F480003

General Info

Members Datasets Scaffolds Average Seq Length
769 502 610 141

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0002088|Ga0495605_0002088_10531_11013
Length 160
Sequence LTFPPLPRYRTVDDMRRNRMTSPAYDDTNIFAKILRAEIPSHRVYEDEHTVALMDVMPQAPGHVLVVPKAPSRNIFDADPAVLSRTIPVVQKIANAVKEAFDADGVLVCQFNEPVAGQTIFHLHFHVIPRHEGVALKPHSGKMEDGAVLAANAEKIRAEL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
17 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
18 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
19 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
20 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
21 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
22 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
23 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
24 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
25 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
26 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
27 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
28 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
29 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
30 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
31 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
32 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
33 2643221599 Rhizobium sp. Root708 Isolate Unclassified
34 2643221607 Rhizobium sp. Root73 Isolate Unclassified
35 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
36 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
37 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
38 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
39 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
40 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
41 2643221718 Rhizobium sp. Root268 Isolate Unclassified
42 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
43 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
44 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
45 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
46 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
47 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
48 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
49 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
50 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
51 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
52 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
53 2738541293 Rhizobium sp. GV031 Isolate Unclassified
54 2751185800 Brucella pituitosa AA2 Isolate Unclassified
55 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
56 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
57 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
58 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
59 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
60 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
61 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
62 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
63 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
64 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
65 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
66 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
67 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
68 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
71 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
72 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
73 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
74 2842694124 Methylopila sp. R-72369 Isolate Unclassified
75 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
76 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
77 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
78 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
79 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
80 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
81 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
82 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
83 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
84 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
85 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
86 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
87 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
88 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
89 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
90 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
91 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
92 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
93 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
94 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
95 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
96 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
97 2909042592 Labrys sp. LIt4 Isolate Nodule
98 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
99 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
100 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
101 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
102 2933599457 Rhizobium phaseoli M3 Isolate Nodule
103 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
104 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
105 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
106 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
107 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
108 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
109 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
110 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
111 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
112 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
113 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
114 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
115 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
116 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
117 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
118 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
119 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
120 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
121 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
122 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
123 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
124 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
125 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
126 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
127 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
128 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
129 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
130 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
131 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
132 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
133 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
134 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
135 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
136 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
137 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
138 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
139 2996887358 Rhizobium sp. R711 Isolate Nodule
140 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
141 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
142 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
143 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
144 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
145 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
146 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
147 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
148 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
149 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
150 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
151 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
152 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
153 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
154 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
155 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
156 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
157 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
158 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
159 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
160 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
161 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
162 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
163 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
164 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
165 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
168 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
169 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
170 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
171 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
174 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
175 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
176 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
179 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
180 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
181 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
182 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
183 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
184 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
187 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
188 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
189 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
190 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
191 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
192 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
195 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
196 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
197 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
198 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
199 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
200 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
201 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
202 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
203 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
204 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
205 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
206 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
207 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
208 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
209 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
211 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
212 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
213 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
214 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
215 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
216 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
217 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
221 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
222 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
227 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
228 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
229 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
230 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
