | 137 |
| 491 | 3300005618 | Ga0068864_100940407 | Ga0068864_1009404071 | 137 |
| 492 | 3300005834 | Ga0068851_10229384 | Ga0068851_102293842 | 137 |
| 493 | 3300006038 | Ga0075365_10001979 | Ga0075365_100019796 | 137 |
| 494 | 3300006042 | Ga0075368_10012039 | Ga0075368_100120393 | 137 |
| 495 | 3300006048 | Ga0075363_100476658 | Ga0075363_1004766582 | 137 |
| 496 | 3300006178 | Ga0075367_10037815 | Ga0075367_100378154 | 137 |
| 497 | 3300006178 | Ga0075367_10239480 | Ga0075367_102394802 | 137 |
| 498 | 3300006178 | Ga0075367_10341743 | Ga0075367_103417432 | 137 |
| 499 | 3300006186 | Ga0075369_10029415 | Ga0075369_100294153 | 137 |
| 500 | 3300006186 | Ga0075369_10208988 | Ga0075369_102089881 | 137 |
| 501 | 3300006353 | Ga0075370_10044632 | Ga0075370_100446322 | 137 |
| 502 | 3300006353 | Ga0075370_10173705 | Ga0075370_101737052 | 137 |
| 503 | 3300006353 | Ga0075370_10292582 | Ga0075370_102925821 | 137 |
| 504 | 3300009011 | Ga0105251_10024498 | Ga0105251_100244983 | 137 |
| 505 | 3300009036 | Ga0105244_10289759 | Ga0105244_102897592 | 137 |
| 506 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005292 | 137 |
| 507 | 3300009101 | Ga0105247_10170980 | Ga0105247_101709803 | 137 |
| 508 | 3300009177 | Ga0105248_10312069 | Ga0105248_103120692 | 137 |
| 509 | 3300009177 | Ga0105248_10892933 | Ga0105248_108929332 | 137 |
| 510 | 3300009545 | Ga0105237_10001912 | Ga0105237_1000191210 | 137 |
| 511 | 3300009551 | Ga0105238_10304692 | Ga0105238_103046921 | 137 |
| 512 | 3300009766 | Ga0123342_1014422 | Ga0123342_10144228 | 137 |
| 513 | 3300010375 | Ga0105239_10025467 | Ga0105239_100254673 | 137 |
| 514 | 3300010375 | Ga0105239_10094741 | Ga0105239_100947412 | 137 |
| 515 | 3300011119 | Ga0105246_12444512 | Ga0105246_124445121 | 137 |
| 516 | 3300013104 | Ga0157370_10012298 | Ga0157370_100122989 | 137 |
| 517 | 3300013105 | Ga0157369_10177932 | Ga0157369_101779323 | 137 |
| 518 | 3300014325 | Ga0163163_10900814 | Ga0163163_109008142 | 137 |
| 519 | 3300015265 | Ga0182005_1003211 | Ga0182005_10032116 | 137 |
| 520 | 3300025208 | Ga0209436_101419 | Ga0209436_1014197 | 137 |
| 521 | 3300025233 | Ga0209437_100153 | Ga0209437_10015311 | 137 |
| 522 | 3300025245 | Ga0207425_1000010 | Ga0207425_1000010343 | 137 |
| 523 | 3300025245 | Ga0207425_1001355 | Ga0207425_100135510 | 137 |
| 524 | 3300025245 | Ga0207425_1016225 | Ga0207425_10162252 | 137 |
| 525 | 3300025245 | Ga0207425_1022286 | Ga0207425_10222862 | 137 |
| 526 | 3300025258 | Ga0209129_1000099 | Ga0209129_1000099158 | 137 |
| 527 | 3300025258 | Ga0209129_1001480 | Ga0209129_100148012 | 137 |
| 528 | 3300025258 | Ga0209129_1003212 | Ga0209129_10032122 | 137 |
| 529 | 3300025258 | Ga0209129_1003724 | Ga0209129_10037245 | 137 |
