F479994

General Info

Members Datasets Scaffolds Average Seq Length
769 235 1538 236

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001291|Ga0395899_0001291_19752_20534
Length 260
Sequence MAATTLSDRAIVRVSGDDVRGFVQGLVTNDAMAELPVWAGLLTPQGKCLFDFLIWADGDDLLLDCEAEAADDLIKRLSIYRLRRKIKIELDGRFAVHWHPEKVAPALHHNAIDSGPWPPKVVRDPRLEDLGWRWLAPADEVAEGWLEHRLRHGVCEGRAELGDILWLECNAAELNGVNFTKGCYVGQENTARMNWRAKVNRRLVIVPTGDPGPRSRIFYERLGLSVEHRRVDDLDGAIIPKWLEPALAPVHSWPGASPES

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
235 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.29
Rhizosphere 94.93
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0001291 3300037312 Bacteria 21622
2 JGI24740J21852_10072736 3300001979 Bacteria 917
3 JGI24739J22299_10000129 3300001989 Bacteria 23885
4 JGI24737J22298_10000357 3300001990 Bacteria 15471
5 JGI24737J22298_10001378 3300001990 Bacteria 8624
6 JGI24737J22298_10022096 3300001990 Bacteria 2022
7 JGI24735J21928_10016801 3300002067 Bacteria 2265
8 JGI24738J21930_10002016 3300002075 Bacteria 5457
9 Ga0065704_10095184 3300005289 Bacteria 2501
10 Ga0065712_10271178 3300005290 Bacteria 915
11 Ga0065715_10000654 3300005293 Bacteria 13208
12 Ga0065715_10038653 3300005293 Bacteria 1647
13 Ga0065715_10110590 3300005293 Bacteria 2613
14 Ga0065715_10113724 3300005293 Bacteria 2477
15 Ga0065715_10167364 3300005293 Bacteria 1575
16 Ga0070658_10000022 3300005327 Bacteria 186706
17 Ga0070658_10000179 3300005327 Bacteria 55511
18 Ga0070658_10006059 3300005327 Bacteria 9803
19 Ga0070658_10288801 3300005327 Bacteria 1397
20 Ga0070676_10000723 3300005328 Bacteria 16161
21 Ga0070676_10025630 3300005328 Bacteria 3334
22 Ga0070676_10167142 3300005328 Bacteria 1420
23 Ga0070676_10234515 3300005328 Bacteria 1218
24 Ga0070683_100000209 3300005329 Bacteria 39666
25 Ga0070683_100420740 3300005329 Bacteria 1274
26 Ga0070690_100079801 3300005330 Bacteria 2140
27 Ga0070690_100377064 3300005330 Bacteria 1036
28 Ga0070690_100445998 3300005330 Bacteria 959
29 Ga0070670_100000195 3300005331 Bacteria 56039
30 Ga0070670_100005739 3300005331 Bacteria 10484
31 Ga0070670_100014349 3300005331 Bacteria 6798
32 Ga0070670_100015584 3300005331 Bacteria 6529
33 Ga0070670_100070464 3300005331 Bacteria 3001
34 Ga0070670_100264116 3300005331 Bacteria 1501
35 Ga0070670_100712409 3300005331 Bacteria 903
36 Ga0070677_10005215 3300005333 Bacteria 4275
37 Ga0070677_10015668 3300005333 Bacteria 2687
38 Ga0070677_10069190 3300005333 Bacteria 1480
39 Ga0070677_10111800 3300005333 Bacteria 1220
40 Ga0070677_10154064 3300005333 Bacteria 1072
41 Ga0068869_100000331 3300005334 Bacteria 25170
42 Ga0068869_100049115 3300005334 Bacteria 3053
43 Ga0070666_10002196 3300005335 Bacteria 11824
44 Ga0070680_100000641 3300005336 Bacteria 24333
45 Ga0070680_100092032 3300005336 Bacteria 2511
46 Ga0070680_100109530 3300005336 Bacteria 2298
47 Ga0070680_100125735 3300005336 Bacteria 2142
48 Ga0070680_100150125 3300005336 Bacteria 1956
49 Ga0070680_100371107 3300005336 Bacteria 1218
50 Ga0070680_100754194 3300005336 Bacteria 838
51 Ga0070682_100115747 3300005337 Bacteria 1793
52 Ga0068868_100000156 3300005338 Bacteria 44526
53 Ga0070660_100000496 3300005339 Bacteria 26199
54 Ga0070660_100041657 3300005339 Bacteria 3501
55 Ga0070660_100109094 3300005339 Bacteria 2200
56 Ga0070660_100167960 3300005339 Bacteria 1771
57 Ga0070660_100220234 3300005339 Bacteria 1542
58 Ga0070660_100289837 3300005339 Bacteria 1340
59 Ga0070660_100560953 3300005339 Bacteria 953
60 Ga0070660_100690265 3300005339 Bacteria 856
61 Ga0070689_100577752 3300005340 Bacteria 971
62 Ga0070661_100000509 3300005344 Bacteria 29863
63 Ga0070661_100061931 3300005344 Bacteria 2747
64 Ga0070661_100107056 3300005344 Bacteria 2085
65 Ga0070661_100126498 3300005344 Bacteria 1917
66 Ga0070661_100154355 3300005344 Bacteria 1737
67 Ga0070692_10013775 3300005345 Bacteria 3780
68 Ga0070668_100043506 3300005347 Bacteria 3444
69 Ga0070668_100045452 3300005347 Bacteria 3369
70 Ga0070668_100345467 3300005347 Bacteria 1258
71 Ga0070669_100002902 3300005353 Bacteria 12356
72 Ga0070669_100012144 3300005353 Bacteria 6113
73 Ga0070669_100018290 3300005353 Bacteria 5008
74 Ga0070669_100087967 3300005353 Bacteria 2324
75 Ga0070669_100420267 3300005353 Bacteria 1097
76 Ga0070675_100002886 3300005354 Bacteria 12958
77 Ga0070675_100038524 3300005354 Bacteria 3897
78 Ga0070675_100043319 3300005354 Bacteria 3678
79 Ga0070671_100002678 3300005355 Bacteria 13804
80 Ga0070671_100003224 3300005355 Bacteria 12714
81 Ga0070671_100013820 3300005355 Bacteria 6514
82 Ga0070671_100014229 3300005355 Bacteria 6425
83 Ga0070671_100036618 3300005355 Bacteria 4069
84 Ga0070671_100376199 3300005355 Bacteria 1213
85 Ga0070674_100069835 3300005356 Bacteria 2479
86 Ga0070673_100000249 3300005364 Bacteria 27281
87 Ga0070673_100036961 3300005364 Bacteria 3717
88 Ga0070673_100070142 3300005364 Bacteria 2811
89 Ga0070673_100203296 3300005364 Bacteria 1707
90 Ga0070688_100064208 3300005365 Bacteria 2329
91 Ga0070659_100000138 3300005366 Bacteria 56073
92 Ga0070659_100000814 3300005366 Bacteria 22773
93 Ga0070659_100067310 3300005366 Bacteria 2840
94 Ga0070659_100121679 3300005366 Bacteria 2115
95 Ga0070659_100184236 3300005366 Bacteria 1714
96 Ga0070659_100241405 3300005366 Bacteria 1495
97 Ga0070659_100466631 3300005366 Bacteria 1073
98 Ga0070659_100490026 3300005366 Bacteria 1047
99 Ga0070667_100001760 3300005367 Bacteria 19301
100 Ga0070667_100005936 3300005367 Bacteria 10165
101 Ga0070667_100032537 3300005367 Bacteria 4350
102 Ga0070667_100035165 3300005367 Bacteria 4196
103 Ga0070667_100122785 3300005367 Bacteria 2261
104 Ga0070667_100342951 3300005367 Bacteria 1351
105 Ga0070709_10032385 3300005434 Bacteria 3152
106 Ga0070714_100024896 3300005435 Bacteria 4934
107 Ga0070714_100457137 3300005435 Bacteria 1213
108 Ga0070714_100967537 3300005435 Bacteria 828
109 Ga0070663_100002205 3300005455 Bacteria 10897
110 Ga0070663_100115286 3300005455 Bacteria 2024
111 Ga0070663_100120386 3300005455 Bacteria 1982
112 Ga0070663_100144293 3300005455 Bacteria 1820
113 Ga0070663_100249992 3300005455 Bacteria 1403
114 Ga0070663_100463302 3300005455 Bacteria 1047
115 Ga0070678_100012520 3300005456 Bacteria 5278
116 Ga0070678_100068969 3300005456 Bacteria 2638
117 Ga0070678_100248262 3300005456 Bacteria 1491
118 Ga0070678_100337292 3300005456 Bacteria 1292
119 Ga0070662_100005377 3300005457 Bacteria 8178
120 Ga0070662_100016179 3300005457 Bacteria 5005
121 Ga0070662_100018029 3300005457 Bacteria 4769
122 Ga0070662_100023842 3300005457 Bacteria 4209
123 Ga0070681_10083437 3300005458 Bacteria 3149
124 Ga0070681_10368083 3300005458 Bacteria 1348
125 Ga0068867_100043358 3300005459 Bacteria 3294
126 Ga0070679_100026909 3300005530 Bacteria 5655
127 Ga0070679_100070909 3300005530 Bacteria 3475
128 Ga0070679_100097574 3300005530 Bacteria 2926
129 Ga0070679_100226931 3300005530 Bacteria 1828
130 Ga0070679_100495567 3300005530 Bacteria 1166
131 Ga0070679_100599328 3300005530 Bacteria 1045
132 Ga0070679_100625444 3300005530 Bacteria 1020
133 Ga0070684_100368687 3300005535 Bacteria 1322
134 Ga0068853_100001329 3300005539 Bacteria 17794
135 Ga0068853_100020437 3300005539 Bacteria 5507