232 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
237 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
238 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
245 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
247 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
270 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
271 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
272 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
275 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
276 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
277 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
278 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
279 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
280 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
281 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
282 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
285 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
286 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
287 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
288 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
289 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
292 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
295 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
296 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
298 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
299 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
300 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
301 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
310 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
315 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
316 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
317 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
318 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
319 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
320 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
321 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
322 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
323 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
324 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
325 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
326 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
327 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
328 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
329 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
330 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
331 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
335 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
349 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
350 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
351 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
354 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
360 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
376 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
411 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
423 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
434 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
437 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
439 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
440 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
441 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
453 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
454 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
455 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
456 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
459 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
460 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
461 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
462 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
465 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
466 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
474 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
475 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
476 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
477 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
478 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
479 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
480 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
483 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
484 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 8005258706 Rhizobium sp. R693 Isolate Nodule
487 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
488 8005321885 Rhizobium sp. R72 Isolate Nodule
489 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
490 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
491 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
492 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
493 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
494 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
495 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
496 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
497 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
498 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
499 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
500 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
501 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
502 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.41
Metatranscriptomes 0.91
Isolates 20.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.62
Nodule 14.3
Rhizoplane 3.12
Rhizosphere 40.05
Stem 0
Stem Tuber 0
Unclassified 16.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10228874 3300001989 Bacteria 545
2 JGI24735J21928_10120957 3300002067 Bacteria 754
3 JGI25158J39367_1000203 3300002739 Bacteria 14163
4 JGI25152J39213_1007422 3300002773 Bacteria 2840
5 JGI25152J39213_1010980 3300002773 Bacteria 2030
6 JGI25152J39213_1011625 3300002773 Bacteria 1938
7 JGI25150J39212_1000010 3300002774 Bacteria 236260
8 JGI25150J39212_1002390 3300002774 Bacteria 4700
9 JGI25159J45721_1000375 3300002987 Bacteria 20707
10 JGI25159J45721_1001546 3300002987 Bacteria 9427
11 JGI25151J46595_10000963 3300003187 Bacteria 21956
12 JGI25151J46595_10023401 3300003187 Bacteria 2546
13 JGI25151J46595_10023768 3300003187 Bacteria 2517
14 JGI25151J46595_10123433 3300003187 Bacteria 656
15 JGI25165J46597_1001522 3300003214 Bacteria 11697
16 JGI25165J46597_1003278 3300003214 Bacteria 4175
17 JGI25153J46596_10001154 3300003215 Bacteria 15990
18 JGI25153J46596_10010280 3300003215 Bacteria 4250
19 JGI25153J46596_10011377 3300003215 Bacteria 3936
20 JGI25153J46596_10026844 3300003215 Bacteria 2030
21 JGI25153J46596_10028546 3300003215 Bacteria 1932
22 JGI25153J46596_10065176 3300003215 Bacteria 969
23 JGI25160J50197_1000004 3300003354 Bacteria 419797
24 JGI25160J50197_1001476 3300003354 Bacteria 11707
25 JGI25160J50197_1003985 3300003354 Bacteria 6443
26 JGI25160J50197_1006150 3300003354 Bacteria 4888
27 JGI25161J50226_1000003 3300003374 Bacteria 413345
28 JGI25161J50226_1000053 3300003374 Bacteria 106635
29 Ga0006562J51391_1167839 3300003578 Bacteria 554
30 Ga0055539_1005927 3300003752 Bacteria 1575
31 Ga0055525_1013677 3300003759 Bacteria 687
32 Ga0055526_1002763 3300003771 Bacteria 11629
33 Ga0055526_1004529 3300003771 Bacteria 8309
34 Ga0055526_1011035 3300003771 Bacteria 4124
35 Ga0055526_1012038 3300003771 Bacteria 3821
36 Ga0055524_1002391 3300003775 Bacteria 9723
37 Ga0055524_1005341 3300003775 Bacteria 5758
38 Ga0055524_1026057 3300003775 Bacteria 1817
39 Ga0055524_1096043 3300003775 Bacteria 504
40 Ga0055536_1019995 3300003781 Bacteria 2084
41 Ga0055528_1001259 3300003790 Bacteria 16042
42 Ga0055528_1007090 3300003790 Bacteria 5004
43 Ga0055528_1008280 3300003790 Bacteria 4485
44 Ga0055528_1015143 3300003790 Bacteria 2802
45 Ga0055528_1045324 3300003790 Bacteria 938
46 Ga0055528_1085874 3300003790 Bacteria 546
47 Ga0055540_1004558 3300003792 Bacteria 6171
48 Ga0055531_10001389 3300003794 Bacteria 17933
49 Ga0055543_1000001 3300004625 Bacteria 419949
50 Ga0055543_1000019 3300004625 Bacteria 161035
51 Ga0055543_1022175 3300004625 Bacteria 1153
52 Ga0065165_1000049 3300005262 Bacteria 195588
53 Ga0065165_1003862 3300005262 Bacteria 9948
54 Ga0065165_1016822 3300005262 Bacteria 2721
55 Ga0065165_1059498 3300005262 Bacteria 1051
56 Ga0070682_100363514 3300005337 Bacteria 1083
57 Ga0070660_100123844 3300005339 Bacteria 2064
58 Ga0070668_100523386 3300005347 Bacteria 1029
59 Ga0070669_100202824 3300005353 Bacteria 1561
60 Ga0070671_100009983 3300005355 Bacteria 7623
61 Ga0070713_100082608 3300005436 Bacteria 2744
62 Ga0070713_100872313 3300005436 Bacteria 865
63 Ga0070663_100171354 3300005455 Bacteria 1678
64 Ga0070662_101780103 3300005457 Bacteria 532
65 Ga0070681_10071247 3300005458 Bacteria 3440
66 Ga0070681_11243662 3300005458 Bacteria 667
67 Ga0070706_100111430 3300005467 Bacteria 2546
68 Ga0070684_100005060 3300005535 Bacteria 10067
69 Ga0070697_100587092 3300005536 Bacteria 979
70 Ga0068853_100342420 3300005539 Bacteria 1389
71 Ga0070665_100124357 3300005548 Bacteria 2581
72 Ga0070665_100147810 3300005548 Bacteria 2353
73 Ga0068855_100421029 3300005563 Bacteria 1461
74 Ga0070664_100855390 3300005564 Bacteria 852
75 Ga0068857_100340023 3300005577 Bacteria 1388
76 Ga0068856_100278750 3300005614 Bacteria 1688
77 Ga0068856_100353269 3300005614 Bacteria 1488
78 Ga0068856_101385914 3300005614 Bacteria 718
79 Ga0068852_100707979 3300005616 Bacteria 1017
80 Ga0068852_101551755 3300005616 Bacteria 685
81 Ga0068864_100940407 3300005618 Bacteria 855
82 Ga0068851_10229384 3300005834 Bacteria 1046
83 Ga0068863_100937866 3300005841 Bacteria 867
84 Ga0068858_100146089 3300005842 Bacteria 2221
85 Ga0081540_1123679 3300005983 Bacteria 1068
86 Ga0070717_10006449 3300006028 Bacteria 8633
87 Ga0075365_10001979 3300006038 Bacteria 9686
88 Ga0075365_10157443 3300006038 Bacteria 1581
89 Ga0075365_10230129 3300006038 Bacteria 1301
90 Ga0075365_10316749 3300006038 Bacteria 1098
91 Ga0075368_10012039 3300006042 Bacteria 3159
92 Ga0075368_10058033 3300006042 Bacteria 1546
93 Ga0075363_100476658 3300006048 Bacteria 739
94 Ga0075364_10009825 3300006051 Bacteria 5754
95 Ga0075367_10037815 3300006178 Bacteria 2806
96 Ga0075367_10239480 3300006178 Bacteria 1137
97 Ga0075367_10341743 3300006178 Bacteria 944
98 Ga0075369_10029415 3300006186 Bacteria 2307
99 Ga0075369_10208988 3300006186 Bacteria 902
100 Ga0075370_10044632 3300006353 Bacteria 2506
101 Ga0075370_10173705 3300006353 Bacteria 1267
102 Ga0075370_10292582 3300006353 Bacteria 968
103 Ga0075428_100079024 3300006844 Bacteria 3590
104 Ga0075431_100016823 3300006847 Bacteria 7428
105 Ga0075429_100099505 3300006880 Bacteria 2537
106 Ga0075436_100085391 3300006914 Bacteria 2191
107 Ga0099825_1029852 3300006941 Bacteria 2480
108 Ga0099824_1009133 3300006942 Bacteria 12334
109 Ga0099794_10147829 3300007265 Bacteria 1192
110 Ga0105251_10024498 3300009011 Bacteria 3099
111 Ga0105244_10289759 3300009036 Bacteria 759
112 Ga0105240_10000005 3300009093 Bacteria 702630
113 Ga0105240_10014824 3300009093 Bacteria 10624
114 Ga0105240_10950532 3300009093 Bacteria 922
115 Ga0111539_10784921 3300009094 Bacteria 1109
116 Ga0105247_10093931 3300009101 Bacteria 1907
117 Ga0105247_10170980 3300009101 Bacteria 1445
118 Ga0114129_10246561 3300009147 Bacteria 2399
119 Ga0105248_10312069 3300009177 Bacteria 1771
120 Ga0105248_10892933 3300009177 Bacteria 1003