| 530 | 3300025261 | Ga0209233_1000603 | Ga0209233_100060316 | 137 |
| 531 | 3300025261 | Ga0209233_1001023 | Ga0209233_100102311 | 137 |
| 532 | 3300025273 | Ga0209673_1000068 | Ga0209673_1000068146 | 137 |
| 533 | 3300025273 | Ga0209673_1000456 | Ga0209673_100045613 | 137 |
| 534 | 3300025273 | Ga0209673_1004030 | Ga0209673_10040307 | 137 |
| 535 | 3300025273 | Ga0209673_1007166 | Ga0209673_10071662 | 137 |
| 536 | 3300025273 | Ga0209673_1026893 | Ga0209673_10268931 | 137 |
| 537 | 3300025273 | Ga0209673_1029066 | Ga0209673_10290662 | 137 |
| 538 | 3300025273 | Ga0209673_1109705 | Ga0209673_11097051 | 137 |
| 539 | 3300025284 | Ga0209130_1000012 | Ga0209130_1000012133 | 137 |
| 540 | 3300025284 | Ga0209130_1000097 | Ga0209130_100009715 | 137 |
| 541 | 3300025284 | Ga0209130_1034284 | Ga0209130_10342842 | 137 |
| 542 | 3300025291 | Ga0209675_1042390 | Ga0209675_10423902 | 137 |
| 543 | 3300025292 | Ga0209676_1018072 | Ga0209676_10180722 | 137 |
| 544 | 3300025294 | Ga0209025_1000022 | Ga0209025_1000022239 | 137 |
| 545 | 3300025294 | Ga0209025_1017508 | Ga0209025_10175083 | 137 |
| 546 | 3300025294 | Ga0209025_1027572 | Ga0209025_10275724 | 137 |
| 547 | 3300025294 | Ga0209025_1040416 | Ga0209025_10404162 | 137 |
| 548 | 3300025294 | Ga0209025_1041227 | Ga0209025_10412274 | 137 |
| 549 | 3300025294 | Ga0209025_1144202 | Ga0209025_11442022 | 137 |
| 550 | 3300025295 | Ga0209564_1000453 | Ga0209564_100045372 | 137 |
| 551 | 3300025295 | Ga0209564_1002007 | Ga0209564_100200710 | 137 |
| 552 | 3300025295 | Ga0209564_1005994 | Ga0209564_10059943 | 137 |
| 553 | 3300025295 | Ga0209564_1010984 | Ga0209564_10109841 | 137 |
| 554 | 3300025295 | Ga0209564_1049204 | Ga0209564_10492043 | 137 |
| 555 | 3300025297 | Ga0209758_1000086 | Ga0209758_100008619 | 137 |
| 556 | 3300025297 | Ga0209758_1002381 | Ga0209758_100238111 | 137 |
| 557 | 3300025297 | Ga0209758_1004908 | Ga0209758_10049089 | 137 |
| 558 | 3300025297 | Ga0209758_1010888 | Ga0209758_10108883 | 137 |
| 559 | 3300025299 | Ga0209256_1001416 | Ga0209256_100141624 | 137 |
| 560 | 3300025299 | Ga0209256_1006050 | Ga0209256_10060506 | 137 |
| 561 | 3300025299 | Ga0209256_1009939 | Ga0209256_10099393 | 137 |
| 562 | 3300025299 | Ga0209256_1018071 | Ga0209256_10180713 | 137 |
| 563 | 3300025299 | Ga0209256_1024619 | Ga0209256_10246193 | 137 |
| 564 | 3300025299 | Ga0209256_1026897 | Ga0209256_10268971 | 137 |
| 565 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003850 | 137 |
| 566 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010492 | 137 |
| 567 | 3300025302 | Ga0207426_1000854 | Ga0207426_100085430 | 137 |
| 568 | 3300025303 | Ga0209051_1005436 | Ga0209051_10054365 | 137 |
| 569 | 3300025304 | Ga0209257_1033722 | Ga0209257_10337223 | 137 |