136 Ga0068853_100028037 3300005539 Bacteria 4736
137 Ga0068853_100287457 3300005539 Bacteria 1517
138 Ga0068853_100312935 3300005539 Bacteria 1454
139 Ga0070672_100004112 3300005543 Bacteria 9500
140 Ga0070672_100088349 3300005543 Bacteria 2495
141 Ga0070672_100105706 3300005543 Bacteria 2289
142 Ga0070672_100114757 3300005543 Bacteria 2199
143 Ga0070672_100300970 3300005543 Bacteria 1359
144 Ga0070696_100569445 3300005546 Bacteria 910
145 Ga0070693_100000703 3300005547 Bacteria 14759
146 Ga0070665_100005560 3300005548 Bacteria 12965
147 Ga0070665_100385056 3300005548 Bacteria 1410
148 Ga0068855_100000163 3300005563 Bacteria 85587
149 Ga0068855_100009899 3300005563 Bacteria 11499
150 Ga0068855_100095216 3300005563 Bacteria 3432
151 Ga0068855_100154958 3300005563 Bacteria 2603
152 Ga0068855_100180519 3300005563 Bacteria 2386
153 Ga0070664_100000544 3300005564 Bacteria 28761
154 Ga0070664_100001299 3300005564 Bacteria 19974
155 Ga0070664_100140408 3300005564 Bacteria 2127
156 Ga0070664_100189327 3300005564 Bacteria 1833
157 Ga0070664_100203776 3300005564 Bacteria 1766
158 Ga0070664_100210672 3300005564 Bacteria 1737
159 Ga0070664_100256615 3300005564 Bacteria 1572
160 Ga0070664_100263187 3300005564 Bacteria 1552
161 Ga0070664_100296252 3300005564 Bacteria 1461
162 Ga0070664_100355821 3300005564 Bacteria 1333
163 Ga0068857_100001148 3300005577 Bacteria 20637
164 Ga0068857_100123514 3300005577 Bacteria 2332
165 Ga0068854_100001188 3300005578 Bacteria 15628
166 Ga0068854_100003932 3300005578 Bacteria 9310
167 Ga0068856_100001006 3300005614 Bacteria 30001
168 Ga0068856_100014136 3300005614 Bacteria 7718
169 Ga0068856_100231412 3300005614 Bacteria 1863
170 Ga0068856_100268667 3300005614 Bacteria 1721
171 Ga0068852_100000502 3300005616 Bacteria 25705
172 Ga0068852_100007393 3300005616 Bacteria 8016
173 Ga0068852_100012780 3300005616 Bacteria 6395
174 Ga0068852_100200478 3300005616 Bacteria 1888
175 Ga0068852_100235440 3300005616 Bacteria 1747
176 Ga0068852_100245413 3300005616 Bacteria 1713
177 Ga0068852_100347452 3300005616 Bacteria 1447
178 Ga0068852_100380886 3300005616 Bacteria 1384
179 Ga0068852_100514189 3300005616 Bacteria 1194
180 Ga0068852_100535068 3300005616 Bacteria 1170
181 Ga0068859_100000778 3300005617 Bacteria 32222
182 Ga0068859_100005561 3300005617 Bacteria 12836
183 Ga0068859_100078684 3300005617 Bacteria 3338
184 Ga0068859_100538900 3300005617 Bacteria 1262
185 Ga0068864_100000189 3300005618 Bacteria 56038
186 Ga0068864_100000795 3300005618 Bacteria 26479
187 Ga0068864_100005333 3300005618 Bacteria 10533
188 Ga0068864_100018948 3300005618 Bacteria 5753
189 Ga0068864_100038052 3300005618 Bacteria 4107
190 Ga0068864_100128789 3300005618 Bacteria 2271
191 Ga0068851_10076344 3300005834 Bacteria 1742
192 Ga0068851_10309495 3300005834 Bacteria 910
193 Ga0068863_100000073 3300005841 Bacteria 110576
194 Ga0068863_100003770 3300005841 Bacteria 14990
195 Ga0068863_100154555 3300005841 Bacteria 2196
196 Ga0068863_100183485 3300005841 Bacteria 2009
197 Ga0068863_100948417 3300005841 Bacteria 862
198 Ga0068858_100032992 3300005842 Bacteria 4809
199 Ga0068858_100041345 3300005842 Bacteria 4275
200 Ga0068860_100001686 3300005843 Bacteria 23599
201 Ga0068860_100016439 3300005843 Bacteria 7214
202 Ga0068860_100135061 3300005843 Bacteria 2369
203 Ga0068860_100382779 3300005843 Bacteria 1389
204 Ga0068862_100000233 3300005844 Bacteria 62058
205 Ga0068862_100003296 3300005844 Bacteria 13962
206 Ga0068862_100007156 3300005844 Bacteria 9260
207 Ga0068862_100035214 3300005844 Bacteria 4237
208 Ga0068862_100160365 3300005844 Bacteria 2007
209 Ga0068862_100610282 3300005844 Bacteria 1048
210 Ga0081539_10004604 3300005985 Bacteria 15046
211 Ga0070717_10080827 3300006028 Bacteria 2728
212 Ga0075365_10119746 3300006038 Bacteria 1815
213 Ga0075432_10042944 3300006058 Bacteria 1583
214 Ga0070712_100062532 3300006175 Bacteria 2633
215 Ga0075362_10170905 3300006177 Bacteria 1050
216 Ga0097621_100077538 3300006237 Bacteria 2759
217 Ga0097621_100181384 3300006237 Bacteria 1819
218 Ga0097621_100216581 3300006237 Bacteria 1667
219 Ga0068871_100093675 3300006358 Bacteria 2506
220 Ga0068871_100147271 3300006358 Bacteria 2006
221 Ga0075428_100600416 3300006844 Bacteria 1176
222 Ga0075431_100081205 3300006847 Bacteria 3348
223 Ga0068865_100003247 3300006881 Bacteria 9738
224 Ga0068865_100005327 3300006881 Bacteria 7788
225 Ga0068865_100365538 3300006881 Bacteria 1173
226 Ga0097620_100000778 3300006931 Bacteria 32222
227 Ga0097620_100005561 3300006931 Bacteria 12836
228 Ga0097620_100078681 3300006931 Bacteria 3338
229 Ga0097620_100538944 3300006931 Bacteria 1262
230 Ga0105251_10000468 3300009011 Bacteria 38504
231 Ga0105240_10020228 3300009093 Bacteria 8885
232 Ga0105240_10022230 3300009093 Bacteria 8414
233 Ga0111539_10958268 3300009094 Bacteria 995
234 Ga0105245_10000326 3300009098 Bacteria 44899
235 Ga0105247_10030300 3300009101 Bacteria 3279
236 Ga0105243_10015618 3300009148 Bacteria 5740
237 Ga0105243_10154793 3300009148 Bacteria 1970
238 Ga0105243_10583871 3300009148 Bacteria 1073
239 Ga0105241_10711866 3300009174 Bacteria 917
240 Ga0105242_10634395 3300009176 Bacteria 1037
241 Ga0105248_10000026 3300009177 Bacteria 257155
242 Ga0105248_10000159 3300009177 Bacteria 78504
243 Ga0105248_10005569 3300009177 Bacteria 13842
244 Ga0105248_10021410 3300009177 Bacteria 7163
245 Ga0105248_10056551 3300009177 Bacteria 4401
246 Ga0105248_10097680 3300009177 Bacteria 3309
247 Ga0105248_10121446 3300009177 Bacteria 2947
248 Ga0105248_10169985 3300009177 Bacteria 2457
249 Ga0105248_10183470 3300009177 Bacteria 2358
250 Ga0105248_10292289 3300009177 Bacteria 1835
251 Ga0105248_10398726 3300009177 Bacteria 1549
252 Ga0105248_11090466 3300009177 Bacteria 902
253 Ga0105237_10653645 3300009545 Bacteria 1058
254 Ga0105238_10100625 3300009551 Bacteria 2873
255 Ga0105249_10000110 3300009553 Bacteria 111292
256 Ga0105239_10139049 3300010375 Bacteria 2705
257 Ga0105246_10007596 3300011119 Bacteria 6648
258 Ga0157373_10025715 3300013100 Bacteria 4256
259 Ga0157373_10061445 3300013100 Bacteria 2661
260 Ga0157373_10072724 3300013100 Bacteria 2427
261 Ga0157373_10414906 3300013100 Bacteria 966
262 Ga0157371_10008488 3300013102 Bacteria 8176
263 Ga0157371_10018899 3300013102 Bacteria 5090
264 Ga0157371_10020658 3300013102 Bacteria 4845
265 Ga0157371_10024982 3300013102 Bacteria 4359
266 Ga0157371_10205219 3300013102 Bacteria 1414
267 Ga0157371_10484896 3300013102 Bacteria 912
268 Ga0157370_10262569 3300013104 Bacteria 1596
269 Ga0157370_10527734 3300013104 Bacteria 1083
270 Ga0157369_10002388 3300013105 Bacteria 22553
271 Ga0157369_10018284 3300013105 Bacteria 7862
272 Ga0157369_10186161 3300013105 Bacteria 2183
273 Ga0157369_10190313 3300013105 Bacteria 2156
274 Ga0157369_10558099 3300013105 Bacteria 1183
275 Ga0157374_10005525 3300013296 Bacteria 10631
276 Ga0163162_10032032 3300013306 Bacteria 5218
277 Ga0163162_10121764 3300013306 Bacteria 2713
278 Ga0163162_10122547 3300013306 Bacteria 2705
279 Ga0163162_10172626 3300013306 Bacteria 2287
280 Ga0163162_10194791 3300013306 Bacteria 2155
281 Ga0163162_10394966 3300013306 Bacteria 1515
282 Ga0157372_10333910 3300013307 Bacteria 1765