121 Ga0105237_10001912 3300009545 Bacteria 26585
122 Ga0105237_10584035 3300009545 Bacteria 1124
123 Ga0105237_11133290 3300009545 Bacteria 789
124 Ga0105238_10184478 3300009551 Bacteria 2063
125 Ga0105238_10304692 3300009551 Bacteria 1577
126 Ga0105238_10927254 3300009551 Bacteria 890
127 Ga0123342_1014422 3300009766 Bacteria 7541
128 Ga0099796_10004763 3300010159 Bacteria 3316
129 Ga0099796_10377253 3300010159 Bacteria 617
130 Ga0105239_10025467 3300010375 Bacteria 6513
131 Ga0105239_10094741 3300010375 Bacteria 3298
132 Ga0105239_10516678 3300010375 Bacteria 1358
133 Ga0105239_10663501 3300010375 Bacteria 1191
134 Ga0105246_12444512 3300011119 Bacteria 513
135 Ga0157326_1045089 3300012513 Bacteria 631
136 Ga0157370_10012298 3300013104 Bacteria 8883
137 Ga0157369_10004236 3300013105 Bacteria 16992
138 Ga0157369_10015990 3300013105 Bacteria 8443
139 Ga0157369_10177932 3300013105 Bacteria 2239
140 Ga0157372_10102460 3300013307 Bacteria 3270
141 Ga0157372_10145587 3300013307 Bacteria 2732
142 Ga0163163_10795249 3300014325 Bacteria 1009
143 Ga0163163_10900814 3300014325 Bacteria 948
144 Ga0182008_10135671 3300014497 Bacteria 1229
145 Ga0182005_1003211 3300015265 Bacteria 5594
146 Ga0197907_10585868 3300020069 Bacteria 937
147 Ga0206353_10443739 3300020082 Bacteria 1558
148 Ga0206353_10983039 3300020082 Bacteria 1335
149 Ga0213873_10010836 3300021358 Bacteria 1933
150 Ga0213872_10113317 3300021361 Bacteria 1203
151 Ga0213876_10010189 3300021384 Bacteria 5049
152 Ga0213876_10275880 3300021384 Bacteria 894
153 Ga0213876_10487603 3300021384 Bacteria 656
154 Ga0213871_10057762 3300021441 Bacteria 1075
155 Ga0224712_10072294 3300022467 Bacteria 1404
156 Ga0224712_10102193 3300022467 Bacteria 1217
157 Ga0209436_101419 3300025208 Bacteria 8408
158 Ga0209436_102492 3300025208 Bacteria 5503
159 Ga0209563_107655 3300025230 Bacteria 1757
160 Ga0209437_100153 3300025233 Bacteria 154068
161 Ga0207425_1000010 3300025245 Bacteria 572898
162 Ga0207425_1001355 3300025245 Bacteria 10461
163 Ga0207425_1016225 3300025245 Bacteria 1656
164 Ga0207425_1022286 3300025245 Bacteria 1336
165 Ga0209677_104516 3300025253 Bacteria 3979
166 Ga0209129_1000099 3300025258 Bacteria 162471
167 Ga0209129_1001480 3300025258 Bacteria 13053
168 Ga0209129_1003212 3300025258 Bacteria 7299
169 Ga0209129_1003724 3300025258 Bacteria 6454
170 Ga0209233_1000603 3300025261 Bacteria 18548
171 Ga0209233_1001023 3300025261 Bacteria 11892
172 Ga0209233_1004384 3300025261 Bacteria 4809
173 Ga0209673_1000068 3300025273 Bacteria 245891
174 Ga0209673_1000456 3300025273 Bacteria 69267
175 Ga0209673_1004030 3300025273 Bacteria 8133
176 Ga0209673_1007166 3300025273 Bacteria 5207
177 Ga0209673_1026893 3300025273 Bacteria 1881
178 Ga0209673_1029066 3300025273 Bacteria 1766
179 Ga0209673_1109705 3300025273 Bacteria 579
180 Ga0209130_1000012 3300025284 Bacteria 421329
181 Ga0209130_1000097 3300025284 Bacteria 143750
182 Ga0209130_1034284 3300025284 Bacteria 1023
183 Ga0209675_1042390 3300025291 Bacteria 987
184 Ga0209676_1003690 3300025292 Bacteria 9152
185 Ga0209676_1018072 3300025292 Bacteria 2470
186 Ga0209025_1000022 3300025294 Bacteria 574487
187 Ga0209025_1000033 3300025294 Bacteria 414511
188 Ga0209025_1017508 3300025294 Bacteria 4129
189 Ga0209025_1027572 3300025294 Bacteria 2813
190 Ga0209025_1040416 3300025294 Bacteria 2017
191 Ga0209025_1041227 3300025294 Bacteria 1981
192 Ga0209025_1144202 3300025294 Bacteria 669
193 Ga0209564_1000140 3300025295 Bacteria 179856
194 Ga0209564_1000453 3300025295 Bacteria 69474
195 Ga0209564_1002007 3300025295 Bacteria 17768
196 Ga0209564_1005994 3300025295 Bacteria 6719
197 Ga0209564_1010984 3300025295 Bacteria 4107
198 Ga0209564_1049204 3300025295 Bacteria 1045
199 Ga0209758_1000086 3300025297 Bacteria 254778
200 Ga0209758_1000138 3300025297 Bacteria 175187
201 Ga0209758_1002381 3300025297 Bacteria 19357
202 Ga0209758_1004908 3300025297 Bacteria 10753
203 Ga0209758_1010556 3300025297 Bacteria 5506
204 Ga0209758_1010888 3300025297 Bacteria 5359
205 Ga0209758_1011376 3300025297 Bacteria 5164
206 Ga0209256_1000836 3300025299 Bacteria 38702
207 Ga0209256_1001416 3300025299 Bacteria 24924
208 Ga0209256_1006050 3300025299 Bacteria 6603
209 Ga0209256_1009939 3300025299 Bacteria 4078
210 Ga0209256_1018071 3300025299 Bacteria 2311
211 Ga0209256_1024619 3300025299 Bacteria 1769
212 Ga0209256_1026897 3300025299 Bacteria 1648
213 Ga0207426_1000003 3300025302 Bacteria 1063212
214 Ga0207426_1000010 3300025302 Bacteria 796003
215 Ga0207426_1000854 3300025302 Bacteria 32034
216 Ga0207426_1070433 3300025302 Bacteria 977
217 Ga0209051_1005436 3300025303 Bacteria 7448
218 Ga0209051_1011889 3300025303 Bacteria 4256
219 Ga0209257_1015246 3300025304 Bacteria 3217
220 Ga0209257_1033722 3300025304 Bacteria 1606
221 Ga0207656_10162050 3300025321 Bacteria 1065
222 Ga0207710_10562915 3300025900 Bacteria 594
223 Ga0207680_10811944 3300025903 Bacteria 670
224 Ga0207647_10009466 3300025904 Bacteria 6921
225 Ga0207705_10509204 3300025909 Bacteria 935
226 Ga0207684_10169069 3300025910 Bacteria 1884
227 Ga0207695_10000011 3300025913 Bacteria 910221
228 Ga0207695_10119024 3300025913 Bacteria 2612
229 Ga0207695_10218040 3300025913 Bacteria 1816
230 Ga0207671_10017031 3300025914 Bacteria 5621
231 Ga0207671_10287327 3300025914 Bacteria 1298
232 Ga0207671_10689966 3300025914 Bacteria 812
233 Ga0207649_10859823 3300025920 Bacteria 710
234 Ga0207681_11072352 3300025923 Bacteria 676
235 Ga0207694_10867041 3300025924 Bacteria 763
236 Ga0207694_11101795 3300025924 Bacteria 672
237 Ga0207694_11146646 3300025924 Bacteria 658
238 Ga0207700_10134681 3300025928 Bacteria 2022
239 Ga0207644_10046192 3300025931 Bacteria 3101
240 Ga0207665_10815413 3300025939 Bacteria 738
241 Ga0207711_10616777 3300025941 Bacteria 1012
242 Ga0207711_10678077 3300025941 Bacteria 961
243 Ga0207658_11629899 3300025986 Bacteria 590
244 Ga0207639_10056367 3300026041 Bacteria 3012
245 Ga0207639_10314688 3300026041 Bacteria 1388
246 Ga0207678_10137526 3300026067 Bacteria 2084
247 Ga0207702_10096960 3300026078 Bacteria 2594
248 Ga0207698_11071290 3300026142 Bacteria 818
249 Ga0209389_1000068 3300027296 Bacteria 98954
250 Ga0209489_115015 3300027361 Bacteria 5028
251 Ga0209700_100117 3300027363 Bacteria 115595
252 Ga0209813_10068141 3300027866 Bacteria 1151
253 Ga0209813_10305543 3300027866 Bacteria 619
254 Ga0268266_10103826 3300028379 Bacteria 2509
255 Ga0268266_10113172 3300028379 Bacteria 2406
256 Ga0268266_10170818 3300028379 Bacteria 1973
257 Ga0268266_10732581 3300028379 Bacteria 954
258 Ga0265337_1028868 3300028556 Bacteria 1662
259 Ga0265319_1013066 3300028563 Bacteria 3323
260 Ga0265334_10049583 3300028573 Bacteria 1614
261 Ga0265323_10020524 3300028653 Bacteria 2543
262 Ga0265336_10002573 3300028666 Bacteria 7416
263 Ga0307515_10000274 3300028794 Bacteria 126011
264 Ga0265338_10000306 3300028800 Bacteria 88631
265 Ga0265324_10031006 3300029957 Bacteria 1874
266 Ga0265770_1032771 3300030878 Bacteria 878
267 Ga0265339_10002239 3300031249 Bacteria 13983
268 Ga0265339_10012914 3300031249 Bacteria 5076
269 Ga0307513_10130415 3300031456 Bacteria 2460
270 Ga0316579_10364317 3300031691 Bacteria 699
271 Ga0265314_10006693 3300031711 Bacteria 10126
272 Ga0265314_10016806 3300031711 Bacteria 5765
273 Ga0265342_10002241 3300031712 Bacteria 16904
274 Ga0316576_10207246 3300031727 Bacteria 1476
275 Ga0316578_10016183 3300031728 Bacteria 4031
276 Ga0307405_10145326 3300031731 Bacteria 1660
277 Ga0307405_11872842 3300031731 Bacteria 535
278 Ga0307406_10815341 3300031901 Bacteria 788
279 Ga0307412_10006135 3300031911 Bacteria 6773
280 Ga0307412_10516612 3300031911 Bacteria 997
281 Ga0307510_10005071 3300033180 Bacteria 15630
282 Ga0373950_0007064 3300034818 Bacteria 1732
283 Ga0373934_0055497 3300035086 Bacteria 1574
284 Ga0373923_0016942 3300035111 Bacteria 2779
285 Ga0373945_0464526 3300035116 Bacteria 561
286 Ga0373953_0062763 3300035117 Bacteria 1521
287 Ga0373954_0006611 3300035118 Bacteria 5060
288 Ga0373956_0030711 3300035119 Bacteria 2350
289 Ga0373957_0006450 3300035120 Bacteria 3697
290 Ga0373946_0769683 3300035171 Bacteria 506
291 Ga0373955_0023150 3300035172 Bacteria 3160
292 Ga0316574_0119291 3300035398 Bacteria 1693
293 Ga0373924_0032178 3300035410 Bacteria 2112
294 Ga0373935_0132812 3300035692 Bacteria 1674
295 Ga0373933_0026183 3300035724 Bacteria 3348
296 Ga0373937_0032086 3300036401 Bacteria 4762
297 Ga0316584_0008552 3300036712 Bacteria 7055
298 Ga0395899_0313179 3300037312 Bacteria 1059
299 Ga0395900_0733119 3300037418 Bacteria 920
300 Ga0395898_0057313 3300037466 Bacteria 3797
301 Ga0395898_0078296 3300037466 Bacteria 3190
302 Ga0395905_0404181 3300037471 Bacteria 1261
303 Ga0436364_0233092 3300037853 Bacteria 804
304 Ga0400485_00503 3300038735 Bacteria 2587
305 Ga0400488_28184 3300038741 Unclassified 3960
306 Ga0400486_21295 3300038742 Bacteria 1274
307 Ga0400486_26461 3300038742 Bacteria 1992
308 Ga0436365_0438663 3300039437 Bacteria 4625
309 Ga0436365_0871323 3300039437 Bacteria 58014
310 Ga0436365_1194219 3300039437 Bacteria 729
311 Ga0436360_0694913 3300039438 Bacteria 2439
312 Ga0436360_0844831 3300039438 Bacteria 3290
313 Ga0436360_0908501 3300039438 Bacteria 1244
314 Ga0436361_0048455 3300039447 Bacteria 1173
315 Ga0436361_0526438 3300039447 Bacteria 1062
316 Ga0436361_1012780 3300039447 Bacteria 1377
317 Ga0436363_0933367 3300039450 Bacteria 2850
318 Ga0436363_1129826 3300039450 Bacteria 584
319 Ga0436363_1425956 3300039450 Bacteria 1305
320 Ga0436362_0024952 3300039453 Bacteria 2455
321 Ga0436362_0768214 3300039453 Bacteria 997
322 Ga0439465_0015497 3300041413 Bacteria 2379
323 Ga0451789_0078933 3300041443 Bacteria 848
324 Ga0451793_1434131 3300041452 Bacteria 635
325 Ga0451795_0917465 3300041456 Bacteria 2245
326 Ga0451847_0657346 3300041503 Bacteria 627
327 Ga0451843_0290270 3300041509 Bacteria 896
328 Ga0439432_242193 3300042006 Bacteria 518
329 Ga0439449_0034252 3300042007 Bacteria 1891
330 Ga0466972_0000076 3300044658 Bacteria 92672
331 Ga0466966_0331345 3300044684 Bacteria 915
332 Ga0466961_0143191 3300044693 Bacteria 1496
333 Ga0453684_1100793 3300044712 Bacteria 839
334 Ga0466968_0023554 3300044735 Bacteria 2510
335 Ga0466968_0195362 3300044735 Bacteria 946
336 Ga0466960_0099571 3300044901 Bacteria 1495
337 Ga0466959_0319596 3300045049 Bacteria 1061
338 Ga0495592_0009044 3300046454 Bacteria 7487
339 Ga0495603_0227817 3300046455 Bacteria 1075
340 Ga0495590_0148034 3300046457 Bacteria 850
341 Ga0495629_0057035 3300046459 Bacteria 2731
342 Ga0495629_0276187 3300046459 Bacteria 1154
343 Ga0495638_0000924 3300046460 Bacteria 29846
344 Ga0495638_0005428 3300046460 Bacteria 9486
345 Ga0495651_0040780 3300046462 Bacteria 3607
346 Ga0495653_0005677 3300046463 Bacteria 10189
347 Ga0495650_0176812 3300046471 Bacteria 753
348 Ga0495605_0002088 3300046474 Bacteria 12551
349 Ga0495664_0002486 3300046477 Bacteria 9915
350 Ga0495585_0019211 3300046492 Bacteria 3943
351 Ga0495585_0036462 3300046492 Bacteria 2773
352 Ga0495585_0169541 3300046492 Bacteria 1128
353 Ga0495607_0123602 3300046501 Bacteria 1355
354 Ga0495607_0397603 3300046501 Bacteria 627
355 Ga0495583_0008910 3300046506 Bacteria 6063
356 Ga0495583_0020660 3300046506 Bacteria 3404
357 Ga0495606_0155356 3300046507 Bacteria 1339
358 Ga0495606_0198382 3300046507 Bacteria 1145
359 Ga0495606_0490591 3300046507 Bacteria 622
360 Ga0495608_0020322 3300046511 Bacteria 4564
361 Ga0495610_0008057 3300046512 Bacteria 6891
362 Ga0495610_0044905 3300046512 Bacteria 2190
363 Ga0495610_0156580 3300046512 Bacteria 967