| 570 | 3300025321 | Ga0207656_10162050 | Ga0207656_101620502 | 137 |
| 571 | 3300025900 | Ga0207710_10562915 | Ga0207710_105629151 | 137 |
| 572 | 3300025903 | Ga0207680_10811944 | Ga0207680_108119441 | 137 |
| 573 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011622 | 137 |
| 574 | 3300025914 | Ga0207671_10017031 | Ga0207671_100170316 | 137 |
| 575 | 3300025914 | Ga0207671_10689966 | Ga0207671_106899662 | 137 |
| 576 | 3300025923 | Ga0207681_11072352 | Ga0207681_110723522 | 137 |
| 577 | 3300025924 | Ga0207694_11146646 | Ga0207694_111466461 | 137 |
| 578 | 3300025931 | Ga0207644_10046192 | Ga0207644_100461924 | 137 |
| 579 | 3300025941 | Ga0207711_10616777 | Ga0207711_106167772 | 137 |
| 580 | 3300025941 | Ga0207711_10678077 | Ga0207711_106780772 | 137 |
| 581 | 3300025986 | Ga0207658_11629899 | Ga0207658_116298991 | 137 |
| 582 | 3300027866 | Ga0209813_10305543 | Ga0209813_103055431 | 137 |
| 583 | 3300028379 | Ga0268266_10103826 | Ga0268266_101038262 | 137 |
| 584 | 3300028379 | Ga0268266_10170818 | Ga0268266_101708182 | 137 |
| 585 | 3300028794 | Ga0307515_10000274 | Ga0307515_1000027433 | 137 |
| 586 | 3300031456 | Ga0307513_10130415 | Ga0307513_101304152 | 137 |
| 587 | 3300031731 | Ga0307405_10145326 | Ga0307405_101453261 | 137 |
| 588 | 3300031901 | Ga0307406_10815341 | Ga0307406_108153411 | 137 |
| 589 | 3300031911 | Ga0307412_10006135 | Ga0307412_100061352 | 137 |
| 590 | 3300031911 | Ga0307412_10516612 | Ga0307412_105166122 | 137 |
| 591 | 3300037471 | Ga0395905_0404181 | Ga0395905_0404181_710_1135 | 137 |
| 592 | 3300041413 | Ga0439465_0015497 | Ga0439465_0015497_720_1148 | 137 |
| 593 | 3300041456 | Ga0451795_0917465 | Ga0451795_0917465_1754_2185 | 137 |
| 594 | 3300042006 | Ga0439432_242193 | Ga0439432_242193_18_449 | 137 |
| 595 | 3300042007 | Ga0439449_0034252 | Ga0439449_0034252_260_691 | 137 |
| 596 | 3300044901 | Ga0466960_0099571 | Ga0466960_0099571_71_493 | 137 |
| 597 | 3300046455 | Ga0495603_0227817 | Ga0495603_0227817_359_784 | 137 |
| 598 | 3300046457 | Ga0495590_0148034 | Ga0495590_0148034_102_530 | 137 |
| 599 | 3300046460 | Ga0495638_0000924 | Ga0495638_0000924_2896_3321 | 137 |
| 600 | 3300046471 | Ga0495650_0176812 | Ga0495650_0176812_69_494 | 137 |
| 601 | 3300046474 | Ga0495605_0002088 | Ga0495605_0002088_10531_11013 | 137 |
| 602 | 3300046492 | Ga0495585_0019211 | Ga0495585_0019211_469_951 | 137 |
| 603 | 3300046492 | Ga0495585_0036462 | Ga0495585_0036462_1360_1785 | 137 |
| 604 | 3300046492 | Ga0495585_0169541 | Ga0495585_0169541_570_995 | 137 |
| 605 | 3300046501 | Ga0495607_0123602 | Ga0495607_0123602_350_778 | 137 |
| 606 | 3300046501 | Ga0495607_0397603 | Ga0495607_0397603_23_448 | 137 |
| 607 | 3300046506 | Ga0495583_0008910 | Ga0495583_0008910_4028_4510 | 137 |