283 Ga0157375_10025088 3300013308 Bacteria 5530
284 Ga0157375_10061470 3300013308 Bacteria 3729
285 Ga0157375_10079188 3300013308 Bacteria 3321
286 Ga0157375_10240097 3300013308 Bacteria 1971
287 Ga0157375_10353156 3300013308 Bacteria 1636
288 Ga0157375_10452078 3300013308 Bacteria 1450
289 Ga0157375_11505442 3300013308 Bacteria 794
290 Ga0163163_10000338 3300014325 Bacteria 45226
291 Ga0163163_10442360 3300014325 Bacteria 1360
292 Ga0157380_10002361 3300014326 Bacteria 12689
293 Ga0157380_10067433 3300014326 Bacteria 2881
294 Ga0157380_10175265 3300014326 Bacteria 1878
295 Ga0157380_10684365 3300014326 Bacteria 1028
296 Ga0182008_10103489 3300014497 Bacteria 1408
297 Ga0157377_10435996 3300014745 Bacteria 901
298 Ga0157379_10334019 3300014968 Bacteria 1385
299 Ga0163161_10040969 3300017792 Bacteria 3327
300 Ga0163161_10096129 3300017792 Bacteria 2199
301 Ga0163161_10246096 3300017792 Bacteria 1392
302 Ga0163161_10385947 3300017792 Bacteria 1120
303 Ga0207697_10000584 3300025315 Bacteria 20797
304 Ga0207697_10000628 3300025315 Bacteria 20080
305 Ga0207656_10011277 3300025321 Bacteria 3375
306 Ga0207656_10188278 3300025321 Bacteria 993
307 Ga0207713_1010672 3300025735 Bacteria 5063
308 Ga0207682_10026117 3300025893 Bacteria 2320
309 Ga0207682_10028649 3300025893 Bacteria 2224
310 Ga0207682_10095725 3300025893 Bacteria 1293
311 Ga0207710_10014805 3300025900 Bacteria 3293
312 Ga0207688_10004411 3300025901 Bacteria 7657
313 Ga0207688_10020823 3300025901 Bacteria 3580
314 Ga0207647_10002145 3300025904 Bacteria 15075
315 Ga0207647_10007691 3300025904 Bacteria 7763
316 Ga0207647_10017285 3300025904 Bacteria 4903
317 Ga0207699_10140441 3300025906 Bacteria 1587
318 Ga0207645_10001233 3300025907 Bacteria 21061
319 Ga0207645_10011120 3300025907 Bacteria 6158
320 Ga0207645_10028384 3300025907 Bacteria 3612
321 Ga0207645_10204031 3300025907 Bacteria 1301
322 Ga0207705_10000236 3300025909 Bacteria 54788
323 Ga0207705_10000260 3300025909 Bacteria 51366
324 Ga0207705_10037429 3300025909 Bacteria 3472
325 Ga0207705_10076647 3300025909 Bacteria 2431
326 Ga0207705_10102877 3300025909 Bacteria 2103
327 Ga0207705_10288477 3300025909 Bacteria 1257
328 Ga0207705_10297584 3300025909 Bacteria 1237
329 Ga0207707_10241273 3300025912 Bacteria 1571
330 Ga0207707_10320023 3300025912 Bacteria 1339
331 Ga0207695_10001533 3300025913 Bacteria 38143
332 Ga0207693_10048619 3300025915 Bacteria 3330
333 Ga0207660_10001336 3300025917 Bacteria 16498
334 Ga0207660_10045934 3300025917 Bacteria 3080
335 Ga0207660_10275551 3300025917 Bacteria 1334
336 Ga0207660_10351623 3300025917 Bacteria 1181
337 Ga0207660_10468539 3300025917 Bacteria 1020
338 Ga0207657_10000031 3300025919 Bacteria 132167
339 Ga0207657_10000267 3300025919 Bacteria 55426
340 Ga0207657_10014578 3300025919 Bacteria 7661
341 Ga0207657_10067189 3300025919 Bacteria 3049
342 Ga0207657_10158296 3300025919 Bacteria 1841
343 Ga0207657_10166587 3300025919 Bacteria 1787
344 Ga0207657_10359317 3300025919 Bacteria 1148
345 Ga0207657_10486841 3300025919 Bacteria 967
346 Ga0207649_10000394 3300025920 Bacteria 32788
347 Ga0207649_10038576 3300025920 Bacteria 2893
348 Ga0207649_10111419 3300025920 Bacteria 1829
349 Ga0207649_10159742 3300025920 Bacteria 1561
350 Ga0207649_10307350 3300025920 Bacteria 1161
351 Ga0207649_10538302 3300025920 Bacteria 892
352 Ga0207652_10077209 3300025921 Bacteria 2906
353 Ga0207652_10093149 3300025921 Bacteria 2651
354 Ga0207652_10328709 3300025921 Bacteria 1380
355 Ga0207681_10001333 3300025923 Bacteria 15917
356 Ga0207681_10009822 3300025923 Bacteria 5852
357 Ga0207681_10016807 3300025923 Bacteria 4585
358 Ga0207681_10077265 3300025923 Bacteria 2340
359 Ga0207681_10185415 3300025923 Bacteria 1588
360 Ga0207681_10368494 3300025923 Bacteria 1154
361 Ga0207694_10478125 3300025924 Bacteria 1042
362 Ga0207650_10000243 3300025925 Bacteria 59507
363 Ga0207650_10002008 3300025925 Bacteria 14261
364 Ga0207650_10003293 3300025925 Bacteria 11114
365 Ga0207650_10045653 3300025925 Bacteria 3223
366 Ga0207650_10053984 3300025925 Bacteria 2979
367 Ga0207650_10093245 3300025925 Bacteria 2305
368 Ga0207650_10164624 3300025925 Bacteria 1759
369 Ga0207650_10616782 3300025925 Bacteria 913
370 Ga0207659_10031776 3300025926 Bacteria 3618
371 Ga0207659_10050207 3300025926 Bacteria 2962
372 Ga0207687_10007615 3300025927 Bacteria 7120
373 Ga0207664_10086877 3300025929 Bacteria 2556
374 Ga0207664_10384771 3300025929 Bacteria 1246
375 Ga0207644_10005857 3300025931 Bacteria 8010
376 Ga0207644_10007309 3300025931 Bacteria 7188
377 Ga0207644_10014636 3300025931 Bacteria 5254
378 Ga0207644_10043926 3300025931 Bacteria 3173
379 Ga0207644_10123565 3300025931 Bacteria 1973
380 Ga0207644_10143571 3300025931 Bacteria 1840
381 Ga0207644_10221253 3300025931 Bacteria 1501
382 Ga0207644_10292295 3300025931 Bacteria 1311
383 Ga0207690_10000382 3300025932 Bacteria 29300
384 Ga0207690_10072496 3300025932 Bacteria 2378
385 Ga0207690_10125227 3300025932 Bacteria 1873
386 Ga0207690_10195835 3300025932 Bacteria 1531
387 Ga0207690_10805949 3300025932 Bacteria 776
388 Ga0207706_10000028 3300025933 Bacteria 149092
389 Ga0207706_10000171 3300025933 Bacteria 72122
390 Ga0207706_10000475 3300025933 Bacteria 42955
391 Ga0207706_10003718 3300025933 Bacteria 14556
392 Ga0207706_10013507 3300025933 Bacteria 7421
393 Ga0207706_10020276 3300025933 Bacteria 5976
394 Ga0207706_10051877 3300025933 Bacteria 3621
395 Ga0207706_10060526 3300025933 Bacteria 3334
396 Ga0207709_10037183 3300025935 Bacteria 2891
397 Ga0207709_10125494 3300025935 Bacteria 1740
398 Ga0207670_10495253 3300025936 Bacteria 991
399 Ga0207669_10001298 3300025937 Bacteria 10609
400 Ga0207704_10001327 3300025938 Bacteria 11039
401 Ga0207704_10017092 3300025938 Bacteria 3750
402 Ga0207704_10256992 3300025938 Bacteria 1315
403 Ga0207691_10001864 3300025940 Bacteria 20610
404 Ga0207691_10004641 3300025940 Bacteria 13301
405 Ga0207691_10038192 3300025940 Bacteria 4442
406 Ga0207691_10146746 3300025940 Bacteria 2076
407 Ga0207691_10216417 3300025940 Bacteria 1662
408 Ga0207691_10371485 3300025940 Bacteria 1221
409 Ga0207711_10000004 3300025941 Bacteria 870636
410 Ga0207711_10000500 3300025941 Bacteria 40435
411 Ga0207711_10001375 3300025941 Bacteria 22908
412 Ga0207711_10060833 3300025941 Bacteria 3255
413 Ga0207711_10118333 3300025941 Bacteria 2363
414 Ga0207711_10264497 3300025941 Bacteria 1582
415 Ga0207711_10280186 3300025941 Bacteria 1535
416 Ga0207711_10304260 3300025941 Bacteria 1471
417 Ga0207711_10369257 3300025941 Bacteria 1330
418 Ga0207689_10000092 3300025942 Bacteria 73254
419 Ga0207661_10009852 3300025944 Bacteria 6864
420 Ga0207679_10000129 3300025945 Bacteria 61477
421 Ga0207679_10010347 3300025945 Bacteria 6003
422 Ga0207679_10013915 3300025945 Bacteria 5274
423 Ga0207679_10060080 3300025945 Bacteria 2823
424 Ga0207679_10306569 3300025945 Bacteria 1370
425 Ga0207679_10344177 3300025945 Bacteria 1298
426 Ga0207667_10000357 3300025949 Bacteria 62034
427 Ga0207667_10041374 3300025949 Bacteria 4901
428 Ga0207667_10103109 3300025949 Bacteria 2943
429 Ga0207651_10000176 3300025960 Bacteria 27858
430 Ga0207651_10004216 3300025960 Bacteria 7207
431 Ga0207651_10014349 3300025960 Bacteria 4571