364 Ga0495616_0042395 3300046513 Bacteria 2317
365 Ga0495618_0006096 3300046514 Bacteria 7313
366 Ga0495620_0155116 3300046515 Bacteria 891
367 Ga0495628_0011244 3300046516 Bacteria 7575
368 Ga0495630_0147053 3300046517 Bacteria 1792
369 Ga0495631_0001767 3300046518 Bacteria 12813
370 Ga0495632_0014213 3300046519 Bacteria 4512
371 Ga0495632_0032163 3300046519 Bacteria 2706
372 Ga0495632_0284424 3300046519 Bacteria 736
373 Ga0495643_0063611 3300046522 Bacteria 1951
374 Ga0495643_0195253 3300046522 Bacteria 975
375 Ga0495643_0319325 3300046522 Bacteria 702
376 Ga0495648_0323226 3300046524 Bacteria 714
377 Ga0495652_0032345 3300046529 Bacteria 4575
378 Ga0495654_0058513 3300046530 Bacteria 1859
379 Ga0495640_0010256 3300046533 Bacteria 7249
380 Ga0495640_0259611 3300046533 Bacteria 1086
381 Ga0495586_0058305 3300046535 Bacteria 2096
382 Ga0495587_0026476 3300046536 Bacteria 3536
383 Ga0495609_0060724 3300046538 Bacteria 1671
384 Ga0495645_0023868 3300046543 Bacteria 4433
385 Ga0495633_0019885 3300046558 Bacteria 3387
386 Ga0495667_0013520 3300046559 Bacteria 5523
387 Ga0495656_0040691 3300046615 Bacteria 1938
388 Ga0495668_0008078 3300046616 Bacteria 6627
389 Ga0495668_0297096 3300046616 Bacteria 885
390 Ga0495668_0830559 3300046616 Bacteria 512
391 Ga0495634_0023026 3300046642 Bacteria 4384
392 Ga0495611_0012991 3300046648 Bacteria 3541
393 Ga0495625_0002947 3300046660 Bacteria 17740
394 Ga0495625_0067482 3300046660 Bacteria 2517
395 Ga0495625_0227821 3300046660 Bacteria 1218
396 Ga0495625_0281404 3300046660 Bacteria 1070
397 Ga0495635_0005046 3300046663 Bacteria 9181
398 Ga0495661_0325889 3300046665 Bacteria 762
399 Ga0495588_0076451 3300046674 Bacteria 1745
400 Ga0495588_0091671 3300046674 Bacteria 1592
401 Ga0495657_0006746 3300046675 Bacteria 8952
402 Ga0495599_0018262 3300046678 Bacteria 4370
403 Ga0495623_0028228 3300046679 Bacteria 3610
404 Ga0495646_0059626 3300046680 Bacteria 2278
405 Ga0495613_0079532 3300046689 Bacteria 2384
406 Ga0495670_0067902 3300046691 Bacteria 1800
407 Ga0495670_0135256 3300046691 Bacteria 1287
408 Ga0495649_0426574 3300046694 Bacteria 664
409 Ga0495600_0203521 3300046809 Bacteria 1270
410 Ga0495660_0037984 3300046810 Bacteria 2680
411 Ga0495604_0017273 3300047317 Bacteria 5774
412 Ga0495674_0016021 3300047319 Bacteria 6995
413 Ga0495672_0051214 3300047320 Bacteria 2433
414 Ga0495680_0029968 3300047322 Bacteria 4448
415 Ga0495675_0010988 3300047444 Bacteria 5675
416 Ga0495673_0074912 3300047469 Bacteria 1415
417 Ga0495673_0139694 3300047469 Bacteria 945
418 Ga0495673_0316917 3300047469 Bacteria 556
419 Ga0495681_0088898 3300047470 Bacteria 1367
420 Ga0495684_0017339 3300047471 Bacteria 5543
421 Ga0495686_0030036 3300047472 Bacteria 3532
422 Ga0495686_0301838 3300047472 Bacteria 883
423 Ga0495593_0063838 3300047673 Bacteria 1923
424 Ga0495602_0024624 3300048088 Bacteria 5838
425 Ga0496101_0107850 3300048904 Bacteria 2093
426 Ga0496101_0136833 3300048904 Bacteria 1865
427 Ga0496102_0180722 3300048905 Bacteria 1987
428 Ga0496102_0316387 3300048905 Bacteria 1471
429 Ga0496102_0680122 3300048905 Bacteria 952
430 Ga0496103_0644673 3300048906 Bacteria 673
431 Ga0496104_0183798 3300048907 Bacteria 2001
432 Ga0496104_0669354 3300048907 Bacteria 946
433 Ga0496105_0065235 3300048908 Bacteria 3005
434 Ga0496106_0020301 3300048909 Bacteria 4930
435 Ga0496107_0113748 3300048910 Bacteria 1991
436 Ga0496107_0763152 3300048910 Bacteria 709
437 Ga0496108_0413585 3300048911 Bacteria 1178
438 Ga0496108_0546789 3300048911 Bacteria 1010
439 Ga0496108_0943533 3300048911 Bacteria 739
440 Ga0496110_0432169 3300048913 Bacteria 1200
441 Ga0496110_1353795 3300048913 Bacteria 621
442 Ga0496111_0243105 3300048914 Bacteria 1336
443 Ga0496114_0801143 3300048917 Unclassified 821
444 Ga0496114_1256261 3300048917 Bacteria 627
445 Ga0496114_1355833 3300048917 Bacteria 598
446 Ga0496116_0016230 3300048919 Bacteria 5839
447 Ga0496116_0017063 3300048919 Bacteria 5655
448 Ga0496116_0028311 3300048919 Bacteria 4062
449 Ga0496116_0068234 3300048919 Bacteria 2266
450 Ga0496116_0140463 3300048919 Bacteria 1360
451 Ga0496116_0182505 3300048919 Bacteria 1121
452 Ga0496116_0186017 3300048919 Bacteria 1105
453 Ga0496116_0292112 3300048919 Bacteria 782
454 Ga0496117_0019308 3300048920 Bacteria 5605
455 Ga0496117_0028796 3300048920 Bacteria 4294
456 Ga0496117_0036604 3300048920 Bacteria 3669
457 Ga0496117_0053053 3300048920 Bacteria 2851
458 Ga0496118_0045143 3300048921 Bacteria 3444
459 Ga0496118_0053336 3300048921 Bacteria 3075
460 Ga0496118_0089530 3300048921 Bacteria 2124
461 Ga0496118_0171754 3300048921 Bacteria 1323
462 Ga0496118_0278678 3300048921 Bacteria 932
463 Ga0496119_0103330 3300048922 Bacteria 1596
464 Ga0496119_0156515 3300048922 Bacteria 1216
465 Ga0496119_0192971 3300048922 Bacteria 1060
466 Ga0496119_0217924 3300048922 Bacteria 978
467 Ga0496120_0044203 3300048923 Bacteria 2590
468 Ga0496120_0095205 3300048923 Bacteria 1583
469 Ga0496120_0233822 3300048923 Bacteria 871
470 Ga0496120_0242703 3300048923 Bacteria 849
471 Ga0496120_0287691 3300048923 Bacteria 757
472 Ga0496121_0024624 3300048924 Bacteria 5747
473 Ga0496121_0026935 3300048924 Bacteria 5396
474 Ga0496121_0031852 3300048924 Bacteria 4808
475 Ga0496121_0047386 3300048924 Bacteria 3667
476 Ga0496121_0063557 3300048924 Bacteria 3015
477 Ga0496121_0083709 3300048924 Bacteria 2517
478 Ga0496121_0104740 3300048924 Bacteria 2172
479 Ga0496121_0115298 3300048924 Bacteria 2040
480 Ga0496121_0176439 3300048924 Bacteria 1546
481 Ga0496121_0333464 3300048924 Bacteria 1016
482 Ga0496121_0372974 3300048924 Bacteria 943
483 Ga0496122_0018692 3300048925 Bacteria 6382
484 Ga0496122_0133519 3300048925 Bacteria 1570
485 Ga0496122_0157882 3300048925 Bacteria 1388
486 Ga0496122_0232318 3300048925 Bacteria 1047
487 Ga0496122_0444030 3300048925 Bacteria 645
488 Ga0496123_0019646 3300048926 Bacteria 5320
489 Ga0496123_0033047 3300048926 Bacteria 3730
490 Ga0496123_0102808 3300048926 Bacteria 1657
491 Ga0496123_0107142 3300048926 Bacteria 1608
492 Ga0496123_0194328 3300048926 Bacteria 1046
493 Ga0496123_0195585 3300048926 Bacteria 1042
494 Ga0496124_0000740 3300048927 Bacteria 53495
495 Ga0496124_0003528 3300048927 Bacteria 19047
496 Ga0496124_0015170 3300048927 Bacteria 7400
497 Ga0496124_0070523 3300048927 Bacteria 2898
498 Ga0496124_0076882 3300048927 Bacteria 2754
499 Ga0496124_0112962 3300048927 Bacteria 2183
500 Ga0496124_0115460 3300048927 Bacteria 2154
501 Ga0496124_0142400 3300048927 Bacteria 1890
502 Ga0496124_0181096 3300048927 Bacteria 1621
503 Ga0496124_0237326 3300048927 Bacteria 1358
504 Ga0496124_0294641 3300048927 Bacteria 1175
505 Ga0496124_0412763 3300048927 Bacteria 933
506 Ga0496124_0631911 3300048927 Bacteria 691
507 Ga0496125_0000001 3300048928 Bacteria 1766138
508 Ga0496125_0009489 3300048928 Bacteria 9988
509 Ga0496125_0064559 3300048928 Bacteria 2908
510 Ga0496125_0100953 3300048928 Bacteria 2125
511 Ga0496125_0227912 3300048928 Bacteria 1194
512 Ga0496125_0315875 3300048928 Bacteria 950
513 Ga0496125_0479030 3300048928 Bacteria 706
514 Ga0496125_0491878 3300048928 Bacteria 692
515 Ga0496125_0543013 3300048928 Bacteria 645
516 Ga0496126_0036666 3300048929 Bacteria 4582
517 Ga0496126_0069234 3300048929 Bacteria 3148
518 Ga0496126_0150953 3300048929 Bacteria 1991
519 Ga0496126_0457760 3300048929 Bacteria 1026
520 Ga0496126_0545355 3300048929 Bacteria 921
521 Ga0496126_0796633 3300048929 Bacteria 725
522 Ga0495678_036147 3300049459 Bacteria 2018
523 Ga0495678_102061 3300049459 Bacteria 992
524 Ga0495682_0082097 3300049460 Bacteria 1159
525 Ga0501031_0388071 3300049568 Bacteria 903
526 Ga0501032_0896568 3300049569 Bacteria 558
527 Ga0501033_0621784 3300049570 Bacteria 739
528 Ga0501034_0327332 3300049571 Bacteria 1464
529 Ga0501037_0303866 3300049573 Bacteria 1107
530 Ga0501038_0306378 3300049574 Bacteria 1245
531 Ga0501047_0709454 3300049581 Bacteria 823
532 Ga0501048_0252607 3300049582 Bacteria 1252
533 Ga0501068_0594418 3300049584 Bacteria 721
534 Ga0501073_0344337 3300049589 Bacteria 1029
535 Ga0501073_0360914 3300049589 Bacteria 1003
536 Ga0501249_209831 3300049679 Bacteria 515
537 Ga0501080_0048758 3300049742 Bacteria 3941
538 Ga0501083_0440314 3300049744 Bacteria 848
539 Ga0501035_0821801 3300049822 Bacteria 741
540 Ga0501044_0618194 3300049823 Bacteria 975
541 nmdc:mga00v17_409228_c1 3300050491 Bacteria 881
542 nmdc:mga00v17_89664_c1 3300050491 Bacteria 1930
543 nmdc:mga0yw44_13202_c1 3300050492 Bacteria 4340
544 nmdc:mga0yw44_471439_c1 3300050492 Bacteria 851
545 nmdc:mga0k408_188285_c1 3300050493 Bacteria 1231
546 nmdc:mga06z11_660996_c1 3300050494 Bacteria 636
547 nmdc:mga04h51_81320_c1 3300050495 Bacteria 1150
548 nmdc:mga07m45_140253_c1 3300050496 Bacteria 1400
549 nmdc:mga07m45_402457_c1 3300050496 Bacteria 794
550 nmdc:mga08x19_53446_c1 3300050514 Bacteria 2599
551 nmdc:mga0sz30_128957_c1 3300050516 Bacteria 1114
552 nmdc:mga0sz30_169687_c1 3300050516 Bacteria 967
553 nmdc:mga0sz30_76189_c1 3300050516 Bacteria 1448
554 Ga0495601_0023245 3300053077 Bacteria 3808
555 Ga0495612_0004910 3300053078 Bacteria 5532
556 Ga0500610_0039853 3300053079 Bacteria 2426
557 Ga0495595_0013972 3300053084 Bacteria 3399
558 Ga0495619_0059570 3300053085 Bacteria 2536
559 Ga0500644_0185980 3300053088 Bacteria 853
560 Ga0500644_0244704 3300053088 Bacteria 754
561 Ga0500644_0318784 3300053088 Bacteria 668
562 Ga0500647_0077502 3300053091 Bacteria 1594
563 Ga0500651_0170834 3300053093 Bacteria 1296
564 Ga0500566_0004992 3300053094 Bacteria 7900
565 Ga0500650_0090027 3300053098 Bacteria 1436
566 Ga0500556_0164648 3300053104 Bacteria 875
567 Ga0500556_0341764 3300053104 Bacteria 581
568 Ga0500557_000001 3300053105 Bacteria 241298
569 Ga0500557_009624 3300053105 Bacteria 2378
570 Ga0500562_010892 3300053108 Bacteria 2307
571 Ga0500562_034535 3300053108 Bacteria 1338
572 Ga0500562_078000 3300053108 Bacteria 896
573 Ga0500569_022939 3300053109 Bacteria 1670
574 Ga0500594_0002914 3300053118 Bacteria 3735
575 Ga0500594_0287001 3300053118 Bacteria 551
576 Ga0500597_156333 3300053120 Bacteria 977
577 Ga0500618_010538 3300053125 Bacteria 2478
578 Ga0500618_027174 3300053125 Bacteria 1362
579 Ga0500642_0000221 3300053130 Bacteria 22633
580 Ga0500652_352014 3300053131 Bacteria 557
581 Ga0500658_0094335 3300053134 Bacteria 1298
582 Ga0500658_0266967 3300053134 Bacteria 787
583 Ga0500559_0000205 3300053136 Bacteria 47084
584 Ga0500568_0002640 3300053139 Bacteria 10411
585 Ga0500568_0003244 3300053139 Bacteria 9191
586 Ga0500568_0083766 3300053139 Bacteria 1208
587 Ga0500588_0028853 3300053146 Bacteria 1577
588 Ga0500603_025190 3300053150 Bacteria 1494
589 Ga0500616_0003914 3300053153 Bacteria 10944
590 Ga0500622_0003496 3300053156 Bacteria 10430
591 Ga0500622_0044431 3300053156 Bacteria 2302
592 Ga0500624_119333 3300053157 Bacteria 553
593 Ga0500627_0168049 3300053158 Bacteria 989
594 Ga0500633_0022893 3300053160 Bacteria 1920
595 Ga0500633_0025087 3300053160 Bacteria 1860
596 Ga0500633_0251869 3300053160 Bacteria 656
597 Ga0500634_0017698 3300053161 Bacteria 3818
598 Ga0500634_0301202 3300053161 Bacteria 636
599 Ga0500639_156676 3300053163 Bacteria 1042
600 Ga0500636_0027461 3300053177 Bacteria 3363
601 Ga0500636_0340005 3300053177 Bacteria 721
602 Ga0500576_065341 3300053725 Bacteria 1579
603 Ga0500625_001974 3300053729 Bacteria 7428
604 Ga0500645_051143 3300053730 Bacteria 1205
605 Ga0500596_002653 3300053735 Bacteria 3508
606 Ga0500599_002156 3300053736 Bacteria 2341
607 Ga0500601_000068 3300053737 Bacteria 21333
608 Ga0500601_008028 3300053737 Bacteria 1171
609 Ga0501084_0164014 3300054114 Bacteria 1875