| 608 | 3300046506 | Ga0495583_0020660 | Ga0495583_0020660_1835_2260 | 137 |
| 609 | 3300046507 | Ga0495606_0155356 | Ga0495606_0155356_255_683 | 137 |
| 610 | 3300046507 | Ga0495606_0198382 | Ga0495606_0198382_482_910 | 137 |
| 611 | 3300046507 | Ga0495606_0490591 | Ga0495606_0490591_160_588 | 137 |
| 612 | 3300046512 | Ga0495610_0008057 | Ga0495610_0008057_4531_4956 | 137 |
| 613 | 3300046512 | Ga0495610_0044905 | Ga0495610_0044905_61_489 | 137 |
| 614 | 3300046512 | Ga0495610_0156580 | Ga0495610_0156580_210_635 | 137 |
| 615 | 3300046513 | Ga0495616_0042395 | Ga0495616_0042395_1162_1644 | 137 |
| 616 | 3300046515 | Ga0495620_0155116 | Ga0495620_0155116_334_759 | 137 |
| 617 | 3300046518 | Ga0495631_0001767 | Ga0495631_0001767_1551_2033 | 137 |
| 618 | 3300046519 | Ga0495632_0014213 | Ga0495632_0014213_3546_3971 | 137 |
| 619 | 3300046519 | Ga0495632_0032163 | Ga0495632_0032163_1650_2132 | 137 |
| 620 | 3300046522 | Ga0495643_0063611 | Ga0495643_0063611_1174_1599 | 137 |
| 621 | 3300046522 | Ga0495643_0195253 | Ga0495643_0195253_121_549 | 137 |
| 622 | 3300046522 | Ga0495643_0319325 | Ga0495643_0319325_174_602 | 137 |
| 623 | 3300046524 | Ga0495648_0323226 | Ga0495648_0323226_200_682 | 137 |
| 624 | 3300046530 | Ga0495654_0058513 | Ga0495654_0058513_494_976 | 137 |
| 625 | 3300046538 | Ga0495609_0060724 | Ga0495609_0060724_499_981 | 137 |
| 626 | 3300046558 | Ga0495633_0019885 | Ga0495633_0019885_1562_1987 | 137 |
| 627 | 3300046615 | Ga0495656_0040691 | Ga0495656_0040691_1261_1686 | 137 |
| 628 | 3300046616 | Ga0495668_0008078 | Ga0495668_0008078_1369_1851 | 137 |
| 629 | 3300046616 | Ga0495668_0297096 | Ga0495668_0297096_62_487 | 137 |
| 630 | 3300046648 | Ga0495611_0012991 | Ga0495611_0012991_1707_2189 | 137 |
| 631 | 3300046660 | Ga0495625_0002947 | Ga0495625_0002947_1466_1948 | 137 |
| 632 | 3300046660 | Ga0495625_0067482 | Ga0495625_0067482_1080_1505 | 137 |
| 633 | 3300046660 | Ga0495625_0281404 | Ga0495625_0281404_322_747 | 137 |
| 634 | 3300046665 | Ga0495661_0325889 | Ga0495661_0325889_12_437 | 137 |
| 635 | 3300046674 | Ga0495588_0076451 | Ga0495588_0076451_189_614 | 137 |
| 636 | 3300046674 | Ga0495588_0091671 | Ga0495588_0091671_639_1067 | 137 |
| 637 | 3300046691 | Ga0495670_0067902 | Ga0495670_0067902_1179_1661 | 137 |
| 638 | 3300046691 | Ga0495670_0135256 | Ga0495670_0135256_106_531 | 137 |
| 639 | 3300046810 | Ga0495660_0037984 | Ga0495660_0037984_862_1344 | 137 |
| 640 | 3300047320 | Ga0495672_0051214 | Ga0495672_0051214_358_783 | 137 |
| 641 | 3300047469 | Ga0495673_0074912 | Ga0495673_0074912_792_1217 | 137 |
| 642 | 3300047469 | Ga0495673_0139694 | Ga0495673_0139694_210_635 | 137 |
| 643 | 3300047469 | Ga0495673_0316917 | Ga0495673_0316917_60_485 | 137 |