432 Ga0207651_10106085 3300025960 Bacteria 2097
433 Ga0207712_10000701 3300025961 Bacteria 25878
434 Ga0207668_10003189 3300025972 Bacteria 9609
435 Ga0207668_10053589 3300025972 Bacteria 2796
436 Ga0207668_10098748 3300025972 Bacteria 2164
437 Ga0207668_10141816 3300025972 Bacteria 1849
438 Ga0207640_10000469 3300025981 Bacteria 24706
439 Ga0207640_10000922 3300025981 Bacteria 16485
440 Ga0207658_10000430 3300025986 Bacteria 39640
441 Ga0207658_10030575 3300025986 Bacteria 3814
442 Ga0207658_10057868 3300025986 Bacteria 2882
443 Ga0207658_10086952 3300025986 Bacteria 2412
444 Ga0207677_10001085 3300026023 Bacteria 14802
445 Ga0207703_10023487 3300026035 Bacteria 4844
446 Ga0207703_10039713 3300026035 Bacteria 3762
447 Ga0207639_10000131 3300026041 Bacteria 54681
448 Ga0207639_10003016 3300026041 Bacteria 11334
449 Ga0207639_10071391 3300026041 Bacteria 2715
450 Ga0207639_10097373 3300026041 Bacteria 2369
451 Ga0207639_10147064 3300026041 Bacteria 1970
452 Ga0207639_10364729 3300026041 Bacteria 1293
453 Ga0207678_10000740 3300026067 Bacteria 29953
454 Ga0207678_10013949 3300026067 Bacteria 7063
455 Ga0207678_10023639 3300026067 Bacteria 5374
456 Ga0207678_10025287 3300026067 Bacteria 5183
457 Ga0207678_10093264 3300026067 Bacteria 2573
458 Ga0207678_10182782 3300026067 Bacteria 1790
459 Ga0207678_10208646 3300026067 Bacteria 1671
460 Ga0207678_10359505 3300026067 Bacteria 1256
461 Ga0207678_10459675 3300026067 Bacteria 1107
462 Ga0207678_10598406 3300026067 Bacteria 966
463 Ga0207702_10000247 3300026078 Bacteria 62873
464 Ga0207702_10011305 3300026078 Bacteria 7442
465 Ga0207702_10365351 3300026078 Bacteria 1384
466 Ga0207641_10000018 3300026088 Bacteria 298209
467 Ga0207641_10062093 3300026088 Bacteria 3187
468 Ga0207641_10192378 3300026088 Bacteria 1876
469 Ga0207648_10008297 3300026089 Bacteria 10086
470 Ga0207648_10017502 3300026089 Bacteria 6518
471 Ga0207648_10317412 3300026089 Bacteria 1400
472 Ga0207648_10448045 3300026089 Bacteria 1175
473 Ga0207676_10000027 3300026095 Bacteria 245868
474 Ga0207676_10001355 3300026095 Bacteria 18216
475 Ga0207676_10008398 3300026095 Bacteria 7341
476 Ga0207676_10017890 3300026095 Bacteria 5143
477 Ga0207676_10024995 3300026095 Bacteria 4428
478 Ga0207676_10132176 3300026095 Bacteria 2124
479 Ga0207674_10005285 3300026116 Bacteria 15361
480 Ga0207674_10221847 3300026116 Bacteria 1839
481 Ga0207675_100022986 3300026118 Bacteria 5799
482 Ga0207675_100220995 3300026118 Bacteria 1825
483 Ga0207675_100386869 3300026118 Bacteria 1376
484 Ga0207683_10017765 3300026121 Bacteria 6066
485 Ga0207683_10062438 3300026121 Bacteria 3281
486 Ga0207683_10267681 3300026121 Bacteria 1561
487 Ga0207698_10000125 3300026142 Bacteria 48032
488 Ga0207698_10007108 3300026142 Bacteria 7013
489 Ga0207698_10014500 3300026142 Bacteria 5242
490 Ga0207698_10039698 3300026142 Bacteria 3490
491 Ga0207698_10125484 3300026142 Bacteria 2182
492 Ga0207698_10434081 3300026142 Bacteria 1264
493 Ga0207698_10529773 3300026142 Bacteria 1151
494 Ga0207698_10757397 3300026142 Bacteria 970
495 Ga0209974_10014271 3300027876 Bacteria 2645
496 Ga0268266_10010715 3300028379 Bacteria 7988
497 Ga0268266_10526800 3300028379 Bacteria 1130
498 Ga0268265_10000097 3300028380 Bacteria 110755
499 Ga0268265_10002770 3300028380 Bacteria 12931
500 Ga0268265_10023472 3300028380 Bacteria 4348
501 Ga0268265_10125935 3300028380 Bacteria 2120
502 Ga0268265_10303834 3300028380 Bacteria 1438
503 Ga0268264_10003351 3300028381 Bacteria 13846
504 Ga0316177_1146319 3300030731 Bacteria 1204
505 Ga0316182_1055757 3300030745 Bacteria 2093
506 Ga0307408_100002967 3300031548 Bacteria 11753
507 Ga0307408_100027563 3300031548 Bacteria 3917
508 Ga0307408_100051681 3300031548 Bacteria 2961
509 Ga0307408_100124140 3300031548 Bacteria 2004
510 Ga0307408_100193414 3300031548 Bacteria 1641
511 Ga0307408_100328401 3300031548 Bacteria 1291
512 Ga0307405_10011333 3300031731 Bacteria 4666
513 Ga0307405_10034957 3300031731 Bacteria 2996
514 Ga0307405_10103721 3300031731 Bacteria 1912
515 Ga0307405_10107126 3300031731 Bacteria 1886
516 Ga0307405_10168043 3300031731 Bacteria 1561
517 Ga0307405_10427849 3300031731 Bacteria 1044
518 Ga0307405_10656551 3300031731 Bacteria 863
519 Ga0307413_10000144 3300031824 Bacteria 19106
520 Ga0307413_10000322 3300031824 Bacteria 14948
521 Ga0307413_10038126 3300031824 Bacteria 2782
522 Ga0307413_10049572 3300031824 Bacteria 2517
523 Ga0307413_10069246 3300031824 Bacteria 2213
524 Ga0307413_10147943 3300031824 Bacteria 1633
525 Ga0307413_10200647 3300031824 Bacteria 1440
526 Ga0307413_10270399 3300031824 Bacteria 1272
527 Ga0307413_10314546 3300031824 Bacteria 1193
528 Ga0307413_10366970 3300031824 Bacteria 1117
529 Ga0307413_10647649 3300031824 Bacteria 871
530 Ga0307413_10669457 3300031824 Bacteria 858
531 Ga0307410_10000229 3300031852 Bacteria 21150
532 Ga0307410_10001946 3300031852 Bacteria 9696
533 Ga0307410_10003819 3300031852 Bacteria 7656
534 Ga0307410_10007280 3300031852 Bacteria 6047
535 Ga0307410_10025235 3300031852 Bacteria 3725
536 Ga0307410_10049821 3300031852 Bacteria 2813
537 Ga0307410_10051727 3300031852 Bacteria 2770
538 Ga0307410_10103820 3300031852 Bacteria 2042
539 Ga0307410_10113526 3300031852 Bacteria 1964
540 Ga0307410_10241203 3300031852 Bacteria 1401
541 Ga0307410_10307970 3300031852 Bacteria 1252
542 Ga0307410_10328517 3300031852 Bacteria 1215
543 Ga0307410_10335763 3300031852 Bacteria 1203
544 Ga0307410_10411814 3300031852 Bacteria 1094
545 Ga0307410_10487566 3300031852 Bacteria 1012
546 Ga0307406_10006278 3300031901 Bacteria 6549
547 Ga0307406_10017897 3300031901 Bacteria 4133
548 Ga0307406_10028782 3300031901 Bacteria 3359
549 Ga0307406_10451957 3300031901 Bacteria 1031
550 Ga0307407_10003042 3300031903 Bacteria 6751
551 Ga0307407_10005040 3300031903 Bacteria 5690
552 Ga0307407_10017401 3300031903 Bacteria 3606
553 Ga0307407_10037315 3300031903 Bacteria 2684
554 Ga0307407_10048031 3300031903 Bacteria 2426
555 Ga0307407_10060068 3300031903 Bacteria 2217
556 Ga0307407_10071329 3300031903 Bacteria 2068
557 Ga0307407_10437942 3300031903 Bacteria 946
558 Ga0307412_10002810 3300031911 Bacteria 9664
559 Ga0307412_10039483 3300031911 Bacteria 3047
560 Ga0307412_10070270 3300031911 Bacteria 2386
561 Ga0307412_10195800 3300031911 Bacteria 1531
562 Ga0307412_10306095 3300031911 Bacteria 1258
563 Ga0307412_10324305 3300031911 Bacteria 1226
564 Ga0307409_100000049 3300031995 Bacteria 42215
565 Ga0307409_100002843 3300031995 Bacteria 9157
566 Ga0307409_100020516 3300031995 Bacteria 4507
567 Ga0307409_100042012 3300031995 Bacteria 3420
568 Ga0307409_100045673 3300031995 Bacteria 3308
569 Ga0307409_100054166 3300031995 Bacteria 3088
570 Ga0307409_100092205 3300031995 Bacteria 2485
571 Ga0307409_100165218 3300031995 Bacteria 1941
572 Ga0307409_100287651 3300031995 Bacteria 1522
573 Ga0307409_100366089 3300031995 Bacteria 1365
574 Ga0307409_100411632 3300031995 Bacteria 1294
575 Ga0307409_100441501 3300031995 Bacteria 1254
576 Ga0307409_100739747 3300031995 Bacteria 986
577 Ga0307409_100818652 3300031995 Bacteria 940
578 Ga0307409_101349643 3300031995 Bacteria 739
579 Ga0307416_100001051 3300032002 Bacteria 14704