610 Ga0501084_0872810 3300054114 Bacteria 757

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0801143 Ga0496114_0801143_16_378 115
2 iso_pu_bacteria 2857349434 2857357590 127
3 iso_pu_bacteria 2989349275 2989353019 132
4 iso_pu_bacteria 2507262055 2507509559 133
5 iso_pu_bacteria 2508501009 2508543600 133
6 iso_pu_bacteria 2508501042 2508698609 133
7 iso_pu_bacteria 2508501128 2509149248 133
8 iso_pu_bacteria 2513237139 2513879392 133
9 iso_pu_bacteria 2513237141 2513889416 133
10 iso_pu_bacteria 2513237161 2514016698 133
11 iso_pu_bacteria 2513237305 2514421787 133
12 iso_pu_bacteria 2515154112 2515629031 133
13 iso_pu_bacteria 2643221637 2644210966 133
14 iso_pu_bacteria 2643221718 2644654621 133
15 iso_pu_bacteria 2721755686 2723576293 133
16 iso_pu_bacteria 2802429603 2805920290 133
17 iso_pu_bacteria 2824671348 2824676216 133
18 iso_pu_bacteria 2824687955 2824692326 133
19 iso_pu_bacteria 2824696289 2824700667 133
20 iso_pu_bacteria 2824704595 2824710531 133
21 iso_pu_bacteria 2824732956 2824735719 133
22 iso_pu_bacteria 2824753945 2824756714 133
23 iso_pu_bacteria 2824763712 2824770897 133
24 iso_pu_bacteria 2824773399 2824779028 133
25 iso_pu_bacteria 2838122688 2838128711 133
26 iso_pu_bacteria 2841949485 2841956398 133
27 iso_pu_bacteria 2841966195 2841967171 133
28 iso_pu_bacteria 2841983080 2841989908 133
29 iso_pu_bacteria 2842694124 2842695394 133
30 iso_pu_bacteria 2847939898 2847945618 133
31 iso_pu_bacteria 2849076700 2849080213 133
32 iso_pu_bacteria 2874590934 2874595329 133
33 iso_pu_bacteria 2874612657 2874613286 133
34 iso_pu_bacteria 2874645413 2874651168 133
35 iso_pu_bacteria 2876771140 2876775265 133
36 iso_pu_bacteria 2876818435 2876824080 133
37 iso_pu_bacteria 2879074833 2879080708 133
38 iso_pu_bacteria 2879127579 2879134709 133
39 iso_pu_bacteria 2879142872 2879144169 133
40 iso_pu_bacteria 2904711408 2904716926 133
41 iso_pu_bacteria 2909042592 2909043688 133
42 iso_pu_bacteria 2920760137 2920765603 133
43 iso_pu_bacteria 2935608549 2935611569 133
44 iso_pu_bacteria 2935648319 2935648941 133
45 iso_pu_bacteria 2935656913 2935656977 133
46 iso_pu_bacteria 2935819856 2935821046 133
47 iso_pu_bacteria 2935847175 2935850694 133
48 iso_pu_bacteria 2935908558 2935913937 133
49 iso_pu_bacteria 2935916978 2935920073 133
50 iso_pu_bacteria 2935926038 2935930412 133
51 iso_pu_bacteria 2935934488 2935939615 133
52 iso_pu_bacteria 2935942939 2935946564 133
53 iso_pu_bacteria 2935951376 2935955597 133
54 iso_pu_bacteria 2935967501 2935972693 133
55 iso_pu_bacteria 2935975950 2935981486 133
56 iso_pu_bacteria 2935984226 2935989122 133
57 iso_pu_bacteria 2936011229 2936011851 133
58 iso_pu_bacteria 2936019824 2936020446 133
59 iso_pu_bacteria 2936028420 2936029140 133
60 iso_pu_bacteria 2936046547 2936047169 133
61 iso_pu_bacteria 2936055302 2936061397 133
62 iso_pu_bacteria 8016630954 8016632094 133
63 iso_pu_bacteria 8019619141 8019627084 133
64 iso_pu_bacteria 8019629233 8019635465 133
65 iso_pu_bacteria 8019638758 8019644239 133
66 iso_pu_bacteria 8019659431 8019663273 133
67 iso_pu_bacteria 8019668869 8019672891 133
68 iso_pu_bacteria 8019678201 8019683252 133
69 iso_pu_bacteria 8019687851 8019688959 133
70 3300038735 Ga0400485_00503 Ga0400485_00503_229_669 134
71 3300038741 Ga0400488_28184 Ga0400488_28184_959_1399 134
72 3300038742 Ga0400486_21295 Ga0400486_21295_219_659 134
73 3300038742 Ga0400486_26461 Ga0400486_26461_1214_1654 134
74 iso_pu_bacteria 2511231027 2511392941 134
75 iso_pu_bacteria 2718218232 2720612897 134
76 iso_pu_bacteria 2718218233 2720619756 134
77 iso_pu_bacteria 2718218235 2720631187 134
78 iso_pu_bacteria 2718218269 2720774914 134
79 iso_pu_bacteria 2721755556 2723026551 134
80 iso_pu_bacteria 2721755684 2723560155 134
81 iso_pu_bacteria 2721755685 2723566713 134
82 iso_pu_bacteria 2721755819 2724089521 134
83 iso_pu_bacteria 2721755822 2724103978 134
84 iso_pu_bacteria 2728369352 2730107487 134
85 iso_pu_bacteria 2751185800 2753359509 134
86 iso_pu_bacteria 2838068647 2838071317 134
87 iso_pu_bacteria 2842422224 2842425026 134
88 iso_pu_bacteria 2842871566 2842872501 134
89 iso_pu_bacteria 2889016732 2889023363 134
90 iso_pu_bacteria 2906354277 2906360370 134
91 iso_pu_bacteria 2928521798 2928523412 134
92 iso_pu_bacteria 2933599457 2933602116 134
93 iso_pu_bacteria 2954011201 2954015683 134
94 iso_pu_bacteria 2958100919 2958107395 134
95 iso_pu_bacteria 2958172287 2958179245 134
96 iso_pu_bacteria 2965119406 2965124406 134
97 iso_pu_bacteria 2977971508 2977977079 134
98 iso_pu_bacteria 2979710463 2979712268 134
99 iso_pu_bacteria 2979742915 2979750739 134
100 iso_pu_bacteria 8005282627 8005288233 134
101 iso_pu_bacteria 8005497431 8005499854 134
102 iso_pu_bacteria 8005626139 8005631477 134
103 iso_pu_bacteria 8005668836 8005671272 134
104 3300003187 JGI25151J46595_10023401 JGI25151J46595_100234013 135
105 3300003771 Ga0055526_1002763 Ga0055526_10027639 135
106 3300003781 Ga0055536_1019995 Ga0055536_10199953 135
107 3300003794 Ga0055531_10001389 Ga0055531_1000138918 135
108 3300025208 Ga0209436_102492 Ga0209436_1024924 135
109 3300025292 Ga0209676_1003690 Ga0209676_10036902 135
110 3300025294 Ga0209025_1000033 Ga0209025_1000033379 135
111 3300025295 Ga0209564_1000140 Ga0209564_100014019 135
112 3300025299 Ga0209256_1000836 Ga0209256_100083624 135
113 3300025303 Ga0209051_1011889 Ga0209051_10118894 135
114 3300025304 Ga0209257_1015246 Ga0209257_10152463 135
115 3300031691 Ga0316579_10364317 Ga0316579_103643171 135
116 3300031727 Ga0316576_10207246 Ga0316576_102072462 135
117 3300031728 Ga0316578_10016183 Ga0316578_100161834 135
118 3300031731 Ga0307405_11872842 Ga0307405_118728421 135
119 3300035398 Ga0316574_0119291 Ga0316574_0119291_1042_1461 135
120 3300036712 Ga0316584_0008552 Ga0316584_0008552_302_721 135
121 3300044712 Ga0453684_1100793 Ga0453684_1100793_390_809 135
122 3300054114 Ga0501084_0164014 Ga0501084_0164014_308_742 135
123 3300054114 Ga0501084_0872810 Ga0501084_0872810_110_532 135
124 iso_pu_bacteria 2510917028 2511182729 135
125 iso_pu_bacteria 2510917030 2511200566 135
126 iso_pu_bacteria 2513237138 2513869335 135
127 iso_pu_bacteria 2513237144 2513909752 135
128 iso_pu_bacteria 2513237146 2513926522 135
129 iso_pu_bacteria 2534681796 2535516140 135
130 iso_pu_bacteria 2582581294 2585199859 135
131 iso_pu_bacteria 2582581298 2585225919 135
132 iso_pu_bacteria 2582581299 2585230079 135
133 iso_pu_bacteria 2582581304 2585254343 135
134 iso_pu_bacteria 2582581307 2585270565 135
135 iso_pu_bacteria 2582581315 2585324091 135
136 iso_pu_bacteria 2582581867 2585400696 135
137 iso_pu_bacteria 2585427529 2585546879 135
138 iso_pu_bacteria 2585427530 2585551766 135
139 iso_pu_bacteria 2585427531 2585558269 135
140 iso_pu_bacteria 2585427590 2585819744 135
141 iso_pu_bacteria 2585427594 2585845759 135
142 iso_pu_bacteria 2585427608 2585897663 135
143 iso_pu_bacteria 2585427609 2585904742 135
144 iso_pu_bacteria 2585428125 2587980142 135
145 iso_pu_bacteria 2599185170 2599418047 135
146 iso_pu_bacteria 2643221599 2644005901 135
147 iso_pu_bacteria 2643221607 2644049531 135
148 iso_pu_bacteria 2643221634 2644193126 135
149 iso_pu_bacteria 2643221636 2644204061 135
150 iso_pu_bacteria 2643221643 2644239232 135
151 iso_pu_bacteria 2643221686 2644482565 135
152 iso_pu_bacteria 2643221689 2644499067 135
153 iso_pu_bacteria 2738541293 2738799280 135
154 iso_pu_bacteria 2818991453 2819638206 135
155 iso_pu_bacteria 2838035591 2838040986 135
156 iso_pu_bacteria 2838661181 2838666169 135
157 iso_pu_bacteria 2842482326 2842487191 135
158 iso_pu_bacteria 2852387548 2852389559 135
159 iso_pu_bacteria 2871495908 2871500671 135
160 iso_pu_bacteria 2876392853 2876395047 135
161 iso_pu_bacteria 2878760144 2878764760 135
162 iso_pu_bacteria 2878767105 2878771861 135
163 iso_pu_bacteria 2903540706 2903545484 135
164 iso_pu_bacteria 2904659560 2904661678 135
165 iso_pu_bacteria 2919100787 2919107751 135
166 iso_pu_bacteria 2923556063 2923558184 135
167 iso_pu_bacteria 2937994558 2937999334 135
168 iso_pu_bacteria 2958165035 2958169808 135
169 iso_pu_bacteria 2961114664 2961116831 135
170 iso_pu_bacteria 2961163497 2961168268 135
171 iso_pu_bacteria 2965018300 2965023087 135
172 iso_pu_bacteria 2968110612 2968112738 135
173 iso_pu_bacteria 2968171901 2968176668 135
174 iso_pu_bacteria 2970554993 2970559607 135
175 iso_pu_bacteria 2987659509 2987664282 135
176 iso_pu_bacteria 2996887358 2996892396 135
177 iso_pu_bacteria 3004188549 3004193337 135
178 iso_pu_bacteria 3005445848 3005447206 135
179 iso_pu_bacteria 3005452660 3005453916 135
180 iso_pu_bacteria 8005258706 8005259678 135
181 iso_pu_bacteria 8005321885 8005326923 135
182 iso_pu_bacteria 8005542996 8005544835 135
183 iso_pu_bacteria 8046767195 8046770286 135
184 iso_pu_bacteria 8057575449 8057578214 135
185 3300002067 JGI24735J21928_10120957 JGI24735J21928_101209572 136
186 3300003215 JGI25153J46596_10001154 JGI25153J46596_1000115415 136
187 3300003215 JGI25153J46596_10065176 JGI25153J46596_100651761 136
188 3300003354 JGI25160J50197_1001476 JGI25160J50197_10014764 136
189 3300003752 Ga0055539_1005927 Ga0055539_10059271 136
190 3300003759 Ga0055525_1013677 Ga0055525_10136771 136
191 3300004625 Ga0055543_1022175 Ga0055543_10221751 136
192 3300005262 Ga0065165_1059498 Ga0065165_10594981 136
193 3300005339 Ga0070660_100123844 Ga0070660_1001238444 136
194 3300005436 Ga0070713_100082608 Ga0070713_1000826083 136
195 3300005436 Ga0070713_100872313 Ga0070713_1008723132 136
196 3300005458 Ga0070681_10071247 Ga0070681_100712471 136
197 3300005458 Ga0070681_11243662 Ga0070681_112436622 136
198 3300005467 Ga0070706_100111430 Ga0070706_1001114304 136
199 3300005535 Ga0070684_100005060 Ga0070684_1000050609 136
200 3300005536 Ga0070697_100587092 Ga0070697_1005870922 136
201 3300005539 Ga0068853_100342420 Ga0068853_1003424201 136
202 3300005563 Ga0068855_100421029 Ga0068855_1004210292 136
203 3300005564 Ga0070664_100855390 Ga0070664_1008553901 136
204 3300005577 Ga0068857_100340023 Ga0068857_1003400232 136
205 3300005614 Ga0068856_100278750 Ga0068856_1002787502 136
206 3300005614 Ga0068856_101385914 Ga0068856_1013859142 136
207 3300005616 Ga0068852_100707979 Ga0068852_1007079792 136
208 3300005616 Ga0068852_101551755 Ga0068852_1015517552 136
209 3300005841 Ga0068863_100937866 Ga0068863_1009378662 136
210 3300005842 Ga0068858_100146089 Ga0068858_1001460892 136
211 3300005983 Ga0081540_1123679 Ga0081540_11236792 136
212 3300006028 Ga0070717_10006449 Ga0070717_100064498 136
213 3300006038 Ga0075365_10157443 Ga0075365_101574432 136
214 3300006038 Ga0075365_10230129 Ga0075365_102301292 136
215 3300006038 Ga0075365_10316749 Ga0075365_103167492 136
216 3300006042 Ga0075368_10058033 Ga0075368_100580333 136
217 3300006051 Ga0075364_10009825 Ga0075364_100098256 136
218 3300006844 Ga0075428_100079024 Ga0075428_1000790244 136
219 3300006847 Ga0075431_100016823 Ga0075431_1000168237 136
220 3300006880 Ga0075429_100099505 Ga0075429_1000995053 136
221 3300006914 Ga0075436_100085391 Ga0075436_1000853912 136
222 3300006941 Ga0099825_1029852 Ga0099825_10298523 136
223 3300006942 Ga0099824_1009133 Ga0099824_10091339 136
224 3300007265 Ga0099794_10147829 Ga0099794_101478291 136
225 3300009093 Ga0105240_10014824 Ga0105240_100148243 136
226 3300009093 Ga0105240_10950532 Ga0105240_109505322 136
227 3300009094 Ga0111539_10784921 Ga0111539_107849212 136
228 3300009101 Ga0105247_10093931 Ga0105247_100939312 136
229 3300009147 Ga0114129_10246561 Ga0114129_102465613 136
230 3300009545 Ga0105237_10584035 Ga0105237_105840352 136
231 3300009545 Ga0105237_11133290 Ga0105237_111332902 136