| 644 | 3300047470 | Ga0495681_0088898 | Ga0495681_0088898_183_608 | 137 |
| 645 | 3300047472 | Ga0495686_0030036 | Ga0495686_0030036_1610_2035 | 137 |
| 646 | 3300048904 | Ga0496101_0107850 | Ga0496101_0107850_1559_1984 | 137 |
| 647 | 3300048904 | Ga0496101_0136833 | Ga0496101_0136833_1276_1704 | 137 |
| 648 | 3300048905 | Ga0496102_0180722 | Ga0496102_0180722_849_1277 | 137 |
| 649 | 3300048905 | Ga0496102_0316387 | Ga0496102_0316387_992_1417 | 137 |
| 650 | 3300048905 | Ga0496102_0680122 | Ga0496102_0680122_400_825 | 137 |
| 651 | 3300048906 | Ga0496103_0644673 | Ga0496103_0644673_53_481 | 137 |
| 652 | 3300048907 | Ga0496104_0669354 | Ga0496104_0669354_412_837 | 137 |
| 653 | 3300048908 | Ga0496105_0065235 | Ga0496105_0065235_1612_2037 | 137 |
| 654 | 3300048909 | Ga0496106_0020301 | Ga0496106_0020301_3378_3806 | 137 |
| 655 | 3300048910 | Ga0496107_0113748 | Ga0496107_0113748_1502_1927 | 137 |
| 656 | 3300048910 | Ga0496107_0763152 | Ga0496107_0763152_144_572 | 137 |
| 657 | 3300048911 | Ga0496108_0413585 | Ga0496108_0413585_386_811 | 137 |
| 658 | 3300048914 | Ga0496111_0243105 | Ga0496111_0243105_438_863 | 137 |
| 659 | 3300048917 | Ga0496114_1256261 | Ga0496114_1256261_123_548 | 137 |
| 660 | 3300048919 | Ga0496116_0016230 | Ga0496116_0016230_3591_4016 | 137 |
| 661 | 3300048919 | Ga0496116_0017063 | Ga0496116_0017063_1637_2065 | 137 |
| 662 | 3300048919 | Ga0496116_0028311 | Ga0496116_0028311_1033_1458 | 137 |
| 663 | 3300048919 | Ga0496116_0068234 | Ga0496116_0068234_1209_1634 | 137 |
| 664 | 3300048919 | Ga0496116_0140463 | Ga0496116_0140463_445_876 | 137 |
| 665 | 3300048919 | Ga0496116_0182505 | Ga0496116_0182505_442_867 | 137 |
| 666 | 3300048919 | Ga0496116_0186017 | Ga0496116_0186017_328_753 | 137 |
| 667 | 3300048919 | Ga0496116_0292112 | Ga0496116_0292112_166_594 | 137 |
| 668 | 3300048920 | Ga0496117_0028796 | Ga0496117_0028796_925_1353 | 137 |
| 669 | 3300048920 | Ga0496117_0036604 | Ga0496117_0036604_2452_2877 | 137 |
| 670 | 3300048920 | Ga0496117_0053053 | Ga0496117_0053053_1252_1680 | 137 |
| 671 | 3300048921 | Ga0496118_0045143 | Ga0496118_0045143_2106_2531 | 137 |
| 672 | 3300048921 | Ga0496118_0053336 | Ga0496118_0053336_1507_1935 | 137 |
| 673 | 3300048921 | Ga0496118_0089530 | Ga0496118_0089530_720_1148 | 137 |
| 674 | 3300048922 | Ga0496119_0103330 | Ga0496119_0103330_231_656 | 137 |
| 675 | 3300048922 | Ga0496119_0217924 | Ga0496119_0217924_474_902 | 137 |
| 676 | 3300048923 | Ga0496120_0044203 | Ga0496120_0044203_1241_1663 | 137 |
| 677 | 3300048923 | Ga0496120_0095205 | Ga0496120_0095205_1118_1546 | 137 |
| 678 | 3300048923 | Ga0496120_0233822 | Ga0496120_0233822_77_505 | 137 |
| 679 | 3300048924 | Ga0496121_0024624 | Ga0496121_0024624_1536_1964 | 137 |
| 680 | 3300048924 | Ga0496121_0026935 | Ga0496121_0026935_1632_2060 | 137 |