580 Ga0307416_100002148 3300032002 Bacteria 11164
581 Ga0307416_100023586 3300032002 Bacteria 4469
582 Ga0307416_100035986 3300032002 Bacteria 3790
583 Ga0307416_100103810 3300032002 Bacteria 2483
584 Ga0307416_100136989 3300032002 Bacteria 2217
585 Ga0307416_100265661 3300032002 Bacteria 1680
586 Ga0307416_100384869 3300032002 Bacteria 1434
587 Ga0307416_101054592 3300032002 Bacteria 917
588 Ga0307414_10000735 3300032004 Bacteria 16778
589 Ga0307414_10003070 3300032004 Bacteria 8861
590 Ga0307414_10008521 3300032004 Bacteria 5820
591 Ga0307414_10009029 3300032004 Bacteria 5702
592 Ga0307414_10017974 3300032004 Bacteria 4338
593 Ga0307414_10029247 3300032004 Bacteria 3584
594 Ga0307414_10063912 3300032004 Bacteria 2618
595 Ga0307414_10073834 3300032004 Bacteria 2469
596 Ga0307414_10076476 3300032004 Bacteria 2433
597 Ga0307414_10077406 3300032004 Bacteria 2421
598 Ga0307414_10083813 3300032004 Bacteria 2342
599 Ga0307414_10088856 3300032004 Bacteria 2288
600 Ga0307414_10090974 3300032004 Bacteria 2266
601 Ga0307414_10121282 3300032004 Bacteria 2010
602 Ga0307414_10151992 3300032004 Bacteria 1827
603 Ga0307414_10638983 3300032004 Bacteria 958
604 Ga0307414_10941233 3300032004 Bacteria 793
605 Ga0307411_10002932 3300032005 Bacteria 7737
606 Ga0307411_10003016 3300032005 Bacteria 7675
607 Ga0307411_10008224 3300032005 Bacteria 5387
608 Ga0307411_10013708 3300032005 Bacteria 4484
609 Ga0307411_10018122 3300032005 Bacteria 4031
610 Ga0307411_10018565 3300032005 Bacteria 3994
611 Ga0307411_10032137 3300032005 Bacteria 3239
612 Ga0307411_10073664 3300032005 Bacteria 2324
613 Ga0307411_10077197 3300032005 Bacteria 2279
614 Ga0307411_10098361 3300032005 Bacteria 2062
615 Ga0307411_10586634 3300032005 Bacteria 956
616 Ga0307411_10687050 3300032005 Bacteria 890
617 Ga0307415_100000886 3300032126 Bacteria 13699
618 Ga0307415_100002565 3300032126 Bacteria 9081
619 Ga0307415_100028704 3300032126 Bacteria 3544
620 Ga0307415_100050658 3300032126 Bacteria 2814
621 Ga0307415_100079181 3300032126 Bacteria 2340
622 Ga0307415_100163609 3300032126 Bacteria 1727
623 Ga0307415_100167011 3300032126 Bacteria 1712
624 Ga0373960_0062525 3300035121 Bacteria 1133
625 Ga0373943_0003195 3300035170 Bacteria 7432
626 Ga0373955_0447270 3300035172 Bacteria 787
627 Ga0373931_0005757 3300035691 Bacteria 5757
628 Ga0373937_0004086 3300036401 Bacteria 12375
629 Ga0373925_0015663 3300037068 Bacteria 5486
630 Ga0395899_0014084 3300037312 Bacteria 6105
631 Ga0395899_0029833 3300037312 Bacteria 4103
632 Ga0395899_0053004 3300037312 Bacteria 3005
633 Ga0395899_0084478 3300037312 Bacteria 2307
634 Ga0395899_0122818 3300037312 Bacteria 1858
635 Ga0395899_0122840 3300037312 Bacteria 1858
636 Ga0395899_0353916 3300037312 Bacteria 981
637 Ga0395899_0361571 3300037312 Bacteria 968
638 Ga0395900_0000447 3300037418 Bacteria 59069
639 Ga0395900_0001678 3300037418 Bacteria 25788
640 Ga0395900_0020464 3300037418 Bacteria 6754
641 Ga0395900_0047856 3300037418 Bacteria 4405
642 Ga0395900_0052054 3300037418 Bacteria 4215
643 Ga0395900_0094481 3300037418 Bacteria 3071
644 Ga0395900_0535742 3300037418 Bacteria 1117
645 Ga0395898_0002889 3300037466 Bacteria 19582
646 Ga0395898_0005900 3300037466 Bacteria 13169
647 Ga0395898_0041927 3300037466 Bacteria 4518
648 Ga0395898_0067385 3300037466 Bacteria 3465
649 Ga0395898_0151677 3300037466 Bacteria 2217
650 Ga0395898_0194006 3300037466 Bacteria 1940
651 Ga0395905_0000083 3300037471 Bacteria 158407
652 Ga0395905_0000974 3300037471 Bacteria 36725
653 Ga0395905_0010192 3300037471 Bacteria 9158
654 Ga0395905_0012382 3300037471 Bacteria 8212
655 Ga0395905_0063031 3300037471 Bacteria 3468
656 Ga0395905_0080148 3300037471 Bacteria 3059
657 Ga0395905_0097824 3300037471 Bacteria 2756
658 Ga0395905_0137983 3300037471 Bacteria 2294
659 Ga0395905_0157672 3300037471 Bacteria 2134
660 Ga0395905_0193281 3300037471 Bacteria 1908
661 Ga0395905_0666724 3300037471 Bacteria 942
662 Ga0395905_0714208 3300037471 Bacteria 904
663 Ga0395901_0000324 3300038443 Bacteria 59134
664 Ga0395901_0067879 3300038443 Bacteria 3714
665 Ga0395901_0140118 3300038443 Bacteria 2542
666 Ga0395901_0222525 3300038443 Bacteria 1972
667 Ga0395901_0224958 3300038443 Bacteria 1960
668 Ga0395901_0226381 3300038443 Bacteria 1953
669 Ga0395901_0511376 3300038443 Bacteria 1221
670 Ga0395901_0527092 3300038443 Bacteria 1199
671 Ga0451789_1306199 3300041443 Bacteria 1836
672 Ga0451802_0592622 3300041460 Bacteria 2591
673 Ga0451806_179633 3300041462 Bacteria 2909
674 Ga0451807_0999254 3300041486 Bacteria 1703
675 Ga0451845_0827461 3300041501 Bacteria 1744
676 Ga0450915_003016 3300042119 Bacteria 923
677 Ga0466969_0126361 3300044656 Bacteria 1188
678 Ga0466972_0030411 3300044658 Bacteria 2658
679 Ga0466966_0017802 3300044684 Bacteria 4692
680 Ga0466966_0171973 3300044684 Bacteria 1316
681 Ga0466961_0139505 3300044693 Bacteria 1518
682 Ga0466961_0296147 3300044693 Bacteria 989
683 Ga0466963_0000971 3300044694 Bacteria 14730
684 Ga0466963_0097034 3300044694 Bacteria 2014
685 Ga0466963_0155306 3300044694 Bacteria 1590
686 Ga0466970_0018245 3300044765 Bacteria 3630
687 Ga0466970_0087116 3300044765 Bacteria 1693
688 Ga0466957_0002813 3300044842 Bacteria 9412
689 Ga0466957_0150665 3300044842 Bacteria 1504
690 Ga0466957_0244348 3300044842 Bacteria 1192
691 Ga0466960_0019503 3300044901 Bacteria 2990
692 Ga0466960_0023169 3300044901 Bacteria 2785
693 Ga0466959_0044866 3300045049 Bacteria 3256
694 Ga0466959_0085473 3300045049 Bacteria 2270
695 Ga0466958_0080216 3300045836 Bacteria 2007
696 Ga0466967_0000483 3300045976 Bacteria 19324
697 Ga0466967_0002578 3300045976 Bacteria 11378
698 Ga0466967_0005574 3300045976 Bacteria 8749
699 Ga0495585_0029093 3300046492 Bacteria 3147
700 Ga0495585_0038614 3300046492 Bacteria 2687
701 Ga0495616_0153841 3300046513 Bacteria 1039
702 Ga0495663_0000927 3300046525 Bacteria 9803
703 Ga0495663_0028065 3300046525 Bacteria 1654
704 Ga0495642_0095246 3300046528 Bacteria 1263
705 Ga0495598_0000240 3300046537 Bacteria 9785
706 Ga0495598_0005370 3300046537 Bacteria 2833
707 Ga0495621_0000207 3300046539 Bacteria 13689
708 Ga0495621_0000400 3300046539 Bacteria 10696
709 Ga0495621_0002332 3300046539 Bacteria 5096
710 Ga0495621_0009158 3300046539 Bacteria 2996
711 Ga0495633_0002388 3300046558 Bacteria 13292
712 Ga0495633_0018054 3300046558 Bacteria 3589
713 Ga0495633_0026257 3300046558 Bacteria 2859
714 Ga0495668_0018079 3300046616 Bacteria 4079
715 Ga0495669_0002246 3300046684 Bacteria 7922
716 Ga0495669_0017334 3300046684 Bacteria 3090
717 Ga0495669_0032740 3300046684 Bacteria 2286
718 Ga0495669_0182786 3300046684 Bacteria 1000
719 Ga0495670_0000467 3300046691 Bacteria 19301
720 Ga0495670_0002036 3300046691 Bacteria 9962
721 Ga0495670_0015797 3300046691 Bacteria 3710
722 Ga0495670_0020573 3300046691 Bacteria 3255
723 Ga0495670_0034842 3300046691 Bacteria 2508
724 Ga0495677_0003563 3300047445 Bacteria 6040
725 Ga0495677_0006363 3300047445 Bacteria 4460
726 Ga0495677_0036854 3300047445 Bacteria 1787
727 Ga0495677_0067594 3300047445 Bacteria 1330
728 Ga0495685_048306 3300047447 Bacteria 1446
729 Ga0495602_0028280 3300048088 Bacteria 5368
730 Ga0496100_0029394 3300048903 Bacteria 3399