232 3300009551 Ga0105238_10184478 Ga0105238_101844782 136
233 3300009551 Ga0105238_10927254 Ga0105238_109272542 136
234 3300010159 Ga0099796_10004763 Ga0099796_100047635 136
235 3300010159 Ga0099796_10377253 Ga0099796_103772531 136
236 3300010375 Ga0105239_10516678 Ga0105239_105166782 136
237 3300010375 Ga0105239_10663501 Ga0105239_106635012 136
238 3300012513 Ga0157326_1045089 Ga0157326_10450891 136
239 3300013105 Ga0157369_10004236 Ga0157369_1000423612 136
240 3300013105 Ga0157369_10015990 Ga0157369_1001599012 136
241 3300013307 Ga0157372_10102460 Ga0157372_101024604 136
242 3300013307 Ga0157372_10145587 Ga0157372_101455873 136
243 3300014325 Ga0163163_10795249 Ga0163163_107952492 136
244 3300014497 Ga0182008_10135671 Ga0182008_101356711 136
245 3300020069 Ga0197907_10585868 Ga0197907_105858682 136
246 3300020082 Ga0206353_10443739 Ga0206353_104437393 136
247 3300020082 Ga0206353_10983039 Ga0206353_109830392 136
248 3300021358 Ga0213873_10010836 Ga0213873_100108362 136
249 3300021361 Ga0213872_10113317 Ga0213872_101133172 136
250 3300021384 Ga0213876_10010189 Ga0213876_100101891 136
251 3300021384 Ga0213876_10275880 Ga0213876_102758801 136
252 3300021384 Ga0213876_10487603 Ga0213876_104876032 136
253 3300021441 Ga0213871_10057762 Ga0213871_100577623 136
254 3300022467 Ga0224712_10072294 Ga0224712_100722943 136
255 3300022467 Ga0224712_10102193 Ga0224712_101021932 136
256 3300025230 Ga0209563_107655 Ga0209563_1076552 136
257 3300025253 Ga0209677_104516 Ga0209677_1045162 136
258 3300025261 Ga0209233_1004384 Ga0209233_10043843 136
259 3300025297 Ga0209758_1000138 Ga0209758_1000138163 136
260 3300025297 Ga0209758_1010556 Ga0209758_10105563 136
261 3300025297 Ga0209758_1011376 Ga0209758_10113762 136
262 3300025302 Ga0207426_1070433 Ga0207426_10704331 136
263 3300025904 Ga0207647_10009466 Ga0207647_100094663 136
264 3300025909 Ga0207705_10509204 Ga0207705_105092041 136
265 3300025910 Ga0207684_10169069 Ga0207684_101690692 136
266 3300025913 Ga0207695_10119024 Ga0207695_101190243 136
267 3300025913 Ga0207695_10218040 Ga0207695_102180402 136
268 3300025914 Ga0207671_10287327 Ga0207671_102873272 136
269 3300025920 Ga0207649_10859823 Ga0207649_108598231 136
270 3300025924 Ga0207694_10867041 Ga0207694_108670412 136
271 3300025924 Ga0207694_11101795 Ga0207694_111017952 136
272 3300025928 Ga0207700_10134681 Ga0207700_101346813 136
273 3300025939 Ga0207665_10815413 Ga0207665_108154132 136
274 3300026041 Ga0207639_10056367 Ga0207639_100563672 136
275 3300026041 Ga0207639_10314688 Ga0207639_103146883 136
276 3300026067 Ga0207678_10137526 Ga0207678_101375262 136
277 3300026078 Ga0207702_10096960 Ga0207702_100969603 136
278 3300026142 Ga0207698_11071290 Ga0207698_110712902 136
279 3300027296 Ga0209389_1000068 Ga0209389_100006813 136
280 3300027361 Ga0209489_115015 Ga0209489_1150152 136
281 3300027363 Ga0209700_100117 Ga0209700_10011790 136
282 3300027866 Ga0209813_10068141 Ga0209813_100681413 136
283 3300028379 Ga0268266_10113172 Ga0268266_101131721 136
284 3300028379 Ga0268266_10732581 Ga0268266_107325812 136
285 3300028556 Ga0265337_1028868 Ga0265337_10288682 136
286 3300028563 Ga0265319_1013066 Ga0265319_10130663 136
287 3300028573 Ga0265334_10049583 Ga0265334_100495833 136
288 3300028653 Ga0265323_10020524 Ga0265323_100205242 136
289 3300028666 Ga0265336_10002573 Ga0265336_100025738 136
290 3300028800 Ga0265338_10000306 Ga0265338_1000030652 136
291 3300029957 Ga0265324_10031006 Ga0265324_100310062 136
292 3300030878 Ga0265770_1032771 Ga0265770_10327712 136
293 3300031249 Ga0265339_10002239 Ga0265339_100022398 136
294 3300031249 Ga0265339_10012914 Ga0265339_100129144 136
295 3300031711 Ga0265314_10006693 Ga0265314_100066935 136
296 3300031711 Ga0265314_10016806 Ga0265314_100168062 136
297 3300031712 Ga0265342_10002241 Ga0265342_100022413 136
298 3300033180 Ga0307510_10005071 Ga0307510_100050713 136
299 3300034818 Ga0373950_0007064 Ga0373950_0007064_1288_1710 136
300 3300035086 Ga0373934_0055497 Ga0373934_0055497_286_708 136
301 3300035111 Ga0373923_0016942 Ga0373923_0016942_954_1376 136
302 3300035116 Ga0373945_0464526 Ga0373945_0464526_38_460 136
303 3300035117 Ga0373953_0062763 Ga0373953_0062763_203_625 136
304 3300035118 Ga0373954_0006611 Ga0373954_0006611_3869_4291 136
305 3300035119 Ga0373956_0030711 Ga0373956_0030711_967_1389 136
306 3300035120 Ga0373957_0006450 Ga0373957_0006450_2317_2739 136
307 3300035171 Ga0373946_0769683 Ga0373946_0769683_24_446 136
308 3300035172 Ga0373955_0023150 Ga0373955_0023150_471_893 136
309 3300035410 Ga0373924_0032178 Ga0373924_0032178_578_1000 136
310 3300035692 Ga0373935_0132812 Ga0373935_0132812_474_896 136
311 3300035724 Ga0373933_0026183 Ga0373933_0026183_1972_2394 136
312 3300036401 Ga0373937_0032086 Ga0373937_0032086_2177_2599 136
313 3300037312 Ga0395899_0313179 Ga0395899_0313179_98_526 136
314 3300037418 Ga0395900_0733119 Ga0395900_0733119_71_496 136
315 3300037466 Ga0395898_0057313 Ga0395898_0057313_1361_1789 136
316 3300037466 Ga0395898_0078296 Ga0395898_0078296_194_616 136
317 3300037853 Ga0436364_0233092 Ga0436364_0233092_189_617 136
318 3300039437 Ga0436365_0438663 Ga0436365_0438663_216_644 136
319 3300039437 Ga0436365_0871323 Ga0436365_0871323_16668_17096 136
320 3300039437 Ga0436365_1194219 Ga0436365_1194219_233_688 136
321 3300039438 Ga0436360_0694913 Ga0436360_0694913_675_1097 136
322 3300039438 Ga0436360_0844831 Ga0436360_0844831_735_1163 136
323 3300039438 Ga0436360_0908501 Ga0436360_0908501_640_1068 136
324 3300039447 Ga0436361_0048455 Ga0436361_0048455_133_576 136
325 3300039447 Ga0436361_0526438 Ga0436361_0526438_32_460 136
326 3300039447 Ga0436361_1012780 Ga0436361_1012780_704_1132 136
327 3300039450 Ga0436363_0933367 Ga0436363_0933367_701_1183 136
328 3300039450 Ga0436363_1129826 Ga0436363_1129826_57_479 136
329 3300039450 Ga0436363_1425956 Ga0436363_1425956_519_950 136
330 3300039453 Ga0436362_0024952 Ga0436362_0024952_313_741 136
331 3300039453 Ga0436362_0768214 Ga0436362_0768214_52_480 136
332 3300041443 Ga0451789_0078933 Ga0451789_0078933_350_778 136
333 3300041452 Ga0451793_1434131 Ga0451793_1434131_137_565 136
334 3300041503 Ga0451847_0657346 Ga0451847_0657346_122_550 136
335 3300041509 Ga0451843_0290270 Ga0451843_0290270_95_523 136
336 3300044658 Ga0466972_0000076 Ga0466972_0000076_85442_85870 136
337 3300044684 Ga0466966_0331345 Ga0466966_0331345_363_791 136
338 3300044693 Ga0466961_0143191 Ga0466961_0143191_319_747 136
339 3300044735 Ga0466968_0023554 Ga0466968_0023554_379_807 136
340 3300044735 Ga0466968_0195362 Ga0466968_0195362_11_493 136
341 3300045049 Ga0466959_0319596 Ga0466959_0319596_297_725 136
342 3300046454 Ga0495592_0009044 Ga0495592_0009044_2436_2858 136
343 3300046459 Ga0495629_0057035 Ga0495629_0057035_1192_1614 136
344 3300046459 Ga0495629_0276187 Ga0495629_0276187_404_832 136
345 3300046460 Ga0495638_0005428 Ga0495638_0005428_5902_6330 136
346 3300046462 Ga0495651_0040780 Ga0495651_0040780_1875_2297 136
347 3300046463 Ga0495653_0005677 Ga0495653_0005677_3455_3877 136
348 3300046477 Ga0495664_0002486 Ga0495664_0002486_3668_4090 136
349 3300046511 Ga0495608_0020322 Ga0495608_0020322_976_1398 136
350 3300046514 Ga0495618_0006096 Ga0495618_0006096_5031_5453 136
351 3300046516 Ga0495628_0011244 Ga0495628_0011244_5000_5422 136
352 3300046517 Ga0495630_0147053 Ga0495630_0147053_248_670 136
353 3300046519 Ga0495632_0284424 Ga0495632_0284424_21_449 136
354 3300046529 Ga0495652_0032345 Ga0495652_0032345_2229_2651 136
355 3300046533 Ga0495640_0010256 Ga0495640_0010256_5372_5794 136
356 3300046533 Ga0495640_0259611 Ga0495640_0259611_568_996 136
357 3300046535 Ga0495586_0058305 Ga0495586_0058305_765_1187 136
358 3300046536 Ga0495587_0026476 Ga0495587_0026476_2344_2766 136
359 3300046543 Ga0495645_0023868 Ga0495645_0023868_2062_2484 136
360 3300046559 Ga0495667_0013520 Ga0495667_0013520_1092_1514 136
361 3300046616 Ga0495668_0830559 Ga0495668_0830559_39_467 136
362 3300046642 Ga0495634_0023026 Ga0495634_0023026_1993_2415 136
363 3300046660 Ga0495625_0227821 Ga0495625_0227821_111_536 136
364 3300046663 Ga0495635_0005046 Ga0495635_0005046_2124_2546 136
365 3300046675 Ga0495657_0006746 Ga0495657_0006746_7575_7997 136
366 3300046678 Ga0495599_0018262 Ga0495599_0018262_2060_2482 136
367 3300046679 Ga0495623_0028228 Ga0495623_0028228_2315_2737 136
368 3300046680 Ga0495646_0059626 Ga0495646_0059626_1027_1449 136
369 3300046689 Ga0495613_0079532 Ga0495613_0079532_1170_1592 136
370 3300046694 Ga0495649_0426574 Ga0495649_0426574_35_463 136
371 3300046809 Ga0495600_0203521 Ga0495600_0203521_784_1206 136
372 3300047317 Ga0495604_0017273 Ga0495604_0017273_2030_2452 136
373 3300047319 Ga0495674_0016021 Ga0495674_0016021_2243_2665 136
374 3300047322 Ga0495680_0029968 Ga0495680_0029968_1983_2405 136
375 3300047444 Ga0495675_0010988 Ga0495675_0010988_2265_2687 136
376 3300047471 Ga0495684_0017339 Ga0495684_0017339_4025_4447 136
377 3300047472 Ga0495686_0301838 Ga0495686_0301838_388_816 136
378 3300047673 Ga0495593_0063838 Ga0495593_0063838_771_1193 136
379 3300048088 Ga0495602_0024624 Ga0495602_0024624_2070_2492 136
380 3300048907 Ga0496104_0183798 Ga0496104_0183798_152_580 136
381 3300048911 Ga0496108_0546789 Ga0496108_0546789_512_940 136
382 3300048911 Ga0496108_0943533 Ga0496108_0943533_206_631 136
383 3300048913 Ga0496110_0432169 Ga0496110_0432169_210_638 136
384 3300048913 Ga0496110_1353795 Ga0496110_1353795_48_476 136
385 3300048917 Ga0496114_1355833 Ga0496114_1355833_52_480 136
386 3300048920 Ga0496117_0019308 Ga0496117_0019308_1355_1777 136
387 3300048921 Ga0496118_0171754 Ga0496118_0171754_365_793 136
388 3300048921 Ga0496118_0278678 Ga0496118_0278678_239_691 136
389 3300048922 Ga0496119_0156515 Ga0496119_0156515_368_796 136
390 3300048922 Ga0496119_0192971 Ga0496119_0192971_115_543 136
391 3300048923 Ga0496120_0242703 Ga0496120_0242703_297_719 136
392 3300048923 Ga0496120_0287691 Ga0496120_0287691_302_730 136
393 3300048924 Ga0496121_0031852 Ga0496121_0031852_3003_3428 136
394 3300048924 Ga0496121_0047386 Ga0496121_0047386_1912_2340 136
395 3300048927 Ga0496124_0076882 Ga0496124_0076882_1187_1612 136
396 3300048927 Ga0496124_0631911 Ga0496124_0631911_102_524 136
397 3300048928 Ga0496125_0000001 Ga0496125_0000001_1466490_1466912 136
398 3300048928 Ga0496125_0315875 Ga0496125_0315875_197_625 136
399 3300048929 Ga0496126_0150953 Ga0496126_0150953_642_1064 136
400 3300048929 Ga0496126_0457760 Ga0496126_0457760_225_653 136
401 3300050491 nmdc:mga00v17_409228_c1 nmdc:mga00v17_409228_c1_349_777 136
402 3300050491 nmdc:mga00v17_89664_c1 nmdc:mga00v17_89664_c1_565_987 136
403 3300050492 nmdc:mga0yw44_13202_c1 nmdc:mga0yw44_13202_c1_2112_2540 136
404 3300050493 nmdc:mga0k408_188285_c1 nmdc:mga0k408_188285_c1_283_708 136
405 3300050494 nmdc:mga06z11_660996_c1 nmdc:mga06z11_660996_c1_165_593 136
406 3300050495 nmdc:mga04h51_81320_c1 nmdc:mga04h51_81320_c1_690_1118 136
407 3300050496 nmdc:mga07m45_140253_c1 nmdc:mga07m45_140253_c1_953_1378 136
408 3300050514 nmdc:mga08x19_53446_c1 nmdc:mga08x19_53446_c1_1827_2255 136
409 3300050516 nmdc:mga0sz30_128957_c1 nmdc:mga0sz30_128957_c1_234_659 136
410 3300053077 Ga0495601_0023245 Ga0495601_0023245_2102_2524 136
411 3300053078 Ga0495612_0004910 Ga0495612_0004910_2122_2544 136
412 3300053084 Ga0495595_0013972 Ga0495595_0013972_1002_1424 136
413 3300053085 Ga0495619_0059570 Ga0495619_0059570_1002_1424 136
414 3300053088 Ga0500644_0185980 Ga0500644_0185980_297_725 136
415 3300053091 Ga0500647_0077502 Ga0500647_0077502_480_908 136
416 3300053094 Ga0500566_0004992 Ga0500566_0004992_1034_1462 136