| 681 | 3300048924 | Ga0496121_0063557 | Ga0496121_0063557_1339_1764 | 137 |
| 682 | 3300048924 | Ga0496121_0083709 | Ga0496121_0083709_841_1266 | 137 |
| 683 | 3300048924 | Ga0496121_0104740 | Ga0496121_0104740_354_782 | 137 |
| 684 | 3300048924 | Ga0496121_0115298 | Ga0496121_0115298_606_1034 | 137 |
| 685 | 3300048924 | Ga0496121_0176439 | Ga0496121_0176439_459_887 | 137 |
| 686 | 3300048924 | Ga0496121_0333464 | Ga0496121_0333464_331_759 | 137 |
| 687 | 3300048924 | Ga0496121_0372974 | Ga0496121_0372974_418_846 | 137 |
| 688 | 3300048925 | Ga0496122_0018692 | Ga0496122_0018692_4664_5092 | 137 |
| 689 | 3300048925 | Ga0496122_0133519 | Ga0496122_0133519_886_1314 | 137 |
| 690 | 3300048925 | Ga0496122_0157882 | Ga0496122_0157882_320_745 | 137 |
| 691 | 3300048925 | Ga0496122_0232318 | Ga0496122_0232318_18_443 | 137 |
| 692 | 3300048925 | Ga0496122_0444030 | Ga0496122_0444030_74_496 | 137 |
| 693 | 3300048926 | Ga0496123_0019646 | Ga0496123_0019646_2103_2531 | 137 |
| 694 | 3300048926 | Ga0496123_0033047 | Ga0496123_0033047_2605_3030 | 137 |
| 695 | 3300048926 | Ga0496123_0102808 | Ga0496123_0102808_74_499 | 137 |
| 696 | 3300048926 | Ga0496123_0107142 | Ga0496123_0107142_908_1336 | 137 |
| 697 | 3300048926 | Ga0496123_0194328 | Ga0496123_0194328_338_763 | 137 |
| 698 | 3300048926 | Ga0496123_0195585 | Ga0496123_0195585_414_842 | 137 |
| 699 | 3300048927 | Ga0496124_0000740 | Ga0496124_0000740_4613_5047 | 137 |
| 700 | 3300048927 | Ga0496124_0003528 | Ga0496124_0003528_13316_13741 | 137 |
| 701 | 3300048927 | Ga0496124_0015170 | Ga0496124_0015170_5016_5444 | 137 |
| 702 | 3300048927 | Ga0496124_0070523 | Ga0496124_0070523_1430_1855 | 137 |
| 703 | 3300048927 | Ga0496124_0112962 | Ga0496124_0112962_922_1347 | 137 |
| 704 | 3300048927 | Ga0496124_0115460 | Ga0496124_0115460_1067_1495 | 137 |
| 705 | 3300048927 | Ga0496124_0142400 | Ga0496124_0142400_196_621 | 137 |
| 706 | 3300048927 | Ga0496124_0181096 | Ga0496124_0181096_164_592 | 137 |
| 707 | 3300048927 | Ga0496124_0237326 | Ga0496124_0237326_341_766 | 137 |
| 708 | 3300048927 | Ga0496124_0294641 | Ga0496124_0294641_437_865 | 137 |
| 709 | 3300048927 | Ga0496124_0412763 | Ga0496124_0412763_20_448 | 137 |
| 710 | 3300048928 | Ga0496125_0009489 | Ga0496125_0009489_945_1373 | 137 |
| 711 | 3300048928 | Ga0496125_0064559 | Ga0496125_0064559_886_1314 | 137 |
| 712 | 3300048928 | Ga0496125_0100953 | Ga0496125_0100953_544_972 | 137 |
| 713 | 3300048928 | Ga0496125_0227912 | Ga0496125_0227912_435_863 | 137 |
| 714 | 3300048928 | Ga0496125_0479030 | Ga0496125_0479030_95_520 | 137 |
| 715 | 3300048928 | Ga0496125_0491878 | Ga0496125_0491878_214_636 | 137 |
| 716 | 3300048928 | Ga0496125_0543013 | Ga0496125_0543013_167_589 | 137 |