731 Ga0496101_0034250 3300048904 Bacteria 3586
732 Ga0496101_0047985 3300048904 Bacteria 3067
733 Ga0496101_0308119 3300048904 Bacteria 1241
734 Ga0496103_0151746 3300048906 Bacteria 1484
735 Ga0496106_0022594 3300048909 Bacteria 4675
736 Ga0496106_0062109 3300048909 Bacteria 2836
737 Ga0496107_0001919 3300048910 Bacteria 13202
738 Ga0496107_0049549 3300048910 Bacteria 3027
739 Ga0496107_0078369 3300048910 Bacteria 2407
740 Ga0496107_0081005 3300048910 Bacteria 2368
741 Ga0496107_0412750 3300048910 Bacteria 1004
742 Ga0496108_0122049 3300048911 Bacteria 2235
743 Ga0496109_0092591 3300048912 Bacteria 2796
744 Ga0496109_0095826 3300048912 Bacteria 2748
745 Ga0496109_0132879 3300048912 Bacteria 2324
746 Ga0496109_0175113 3300048912 Bacteria 2013
747 Ga0496109_0304221 3300048912 Bacteria 1504
748 Ga0496110_0086930 3300048913 Bacteria 2792
749 Ga0496110_0174948 3300048913 Bacteria 1948
750 Ga0496110_0694812 3300048913 Bacteria 919
751 Ga0496111_0093956 3300048914 Bacteria 2199
752 Ga0496111_0315466 3300048914 Bacteria 1158
753 Ga0496112_0004292 3300048915 Bacteria 12040
754 Ga0496112_0005909 3300048915 Bacteria 10673
755 Ga0496113_0108019 3300048916 Bacteria 2163
756 Ga0496113_0161969 3300048916 Bacteria 1769
757 Ga0496114_0034345 3300048917 Bacteria 4183
758 Ga0496115_0619254 3300048918 Bacteria 859
759 Ga0496118_0001906 3300048921 Bacteria 29700
760 Ga0501034_0716550 3300049571 Bacteria 898
761 Ga0501074_0026641 3300049590 Bacteria 4192
762 Ga0501268_000127 3300049765 Bacteria 6541
763 nmdc:mga0yw44_87453_c1 3300050492 Bacteria 1964
764 nmdc:mga06r32_71948_c1 3300050510 Bacteria 3347
765 nmdc:mga08y16_768046_c1 3300050511 Bacteria 959
766 Ga0590074_047938 3300059423 Bacteria 778
767 Ga0466962_0150768 3300061719 Bacteria 1128
768 2885429526 2885427238 Bacteria 2291351
769 2896432075 2896429255 Bacteria 2557483
770 Ga0395899_0001291
771 JGI24740J21852_10072736
772 JGI24739J22299_10000129
773 JGI24737J22298_10000357
774 JGI24737J22298_10001378
775 JGI24737J22298_10022096
776 JGI24735J21928_10016801
777 JGI24738J21930_10002016
778 Ga0065704_10095184
779 Ga0065712_10271178
780 Ga0065715_10000654
781 Ga0065715_10038653
782 Ga0065715_10110590
783 Ga0065715_10113724
784 Ga0065715_10167364
785 Ga0070658_10000022
786 Ga0070658_10000179
787 Ga0070658_10006059
788 Ga0070658_10288801
789 Ga0070676_10000723
790 Ga0070676_10025630
791 Ga0070676_10167142
792 Ga0070676_10234515
793 Ga0070683_100000209
794 Ga0070683_100420740
795 Ga0070690_100079801
796 Ga0070690_100377064
797 Ga0070690_100445998
798 Ga0070670_100000195
799 Ga0070670_100005739
800 Ga0070670_100014349
801 Ga0070670_100015584
802 Ga0070670_100070464
803 Ga0070670_100264116
804 Ga0070670_100712409
805 Ga0070677_10005215
806 Ga0070677_10015668
807 Ga0070677_10069190
808 Ga0070677_10111800
809 Ga0070677_10154064
810 Ga0068869_100000331
811 Ga0068869_100049115
812 Ga0070666_10002196
813 Ga0070680_100000641
814 Ga0070680_100092032
815 Ga0070680_100109530
816 Ga0070680_100125735
817 Ga0070680_100150125
818 Ga0070680_100371107
819 Ga0070680_100754194
820 Ga0070682_100115747
821 Ga0068868_100000156
822 Ga0070660_100000496
823 Ga0070660_100041657
824 Ga0070660_100109094
825 Ga0070660_100167960
826 Ga0070660_100220234
827 Ga0070660_100289837
828 Ga0070660_100560953
829 Ga0070660_100690265
830 Ga0070689_100577752
831 Ga0070661_100000509
832 Ga0070661_100061931
833 Ga0070661_100107056
834 Ga0070661_100126498
835 Ga0070661_100154355
836 Ga0070692_10013775
837 Ga0070668_100043506
838 Ga0070668_100045452
839 Ga0070668_100345467
840 Ga0070669_100002902
841 Ga0070669_100012144
842 Ga0070669_100018290
843 Ga0070669_100087967
844 Ga0070669_100420267
845 Ga0070675_100002886
846 Ga0070675_100038524
847 Ga0070675_100043319
848 Ga0070671_100002678
849 Ga0070671_100003224
850 Ga0070671_100013820
851 Ga0070671_100014229
852 Ga0070671_100036618
853 Ga0070671_100376199
854 Ga0070674_100069835
855 Ga0070673_100000249
856 Ga0070673_100036961
857 Ga0070673_100070142
858 Ga0070673_100203296
859 Ga0070688_100064208
860 Ga0070659_100000138
861 Ga0070659_100000814
862 Ga0070659_100067310
863 Ga0070659_100121679
864 Ga0070659_100184236
865 Ga0070659_100241405
866 Ga0070659_100466631
867 Ga0070659_100490026
868 Ga0070667_100001760
869 Ga0070667_100005936
870 Ga0070667_100032537
871 Ga0070667_100035165
872 Ga0070667_100122785
873 Ga0070667_100342951
874 Ga0070709_10032385
875 Ga0070714_100024896
876 Ga0070714_100457137
877 Ga0070714_100967537
878 Ga0070663_100002205
879 Ga0070663_100115286
880 Ga0070663_100120386
881 Ga0070663_100144293
882 Ga0070663_100249992
883 Ga0070663_100463302
884 Ga0070678_100012520
885 Ga0070678_100068969
886 Ga0070678_100248262
887 Ga0070678_100337292
888 Ga0070662_100005377
889 Ga0070662_100016179
890 Ga0070662_100018029
891 Ga0070662_100023842
892 Ga0070681_10083437
893 Ga0070681_10368083
894 Ga0068867_100043358
895 Ga0070679_100026909
896 Ga0070679_100070909
897 Ga0070679_100097574
898 Ga0070679_100226931
899 Ga0070679_100495567
900 Ga0070679_100599328
901 Ga0070679_100625444
902 Ga0070684_100368687
903 Ga0068853_100001329
904 Ga0068853_100020437
905 Ga0068853_100028037
906 Ga0068853_100287457
907 Ga0068853_100312935
908 Ga0070672_100004112
909 Ga0070672_100088349
910 Ga0070672_100105706
911 Ga0070672_100114757
912 Ga0070672_100300970
913 Ga0070696_100569445
914 Ga0070693_100000703
915 Ga0070665_100005560
916 Ga0070665_100385056
917 Ga0068855_100000163
918 Ga0068855_100009899
919 Ga0068855_100095216
920 Ga0068855_100154958
921 Ga0068855_100180519
922 Ga0070664_100000544
923 Ga0070664_100001299
924 Ga0070664_100140408
925 Ga0070664_100189327
926 Ga0070664_100203776
927 Ga0070664_100210672
928 Ga0070664_100256615
929 Ga0070664_100263187
930 Ga0070664_100296252
931 Ga0070664_100355821
932 Ga0068857_100001148
933 Ga0068857_100123514
934 Ga0068854_100001188
935 Ga0068854_100003932
936 Ga0068856_100001006
937 Ga0068856_100014136
938 Ga0068856_100231412
939 Ga0068856_100268667
940 Ga0068852_100000502
941 Ga0068852_100007393
942 Ga0068852_100012780
943 Ga0068852_100200478
944 Ga0068852_100235440
945 Ga0068852_100245413
946 Ga0068852_100347452
947 Ga0068852_100380886
948 Ga0068852_100514189
949 Ga0068852_100535068
950 Ga0068859_100000778
951 Ga0068859_100005561
952 Ga0068859_100078684
953 Ga0068859_100538900
954 Ga0068864_100000189
955 Ga0068864_100000795
956 Ga0068864_100005333
957 Ga0068864_100018948
958 Ga0068864_100038052
959 Ga0068864_100128789
960 Ga0068851_10076344
961 Ga0068851_10309495
962 Ga0068863_100000073
963 Ga0068863_100003770
964 Ga0068863_100154555
965 Ga0068863_100183485
966 Ga0068863_100948417
967 Ga0068858_100032992
968 Ga0068858_100041345
969 Ga0068860_100001686
970 Ga0068860_100016439
971 Ga0068860_100135061
972 Ga0068860_100382779
973 Ga0068862_100000233
974 Ga0068862_100003296
975 Ga0068862_100007156
976 Ga0068862_100035214
977 Ga0068862_100160365
978 Ga0068862_100610282
979 Ga0081539_10004604
980 Ga0070717_10080827
981 Ga0075365_10119746
982 Ga0075432_10042944
983 Ga0070712_100062532
984 Ga0075362_10170905
985 Ga0097621_100077538
986 Ga0097621_100181384
987 Ga0097621_100216581
988 Ga0068871_100093675
989 Ga0068871_100147271
990 Ga0075428_100600416
991 Ga0075431_100081205
992 Ga0068865_100003247
993 Ga0068865_100005327
994 Ga0068865_100365538
995 Ga0097620_100000778
996 Ga0097620_100005561
997 Ga0097620_100078681
998 Ga0097620_100538944
999 Ga0105251_10000468
1000 Ga0105240_10020228
1001 Ga0105240_10022230
1002 Ga0111539_10958268
1003 Ga0105245_10000326
1004 Ga0105247_10030300
1005 Ga0105243_10015618
1006 Ga0105243_10154793
1007 Ga0105243_10583871
1008 Ga0105241_10711866
1009 Ga0105242_10634395
1010 Ga0105248_10000026
1011 Ga0105248_10000159
1012 Ga0105248_10005569
1013 Ga0105248_10021410
1014 Ga0105248_10056551
1015 Ga0105248_10097680
1016 Ga0105248_10121446
1017 Ga0105248_10169985
1018 Ga0105248_10183470
1019 Ga0105248_10292289
1020 Ga0105248_10398726
1021 Ga0105248_11090466
1022 Ga0105237_10653645
1023 Ga0105238_10100625
1024 Ga0105249_10000110
1025 Ga0105239_10139049
1026 Ga0105246_10007596
1027 Ga0157373_10025715
1028 Ga0157373_10061445
1029 Ga0157373_10072724
1030 Ga0157373_10414906
1031 Ga0157371_10008488
1032 Ga0157371_10018899
1033 Ga0157371_10020658
1034 Ga0157371_10024982
1035 Ga0157371_10205219
1036 Ga0157371_10484896
1037 Ga0157370_10262569
1038 Ga0157370_10527734
1039 Ga0157369_10002388
1040 Ga0157369_10018284
1041 Ga0157369_10186161
1042 Ga0157369_10190313
1043 Ga0157369_10558099
1044 Ga0157374_10005525
1045 Ga0163162_10032032
1046 Ga0163162_10121764
1047 Ga0163162_10122547
1048 Ga0163162_10172626
1049 Ga0163162_10194791
1050 Ga0163162_10394966
1051 Ga0157372_10333910
1052 Ga0157375_10025088
1053 Ga0157375_10061470
1054 Ga0157375_10079188
1055 Ga0157375_10240097
1056 Ga0157375_10353156
1057 Ga0157375_10452078
1058 Ga0157375_11505442
1059 Ga0163163_10000338
1060 Ga0163163_10442360
1061 Ga0157380_10002361
1062 Ga0157380_10067433
1063 Ga0157380_10175265
1064 Ga0157380_10684365
1065 Ga0182008_10103489
1066 Ga0157377_10435996
1067 Ga0157379_10334019
1068 Ga0163161_10040969
1069 Ga0163161_10096129
1070 Ga0163161_10246096
1071 Ga0163161_10385947
1072 Ga0207697_10000584
1073 Ga0207697_10000628
1074 Ga0207656_10011277
1075 Ga0207656_10188278
1076 Ga0207713_1010672
1077 Ga0207682_10026117
1078 Ga0207682_10028649
1079 Ga0207682_10095725
1080 Ga0207710_10014805
1081 Ga0207688_10004411
1082 Ga0207688_10020823
1083 Ga0207647_10002145
1084 Ga0207647_10007691
1085 Ga0207647_10017285
1086 Ga0207699_10140441
1087 Ga0207645_10001233
1088 Ga0207645_10011120
1089 Ga0207645_10028384
1090 Ga0207645_10204031
1091 Ga0207705_10000236
1092 Ga0207705_10000260
1093 Ga0207705_10037429
1094 Ga0207705_10076647
1095 Ga0207705_10102877
1096 Ga0207705_10288477
1097 Ga0207705_10297584
1098 Ga0207707_10241273
1099 Ga0207707_10320023
1100 Ga0207695_10001533
1101 Ga0207693_10048619
1102 Ga0207660_10001336
1103 Ga0207660_10045934
1104 Ga0207660_10275551
1105 Ga0207660_10351623
1106 Ga0207660_10468539
1107 Ga0207657_10000031
1108 Ga0207657_10000267
1109 Ga0207657_10014578
1110 Ga0207657_10067189
1111 Ga0207657_10158296
1112 Ga0207657_10166587
1113 Ga0207657_10359317
1114 Ga0207657_10486841
1115 Ga0207649_10000394
1116 Ga0207649_10038576
1117 Ga0207649_10111419
1118 Ga0207649_10159742
1119 Ga0207649_10307350
1120 Ga0207649_10538302
1121 Ga0207652_10077209
1122 Ga0207652_10093149
1123 Ga0207652_10328709
1124 Ga0207681_10001333
1125 Ga0207681_10009822
1126 Ga0207681_10016807
1127 Ga0207681_10077265
1128 Ga0207681_10185415
1129 Ga0207681_10368494
1130 Ga0207694_10478125
1131 Ga0207650_10000243
1132 Ga0207650_10002008
1133 Ga0207650_10003293
1134 Ga0207650_10045653
1135 Ga0207650_10053984
1136 Ga0207650_10093245
1137 Ga0207650_10164624
1138 Ga0207650_10616782
1139 Ga0207659_10031776
1140 Ga0207659_10050207
1141 Ga0207687_10007615
1142 Ga0207664_10086877
1143 Ga0207664_10384771
1144 Ga0207644_10005857
1145 Ga0207644_10007309
1146 Ga0207644_10014636
1147 Ga0207644_10043926
1148 Ga0207644_10123565
1149 Ga0207644_10143571
1150 Ga0207644_10221253
1151 Ga0207644_10292295
1152 Ga0207690_10000382
1153 Ga0207690_10072496
1154 Ga0207690_10125227
1155 Ga0207690_10195835
1156 Ga0207690_10805949
1157 Ga0207706_10000028
1158 Ga0207706_10000171
1159 Ga0207706_10000475
1160 Ga0207706_10003718
1161 Ga0207706_10013507
1162 Ga0207706_10020276
1163 Ga0207706_10051877
1164 Ga0207706_10060526
1165 Ga0207709_10037183
1166 Ga0207709_10125494
1167 Ga0207670_10495253
1168 Ga0207669_10001298
1169 Ga0207704_10001327
1170 Ga0207704_10017092
1171 Ga0207704_10256992
1172 Ga0207691_10001864
1173 Ga0207691_10004641
1174 Ga0207691_10038192
1175 Ga0207691_10146746
1176 Ga0207691_10216417
1177 Ga0207691_10371485
1178 Ga0207711_10000004
1179 Ga0207711_10000500
1180 Ga0207711_10001375
1181 Ga0207711_10060833
1182 Ga0207711_10118333
1183 Ga0207711_10264497
1184 Ga0207711_10280186
1185 Ga0207711_10304260
1186 Ga0207711_10369257
1187 Ga0207689_10000092
1188 Ga0207661_10009852
1189 Ga0207679_10000129
1190 Ga0207679_10010347
1191 Ga0207679_10013915
1192 Ga0207679_10060080
1193 Ga0207679_10306569
1194 Ga0207679_10344177
1195 Ga0207667_10000357
1196 Ga0207667_10041374
1197 Ga0207667_10103109
1198 Ga0207651_10000176
1199 Ga0207651_10004216
1200 Ga0207651_10014349
1201 Ga0207651_10106085
1202 Ga0207712_10000701
1203 Ga0207668_10003189
1204 Ga0207668_10053589
1205 Ga0207668_10098748
1206 Ga0207668_10141816
1207 Ga0207640_10000469
1208 Ga0207640_10000922
1209 Ga0207658_10000430
1210 Ga0207658_10030575
1211 Ga0207658_10057868
1212 Ga0207658_10086952
1213 Ga0207677_10001085
1214 Ga0207703_10023487
1215 Ga0207703_10039713
1216 Ga0207639_10000131
1217 Ga0207639_10003016
1218 Ga0207639_10071391
1219 Ga0207639_10097373
1220 Ga0207639_10147064
1221 Ga0207639_10364729
1222 Ga0207678_10000740
1223 Ga0207678_10013949
1224 Ga0207678_10023639
1225 Ga0207678_10025287
1226 Ga0207678_10093264
1227 Ga0207678_10182782
1228 Ga0207678_10208646
1229 Ga0207678_10359505
1230 Ga0207678_10459675
1231 Ga0207678_10598406
1232 Ga0207702_10000247
1233 Ga0207702_10011305
1234 Ga0207702_10365351
1235 Ga0207641_10000018
1236 Ga0207641_10062093
1237 Ga0207641_10192378
1238 Ga0207648_10008297
1239 Ga0207648_10017502
1240 Ga0207648_10317412
1241 Ga0207648_10448045
1242 Ga0207676_10000027
1243 Ga0207676_10001355
1244 Ga0207676_10008398
1245 Ga0207676_10017890
1246 Ga0207676_10024995
1247 Ga0207676_10132176
1248 Ga0207674_10005285
1249 Ga0207674_10221847
1250 Ga0207675_100022986
1251 Ga0207675_100220995
1252 Ga0207675_100386869
1253 Ga0207683_10017765
1254 Ga0207683_10062438
1255 Ga0207683_10267681
1256 Ga0207698_10000125
1257 Ga0207698_10007108
1258 Ga0207698_10014500
1259 Ga0207698_10039698
1260 Ga0207698_10125484
1261 Ga0207698_10434081
1262 Ga0207698_10529773
1263 Ga0207698_10757397
1264 Ga0209974_10014271
1265 Ga0268266_10010715
1266 Ga0268266_10526800
1267 Ga0268265_10000097
1268 Ga0268265_10002770
1269 Ga0268265_10023472
1270 Ga0268265_10125935
1271 Ga0268265_10303834
1272 Ga0268264_10003351
1273 Ga0316177_1146319
1274 Ga0316182_1055757
1275 Ga0307408_100002967
1276 Ga0307408_100027563
1277 Ga0307408_100051681
1278 Ga0307408_100124140
1279 Ga0307408_100193414
1280 Ga0307408_100328401
1281 Ga0307405_10011333
1282 Ga0307405_10034957
1283 Ga0307405_10103721
1284 Ga0307405_10107126
1285 Ga0307405_10168043
1286 Ga0307405_10427849
1287 Ga0307405_10656551
1288 Ga0307413_10000144
1289 Ga0307413_10000322
1290 Ga0307413_10038126
1291 Ga0307413_10049572
1292 Ga0307413_10069246
1293 Ga0307413_10147943
1294 Ga0307413_10200647
1295 Ga0307413_10270399
1296 Ga0307413_10314546
1297 Ga0307413_10366970
1298 Ga0307413_10647649
1299 Ga0307413_10669457
1300 Ga0307410_10000229
1301 Ga0307410_10001946
1302 Ga0307410_10003819
1303 Ga0307410_10007280
1304 Ga0307410_10025235
1305 Ga0307410_10049821
1306 Ga0307410_10051727
1307 Ga0307410_10103820
1308 Ga0307410_10113526
1309 Ga0307410_10241203
1310 Ga0307410_10307970
1311 Ga0307410_10328517
1312 Ga0307410_10335763
1313 Ga0307410_10411814
1314 Ga0307410_10487566
1315 Ga0307406_10006278
1316 Ga0307406_10017897
1317 Ga0307406_10028782
1318 Ga0307406_10451957
1319 Ga0307407_10003042
1320 Ga0307407_10005040
1321 Ga0307407_10017401
1322 Ga0307407_10037315
1323 Ga0307407_10048031
1324 Ga0307407_10060068
1325 Ga0307407_10071329
1326 Ga0307407_10437942
1327 Ga0307412_10002810
1328 Ga0307412_10039483
1329 Ga0307412_10070270
1330 Ga0307412_10195800
1331 Ga0307412_10306095
1332 Ga0307412_10324305
1333 Ga0307409_100000049
1334 Ga0307409_100002843
1335 Ga0307409_100020516
1336 Ga0307409_100042012
1337 Ga0307409_100045673
1338 Ga0307409_100054166
1339 Ga0307409_100092205
1340 Ga0307409_100165218
1341 Ga0307409_100287651
1342 Ga0307409_100366089
1343 Ga0307409_100411632
1344 Ga0307409_100441501
1345 Ga0307409_100739747
1346 Ga0307409_100818652
1347 Ga0307409_101349643
1348 Ga0307416_100001051
1349 Ga0307416_100002148
1350 Ga0307416_100023586
1351 Ga0307416_100035986
1352 Ga0307416_100103810
1353 Ga0307416_100136989
1354 Ga0307416_100265661
1355 Ga0307416_100384869
1356 Ga0307416_101054592
1357 Ga0307414_10000735
1358 Ga0307414_10003070
1359 Ga0307414_10008521
1360 Ga0307414_10009029
1361 Ga0307414_10017974
1362 Ga0307414_10029247
1363 Ga0307414_10063912
1364 Ga0307414_10073834
1365 Ga0307414_10076476
1366 Ga0307414_10077406
1367 Ga0307414_10083813
1368 Ga0307414_10088856
1369 Ga0307414_10090974
1370 Ga0307414_10121282
1371 Ga0307414_10151992
1372 Ga0307414_10638983
1373 Ga0307414_10941233
1374 Ga0307411_10002932
1375 Ga0307411_10003016
1376 Ga0307411_10008224
1377 Ga0307411_10013708
1378 Ga0307411_10018122
1379 Ga0307411_10018565
1380 Ga0307411_10032137
1381 Ga0307411_10073664
1382 Ga0307411_10077197
1383 Ga0307411_10098361
1384 Ga0307411_10586634
1385 Ga0307411_10687050
1386 Ga0307415_100000886
1387 Ga0307415_100002565
1388 Ga0307415_100028704
1389 Ga0307415_100050658
1390 Ga0307415_100079181
1391 Ga0307415_100163609
1392 Ga0307415_100167011
1393 Ga0373960_0062525
1394 Ga0373943_0003195
1395 Ga0373955_0447270
1396 Ga0373931_0005757
1397 Ga0373937_0004086
1398 Ga0373925_0015663
1399 Ga0395899_0014084
1400 Ga0395899_0029833
1401 Ga0395899_0053004
1402 Ga0395899_0084478
1403 Ga0395899_0122818
1404 Ga0395899_0122840
1405 Ga0395899_0353916
1406 Ga0395899_0361571
1407 Ga0395900_0000447
1408 Ga0395900_0001678
1409 Ga0395900_0020464
1410 Ga0395900_0047856
1411 Ga0395900_0052054
1412 Ga0395900_0094481
1413 Ga0395900_0535742
1414 Ga0395898_0002889
1415 Ga0395898_0005900
1416 Ga0395898_0041927
1417 Ga0395898_0067385
1418 Ga0395898_0151677
1419 Ga0395898_0194006
1420 Ga0395905_0000083
1421 Ga0395905_0000974
1422 Ga0395905_0010192
1423 Ga0395905_0012382
1424 Ga0395905_0063031
1425 Ga0395905_0080148
1426 Ga0395905_0097824
1427 Ga0395905_0137983
1428 Ga0395905_0157672
1429 Ga0395905_0193281
1430 Ga0395905_0666724
1431 Ga0395905_0714208
1432 Ga0395901_0000324
1433 Ga0395901_0067879
1434 Ga0395901_0140118
1435 Ga0395901_0222525
1436 Ga0395901_0224958
1437 Ga0395901_0226381
1438 Ga0395901_0511376
1439 Ga0395901_0527092
1440 Ga0451789_1306199
1441 Ga0451802_0592622
1442 Ga0451806_179633
1443 Ga0451807_0999254
1444 Ga0451845_0827461
1445 Ga0450915_003016
1446 Ga0466969_0126361
1447 Ga0466972_0030411
1448 Ga0466966_0017802
1449 Ga0466966_0171973
1450 Ga0466961_0139505
1451 Ga0466961_0296147
1452 Ga0466963_0000971
1453 Ga0466963_0097034
1454 Ga0466963_0155306
1455 Ga0466970_0018245
1456 Ga0466970_0087116
1457 Ga0466957_0002813
1458 Ga0466957_0150665
1459 Ga0466957_0244348
1460 Ga0466960_0019503
1461 Ga0466960_0023169
1462 Ga0466959_0044866
1463 Ga0466959_0085473
1464 Ga0466958_0080216
1465 Ga0466967_0000483
1466 Ga0466967_0002578
1467 Ga0466967_0005574
1468 Ga0495585_0029093
1469 Ga0495585_0038614
1470 Ga0495616_0153841
1471 Ga0495663_0000927
1472 Ga0495663_0028065
1473 Ga0495642_0095246
1474 Ga0495598_0000240
1475 Ga0495598_0005370
1476 Ga0495621_0000207
1477 Ga0495621_0000400
1478 Ga0495621_0002332
1479 Ga0495621_0009158
1480 Ga0495633_0002388
1481 Ga0495633_0018054
1482 Ga0495633_0026257
1483 Ga0495668_0018079
1484 Ga0495669_0002246
1485 Ga0495669_0017334
1486 Ga0495669_0032740
1487 Ga0495669_0182786
1488 Ga0495670_0000467
1489 Ga0495670_0002036
1490 Ga0495670_0015797
1491 Ga0495670_0020573
1492 Ga0495670_0034842
1493 Ga0495677_0003563
1494 Ga0495677_0006363
1495 Ga0495677_0036854
1496 Ga0495677_0067594
1497 Ga0495685_048306
1498 Ga0495602_0028280
1499 Ga0496100_0029394
1500 Ga0496101_0034250
1501 Ga0496101_0047985
1502 Ga0496101_0308119
1503 Ga0496103_0151746
1504 Ga0496106_0022594
1505 Ga0496106_0062109
1506 Ga0496107_0001919
1507 Ga0496107_0049549
1508 Ga0496107_0078369
1509 Ga0496107_0081005
1510 Ga0496107_0412750
1511 Ga0496108_0122049
1512 Ga0496109_0092591
1513 Ga0496109_0095826
1514 Ga0496109_0132879
1515 Ga0496109_0175113
1516 Ga0496109_0304221
1517 Ga0496110_0086930
1518 Ga0496110_0174948
1519 Ga0496110_0694812
1520 Ga0496111_0093956
1521 Ga0496111_0315466
1522 Ga0496112_0004292
1523 Ga0496112_0005909
1524 Ga0496113_0108019
1525 Ga0496113_0161969
1526 Ga0496114_0034345
1527 Ga0496115_0619254
1528 Ga0496118_0001906
1529 Ga0501034_0716550
1530 Ga0501074_0026641
1531 Ga0501268_000127
1532 nmdc:mga0yw44_87453_c1
1533 nmdc:mga06r32_71948_c1
1534 nmdc:mga08y16_768046_c1
1535 Ga0590074_047938
1536 Ga0466962_0150768
1537 2885429526
1538 2896432075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6geu-assembly1.cif.gz_A crystal structure of the c230a mutant of human iba57 0.8008 4 227
7z3h-assembly5.cif.gz_E crystal structure of iba57 from chaetomium thermophilum 0.7828 7 232
6qe4-assembly1.cif.gz_A re-refinement of 5oli human iba57-i3c 0.7817 4 227
7z3h-assembly3.cif.gz_C crystal structure of iba57 from chaetomium thermophilum 0.7808 7 232
7z3h-assembly1.cif.gz_A crystal structure of iba57 from chaetomium thermophilum 0.7764 4 232
ID Description Score Start End Superfamily
af_G5EE11_2_112_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.909 1 106 3.30.70.1400
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8965 12 93 3.30.70.1400
1v5vB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8936 13 91 3.30.70.1400
4paaA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8909 12 92 3.30.70.1400
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8904 11 91 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A2N8FKX5-F1-model_v4 deleted 0.9751 8 93
AF-A0A259JWF2-F1-model_v4 Folate-binding protein YgfZ 0.9708 3 163 GO:0016226
AF-A0A533IHT3-F1-model_v4 deleted 0.9685 3 148
AF-A0A382UUQ0-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.963 7 92 GO:0016226
AF-A0A259HZG2-F1-model_v4 Folate-binding protein YgfZ 0.9627 6 124 GO:0016226

Map