417 3300053098 Ga0500650_0090027 Ga0500650_0090027_296_724 136
418 3300053104 Ga0500556_0164648 Ga0500556_0164648_422_850 136
419 3300053105 Ga0500557_000001 Ga0500557_000001_153944_154372 136
420 3300053108 Ga0500562_010892 Ga0500562_010892_603_1031 136
421 3300053118 Ga0500594_0287001 Ga0500594_0287001_70_492 136
422 3300053120 Ga0500597_156333 Ga0500597_156333_480_908 136
423 3300053130 Ga0500642_0000221 Ga0500642_0000221_13172_13600 136
424 3300053131 Ga0500652_352014 Ga0500652_352014_98_526 136
425 3300053136 Ga0500559_0000205 Ga0500559_0000205_8415_8840 136
426 3300053150 Ga0500603_025190 Ga0500603_025190_420_845 136
427 3300053156 Ga0500622_0044431 Ga0500622_0044431_726_1154 136
428 3300053160 Ga0500633_0025087 Ga0500633_0025087_1370_1798 136
429 3300053163 Ga0500639_156676 Ga0500639_156676_412_837 136
430 3300053177 Ga0500636_0027461 Ga0500636_0027461_207_632 136
431 3300053177 Ga0500636_0340005 Ga0500636_0340005_256_684 136
432 3300053725 Ga0500576_065341 Ga0500576_065341_1019_1444 136
433 3300053729 Ga0500625_001974 Ga0500625_001974_2139_2567 136
434 3300053730 Ga0500645_051143 Ga0500645_051143_420_848 136
435 3300053735 Ga0500596_002653 Ga0500596_002653_633_1058 136
436 3300053736 Ga0500599_002156 Ga0500599_002156_1571_1999 136
437 3300053737 Ga0500601_000068 Ga0500601_000068_20847_21275 136
438 3300053737 Ga0500601_008028 Ga0500601_008028_373_798 136
439 3300001989 JGI24739J22299_10228874 JGI24739J22299_102288741 137
440 3300002739 JGI25158J39367_1000203 JGI25158J39367_100020311 137
441 3300002773 JGI25152J39213_1007422 JGI25152J39213_10074223 137
442 3300002773 JGI25152J39213_1010980 JGI25152J39213_10109802 137
443 3300002773 JGI25152J39213_1011625 JGI25152J39213_10116252 137
444 3300002774 JGI25150J39212_1000010 JGI25150J39212_100001014 137
445 3300002774 JGI25150J39212_1002390 JGI25150J39212_10023903 137
446 3300002987 JGI25159J45721_1000375 JGI25159J45721_10003759 137
447 3300002987 JGI25159J45721_1001546 JGI25159J45721_10015463 137
448 3300003187 JGI25151J46595_10000963 JGI25151J46595_1000096318 137
449 3300003187 JGI25151J46595_10023768 JGI25151J46595_100237683 137
450 3300003187 JGI25151J46595_10123433 JGI25151J46595_101234331 137
451 3300003214 JGI25165J46597_1001522 JGI25165J46597_10015222 137
452 3300003214 JGI25165J46597_1003278 JGI25165J46597_10032782 137
453 3300003215 JGI25153J46596_10010280 JGI25153J46596_100102803 137
454 3300003215 JGI25153J46596_10011377 JGI25153J46596_100113773 137
455 3300003215 JGI25153J46596_10026844 JGI25153J46596_100268442 137
456 3300003215 JGI25153J46596_10028546 JGI25153J46596_100285463 137
457 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004133 137
458 3300003354 JGI25160J50197_1003985 JGI25160J50197_10039853 137
459 3300003354 JGI25160J50197_1006150 JGI25160J50197_10061502 137
460 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003295 137
461 3300003374 JGI25161J50226_1000053 JGI25161J50226_100005385 137
462 3300003578 Ga0006562J51391_1167839 Ga0006562J51391_11678391 137
463 3300003771 Ga0055526_1004529 Ga0055526_10045297 137
464 3300003771 Ga0055526_1011035 Ga0055526_10110355 137
465 3300003771 Ga0055526_1012038 Ga0055526_10120384 137
466 3300003775 Ga0055524_1002391 Ga0055524_100239111 137
467 3300003775 Ga0055524_1005341 Ga0055524_10053415 137
468 3300003775 Ga0055524_1026057 Ga0055524_10260573 137
469 3300003775 Ga0055524_1096043 Ga0055524_10960431 137
470 3300003790 Ga0055528_1001259 Ga0055528_10012593 137
471 3300003790 Ga0055528_1007090 Ga0055528_10070904 137
472 3300003790 Ga0055528_1008280 Ga0055528_10082802 137
473 3300003790 Ga0055528_1015143 Ga0055528_10151432 137
474 3300003790 Ga0055528_1045324 Ga0055528_10453242 137
475 3300003790 Ga0055528_1085874 Ga0055528_10858741 137
476 3300003792 Ga0055540_1004558 Ga0055540_10045587 137
477 3300004625 Ga0055543_1000001 Ga0055543_1000001301 137
478 3300004625 Ga0055543_1000019 Ga0055543_100001973 137
479 3300005262 Ga0065165_1000049 Ga0065165_1000049111 137
480 3300005262 Ga0065165_1003862 Ga0065165_10038623 137
481 3300005262 Ga0065165_1016822 Ga0065165_10168222 137
482 3300005337 Ga0070682_100363514 Ga0070682_1003635142 137
483 3300005347 Ga0070668_100523386 Ga0070668_1005233862 137
484 3300005353 Ga0070669_100202824 Ga0070669_1002028242 137
485 3300005355 Ga0070671_100009983 Ga0070671_1000099834 137
486 3300005455 Ga0070663_100171354 Ga0070663_1001713542 137
487 3300005457 Ga0070662_101780103 Ga0070662_1017801031 137
488 3300005548 Ga0070665_100124357 Ga0070665_1001243573 137
489 3300005548 Ga0070665_100147810 Ga0070665_1001478103 137
490 3300005614 Ga0068856_100353269 Ga0068856_1003532692 137
491 3300005618 Ga0068864_100940407 Ga0068864_1009404071 137
492 3300005834 Ga0068851_10229384 Ga0068851_102293842 137
493 3300006038 Ga0075365_10001979 Ga0075365_100019796 137
494 3300006042 Ga0075368_10012039 Ga0075368_100120393 137
495 3300006048 Ga0075363_100476658 Ga0075363_1004766582 137
496 3300006178 Ga0075367_10037815 Ga0075367_100378154 137
497 3300006178 Ga0075367_10239480 Ga0075367_102394802 137
498 3300006178 Ga0075367_10341743 Ga0075367_103417432 137
499 3300006186 Ga0075369_10029415 Ga0075369_100294153 137
500 3300006186 Ga0075369_10208988 Ga0075369_102089881 137
501 3300006353 Ga0075370_10044632 Ga0075370_100446322 137
502 3300006353 Ga0075370_10173705 Ga0075370_101737052 137
503 3300006353 Ga0075370_10292582 Ga0075370_102925821 137
504 3300009011 Ga0105251_10024498 Ga0105251_100244983 137
505 3300009036 Ga0105244_10289759 Ga0105244_102897592 137
506 3300009093 Ga0105240_10000005 Ga0105240_10000005292 137
507 3300009101 Ga0105247_10170980 Ga0105247_101709803 137
508 3300009177 Ga0105248_10312069 Ga0105248_103120692 137
509 3300009177 Ga0105248_10892933 Ga0105248_108929332 137
510 3300009545 Ga0105237_10001912 Ga0105237_1000191210 137
511 3300009551 Ga0105238_10304692 Ga0105238_103046921 137
512 3300009766 Ga0123342_1014422 Ga0123342_10144228 137
513 3300010375 Ga0105239_10025467 Ga0105239_100254673 137
514 3300010375 Ga0105239_10094741 Ga0105239_100947412 137
515 3300011119 Ga0105246_12444512 Ga0105246_124445121 137
516 3300013104 Ga0157370_10012298 Ga0157370_100122989 137
517 3300013105 Ga0157369_10177932 Ga0157369_101779323 137
518 3300014325 Ga0163163_10900814 Ga0163163_109008142 137
519 3300015265 Ga0182005_1003211 Ga0182005_10032116 137
520 3300025208 Ga0209436_101419 Ga0209436_1014197 137
521 3300025233 Ga0209437_100153 Ga0209437_10015311 137
522 3300025245 Ga0207425_1000010 Ga0207425_1000010343 137
523 3300025245 Ga0207425_1001355 Ga0207425_100135510 137
524 3300025245 Ga0207425_1016225 Ga0207425_10162252 137
525 3300025245 Ga0207425_1022286 Ga0207425_10222862 137
526 3300025258 Ga0209129_1000099 Ga0209129_1000099158 137
527 3300025258 Ga0209129_1001480 Ga0209129_100148012 137
528 3300025258 Ga0209129_1003212 Ga0209129_10032122 137
529 3300025258 Ga0209129_1003724 Ga0209129_10037245 137
530 3300025261 Ga0209233_1000603 Ga0209233_100060316 137
531 3300025261 Ga0209233_1001023 Ga0209233_100102311 137
532 3300025273 Ga0209673_1000068 Ga0209673_1000068146 137
533 3300025273 Ga0209673_1000456 Ga0209673_100045613 137
534 3300025273 Ga0209673_1004030 Ga0209673_10040307 137
535 3300025273 Ga0209673_1007166 Ga0209673_10071662 137
536 3300025273 Ga0209673_1026893 Ga0209673_10268931 137
537 3300025273 Ga0209673_1029066 Ga0209673_10290662 137
538 3300025273 Ga0209673_1109705 Ga0209673_11097051 137
539 3300025284 Ga0209130_1000012 Ga0209130_1000012133 137
540 3300025284 Ga0209130_1000097 Ga0209130_100009715 137
541 3300025284 Ga0209130_1034284 Ga0209130_10342842 137
542 3300025291 Ga0209675_1042390 Ga0209675_10423902 137
543 3300025292 Ga0209676_1018072 Ga0209676_10180722 137
544 3300025294 Ga0209025_1000022 Ga0209025_1000022239 137
545 3300025294 Ga0209025_1017508 Ga0209025_10175083 137
546 3300025294 Ga0209025_1027572 Ga0209025_10275724 137
547 3300025294 Ga0209025_1040416 Ga0209025_10404162 137
548 3300025294 Ga0209025_1041227 Ga0209025_10412274 137
549 3300025294 Ga0209025_1144202 Ga0209025_11442022 137
550 3300025295 Ga0209564_1000453 Ga0209564_100045372 137
551 3300025295 Ga0209564_1002007 Ga0209564_100200710 137
552 3300025295 Ga0209564_1005994 Ga0209564_10059943 137
553 3300025295 Ga0209564_1010984 Ga0209564_10109841 137
554 3300025295 Ga0209564_1049204 Ga0209564_10492043 137
555 3300025297 Ga0209758_1000086 Ga0209758_100008619 137
556 3300025297 Ga0209758_1002381 Ga0209758_100238111 137
557 3300025297 Ga0209758_1004908 Ga0209758_10049089 137
558 3300025297 Ga0209758_1010888 Ga0209758_10108883 137
559 3300025299 Ga0209256_1001416 Ga0209256_100141624 137
560 3300025299 Ga0209256_1006050 Ga0209256_10060506 137
561 3300025299 Ga0209256_1009939 Ga0209256_10099393 137
562 3300025299 Ga0209256_1018071 Ga0209256_10180713 137
563 3300025299 Ga0209256_1024619 Ga0209256_10246193 137
564 3300025299 Ga0209256_1026897 Ga0209256_10268971 137
565 3300025302 Ga0207426_1000003 Ga0207426_1000003850 137
566 3300025302 Ga0207426_1000010 Ga0207426_1000010492 137
567 3300025302 Ga0207426_1000854 Ga0207426_100085430 137
568 3300025303 Ga0209051_1005436 Ga0209051_10054365 137
569 3300025304 Ga0209257_1033722 Ga0209257_10337223 137
570 3300025321 Ga0207656_10162050 Ga0207656_101620502 137
571 3300025900 Ga0207710_10562915 Ga0207710_105629151 137
572 3300025903 Ga0207680_10811944 Ga0207680_108119441 137
573 3300025913 Ga0207695_10000011 Ga0207695_10000011622 137
574 3300025914 Ga0207671_10017031 Ga0207671_100170316 137
575 3300025914 Ga0207671_10689966 Ga0207671_106899662 137
576 3300025923 Ga0207681_11072352 Ga0207681_110723522 137
577 3300025924 Ga0207694_11146646 Ga0207694_111466461 137
578 3300025931 Ga0207644_10046192 Ga0207644_100461924 137
579 3300025941 Ga0207711_10616777 Ga0207711_106167772 137
580 3300025941 Ga0207711_10678077 Ga0207711_106780772 137
581 3300025986 Ga0207658_11629899 Ga0207658_116298991 137
582 3300027866 Ga0209813_10305543 Ga0209813_103055431 137
583 3300028379 Ga0268266_10103826 Ga0268266_101038262 137
584 3300028379 Ga0268266_10170818 Ga0268266_101708182 137
585 3300028794 Ga0307515_10000274 Ga0307515_1000027433 137
586 3300031456 Ga0307513_10130415 Ga0307513_101304152 137
587 3300031731 Ga0307405_10145326 Ga0307405_101453261 137
588 3300031901 Ga0307406_10815341 Ga0307406_108153411 137
589 3300031911 Ga0307412_10006135 Ga0307412_100061352 137
590 3300031911 Ga0307412_10516612 Ga0307412_105166122 137
591 3300037471 Ga0395905_0404181 Ga0395905_0404181_710_1135 137
592 3300041413 Ga0439465_0015497 Ga0439465_0015497_720_1148 137
593 3300041456 Ga0451795_0917465 Ga0451795_0917465_1754_2185 137
594 3300042006 Ga0439432_242193 Ga0439432_242193_18_449 137
595 3300042007 Ga0439449_0034252 Ga0439449_0034252_260_691 137
596 3300044901 Ga0466960_0099571 Ga0466960_0099571_71_493 137
597 3300046455 Ga0495603_0227817 Ga0495603_0227817_359_784 137
598 3300046457 Ga0495590_0148034 Ga0495590_0148034_102_530 137
599 3300046460 Ga0495638_0000924 Ga0495638_0000924_2896_3321 137
600 3300046471 Ga0495650_0176812 Ga0495650_0176812_69_494 137
601 3300046474 Ga0495605_0002088 Ga0495605_0002088_10531_11013 137
602 3300046492 Ga0495585_0019211 Ga0495585_0019211_469_951 137
603 3300046492 Ga0495585_0036462 Ga0495585_0036462_1360_1785 137
604 3300046492 Ga0495585_0169541 Ga0495585_0169541_570_995 137
605 3300046501 Ga0495607_0123602 Ga0495607_0123602_350_778 137
606 3300046501 Ga0495607_0397603 Ga0495607_0397603_23_448 137
607 3300046506 Ga0495583_0008910 Ga0495583_0008910_4028_4510 137
608 3300046506 Ga0495583_0020660 Ga0495583_0020660_1835_2260 137
609 3300046507 Ga0495606_0155356 Ga0495606_0155356_255_683 137
610 3300046507 Ga0495606_0198382 Ga0495606_0198382_482_910 137