| 717 | 3300048929 | Ga0496126_0036666 | Ga0496126_0036666_177_602 | 137 |
| 718 | 3300048929 | Ga0496126_0069234 | Ga0496126_0069234_1816_2244 | 137 |
| 719 | 3300048929 | Ga0496126_0545355 | Ga0496126_0545355_317_748 | 137 |
| 720 | 3300048929 | Ga0496126_0796633 | Ga0496126_0796633_65_493 | 137 |
| 721 | 3300049459 | Ga0495678_036147 | Ga0495678_036147_713_1195 | 137 |
| 722 | 3300049459 | Ga0495678_102061 | Ga0495678_102061_260_685 | 137 |
| 723 | 3300049460 | Ga0495682_0082097 | Ga0495682_0082097_441_923 | 137 |
| 724 | 3300049568 | Ga0501031_0388071 | Ga0501031_0388071_101_529 | 137 |
| 725 | 3300049569 | Ga0501032_0896568 | Ga0501032_0896568_59_487 | 137 |
| 726 | 3300049570 | Ga0501033_0621784 | Ga0501033_0621784_180_608 | 137 |
| 727 | 3300049571 | Ga0501034_0327332 | Ga0501034_0327332_750_1181 | 137 |
| 728 | 3300049573 | Ga0501037_0303866 | Ga0501037_0303866_43_471 | 137 |
| 729 | 3300049574 | Ga0501038_0306378 | Ga0501038_0306378_572_1000 | 137 |
| 730 | 3300049581 | Ga0501047_0709454 | Ga0501047_0709454_345_773 | 137 |
| 731 | 3300049582 | Ga0501048_0252607 | Ga0501048_0252607_489_917 | 137 |
| 732 | 3300049584 | Ga0501068_0594418 | Ga0501068_0594418_217_645 | 137 |
| 733 | 3300049589 | Ga0501073_0344337 | Ga0501073_0344337_123_551 | 137 |
| 734 | 3300049589 | Ga0501073_0360914 | Ga0501073_0360914_311_742 | 137 |
| 735 | 3300049679 | Ga0501249_209831 | Ga0501249_209831_27_458 | 137 |
| 736 | 3300049742 | Ga0501080_0048758 | Ga0501080_0048758_825_1256 | 137 |
| 737 | 3300049744 | Ga0501083_0440314 | Ga0501083_0440314_138_566 | 137 |
| 738 | 3300049822 | Ga0501035_0821801 | Ga0501035_0821801_52_480 | 137 |
| 739 | 3300049823 | Ga0501044_0618194 | Ga0501044_0618194_171_599 | 137 |
| 740 | 3300050492 | nmdc:mga0yw44_471439_c1 | nmdc:mga0yw44_471439_c1_380_811 | 137 |
| 741 | 3300050496 | nmdc:mga07m45_402457_c1 | nmdc:mga07m45_402457_c1_22_447 | 137 |
| 742 | 3300050516 | nmdc:mga0sz30_169687_c1 | nmdc:mga0sz30_169687_c1_377_805 | 137 |
| 743 | 3300050516 | nmdc:mga0sz30_76189_c1 | nmdc:mga0sz30_76189_c1_251_664 | 137 |
| 744 | 3300053079 | Ga0500610_0039853 | Ga0500610_0039853_1782_2264 | 137 |
| 745 | 3300053088 | Ga0500644_0244704 | Ga0500644_0244704_244_672 | 137 |
| 746 | 3300053088 | Ga0500644_0318784 | Ga0500644_0318784_117_542 | 137 |
| 747 | 3300053093 | Ga0500651_0170834 | Ga0500651_0170834_564_992 | 137 |
| 748 | 3300053104 | Ga0500556_0341764 | Ga0500556_0341764_124_549 | 137 |
| 749 | 3300053105 | Ga0500557_009624 | Ga0500557_009624_337_819 | 137 |
| 750 | 3300053108 | Ga0500562_034535 | Ga0500562_034535_563_988 | 137 |
| 751 | 3300053108 | Ga0500562_078000 | Ga0500562_078000_349_777 | 137 |
| 752 | 3300053109 | Ga0500569_022939 | Ga0500569_022939_436_918 | 137 |