611 3300046507 Ga0495606_0490591 Ga0495606_0490591_160_588 137
612 3300046512 Ga0495610_0008057 Ga0495610_0008057_4531_4956 137
613 3300046512 Ga0495610_0044905 Ga0495610_0044905_61_489 137
614 3300046512 Ga0495610_0156580 Ga0495610_0156580_210_635 137
615 3300046513 Ga0495616_0042395 Ga0495616_0042395_1162_1644 137
616 3300046515 Ga0495620_0155116 Ga0495620_0155116_334_759 137
617 3300046518 Ga0495631_0001767 Ga0495631_0001767_1551_2033 137
618 3300046519 Ga0495632_0014213 Ga0495632_0014213_3546_3971 137
619 3300046519 Ga0495632_0032163 Ga0495632_0032163_1650_2132 137
620 3300046522 Ga0495643_0063611 Ga0495643_0063611_1174_1599 137
621 3300046522 Ga0495643_0195253 Ga0495643_0195253_121_549 137
622 3300046522 Ga0495643_0319325 Ga0495643_0319325_174_602 137
623 3300046524 Ga0495648_0323226 Ga0495648_0323226_200_682 137
624 3300046530 Ga0495654_0058513 Ga0495654_0058513_494_976 137
625 3300046538 Ga0495609_0060724 Ga0495609_0060724_499_981 137
626 3300046558 Ga0495633_0019885 Ga0495633_0019885_1562_1987 137
627 3300046615 Ga0495656_0040691 Ga0495656_0040691_1261_1686 137
628 3300046616 Ga0495668_0008078 Ga0495668_0008078_1369_1851 137
629 3300046616 Ga0495668_0297096 Ga0495668_0297096_62_487 137
630 3300046648 Ga0495611_0012991 Ga0495611_0012991_1707_2189 137
631 3300046660 Ga0495625_0002947 Ga0495625_0002947_1466_1948 137
632 3300046660 Ga0495625_0067482 Ga0495625_0067482_1080_1505 137
633 3300046660 Ga0495625_0281404 Ga0495625_0281404_322_747 137
634 3300046665 Ga0495661_0325889 Ga0495661_0325889_12_437 137
635 3300046674 Ga0495588_0076451 Ga0495588_0076451_189_614 137
636 3300046674 Ga0495588_0091671 Ga0495588_0091671_639_1067 137
637 3300046691 Ga0495670_0067902 Ga0495670_0067902_1179_1661 137
638 3300046691 Ga0495670_0135256 Ga0495670_0135256_106_531 137
639 3300046810 Ga0495660_0037984 Ga0495660_0037984_862_1344 137
640 3300047320 Ga0495672_0051214 Ga0495672_0051214_358_783 137
641 3300047469 Ga0495673_0074912 Ga0495673_0074912_792_1217 137
642 3300047469 Ga0495673_0139694 Ga0495673_0139694_210_635 137
643 3300047469 Ga0495673_0316917 Ga0495673_0316917_60_485 137
644 3300047470 Ga0495681_0088898 Ga0495681_0088898_183_608 137
645 3300047472 Ga0495686_0030036 Ga0495686_0030036_1610_2035 137
646 3300048904 Ga0496101_0107850 Ga0496101_0107850_1559_1984 137
647 3300048904 Ga0496101_0136833 Ga0496101_0136833_1276_1704 137
648 3300048905 Ga0496102_0180722 Ga0496102_0180722_849_1277 137
649 3300048905 Ga0496102_0316387 Ga0496102_0316387_992_1417 137
650 3300048905 Ga0496102_0680122 Ga0496102_0680122_400_825 137
651 3300048906 Ga0496103_0644673 Ga0496103_0644673_53_481 137
652 3300048907 Ga0496104_0669354 Ga0496104_0669354_412_837 137
653 3300048908 Ga0496105_0065235 Ga0496105_0065235_1612_2037 137
654 3300048909 Ga0496106_0020301 Ga0496106_0020301_3378_3806 137
655 3300048910 Ga0496107_0113748 Ga0496107_0113748_1502_1927 137
656 3300048910 Ga0496107_0763152 Ga0496107_0763152_144_572 137
657 3300048911 Ga0496108_0413585 Ga0496108_0413585_386_811 137
658 3300048914 Ga0496111_0243105 Ga0496111_0243105_438_863 137
659 3300048917 Ga0496114_1256261 Ga0496114_1256261_123_548 137
660 3300048919 Ga0496116_0016230 Ga0496116_0016230_3591_4016 137
661 3300048919 Ga0496116_0017063 Ga0496116_0017063_1637_2065 137
662 3300048919 Ga0496116_0028311 Ga0496116_0028311_1033_1458 137
663 3300048919 Ga0496116_0068234 Ga0496116_0068234_1209_1634 137
664 3300048919 Ga0496116_0140463 Ga0496116_0140463_445_876 137
665 3300048919 Ga0496116_0182505 Ga0496116_0182505_442_867 137
666 3300048919 Ga0496116_0186017 Ga0496116_0186017_328_753 137
667 3300048919 Ga0496116_0292112 Ga0496116_0292112_166_594 137
668 3300048920 Ga0496117_0028796 Ga0496117_0028796_925_1353 137
669 3300048920 Ga0496117_0036604 Ga0496117_0036604_2452_2877 137
670 3300048920 Ga0496117_0053053 Ga0496117_0053053_1252_1680 137
671 3300048921 Ga0496118_0045143 Ga0496118_0045143_2106_2531 137
672 3300048921 Ga0496118_0053336 Ga0496118_0053336_1507_1935 137
673 3300048921 Ga0496118_0089530 Ga0496118_0089530_720_1148 137
674 3300048922 Ga0496119_0103330 Ga0496119_0103330_231_656 137
675 3300048922 Ga0496119_0217924 Ga0496119_0217924_474_902 137
676 3300048923 Ga0496120_0044203 Ga0496120_0044203_1241_1663 137
677 3300048923 Ga0496120_0095205 Ga0496120_0095205_1118_1546 137
678 3300048923 Ga0496120_0233822 Ga0496120_0233822_77_505 137
679 3300048924 Ga0496121_0024624 Ga0496121_0024624_1536_1964 137
680 3300048924 Ga0496121_0026935 Ga0496121_0026935_1632_2060 137
681 3300048924 Ga0496121_0063557 Ga0496121_0063557_1339_1764 137
682 3300048924 Ga0496121_0083709 Ga0496121_0083709_841_1266 137
683 3300048924 Ga0496121_0104740 Ga0496121_0104740_354_782 137
684 3300048924 Ga0496121_0115298 Ga0496121_0115298_606_1034 137
685 3300048924 Ga0496121_0176439 Ga0496121_0176439_459_887 137
686 3300048924 Ga0496121_0333464 Ga0496121_0333464_331_759 137
687 3300048924 Ga0496121_0372974 Ga0496121_0372974_418_846 137
688 3300048925 Ga0496122_0018692 Ga0496122_0018692_4664_5092 137
689 3300048925 Ga0496122_0133519 Ga0496122_0133519_886_1314 137
690 3300048925 Ga0496122_0157882 Ga0496122_0157882_320_745 137
691 3300048925 Ga0496122_0232318 Ga0496122_0232318_18_443 137
692 3300048925 Ga0496122_0444030 Ga0496122_0444030_74_496 137
693 3300048926 Ga0496123_0019646 Ga0496123_0019646_2103_2531 137
694 3300048926 Ga0496123_0033047 Ga0496123_0033047_2605_3030 137
695 3300048926 Ga0496123_0102808 Ga0496123_0102808_74_499 137
696 3300048926 Ga0496123_0107142 Ga0496123_0107142_908_1336 137
697 3300048926 Ga0496123_0194328 Ga0496123_0194328_338_763 137
698 3300048926 Ga0496123_0195585 Ga0496123_0195585_414_842 137
699 3300048927 Ga0496124_0000740 Ga0496124_0000740_4613_5047 137
700 3300048927 Ga0496124_0003528 Ga0496124_0003528_13316_13741 137
701 3300048927 Ga0496124_0015170 Ga0496124_0015170_5016_5444 137
702 3300048927 Ga0496124_0070523 Ga0496124_0070523_1430_1855 137
703 3300048927 Ga0496124_0112962 Ga0496124_0112962_922_1347 137
704 3300048927 Ga0496124_0115460 Ga0496124_0115460_1067_1495 137
705 3300048927 Ga0496124_0142400 Ga0496124_0142400_196_621 137
706 3300048927 Ga0496124_0181096 Ga0496124_0181096_164_592 137
707 3300048927 Ga0496124_0237326 Ga0496124_0237326_341_766 137
708 3300048927 Ga0496124_0294641 Ga0496124_0294641_437_865 137
709 3300048927 Ga0496124_0412763 Ga0496124_0412763_20_448 137
710 3300048928 Ga0496125_0009489 Ga0496125_0009489_945_1373 137
711 3300048928 Ga0496125_0064559 Ga0496125_0064559_886_1314 137
712 3300048928 Ga0496125_0100953 Ga0496125_0100953_544_972 137
713 3300048928 Ga0496125_0227912 Ga0496125_0227912_435_863 137
714 3300048928 Ga0496125_0479030 Ga0496125_0479030_95_520 137
715 3300048928 Ga0496125_0491878 Ga0496125_0491878_214_636 137
716 3300048928 Ga0496125_0543013 Ga0496125_0543013_167_589 137
717 3300048929 Ga0496126_0036666 Ga0496126_0036666_177_602 137
718 3300048929 Ga0496126_0069234 Ga0496126_0069234_1816_2244 137
719 3300048929 Ga0496126_0545355 Ga0496126_0545355_317_748 137
720 3300048929 Ga0496126_0796633 Ga0496126_0796633_65_493 137
721 3300049459 Ga0495678_036147 Ga0495678_036147_713_1195 137
722 3300049459 Ga0495678_102061 Ga0495678_102061_260_685 137
723 3300049460 Ga0495682_0082097 Ga0495682_0082097_441_923 137
724 3300049568 Ga0501031_0388071 Ga0501031_0388071_101_529 137
725 3300049569 Ga0501032_0896568 Ga0501032_0896568_59_487 137
726 3300049570 Ga0501033_0621784 Ga0501033_0621784_180_608 137
727 3300049571 Ga0501034_0327332 Ga0501034_0327332_750_1181 137
728 3300049573 Ga0501037_0303866 Ga0501037_0303866_43_471 137
729 3300049574 Ga0501038_0306378 Ga0501038_0306378_572_1000 137
730 3300049581 Ga0501047_0709454 Ga0501047_0709454_345_773 137
731 3300049582 Ga0501048_0252607 Ga0501048_0252607_489_917 137
732 3300049584 Ga0501068_0594418 Ga0501068_0594418_217_645 137
733 3300049589 Ga0501073_0344337 Ga0501073_0344337_123_551 137
734 3300049589 Ga0501073_0360914 Ga0501073_0360914_311_742 137
735 3300049679 Ga0501249_209831 Ga0501249_209831_27_458 137
736 3300049742 Ga0501080_0048758 Ga0501080_0048758_825_1256 137
737 3300049744 Ga0501083_0440314 Ga0501083_0440314_138_566 137
738 3300049822 Ga0501035_0821801 Ga0501035_0821801_52_480 137
739 3300049823 Ga0501044_0618194 Ga0501044_0618194_171_599 137
740 3300050492 nmdc:mga0yw44_471439_c1 nmdc:mga0yw44_471439_c1_380_811 137
741 3300050496 nmdc:mga07m45_402457_c1 nmdc:mga07m45_402457_c1_22_447 137
742 3300050516 nmdc:mga0sz30_169687_c1 nmdc:mga0sz30_169687_c1_377_805 137
743 3300050516 nmdc:mga0sz30_76189_c1 nmdc:mga0sz30_76189_c1_251_664 137
744 3300053079 Ga0500610_0039853 Ga0500610_0039853_1782_2264 137
745 3300053088 Ga0500644_0244704 Ga0500644_0244704_244_672 137
746 3300053088 Ga0500644_0318784 Ga0500644_0318784_117_542 137
747 3300053093 Ga0500651_0170834 Ga0500651_0170834_564_992 137
748 3300053104 Ga0500556_0341764 Ga0500556_0341764_124_549 137
749 3300053105 Ga0500557_009624 Ga0500557_009624_337_819 137
750 3300053108 Ga0500562_034535 Ga0500562_034535_563_988 137
751 3300053108 Ga0500562_078000 Ga0500562_078000_349_777 137
752 3300053109 Ga0500569_022939 Ga0500569_022939_436_918 137
753 3300053118 Ga0500594_0002914 Ga0500594_0002914_1662_2144 137
754 3300053125 Ga0500618_010538 Ga0500618_010538_1664_2089 137
755 3300053125 Ga0500618_027174 Ga0500618_027174_539_967 137
756 3300053134 Ga0500658_0094335 Ga0500658_0094335_648_1076 137
757 3300053134 Ga0500658_0266967 Ga0500658_0266967_219_644 137
758 3300053139 Ga0500568_0002640 Ga0500568_0002640_8708_9136 137
759 3300053139 Ga0500568_0003244 Ga0500568_0003244_1646_2071 137
760 3300053139 Ga0500568_0083766 Ga0500568_0083766_368_796 137
761 3300053146 Ga0500588_0028853 Ga0500588_0028853_378_860 137
762 3300053153 Ga0500616_0003914 Ga0500616_0003914_405_830 137
763 3300053156 Ga0500622_0003496 Ga0500622_0003496_1201_1629 137
764 3300053157 Ga0500624_119333 Ga0500624_119333_72_497 137
765 3300053158 Ga0500627_0168049 Ga0500627_0168049_338_769 137
766 3300053160 Ga0500633_0022893 Ga0500633_0022893_622_1050 137
767 3300053160 Ga0500633_0251869 Ga0500633_0251869_189_614 137
768 3300053161 Ga0500634_0017698 Ga0500634_0017698_2204_2629 137
769 3300053161 Ga0500634_0301202 Ga0500634_0301202_16_441 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

36

133

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

28

139

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9601 3 137
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9571 3 137
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9529 3 137
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9528 2 137
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9501 3 137
ID Description Score Start End Superfamily
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9571 3 137 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9501 3 137 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9353 42 112 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9277 22 108 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9224 7 112 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7C4TTG7-F1-model_v4 HIT family protein 0.9645 2 136 GO:0003824
GO:0009117
AF-A0A090MML9-F1-model_v4 HIT-like protein 0.9638 1 136 GO:0003824
GO:0009117
AF-B6JAW3-F1-model_v4 Histidine triad (HIT) family protein 0.9628 1 136 GO:0003824
GO:0009117
AF-A0A537U9I5-F1-model_v4 HIT family protein 0.9627 1 136 GO:0003824
GO:0009117
AF-E0MK44-F1-model_v4 HIT domain-containing protein 0.9611 1 136 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
91.53 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map