| 753 | 3300053118 | Ga0500594_0002914 | Ga0500594_0002914_1662_2144 | 137 |
| 754 | 3300053125 | Ga0500618_010538 | Ga0500618_010538_1664_2089 | 137 |
| 755 | 3300053125 | Ga0500618_027174 | Ga0500618_027174_539_967 | 137 |
| 756 | 3300053134 | Ga0500658_0094335 | Ga0500658_0094335_648_1076 | 137 |
| 757 | 3300053134 | Ga0500658_0266967 | Ga0500658_0266967_219_644 | 137 |
| 758 | 3300053139 | Ga0500568_0002640 | Ga0500568_0002640_8708_9136 | 137 |
| 759 | 3300053139 | Ga0500568_0003244 | Ga0500568_0003244_1646_2071 | 137 |
| 760 | 3300053139 | Ga0500568_0083766 | Ga0500568_0083766_368_796 | 137 |
| 761 | 3300053146 | Ga0500588_0028853 | Ga0500588_0028853_378_860 | 137 |
| 762 | 3300053153 | Ga0500616_0003914 | Ga0500616_0003914_405_830 | 137 |
| 763 | 3300053156 | Ga0500622_0003496 | Ga0500622_0003496_1201_1629 | 137 |
| 764 | 3300053157 | Ga0500624_119333 | Ga0500624_119333_72_497 | 137 |
| 765 | 3300053158 | Ga0500627_0168049 | Ga0500627_0168049_338_769 | 137 |
| 766 | 3300053160 | Ga0500633_0022893 | Ga0500633_0022893_622_1050 | 137 |
| 767 | 3300053160 | Ga0500633_0251869 | Ga0500633_0251869_189_614 | 137 |
| 768 | 3300053161 | Ga0500634_0017698 | Ga0500634_0017698_2204_2629 | 137 |
| 769 | 3300053161 | Ga0500634_0301202 | Ga0500634_0301202_16_441 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lb5-assembly2.cif.gz_D | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9601 | 3 | 137 |
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9571 | 3 | 137 |
| 3lb5-assembly2.cif.gz_D | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9529 | 3 | 137 |
| 3lb5-assembly1.cif.gz_B | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9528 | 2 | 137 |
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9501 | 3 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9571 | 3 | 137 | 3.30.428.10 |
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9501 | 3 | 137 | 3.30.428.10 |
| af_Q0IQH7_1_86_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9353 | 42 | 112 | 3.30.428.10 |
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9277 | 22 | 108 | 3.30.428.10 |
| 1y23D01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9224 | 7 | 112 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4TTG7-F1-model_v4 | HIT family protein | 0.9645 | 2 | 136 |
GO:0003824
GO:0009117 |
| AF-A0A090MML9-F1-model_v4 | HIT-like protein | 0.9638 | 1 | 136 |
GO:0003824
GO:0009117 |
| AF-B6JAW3-F1-model_v4 | Histidine triad (HIT) family protein | 0.9628 | 1 | 136 |
GO:0003824
GO:0009117 |
| AF-A0A537U9I5-F1-model_v4 | HIT family protein | 0.9627 | 1 | 136 |
GO:0003824
GO:0009117 |
| AF-E0MK44-F1-model_v4 | HIT domain-containing protein | 0.9611 | 1 | 136 |
GO:0003824
GO:0009117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar