F479961

General Info

Members Datasets Scaffolds Average Seq Length
768 356 1536 124

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0003803|Ga0495638_0003803_4623_5000
Length 119
Sequence MSLSRIVMRLARNPGTEFAGGDDHRGYALTAPLTADGHLDEAAYAKAKASCSVRRFAPDEDAVDGKLARKGARWFFDYDDEPVHRLGEHRFALGEYVTVTDEDGRPLTYKVMEVVQVAA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
304 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
305 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
308 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
309 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
310 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
311 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
323 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
337 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
338 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
339 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
340 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
341 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
342 2643221583 Caulobacter sp. Root655 Isolate Unclassified
343 2643221584 Caulobacter sp. Root656 Isolate Unclassified
344 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
345 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
346 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
347 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
348 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
349 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
350 2818991435 Caulobacter henricii 536 Isolate Unclassified
351 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
352 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
353 2849560528 Caulobacter zeae 410 Isolate Unclassified
354 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
355 2851153111 Caulobacter radicis 736 Isolate Unclassified
356 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.26
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.49
Nodule 0.26
Rhizoplane 4.04
Rhizosphere 73.96
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0003803 3300046460 Bacteria 11723
2 JGI25153J46596_10042631 3300003215 Bacteria 1383
3 rootL2_10016434 3300003322 Bacteria 1751
4 rootL2_10228638 3300003322 Bacteria 1585
5 Ga0055526_1039481 3300003771 Bacteria 1202
6 Ga0055537_1000562 3300003773 Bacteria 20988
7 Ga0055524_1007120 3300003775 Bacteria 4790
8 Ga0055528_1086361 3300003790 Bacteria 543
9 Ga0055530_10002586 3300003791 Bacteria 11478
10 Ga0055531_10005697 3300003794 Bacteria 7228
11 Ga0055531_10017988 3300003794 Bacteria 2947
12 Ga0055531_10024083 3300003794 Bacteria 2258
13 Ga0055543_1031655 3300004625 Bacteria 922
14 Ga0065165_1000307 3300005262 Bacteria 80513
15 Ga0065165_1002473 3300005262 Bacteria 15542
16 Ga0070658_10098394 3300005327 Bacteria 2416
17 Ga0070658_10310792 3300005327 Bacteria 1345
18 Ga0070683_100816795 3300005329 Bacteria 894
19 Ga0070683_101085257 3300005329 Bacteria 769
20 Ga0070690_100715853 3300005330 Bacteria 770
21 Ga0070670_100000128 3300005331 Bacteria 71585
22 Ga0070670_100062321 3300005331 Bacteria 3202
23 Ga0070670_100092753 3300005331 Bacteria 2597
24 Ga0070670_100112931 3300005331 Bacteria 2342
25 Ga0070670_100406173 3300005331 Bacteria 1203
26 Ga0070666_10060179 3300005335 Bacteria 2570
27 Ga0070666_10066785 3300005335 Bacteria 2441
28 Ga0070666_11214892 3300005335 Bacteria 562
29 Ga0070680_100064204 3300005336 Bacteria 3009
30 Ga0070680_100259869 3300005336 Bacteria 1469
31 Ga0070680_100547686 3300005336 Bacteria 991
32 Ga0070682_100081869 3300005337 Bacteria 2091
33 Ga0070682_101197347 3300005337 Bacteria 641
34 Ga0068868_100212289 3300005338 Bacteria 1618
35 Ga0070660_101326635 3300005339 Bacteria 611
36 Ga0070689_101518801 3300005340 Bacteria 607
37 Ga0070691_10044451 3300005341 Bacteria 2106
38 Ga0070661_100973990 3300005344 Bacteria 703
39 Ga0070668_100000195 3300005347 Bacteria 39719
40 Ga0070668_100003161 3300005347 Bacteria 12135
41 Ga0070668_100004647 3300005347 Bacteria 10172
42 Ga0070668_100036004 3300005347 Bacteria 3777
43 Ga0070668_100102873 3300005347 Bacteria 2265
44 Ga0070669_100001021 3300005353 Bacteria 20402
45 Ga0070669_101357827 3300005353 Bacteria 616
46 Ga0070671_100000895 3300005355 Bacteria 21726
47 Ga0070671_100031377 3300005355 Bacteria 4389
48 Ga0070671_100253576 3300005355 Bacteria 1495
49 Ga0070671_100657676 3300005355 Bacteria 907
50 Ga0070673_101614276 3300005364 Bacteria 613
51 Ga0070688_100432844 3300005365 Bacteria 980
52 Ga0070659_100534103 3300005366 Bacteria 1003
53 Ga0070659_100731711 3300005366 Bacteria 857
54 Ga0070667_100000169 3300005367 Bacteria 81539
55 Ga0070667_100005053 3300005367 Bacteria 11038
56 Ga0070667_100013278 3300005367 Bacteria 6804
57 Ga0070667_100047472 3300005367 Bacteria 3613
58 Ga0070667_102231723 3300005367 Bacteria 516
59 Ga0070678_100281299 3300005456 Bacteria 1407
60 Ga0070662_100236987 3300005457 Bacteria 1462
61 Ga0070662_100239480 3300005457 Bacteria 1455
62 Ga0070681_10076249 3300005458 Bacteria 3312
63 Ga0070681_10102405 3300005458 Bacteria 2808
64 Ga0070681_10858063 3300005458 Bacteria 826
65 Ga0068867_100302549 3300005459 Bacteria 1319
66 Ga0070685_11508223 3300005466 Bacteria 518
67 Ga0070698_100379032 3300005471 Bacteria 1347
68 Ga0070679_100027525 3300005530 Bacteria 5597
69 Ga0070679_100559566 3300005530 Bacteria 1087
70 Ga0068853_100019157 3300005539 Bacteria 5672
71 Ga0068853_100113633 3300005539 Bacteria 2408
72 Ga0068853_100386290 3300005539 Unclassified 1308
73 Ga0068853_100535990 3300005539 Bacteria 1108
74 Ga0068853_100931822 3300005539 Bacteria 835
75 Ga0068853_102479138 3300005539 Bacteria 502
76 Ga0070686_100939036 3300005544 Bacteria 706
77 Ga0070665_100001054 3300005548 Bacteria 34499
78 Ga0070665_100001083 3300005548 Bacteria 33888
79 Ga0070665_100044661 3300005548 Bacteria 4450
80 Ga0070665_100256442 3300005548 Bacteria 1750
81 Ga0070665_102516549 3300005548 Bacteria 516
82 Ga0068855_100010008 3300005563 Bacteria 11426
83 Ga0068855_100044699 3300005563 Bacteria 5241
84 Ga0068855_100133055 3300005563 Bacteria 2839
85 Ga0068855_100146973 3300005563 Bacteria 2682
86 Ga0068855_101551458 3300005563 Bacteria 679
87 Ga0068855_102088162 3300005563 Bacteria 571
88 Ga0070664_101397306 3300005564 Bacteria 662
89 Ga0068857_100653216 3300005577 Bacteria 997
90 Ga0068854_100083216 3300005578 Bacteria 2366
91 Ga0068854_100264202 3300005578 Bacteria 1379
92 Ga0068856_100236821 3300005614 Bacteria 1841
93 Ga0068856_100613248 3300005614 Bacteria 1109
94 Ga0068859_100000407 3300005617 Bacteria 42783
95 Ga0068859_100243535 3300005617 Bacteria 1888
96 Ga0068859_100282802 3300005617 Bacteria 1752
97 Ga0068859_101193542 3300005617 Bacteria 838
98 Ga0068859_103134958 3300005617 Bacteria 504
99 Ga0068864_100000561 3300005618 Bacteria 31782
100 Ga0068864_100012687 3300005618 Bacteria 6966
101 Ga0068864_100045946 3300005618 Bacteria 3746
102 Ga0068864_100155113 3300005618 Bacteria 2078
103 Ga0068864_100846805 3300005618 Bacteria 901
104 Ga0068864_101603112 3300005618 Bacteria 655
105 Ga0068864_102713859 3300005618 Bacteria 501
106 Ga0068866_10801407 3300005718 Bacteria 655
107 Ga0068861_100065578 3300005719 Bacteria 2797
108 Ga0068863_100000101 3300005841 Bacteria 92384
109 Ga0068863_100002206 3300005841 Bacteria 19342
110 Ga0068863_100005153 3300005841 Bacteria 12895
111 Ga0068863_100040434 3300005841 Bacteria 4434
112 Ga0068863_100182680 3300005841 Bacteria 2013
113 Ga0068863_100760766 3300005841 Bacteria 965
114 Ga0068858_100001173 3300005842 Bacteria 27188
115 Ga0068858_100003917 3300005842 Bacteria 14706
116 Ga0068858_100169945 3300005842 Bacteria 2055
117 Ga0068858_100240703 3300005842 Bacteria 1717
118 Ga0068860_100000055 3300005843 Bacteria 203538
119 Ga0068860_100000211 3300005843 Bacteria 91286
120 Ga0068860_100019283 3300005843 Bacteria 6620
121 Ga0068860_100450733 3300005843 Bacteria 1279
122 Ga0068862_100002104 3300005844 Bacteria 17946
123 Ga0068862_100004288 3300005844 Bacteria 12062
124 Ga0068862_100007104 3300005844 Bacteria 9300
125 Ga0068862_100259448 3300005844 Bacteria 1586
126 Ga0068862_100515922 3300005844 Bacteria 1137
127 Ga0070717_10078474 3300006028 Bacteria 2767
128 Ga0070717_10188631 3300006028 Bacteria 1800
129 Ga0075365_10124544 3300006038 Bacteria 1780
130 Ga0075368_10000328 3300006042 Bacteria 13906
131 Ga0075363_100035685 3300006048 Bacteria 2604
132 Ga0075363_100353326 3300006048 Bacteria 859
133 Ga0075364_10001220 3300006051 Bacteria 13831
134 Ga0075362_10042252 3300006177 Bacteria 2014
135 Ga0075367_10000091 3300006178 Bacteria 24634
136 Ga0075366_10160941 3300006195 Unclassified 1360
137 Ga0075366_10349840 3300006195 Bacteria 907
138 Ga0097621_100245349 3300006237 Bacteria 1567
139 Ga0075370_10214311 3300006353 Unclassified 1137
140 Ga0075370_10255984 3300006353 Bacteria 1038
141 Ga0075370_10495532 3300006353 Bacteria 737
142 Ga0068871_100249645 3300006358 Bacteria 1545
143 Ga0068871_100822349 3300006358 Bacteria 857
144 Ga0068871_101365651 3300006358 Bacteria 667
145 Ga0068865_100000477 3300006881 Bacteria 22364
146 Ga0097620_100000407 3300006931 Bacteria 42783
147 Ga0097620_100243532 3300006931 Bacteria 1888
148 Ga0097620_100282797 3300006931 Bacteria 1752
149 Ga0097620_101193971 3300006931 Bacteria 838
150 Ga0097620_101674984 3300006931 Bacteria 702
151 Ga0097620_103134921 3300006931 Bacteria 504
152 Ga0079104_1007780 3300006946 Bacteria 3829
153 Ga0105250_10014820 3300009092 Bacteria 3197
154 Ga0105240_10035366 3300009093 Bacteria 6439
155 Ga0105240_10037452 3300009093 Bacteria 6234
156 Ga0105240_10282148 3300009093 Bacteria 1907
157 Ga0105240_11752273 3300009093 Bacteria 648
158 Ga0105240_12329155 3300009093 Bacteria 555
159 Ga0105245_10536640 3300009098 Bacteria 1190
160 Ga0105245_10944948 3300009098 Bacteria 905
161 Ga0105243_11382139 3300009148 Bacteria 724
162 Ga0105241_10252825 3300009174 Bacteria 1495
163 Ga0105241_10903920 3300009174 Bacteria 820
164 Ga0105242_10150763 3300009176 Bacteria 2027
165 Ga0105248_10000349 3300009177 Bacteria 54104
166 Ga0105248_10004855 3300009177 Bacteria 14887
167 Ga0105248_10008404 3300009177 Bacteria 11328
168 Ga0105248_10011646 3300009177 Bacteria 9689
169 Ga0105248_10027940 3300009177 Bacteria 6282
170 Ga0105248_10637909 3300009177 Bacteria 1202
171 Ga0105248_11186238 3300009177 Bacteria 863
172 Ga0105248_11328574 3300009177 Bacteria 813
173 Ga0105248_11725617 3300009177 Bacteria 710
174 Ga0105248_12927503 3300009177 Bacteria 544
175 Ga0105248_13246027 3300009177 Bacteria 517
176 Ga0105248_13246035 3300009177 Unclassified 517
177 Ga0105237_10145343 3300009545 Bacteria 2366
178 Ga0105237_10500920 3300009545 Bacteria 1221
179 Ga0105237_11471352 3300009545 Bacteria 688
180 Ga0105238_10050097 3300009551 Bacteria 4205
181 Ga0105238_10101189 3300009551 Bacteria 2864
182 Ga0105238_10242319 3300009551 Bacteria 1781
183 Ga0105238_10945484 3300009551 Bacteria 881
184 Ga0105238_11203370 3300009551 Bacteria 782
185 Ga0105249_10001588 3300009553 Bacteria 19927
186 Ga0105249_10027976 3300009553 Bacteria 5089
187 Ga0105249_10231313 3300009553 Bacteria 1823
188 Ga0105249_10290865 3300009553 Bacteria 1635
189 Ga0105249_10391632 3300009553 Bacteria 1418
190 Ga0105249_10987913 3300009553 Bacteria 910
191 Ga0105148_110709 3300009978 Bacteria 700
192 Ga0105239_10476032 3300010375 Bacteria 1418
193 Ga0105239_10695002 3300010375 Bacteria 1163
194 Ga0105239_10858146 3300010375 Bacteria 1041
195 Ga0105239_11348287 3300010375 Bacteria 823
196 Ga0105239_12198955 3300010375 Bacteria 641
197 Ga0157327_1057865 3300012512 Bacteria 570
198 Ga0157373_10004968 3300013100 Bacteria 9993
199 Ga0157373_10042339 3300013100 Bacteria 3255
200 Ga0157373_10546342 3300013100 Bacteria 840
201 Ga0157370_10077369 3300013104 Bacteria 3134
202 Ga0157370_10202801 3300013104 Bacteria 1840
203 Ga0157369_10216591 3300013105 Bacteria 2005
204 Ga0157369_11225965 3300013105 Bacteria 765
205 Ga0157374_11465330 3300013296 Bacteria 706
206 Ga0163162_10009921 3300013306 Bacteria 9262
207 Ga0163162_10083848 3300013306 Bacteria 3261
208 Ga0163162_10281608 3300013306 Bacteria 1795
209 Ga0163162_10970840 3300013306 Bacteria 960
210 Ga0157372_10191636 3300013307 Bacteria 2368
211 Ga0157375_10105627 3300013308 Bacteria 2907
212 Ga0157375_10232188 3300013308 Bacteria 2004
213 Ga0157375_10490998 3300013308 Bacteria 1392
214 Ga0163163_10005243 3300014325 Bacteria 11177
215 Ga0163163_10020813 3300014325 Bacteria 6184
216 Ga0163163_10062687 3300014325 Bacteria 3685
217 Ga0163163_10087163 3300014325 Bacteria 3132
218 Ga0163163_10111538 3300014325 Bacteria 2764
219 Ga0163163_10318530 3300014325 Bacteria 1609
220 Ga0163163_10400194 3300014325 Bacteria 1431
221 Ga0163163_11035983 3300014325 Bacteria 884
222 Ga0163163_13266706 3300014325 Bacteria 506
223 Ga0157380_10329337 3300014326 Bacteria 1420
224 Ga0157380_11088495 3300014326 Bacteria 838
225 Ga0157379_10000119 3300014968 Bacteria 54670
226 Ga0157379_10046669 3300014968 Bacteria 3865
227 Ga0157379_10054996 3300014968 Bacteria 3557
228 Ga0157379_10309300 3300014968 Bacteria 1441
229 Ga0157376_10332579 3300014969 Bacteria 1448
230 Ga0163161_10154145 3300017792 Bacteria 1748
231 Ga0163161_10446667 3300017792 Bacteria 1044
232 Ga0163161_10697563 3300017792 Bacteria 845
233 Ga0163161_11403047 3300017792 Bacteria 610
234 Ga0206356_10375787 3300020070 Bacteria 612
235 Ga0213876_10015560 3300021384 Bacteria 4025
236 Ga0213876_10452455 3300021384 Bacteria 683
237 Ga0213871_10104871 3300021441 Unclassified 831
238 Ga0209026_1000800 3300025250 Bacteria 17123
239 Ga0209026_1010961 3300025250 Bacteria 1660
240 Ga0209565_1000414 3300025263 Bacteria 35246
241 Ga0209673_1001567 3300025273 Bacteria 20402
242 Ga0209673_1071722 3300025273 Bacteria 822
243 Ga0209564_1002030 3300025295 Bacteria 17560
244 Ga0209564_1063882 3300025295 Bacteria 806
245 Ga0209758_1002163 3300025297 Bacteria 20648
246 Ga0209758_1002287 3300025297 Bacteria 19832
247 Ga0209050_1000031 3300025298 Bacteria 458181
248 Ga0209256_1003858 3300025299 Bacteria 9990
249 Ga0209256_1003966 3300025299 Bacteria 9729
250 Ga0209256_1018510 3300025299 Bacteria 2259
251 Ga0209257_1000073 3300025304 Bacteria 325833
252 Ga0209257_1001335 3300025304 Bacteria 29946
253 Ga0209257_1005089 3300025304 Bacteria 9548
254 Ga0207642_11007266 3300025899 Bacteria 537
255 Ga0207710_10333975 3300025900 Bacteria 770
256 Ga0207710_10508737 3300025900 Bacteria 625
257 Ga0207680_10150917 3300025903 Bacteria 1549
258 Ga0207680_10665123 3300025903 Bacteria 746
259 Ga0207705_10086832 3300025909 Bacteria 2287
260 Ga0207705_11085855 3300025909 Bacteria 617
261 Ga0207705_11318851 3300025909 Bacteria 551
262 Ga0207654_10309401 3300025911 Bacteria 1077
263 Ga0207707_10067008 3300025912 Bacteria 3127
264 Ga0207707_10449929 3300025912 Bacteria 1102
265 Ga0207695_10002249 3300025913 Bacteria 28926
266 Ga0207695_10008692 3300025913 Bacteria 12667
267 Ga0207695_10033670 3300025913 Bacteria 5583
268 Ga0207695_10135991 3300025913 Bacteria 2411
269 Ga0207695_10150535 3300025913 Bacteria 2266
270 Ga0207671_10161924 3300025914 Bacteria 1733
271 Ga0207671_10492685 3300025914 Bacteria 977
272 Ga0207660_10029717 3300025917 Bacteria 3752
273 Ga0207660_10071525 3300025917 Bacteria 2524
274 Ga0207660_10181127 3300025917 Bacteria 1636
275 Ga0207652_10453961 3300025921 Bacteria 1155
276 Ga0207652_11344565 3300025921 Bacteria 617
277 Ga0207681_10251082 3300025923 Bacteria 1381
278 Ga0207681_10270614 3300025923 Bacteria 1333
279 Ga0207694_10008305 3300025924 Bacteria 7849
280 Ga0207694_10210591 3300025924 Bacteria 1583
281 Ga0207694_10447889 3300025924 Bacteria 1077
282 Ga0207650_10000315 3300025925 Bacteria 47489
283 Ga0207650_10025870 3300025925 Bacteria 4183
284 Ga0207650_10071259 3300025925 Bacteria 2614
285 Ga0207650_10139026 3300025925 Bacteria 1908
286 Ga0207650_11655895 3300025925 Unclassified 543
287 Ga0207644_10000679 3300025931 Bacteria 21492
288 Ga0207644_10056731 3300025931 Bacteria 2827
289 Ga0207644_10080330 3300025931 Bacteria 2408
290 Ga0207644_10464985 3300025931 Unclassified 1040
291 Ga0207644_11505943 3300025931 Bacteria 565
292 Ga0207690_10609643 3300025932 Bacteria 892
293 Ga0207706_10229506 3300025933 Bacteria 1624
294 Ga0207706_10297511 3300025933 Bacteria 1406
295 Ga0207686_10063811 3300025934 Bacteria 2344
296 Ga0207670_11247722 3300025936 Bacteria 630
297 Ga0207669_10736863 3300025937 Bacteria 813
298 Ga0207704_10001880 3300025938 Bacteria 9398
299 Ga0207704_11507440 3300025938 Bacteria 577
300 Ga0207711_10003417 3300025941 Bacteria 13735
301 Ga0207711_10005865 3300025941 Bacteria 10370
302 Ga0207711_10006591 3300025941 Bacteria 9775
303 Ga0207711_10026071 3300025941 Bacteria 4903
304 Ga0207711_10100590 3300025941 Bacteria 2557
305 Ga0207711_10221443 3300025941 Bacteria 1731
306 Ga0207711_10385808 3300025941 Bacteria 1300
307 Ga0207711_10887056 3300025941 Bacteria 829
308 Ga0207711_11370403 3300025941 Bacteria 650
309 Ga0207711_11652685 3300025941 Bacteria 584
310 Ga0207711_11997950 3300025941 Bacteria 523
311 Ga0207689_11005179 3300025942 Bacteria 703
312 Ga0207679_10134411 3300025945 Bacteria 1989
313 Ga0207667_10041076 3300025949 Bacteria 4920
314 Ga0207667_10086365 3300025949 Bacteria 3246
315 Ga0207667_10648781 3300025949 Bacteria 1061
316 Ga0207667_11424947 3300025949 Bacteria 666
317 Ga0207651_10013365 3300025960 Bacteria 4697
318 Ga0207712_10010595 3300025961 Bacteria 5853
319 Ga0207712_10244894 3300025961 Bacteria 1446
320 Ga0207712_11070299 3300025961 Bacteria 717
321 Ga0207668_10000007 3300025972 Bacteria 190613
322 Ga0207668_10001472 3300025972 Bacteria 13802
323 Ga0207668_10015771 3300025972 Bacteria 4701
324 Ga0207668_10034342 3300025972 Bacteria 3367
325 Ga0207668_10037884 3300025972 Bacteria 3231
326 Ga0207668_10047510 3300025972 Bacteria 2939
327 Ga0207640_10027977 3300025981 Bacteria 3441
328 Ga0207640_10081298 3300025981 Bacteria 2215
329 Ga0207640_11872869 3300025981 Bacteria 543
330 Ga0207658_10000052 3300025986 Bacteria 128748
331 Ga0207658_10008069 3300025986 Bacteria 7174
332 Ga0207658_10031797 3300025986 Bacteria 3751
333 Ga0207658_10881350 3300025986 Bacteria 814
334 Ga0207658_11113029 3300025986 Bacteria 721
335 Ga0207703_10000105 3300026035 Bacteria 99702
336 Ga0207703_10002806 3300026035 Bacteria 14880
337 Ga0207703_10061871 3300026035 Bacteria 3066
338 Ga0207703_10217781 3300026035 Bacteria 1705
339 Ga0207703_11039509 3300026035 Bacteria 786
340 Ga0207703_11224539 3300026035 Bacteria 722
341 Ga0207639_10014437 3300026041 Bacteria 5556
342 Ga0207639_10028144 3300026041 Bacteria 4101
343 Ga0207639_10412905 3300026041 Bacteria 1219
344 Ga0207639_10455204 3300026041 Bacteria 1162
345 Ga0207678_10335464 3300026067 Bacteria 1302
346 Ga0207702_10155204 3300026078 Bacteria 2086
347 Ga0207702_10322746 3300026078 Bacteria 1471
348 Ga0207702_11615397 3300026078 Bacteria 641
349 Ga0207641_10000160 3300026088 Bacteria 95407
350 Ga0207641_10002888 3300026088 Bacteria 15554
351 Ga0207641_10006166 3300026088 Bacteria 10145
352 Ga0207641_10081699 3300026088 Bacteria 2807
353 Ga0207641_10280872 3300026088 Bacteria 1566
354 Ga0207641_10412260 3300026088 Bacteria 1299
355 Ga0207641_10469405 3300026088 Bacteria 1218
356 Ga0207641_11804163 3300026088 Bacteria 613
357 Ga0207641_12325624 3300026088 Bacteria 535
358 Ga0207648_11425932 3300026089 Bacteria 651
359 Ga0207676_10000159 3300026095 Bacteria 59242
360 Ga0207676_10000380 3300026095 Bacteria 37876
361 Ga0207676_10003296 3300026095 Bacteria 11468
362 Ga0207676_10035485 3300026095 Bacteria 3785
363 Ga0207676_10338954 3300026095 Bacteria 1386
364 Ga0207676_10445614 3300026095 Bacteria 1219
365 Ga0207676_10656423 3300026095 Bacteria 1013
366 Ga0207676_11351527 3300026095 Bacteria 708
367 Ga0207676_11689004 3300026095 Bacteria 631
368 Ga0207674_10342257 3300026116 Bacteria 1446
369 Ga0207675_100192443 3300026118 Bacteria 1957
370 Ga0207675_100982575 3300026118 Bacteria 862
371 Ga0207683_10233188 3300026121 Bacteria 1679
372 Ga0207683_10380674 3300026121 Bacteria 1297
373 Ga0207698_11183579 3300026142 Bacteria 778
374 Ga0207698_11869394 3300026142 Bacteria 615
375 Ga0207698_12605326 3300026142 Bacteria 515
376 Ga0209281_1013319 3300027111 Bacteria 1779
377 Ga0209981_1008629 3300027378 Bacteria 1384
378 Ga0209999_1007104 3300027543 Bacteria 2014
379 Ga0209813_10022309 3300027866 Bacteria 1789
380 Ga0268266_10002189 3300028379 Bacteria 21374
381 Ga0268266_10056945 3300028379 Bacteria 3362
382 Ga0268266_10111835 3300028379 Bacteria 2420
383 Ga0268266_10244847 3300028379 Bacteria 1656
384 Ga0268265_10001929 3300028380 Bacteria 16463
385 Ga0268265_10003935 3300028380 Bacteria 10465
386 Ga0268265_10008280 3300028380 Bacteria 7024
387 Ga0268265_10030008 3300028380 Bacteria 3912
388 Ga0268265_10120518 3300028380 Bacteria 2160
389 Ga0268265_10228304 3300028380 Bacteria 1634
390 Ga0268265_11336730 3300028380 Bacteria 717
391 Ga0268265_12620744 3300028380 Bacteria 510
392 Ga0268264_10000112 3300028381 Bacteria 203742
393 Ga0268264_10000270 3300028381 Bacteria 90954
394 Ga0268264_10011304 3300028381 Bacteria 7374
395 Ga0268264_10378392 3300028381 Bacteria 1355
396 Ga0268264_11114257 3300028381 Bacteria 798
397 Ga0265334_10006729 3300028573 Bacteria 4937
398 Ga0307517_10013485 3300028786 Bacteria 11088
399 Ga0307517_10168146 3300028786 Bacteria 1450
400 Ga0307517_10244709 3300028786 Bacteria 1060
401 Ga0307515_10058050 3300028794 Bacteria 5584
402 Ga0307515_10064837 3300028794 Bacteria 5100
403 Ga0307515_10128770 3300028794 Bacteria 2804
404 Ga0265338_10022804 3300028800 Bacteria 6463
405 Ga0265338_10026523 3300028800 Bacteria 5841
406 Ga0307511_10052739 3300030521 Bacteria 3236
407 Ga0265339_10467342 3300031249 Bacteria 584
408 Ga0265331_10369690 3300031250 Bacteria 642
409 Ga0265327_10000337 3300031251 Bacteria 89213
410 Ga0307513_10000082 3300031456 Bacteria 131779
411 Ga0307513_10002784 3300031456 Bacteria 24017
412 Ga0307513_10003048 3300031456 Bacteria 22854
413 Ga0307513_10004685 3300031456 Bacteria 18196
414 Ga0307513_10350587 3300031456 Bacteria 1224
415 Ga0307513_10864537 3300031456 Bacteria 611
416 Ga0307408_100839864 3300031548 Bacteria 837
417 Ga0307408_100863080 3300031548 Bacteria 826
418 Ga0307408_101536506 3300031548 Bacteria 630
419 Ga0307408_101783547 3300031548 Bacteria 588
420 Ga0265314_10161642 3300031711 Bacteria 1362
421 Ga0307405_10440912 3300031731 Bacteria 1030
422 Ga0307405_10483447 3300031731 Bacteria 989
423 Ga0307405_10952091 3300031731 Bacteria 730
424 Ga0307413_10195283 3300031824 Bacteria 1456
425 Ga0307410_11402825 3300031852 Bacteria 613
426 Ga0307406_10710809 3300031901 Bacteria 840
427 Ga0307412_10911059 3300031911 Bacteria 771
428 Ga0307412_11228432 3300031911 Bacteria 672
429 Ga0307412_11499981 3300031911 Bacteria 613
430 Ga0307416_101669999 3300032002 Bacteria 742
431 Ga0307416_103876817 3300032002 Bacteria 501
432 Ga0307414_10116546 3300032004 Bacteria 2045
433 Ga0307414_11006823 3300032004 Bacteria 767
434 Ga0307411_12250419 3300032005 Bacteria 512
435 Ga0307415_101424359 3300032126 Bacteria 660
436 Ga0307415_101506806 3300032126 Bacteria 644
437 Ga0307415_101922603 3300032126 Bacteria 575
438 Ga0307510_10002252 3300033180 Bacteria 21803
439 Ga0373926_0147979 3300035083 Bacteria 893
440 Ga0373944_0000508 3300035089 Bacteria 9065
441 Ga0373936_0030197 3300035113 Bacteria 2137
442 Ga0373939_0530429 3300035114 Bacteria 506
443 Ga0373943_0289786 3300035170 Bacteria 927
444 Ga0373943_0303427 3300035170 Bacteria 907
445 Ga0373946_0010569 3300035171 Bacteria 3420
446 Ga0373931_0309650 3300035691 Bacteria 978
447 Ga0373931_1063466 3300035691 Bacteria 550
448 Ga0373927_0000296 3300035695 Bacteria 39241
449 Ga0373927_1173864 3300035695 Bacteria 506
450 Ga0373933_0247198 3300035724 Bacteria 1148
451 Ga0373947_0211836 3300035725 Unclassified 1271
452 Ga0373937_0367025 3300036401 Bacteria 1365
453 Ga0373937_0922129 3300036401 Unclassified 822
454 Ga0373925_0000022 3300037068 Bacteria 160046
455 Ga0373925_0292279 3300037068 Bacteria 1314
456 Ga0395899_0000557 3300037312 Bacteria 40072
457 Ga0395899_0140831 3300037312 Bacteria 1716
458 Ga0395900_0000010 3300037418 Bacteria 461364
459 Ga0395900_0061996 3300037418 Bacteria 3844
460 Ga0395900_1155110 3300037418 Bacteria 690
461 Ga0395898_0018674 3300037466 Bacteria 7068
462 Ga0395898_0042837 3300037466 Bacteria 4464
463 Ga0395898_0313443 3300037466 Bacteria 1497
464 Ga0395905_0006948 3300037471 Bacteria 11310
465 Ga0395905_0163759 3300037471 Bacteria 2090
466 Ga0395905_0177779 3300037471 Bacteria 1998
467 Ga0395905_0299487 3300037471 Bacteria 1495
468 Ga0395905_0309141 3300037471 Bacteria 1469
469 Ga0395905_0876788 3300037471 Bacteria 800
470 Ga0395905_0929335 3300037471 Bacteria 773
471 Ga0395905_1337229 3300037471 Bacteria 620
472 Ga0395905_1571292 3300037471 Bacteria 562
473 Ga0395901_0000007 3300038443 Bacteria 497408
474 Ga0395901_0295838 3300038443 Bacteria 1679
475 Ga0395901_0729909 3300038443 Bacteria 985
476 Ga0395901_1269057 3300038443 Bacteria 699
477 Ga0395901_1506912 3300038443 Bacteria 628
478 Ga0436365_0233204 3300039437 Bacteria 633
479 Ga0436365_0235294 3300039437 Bacteria 2381
480 Ga0436365_0988854 3300039437 Bacteria 4957
481 Ga0436365_1177820 3300039437 Bacteria 814
482 Ga0436365_1288496 3300039437 Bacteria 5067
483 Ga0436362_1173452 3300039453 Bacteria 638
484 Ga0439465_0053654 3300041413 Bacteria 1325
485 Ga0451789_0641556 3300041443 Bacteria 589
486 Ga0451795_0636755 3300041456 Bacteria 506
487 Ga0451841_1329338 3300041498 Bacteria 578
488 Ga0439431_0055230 3300041997 Bacteria 1037
489 Ga0439445_0109697 3300042004 Bacteria 787
490 Ga0439446_0006467 3300042156 Bacteria 3056
491 Ga0466965_0343402 3300044683 Bacteria 816
492 Ga0466966_0536961 3300044684 Bacteria 704
493 Ga0466961_0468260 3300044693 Bacteria 762
494 Ga0453684_0194302 3300044712 Bacteria 2371
495 Ga0466957_0374883 3300044842 Bacteria 969
496 Ga0466960_0083723 3300044901 Bacteria 1613
497 Ga0466960_0780881 3300044901 Bacteria 577
498 Ga0466959_0949473 3300045049 Bacteria 573
499 Ga0466958_0328728 3300045836 Bacteria 983
500 Ga0495627_001895 3300046453 Bacteria 10972
501 Ga0495590_0030240 3300046457 Bacteria 1897
502 Ga0495629_0080874 3300046459 Bacteria 2268
503 Ga0495638_0002503 3300046460 Bacteria 14964
504 Ga0495638_0039238 3300046460 Bacteria 3006
505 Ga0495653_0538462 3300046463 Bacteria 724
506 Ga0495650_0000007 3300046471 Bacteria 718072
507 Ga0495650_0025100 3300046471 Bacteria 2801
508 Ga0495605_0274762 3300046474 Unclassified 717
509 Ga0495585_0113228 3300046492 Bacteria 1441
510 Ga0495607_0157106 3300046501 Bacteria 1158
511 Ga0495583_0042084 3300046506 Bacteria 2136
512 Ga0495583_0178122 3300046506 Bacteria 871
513 Ga0495606_0008563 3300046507 Bacteria 8852
514 Ga0495606_0135262 3300046507 Bacteria 1461
515 Ga0495606_0199606 3300046507 Bacteria 1141
516 Ga0495610_0000029 3300046512 Bacteria 271137
517 Ga0495610_0010088 3300046512 Bacteria 5898
518 Ga0495610_0121845 3300046512 Bacteria 1142
519 Ga0495610_0135053 3300046512 Bacteria 1067
520 Ga0495616_0000174 3300046513 Bacteria 54942
521 Ga0495620_0030909 3300046515 Bacteria 2459
522 Ga0495620_0175693 3300046515 Bacteria 829
523 Ga0495620_0365019 3300046515 Bacteria 547
524 Ga0495620_0429407 3300046515 Bacteria 500
525 Ga0495628_0104971 3300046516 Bacteria 2177
526 Ga0495631_0006175 3300046518 Bacteria 6209
527 Ga0495631_0071424 3300046518 Bacteria 1500
528 Ga0495631_0453039 3300046518 Bacteria 546
529 Ga0495632_0012294 3300046519 Bacteria 4940
530 Ga0495637_0013757 3300046520 Bacteria 3835
531 Ga0495637_0022565 3300046520 Bacteria 2869
532 Ga0495637_0048314 3300046520 Bacteria 1793
533 Ga0495643_0143076 3300046522 Bacteria 1190
534 Ga0495643_0145655 3300046522 Bacteria 1177
535 Ga0495643_0166722 3300046522 Bacteria 1080
536 Ga0495644_0132337 3300046523 Bacteria 951
537 Ga0495648_0101293 3300046524 Bacteria 1589
538 Ga0495648_0138288 3300046524 Bacteria 1285
539 Ga0495648_0204437 3300046524 Bacteria 986
540 Ga0495648_0451720 3300046524 Bacteria 562
541 Ga0495663_0020090 3300046525 Bacteria 1916
542 Ga0495663_0321103 3300046525 Bacteria 560
543 Ga0495642_0043680 3300046528 Bacteria 1828
544 Ga0495642_0326066 3300046528 Unclassified 674
545 Ga0495654_0000116 3300046530 Bacteria 90109
546 Ga0495654_0087031 3300046530 Bacteria 1455
547 Ga0495654_0170992 3300046530 Bacteria 947
548 Ga0495609_0105136 3300046538 Bacteria 1221
549 Ga0495609_0139498 3300046538 Bacteria 1035
550 Ga0495621_0051353 3300046539 Bacteria 1475
551 Ga0495621_0373161 3300046539 Bacteria 601
552 Ga0495597_0017381 3300046542 Bacteria 3386
553 Ga0495645_0129428 3300046543 Bacteria 1770
554 Ga0495645_0555491 3300046543 Bacteria 711
555 Ga0495645_0670212 3300046543 Bacteria 632
556 Ga0495622_0005537 3300046557 Bacteria 5853
557 Ga0495633_0367356 3300046558 Bacteria 651
558 Ga0495668_0034575 3300046616 Bacteria 2834
559 Ga0495668_0046706 3300046616 Bacteria 2405
560 Ga0495668_0065544 3300046616 Bacteria 1999
561 Ga0495668_0129417 3300046616 Bacteria 1382
562 Ga0495668_0139269 3300046616 Bacteria 1328
563 Ga0495668_0146867 3300046616 Unclassified 1291
564 Ga0495668_0299814 3300046616 Bacteria 881
565 Ga0495668_0517011 3300046616 Bacteria 658
566 Ga0495668_0765807 3300046616 Bacteria 534
567 Ga0495611_0068983 3300046648 Bacteria 1614
568 Ga0495625_0000051 3300046660 Bacteria 193325
569 Ga0495625_0006547 3300046660 Bacteria 10345
570 Ga0495625_0013474 3300046660 Bacteria 6568
571 Ga0495625_0027323 3300046660 Bacteria 4298
572 Ga0495625_0082583 3300046660 Bacteria 2234
573 Ga0495625_0095257 3300046660 Bacteria 2052
574 Ga0495625_0163634 3300046660 Bacteria 1489
575 Ga0495625_0554546 3300046660 Bacteria 695
576 Ga0495625_0767920 3300046660 Bacteria 563
577 Ga0495599_0851380 3300046678 Bacteria 519
578 Ga0495646_0574800 3300046680 Bacteria 574
579 Ga0495669_0000477 3300046684 Bacteria 18627
580 Ga0495669_0023009 3300046684 Bacteria 2709
581 Ga0495669_0507601 3300046684 Bacteria 586
582 Ga0495624_0385633 3300046690 Bacteria 841
583 Ga0495670_0303454 3300046691 Bacteria 856
584 Ga0495670_0352809 3300046691 Bacteria 792
585 Ga0495671_0142661 3300046692 Bacteria 1167
586 Ga0495589_0014765 3300046794 Bacteria 4019
587 Ga0495581_0267263 3300047315 Bacteria 1000
588 Ga0495674_0966016 3300047319 Unclassified 655
589 Ga0495672_0005855 3300047320 Bacteria 9642
590 Ga0495687_157043 3300047443 Bacteria 770
591 Ga0495677_0057749 3300047445 Bacteria 1435
592 Ga0495677_0096197 3300047445 Bacteria 1118
593 Ga0495673_0000082 3300047469 Bacteria 199141
594 Ga0495673_0000123 3300047469 Bacteria 144484
595 Ga0495673_0034715 3300047469 Bacteria 2330
596 Ga0495681_0068251 3300047470 Bacteria 1618
597 Ga0495681_0069336 3300047470 Bacteria 1602
598 Ga0495686_0004520 3300047472 Bacteria 11400
599 Ga0495686_0006301 3300047472 Bacteria 9117
600 Ga0495686_0011451 3300047472 Bacteria 6247
601 Ga0495686_0013415 3300047472 Bacteria 5684
602 Ga0495686_0257975 3300047472 Bacteria 977
603 Ga0495686_0440258 3300047472 Bacteria 694
604 Ga0495615_0289067 3300048090 Bacteria 528
605 Ga0496100_0318744 3300048903 Bacteria 1167
606 Ga0496101_0049620 3300048904 Bacteria 3020
607 Ga0496101_0076253 3300048904 Bacteria 2470
608 Ga0496102_0023819 3300048905 Bacteria 5440
609 Ga0496102_0340101 3300048905 Bacteria 1413
610 Ga0496102_1652384 3300048905 Bacteria 559
611 Ga0496103_0064568 3300048906 Bacteria 2282
612 Ga0496103_0151965 3300048906 Bacteria 1483
613 Ga0496103_0303400 3300048906 Bacteria 1027
614 Ga0496105_0785758 3300048908 Bacteria 725
615 Ga0496106_0019483 3300048909 Bacteria 5033
616 Ga0496106_0028464 3300048909 Bacteria 4163
617 Ga0496106_0109995 3300048909 Bacteria 2144
618 Ga0496107_0000089 3300048910 Bacteria 43926
619 Ga0496108_0200224 3300048911 Bacteria 1733
620 Ga0496109_0059837 3300048912 Bacteria 3480
621 Ga0496110_0203105 3300048913 Bacteria 1801
622 Ga0496110_0722010 3300048913 Bacteria 899
623 Ga0496111_0155001 3300048914 Bacteria 1700
624 Ga0496111_1086618 3300048914 Bacteria 571
625 Ga0496112_0017757 3300048915 Bacteria 6695
626 Ga0496112_0777419 3300048915 Bacteria 883
627 Ga0496113_0100344 3300048916 Bacteria 2243
628 Ga0496113_1138155 3300048916 Bacteria 611
629 Ga0496115_0000844 3300048918 Bacteria 22363
630 Ga0496115_0020431 3300048918 Bacteria 5109
631 Ga0496115_0126466 3300048918 Bacteria 2106
632 Ga0496115_0595446 3300048918 Bacteria 879
633 Ga0496115_1364311 3300048918 Bacteria 525
634 Ga0496117_0071591 3300048920 Bacteria 2322
635 Ga0496118_0066986 3300048921 Bacteria 2618
636 Ga0496119_0018413 3300048922 Bacteria 5199
637 Ga0496121_0000009 3300048924 Bacteria 836971
638 Ga0496121_0011733 3300048924 Bacteria 9669
639 Ga0496121_0408321 3300048924 Bacteria 887
640 Ga0496122_0284370 3300048925 Bacteria 902
641 Ga0496126_0614604 3300048929 Bacteria 855
642 Ga0495678_002925 3300049459 Bacteria 10933
643 Ga0501032_0067343 3300049569 Bacteria 2392
644 Ga0501033_0163064 3300049570 Bacteria 1604
645 Ga0501033_0636513 3300049570 Bacteria 729
646 Ga0501034_0450498 3300049571 Bacteria 1205
647 Ga0501034_0884725 3300049571 Bacteria 782
648 Ga0501043_0669402 3300049579 Bacteria 761
649 Ga0501046_0520130 3300049580 Bacteria 851
650 Ga0501047_0006760 3300049581 Bacteria 10776
651 Ga0501047_0117683 3300049581 Bacteria 2539
652 Ga0501047_0207573 3300049581 Bacteria 1818
653 Ga0501047_0567498 3300049581 Bacteria 958
654 Ga0501047_0648677 3300049581 Bacteria 875
655 Ga0501048_0108347 3300049582 Bacteria 1961
656 Ga0501070_0811786 3300049586 Bacteria 734
657 Ga0501070_0927346 3300049586 Bacteria 678
658 Ga0501238_001885 3300049671 Bacteria 2446
659 Ga0501257_001918 3300049686 Bacteria 4330
660 Ga0501273_061568 3300049770 Bacteria 593
661 Ga0501035_0222077 3300049822 Bacteria 1613
662 Ga0501035_0790092 3300049822 Bacteria 759
663 Ga0501035_1151900 3300049822 Bacteria 604
664 Ga0501044_0053153 3300049823 Bacteria 4168
665 Ga0501044_0925092 3300049823 Bacteria 746
666 Ga0501044_1382516 3300049823 Bacteria 570
667 nmdc:mga03683_369814_c1 3300050489 Bacteria 681
668 nmdc:mga03n38_34587_c1 3300050490 Bacteria 2159
669 nmdc:mga00v17_282_c1 3300050491 Bacteria 30074
670 nmdc:mga0k408_241688_c1 3300050493 Bacteria 1078
671 nmdc:mga0k408_58819_c1 3300050493 Bacteria 2232
672 nmdc:mga06z11_352155_c1 3300050494 Bacteria 882
673 nmdc:mga07m45_151253_c1 3300050496 Bacteria 1346
674 nmdc:mga07m45_21610_c1 3300050496 Bacteria 3506
675 nmdc:mga07m45_2401_c1 3300050496 Unclassified 1455
676 Ga0500635_0000080 3300053080 Bacteria 63214
677 Ga0500635_0161421 3300053080 Bacteria 860
678 Ga0500578_0001330 3300053086 Bacteria 25351
679 Ga0500578_0064139 3300053086 Bacteria 2343
680 Ga0500643_004128 3300053087 Bacteria 6678
681 Ga0500643_008375 3300053087 Bacteria 4065
682 Ga0500643_012178 3300053087 Bacteria 3090
683 Ga0500643_018221 3300053087 Bacteria 2334
684 Ga0500643_045349 3300053087 Bacteria 1274
685 Ga0500644_0000817 3300053088 Bacteria 10508
686 Ga0500646_0173628 3300053090 Bacteria 726
687 Ga0500583_0112149 3300053092 Bacteria 1344
688 Ga0500651_0043669 3300053093 Bacteria 2823
689 Ga0500566_0025410 3300053094 Bacteria 3473
690 Ga0500641_0000989 3300053096 Bacteria 10095
691 Ga0500641_0033355 3300053096 Bacteria 2043
692 Ga0500641_0109676 3300053096 Bacteria 1188
693 Ga0500650_0129974 3300053098 Bacteria 1171
694 Ga0500554_004309 3300053102 Bacteria 3004
695 Ga0500555_006512 3300053103 Bacteria 3319
696 Ga0500555_092589 3300053103 Bacteria 775
697 Ga0500556_0001038 3300053104 Bacteria 14488
698 Ga0500556_0004885 3300053104 Bacteria 3795
699 Ga0500556_0158860 3300053104 Bacteria 892
700 Ga0500557_234064 3300053105 Bacteria 580
701 Ga0500562_000175 3300053108 Bacteria 17715
702 Ga0500562_000192 3300053108 Bacteria 16565
703 Ga0500562_001492 3300053108 Bacteria 5771
704 Ga0500562_008146 3300053108 Bacteria 2643
705 Ga0500569_003741 3300053109 Bacteria 3141
706 Ga0500572_019183 3300053111 Bacteria 1783
707 Ga0500594_0000343 3300053118 Bacteria 10448
708 Ga0500595_026812 3300053119 Bacteria 1981
709 Ga0500595_094612 3300053119 Bacteria 861
710 Ga0500608_020849 3300053122 Bacteria 3020
711 Ga0500614_021326 3300053123 Bacteria 1502
712 Ga0500614_042601 3300053123 Bacteria 1160
713 Ga0500618_000305 3300053125 Bacteria 36613
714 Ga0500642_0218173 3300053130 Bacteria 884
715 Ga0500652_268592 3300053131 Bacteria 670
716 Ga0500658_0010384 3300053134 Bacteria 3433
717 Ga0500559_0000002 3300053136 Bacteria 262002
718 Ga0500559_0000008 3300053136 Bacteria 182182
719 Ga0500559_0005600 3300053136 Bacteria 5762
720 Ga0500559_0009234 3300053136 Bacteria 4279
721 Ga0500564_008131 3300053138 Bacteria 4489
722 Ga0500564_386497 3300053138 Bacteria 510
723 Ga0500568_0079455 3300053139 Bacteria 1247
724 Ga0500590_086804 3300053148 Bacteria 1525
725 Ga0500604_0257349 3300053151 Bacteria 604
726 Ga0500616_0019532 3300053153 Bacteria 3818
727 Ga0500616_0294367 3300053153 Bacteria 676
728 Ga0500616_0295944 3300053153 Bacteria 674
729 Ga0500622_0000474 3300053156 Bacteria 37843
730 Ga0500622_0014049 3300053156 Bacteria 4304
731 Ga0500622_0187530 3300053156 Bacteria 950
732 Ga0500622_0217929 3300053156 Bacteria 857
733 Ga0500627_0028327 3300053158 Bacteria 2326
734 Ga0500633_0272677 3300053160 Bacteria 626
735 Ga0500639_110398 3300053163 Unclassified 1339
736 Ga0500639_288500 3300053163 Bacteria 626
737 Ga0500636_0008561 3300053177 Bacteria 5931
738 Ga0500637_0002594 3300053178 Bacteria 8079
739 Ga0500637_0490844 3300053178 Bacteria 611
740 Ga0500576_083852 3300053725 Bacteria 1339
741 Ga0500645_000703 3300053730 Bacteria 20751
742 Ga0500645_002828 3300053730 Bacteria 7477
743 Ga0500645_004887 3300053730 Bacteria 5043
744 Ga0500645_034505 3300053730 Bacteria 1511
745 Ga0500609_000232 3300053731 Bacteria 8044
746 Ga0500596_003387 3300053735 Bacteria 3037
747 Ga0587091_214748 3300059511 Bacteria 523
748 2511123526 2510917020 Bacteria 5657507
749 2585150209 2582581279 Bacteria 4980720
750 2585153243 2582581280 Bacteria 5994497
751 2585196932 2582581293 Bacteria 5907401
752 2643748822 2643221545 Bacteria 5083237
753 2643778978 2643221552 Bacteria 5708754
754 2643923392 2643221583 Bacteria 5218014
755 2643930059 2643221584 Bacteria 5511711
756 2644001985 2643221598 Bacteria 4578346
757 2644085366 2643221614 Bacteria 4260023
758 2644342918 2643221661 Bacteria 4267604
759 2644366218 2643221666 Bacteria 4265935
760 2644509576 2643221691 Bacteria 5093099
761 2792463656 2791355048 Bacteria 5832535
762 2819539275 2818991435 Bacteria 5433759
763 2819648210 2818991454 Bacteria 5563326
764 2843748449 2843744320 Bacteria 5659202
765 2849562354 2849560528 Bacteria 5393480
766 2849574595 2849573788 Bacteria 5421256
767 2851155037 2851153111 Bacteria 5542585
768 2898330064 2898329390 Bacteria 5168154
769 Ga0495638_0003803
770 JGI25153J46596_10042631
771 rootL2_10016434
772 rootL2_10228638
773 Ga0055526_1039481
774 Ga0055537_1000562
775 Ga0055524_1007120
776 Ga0055528_1086361
777 Ga0055530_10002586
778 Ga0055531_10005697
779 Ga0055531_10017988
780 Ga0055531_10024083
781 Ga0055543_1031655
782 Ga0065165_1000307
783 Ga0065165_1002473
784 Ga0070658_10098394
785 Ga0070658_10310792
786 Ga0070683_100816795
787 Ga0070683_101085257
788 Ga0070690_100715853
789 Ga0070670_100000128
790 Ga0070670_100062321
791 Ga0070670_100092753
792 Ga0070670_100112931
793 Ga0070670_100406173
794 Ga0070666_10060179
795 Ga0070666_10066785
796 Ga0070666_11214892
797 Ga0070680_100064204
798 Ga0070680_100259869
799 Ga0070680_100547686
800 Ga0070682_100081869
801 Ga0070682_101197347
802 Ga0068868_100212289
803 Ga0070660_101326635
804 Ga0070689_101518801
805 Ga0070691_10044451
806 Ga0070661_100973990
807 Ga0070668_100000195
808 Ga0070668_100003161
809 Ga0070668_100004647
810 Ga0070668_100036004
811 Ga0070668_100102873
812 Ga0070669_100001021
813 Ga0070669_101357827
814 Ga0070671_100000895
815 Ga0070671_100031377
816 Ga0070671_100253576
817 Ga0070671_100657676
818 Ga0070673_101614276
819 Ga0070688_100432844
820 Ga0070659_100534103
821 Ga0070659_100731711
822 Ga0070667_100000169
823 Ga0070667_100005053
824 Ga0070667_100013278
825 Ga0070667_100047472
826 Ga0070667_102231723
827 Ga0070678_100281299
828 Ga0070662_100236987
829 Ga0070662_100239480
830 Ga0070681_10076249
831 Ga0070681_10102405
832 Ga0070681_10858063
833 Ga0068867_100302549
834 Ga0070685_11508223
835 Ga0070698_100379032
836 Ga0070679_100027525
837 Ga0070679_100559566
838 Ga0068853_100019157
839 Ga0068853_100113633
840 Ga0068853_100386290
841 Ga0068853_100535990
842 Ga0068853_100931822
843 Ga0068853_102479138
844 Ga0070686_100939036
845 Ga0070665_100001054
846 Ga0070665_100001083
847 Ga0070665_100044661
848 Ga0070665_100256442
849 Ga0070665_102516549
850 Ga0068855_100010008
851 Ga0068855_100044699
852 Ga0068855_100133055
853 Ga0068855_100146973
854 Ga0068855_101551458
855 Ga0068855_102088162
856 Ga0070664_101397306
857 Ga0068857_100653216
858 Ga0068854_100083216
859 Ga0068854_100264202
860 Ga0068856_100236821
861 Ga0068856_100613248
862 Ga0068859_100000407
863 Ga0068859_100243535
864 Ga0068859_100282802
865 Ga0068859_101193542
866 Ga0068859_103134958
867 Ga0068864_100000561
868 Ga0068864_100012687
869 Ga0068864_100045946
870 Ga0068864_100155113
871 Ga0068864_100846805
872 Ga0068864_101603112
873 Ga0068864_102713859
874 Ga0068866_10801407
875 Ga0068861_100065578
876 Ga0068863_100000101
877 Ga0068863_100002206
878 Ga0068863_100005153
879 Ga0068863_100040434
880 Ga0068863_100182680
881 Ga0068863_100760766
882 Ga0068858_100001173
883 Ga0068858_100003917
884 Ga0068858_100169945
885 Ga0068858_100240703
886 Ga0068860_100000055
887 Ga0068860_100000211
888 Ga0068860_100019283
889 Ga0068860_100450733
890 Ga0068862_100002104
891 Ga0068862_100004288
892 Ga0068862_100007104
893 Ga0068862_100259448
894 Ga0068862_100515922
895 Ga0070717_10078474
896 Ga0070717_10188631
897 Ga0075365_10124544
898 Ga0075368_10000328
899 Ga0075363_100035685
900 Ga0075363_100353326
901 Ga0075364_10001220
902 Ga0075362_10042252
903 Ga0075367_10000091
904 Ga0075366_10160941
905 Ga0075366_10349840
906 Ga0097621_100245349
907 Ga0075370_10214311
908 Ga0075370_10255984
909 Ga0075370_10495532
910 Ga0068871_100249645
911 Ga0068871_100822349
912 Ga0068871_101365651
913 Ga0068865_100000477
914 Ga0097620_100000407
915 Ga0097620_100243532
916 Ga0097620_100282797
917 Ga0097620_101193971
918 Ga0097620_101674984
919 Ga0097620_103134921
920 Ga0079104_1007780
921 Ga0105250_10014820
922 Ga0105240_10035366
923 Ga0105240_10037452
924 Ga0105240_10282148
925 Ga0105240_11752273
926 Ga0105240_12329155
927 Ga0105245_10536640
928 Ga0105245_10944948
929 Ga0105243_11382139
930 Ga0105241_10252825
931 Ga0105241_10903920
932 Ga0105242_10150763
933 Ga0105248_10000349
934 Ga0105248_10004855
935 Ga0105248_10008404
936 Ga0105248_10011646
937 Ga0105248_10027940
938 Ga0105248_10637909
939 Ga0105248_11186238
940 Ga0105248_11328574
941 Ga0105248_11725617
942 Ga0105248_12927503
943 Ga0105248_13246027
944 Ga0105248_13246035
945 Ga0105237_10145343
946 Ga0105237_10500920
947 Ga0105237_11471352
948 Ga0105238_10050097
949 Ga0105238_10101189
950 Ga0105238_10242319
951 Ga0105238_10945484
952 Ga0105238_11203370
953 Ga0105249_10001588
954 Ga0105249_10027976
955 Ga0105249_10231313
956 Ga0105249_10290865
957 Ga0105249_10391632
958 Ga0105249_10987913
959 Ga0105148_110709
960 Ga0105239_10476032
961 Ga0105239_10695002
962 Ga0105239_10858146
963 Ga0105239_11348287
964 Ga0105239_12198955
965 Ga0157327_1057865
966 Ga0157373_10004968
967 Ga0157373_10042339
968 Ga0157373_10546342
969 Ga0157370_10077369
970 Ga0157370_10202801
971 Ga0157369_10216591
972 Ga0157369_11225965
973 Ga0157374_11465330
974 Ga0163162_10009921
975 Ga0163162_10083848
976 Ga0163162_10281608
977 Ga0163162_10970840
978 Ga0157372_10191636
979 Ga0157375_10105627
980 Ga0157375_10232188
981 Ga0157375_10490998
982 Ga0163163_10005243
983 Ga0163163_10020813
984 Ga0163163_10062687
985 Ga0163163_10087163
986 Ga0163163_10111538
987 Ga0163163_10318530
988 Ga0163163_10400194
989 Ga0163163_11035983
990 Ga0163163_13266706
991 Ga0157380_10329337
992 Ga0157380_11088495
993 Ga0157379_10000119
994 Ga0157379_10046669
995 Ga0157379_10054996
996 Ga0157379_10309300
997 Ga0157376_10332579
998 Ga0163161_10154145
999 Ga0163161_10446667
1000 Ga0163161_10697563
1001 Ga0163161_11403047
1002 Ga0206356_10375787
1003 Ga0213876_10015560
1004 Ga0213876_10452455
1005 Ga0213871_10104871
1006 Ga0209026_1000800
1007 Ga0209026_1010961
1008 Ga0209565_1000414
1009 Ga0209673_1001567
1010 Ga0209673_1071722
1011 Ga0209564_1002030
1012 Ga0209564_1063882
1013 Ga0209758_1002163
1014 Ga0209758_1002287
1015 Ga0209050_1000031
1016 Ga0209256_1003858
1017 Ga0209256_1003966
1018 Ga0209256_1018510
1019 Ga0209257_1000073
1020 Ga0209257_1001335
1021 Ga0209257_1005089
1022 Ga0207642_11007266
1023 Ga0207710_10333975
1024 Ga0207710_10508737
1025 Ga0207680_10150917
1026 Ga0207680_10665123
1027 Ga0207705_10086832
1028 Ga0207705_11085855
1029 Ga0207705_11318851
1030 Ga0207654_10309401
1031 Ga0207707_10067008
1032 Ga0207707_10449929
1033 Ga0207695_10002249
1034 Ga0207695_10008692
1035 Ga0207695_10033670
1036 Ga0207695_10135991
1037 Ga0207695_10150535
1038 Ga0207671_10161924
1039 Ga0207671_10492685
1040 Ga0207660_10029717
1041 Ga0207660_10071525
1042 Ga0207660_10181127
1043 Ga0207652_10453961
1044 Ga0207652_11344565
1045 Ga0207681_10251082
1046 Ga0207681_10270614
1047 Ga0207694_10008305
1048 Ga0207694_10210591
1049 Ga0207694_10447889
1050 Ga0207650_10000315
1051 Ga0207650_10025870
1052 Ga0207650_10071259
1053 Ga0207650_10139026
1054 Ga0207650_11655895
1055 Ga0207644_10000679
1056 Ga0207644_10056731
1057 Ga0207644_10080330
1058 Ga0207644_10464985
1059 Ga0207644_11505943
1060 Ga0207690_10609643
1061 Ga0207706_10229506
1062 Ga0207706_10297511
1063 Ga0207686_10063811
1064 Ga0207670_11247722
1065 Ga0207669_10736863
1066 Ga0207704_10001880
1067 Ga0207704_11507440
1068 Ga0207711_10003417
1069 Ga0207711_10005865
1070 Ga0207711_10006591
1071 Ga0207711_10026071
1072 Ga0207711_10100590
1073 Ga0207711_10221443
1074 Ga0207711_10385808
1075 Ga0207711_10887056
1076 Ga0207711_11370403
1077 Ga0207711_11652685
1078 Ga0207711_11997950
1079 Ga0207689_11005179
1080 Ga0207679_10134411
1081 Ga0207667_10041076
1082 Ga0207667_10086365
1083 Ga0207667_10648781
1084 Ga0207667_11424947
1085 Ga0207651_10013365
1086 Ga0207712_10010595
1087 Ga0207712_10244894
1088 Ga0207712_11070299
1089 Ga0207668_10000007
1090 Ga0207668_10001472
1091 Ga0207668_10015771
1092 Ga0207668_10034342
1093 Ga0207668_10037884
1094 Ga0207668_10047510
1095 Ga0207640_10027977
1096 Ga0207640_10081298
1097 Ga0207640_11872869
1098 Ga0207658_10000052
1099 Ga0207658_10008069
1100 Ga0207658_10031797
1101 Ga0207658_10881350
1102 Ga0207658_11113029
1103 Ga0207703_10000105
1104 Ga0207703_10002806
1105 Ga0207703_10061871
1106 Ga0207703_10217781
1107 Ga0207703_11039509
1108 Ga0207703_11224539
1109 Ga0207639_10014437
1110 Ga0207639_10028144
1111 Ga0207639_10412905
1112 Ga0207639_10455204
1113 Ga0207678_10335464
1114 Ga0207702_10155204
1115 Ga0207702_10322746
1116 Ga0207702_11615397
1117 Ga0207641_10000160
1118 Ga0207641_10002888
1119 Ga0207641_10006166
1120 Ga0207641_10081699
1121 Ga0207641_10280872
1122 Ga0207641_10412260
1123 Ga0207641_10469405
1124 Ga0207641_11804163
1125 Ga0207641_12325624
1126 Ga0207648_11425932
1127 Ga0207676_10000159
1128 Ga0207676_10000380
1129 Ga0207676_10003296
1130 Ga0207676_10035485
1131 Ga0207676_10338954
1132 Ga0207676_10445614
1133 Ga0207676_10656423
1134 Ga0207676_11351527
1135 Ga0207676_11689004
1136 Ga0207674_10342257
1137 Ga0207675_100192443
1138 Ga0207675_100982575
1139 Ga0207683_10233188
1140 Ga0207683_10380674
1141 Ga0207698_11183579
1142 Ga0207698_11869394
1143 Ga0207698_12605326
1144 Ga0209281_1013319
1145 Ga0209981_1008629
1146 Ga0209999_1007104
1147 Ga0209813_10022309
1148 Ga0268266_10002189
1149 Ga0268266_10056945
1150 Ga0268266_10111835
1151 Ga0268266_10244847
1152 Ga0268265_10001929
1153 Ga0268265_10003935
1154 Ga0268265_10008280
1155 Ga0268265_10030008
1156 Ga0268265_10120518
1157 Ga0268265_10228304
1158 Ga0268265_11336730
1159 Ga0268265_12620744
1160 Ga0268264_10000112
1161 Ga0268264_10000270
1162 Ga0268264_10011304
1163 Ga0268264_10378392
1164 Ga0268264_11114257
1165 Ga0265334_10006729
1166 Ga0307517_10013485
1167 Ga0307517_10168146
1168 Ga0307517_10244709
1169 Ga0307515_10058050
1170 Ga0307515_10064837
1171 Ga0307515_10128770
1172 Ga0265338_10022804
1173 Ga0265338_10026523
1174 Ga0307511_10052739
1175 Ga0265339_10467342
1176 Ga0265331_10369690
1177 Ga0265327_10000337
1178 Ga0307513_10000082
1179 Ga0307513_10002784
1180 Ga0307513_10003048
1181 Ga0307513_10004685
1182 Ga0307513_10350587
1183 Ga0307513_10864537
1184 Ga0307408_100839864
1185 Ga0307408_100863080
1186 Ga0307408_101536506
1187 Ga0307408_101783547
1188 Ga0265314_10161642
1189 Ga0307405_10440912
1190 Ga0307405_10483447
1191 Ga0307405_10952091
1192 Ga0307413_10195283
1193 Ga0307410_11402825
1194 Ga0307406_10710809
1195 Ga0307412_10911059
1196 Ga0307412_11228432
1197 Ga0307412_11499981
1198 Ga0307416_101669999
1199 Ga0307416_103876817
1200 Ga0307414_10116546
1201 Ga0307414_11006823
1202 Ga0307411_12250419
1203 Ga0307415_101424359
1204 Ga0307415_101506806
1205 Ga0307415_101922603
1206 Ga0307510_10002252
1207 Ga0373926_0147979
1208 Ga0373944_0000508
1209 Ga0373936_0030197
1210 Ga0373939_0530429
1211 Ga0373943_0289786
1212 Ga0373943_0303427
1213 Ga0373946_0010569
1214 Ga0373931_0309650
1215 Ga0373931_1063466
1216 Ga0373927_0000296
1217 Ga0373927_1173864
1218 Ga0373933_0247198
1219 Ga0373947_0211836
1220 Ga0373937_0367025
1221 Ga0373937_0922129
1222 Ga0373925_0000022
1223 Ga0373925_0292279
1224 Ga0395899_0000557
1225 Ga0395899_0140831
1226 Ga0395900_0000010
1227 Ga0395900_0061996
1228 Ga0395900_1155110
1229 Ga0395898_0018674
1230 Ga0395898_0042837
1231 Ga0395898_0313443
1232 Ga0395905_0006948
1233 Ga0395905_0163759
1234 Ga0395905_0177779
1235 Ga0395905_0299487
1236 Ga0395905_0309141
1237 Ga0395905_0876788
1238 Ga0395905_0929335
1239 Ga0395905_1337229
1240 Ga0395905_1571292
1241 Ga0395901_0000007
1242 Ga0395901_0295838
1243 Ga0395901_0729909
1244 Ga0395901_1269057
1245 Ga0395901_1506912
1246 Ga0436365_0233204
1247 Ga0436365_0235294
1248 Ga0436365_0988854
1249 Ga0436365_1177820
1250 Ga0436365_1288496
1251 Ga0436362_1173452
1252 Ga0439465_0053654
1253 Ga0451789_0641556
1254 Ga0451795_0636755
1255 Ga0451841_1329338
1256 Ga0439431_0055230
1257 Ga0439445_0109697
1258 Ga0439446_0006467
1259 Ga0466965_0343402
1260 Ga0466966_0536961
1261 Ga0466961_0468260
1262 Ga0453684_0194302
1263 Ga0466957_0374883
1264 Ga0466960_0083723
1265 Ga0466960_0780881
1266 Ga0466959_0949473
1267 Ga0466958_0328728
1268 Ga0495627_001895
1269 Ga0495590_0030240
1270 Ga0495629_0080874
1271 Ga0495638_0002503
1272 Ga0495638_0039238
1273 Ga0495653_0538462
1274 Ga0495650_0000007
1275 Ga0495650_0025100
1276 Ga0495605_0274762
1277 Ga0495585_0113228
1278 Ga0495607_0157106
1279 Ga0495583_0042084
1280 Ga0495583_0178122
1281 Ga0495606_0008563
1282 Ga0495606_0135262
1283 Ga0495606_0199606
1284 Ga0495610_0000029
1285 Ga0495610_0010088
1286 Ga0495610_0121845
1287 Ga0495610_0135053
1288 Ga0495616_0000174
1289 Ga0495620_0030909
1290 Ga0495620_0175693
1291 Ga0495620_0365019
1292 Ga0495620_0429407
1293 Ga0495628_0104971
1294 Ga0495631_0006175
1295 Ga0495631_0071424
1296 Ga0495631_0453039
1297 Ga0495632_0012294
1298 Ga0495637_0013757
1299 Ga0495637_0022565
1300 Ga0495637_0048314
1301 Ga0495643_0143076
1302 Ga0495643_0145655
1303 Ga0495643_0166722
1304 Ga0495644_0132337
1305 Ga0495648_0101293
1306 Ga0495648_0138288
1307 Ga0495648_0204437
1308 Ga0495648_0451720
1309 Ga0495663_0020090
1310 Ga0495663_0321103
1311 Ga0495642_0043680
1312 Ga0495642_0326066
1313 Ga0495654_0000116
1314 Ga0495654_0087031
1315 Ga0495654_0170992
1316 Ga0495609_0105136
1317 Ga0495609_0139498
1318 Ga0495621_0051353
1319 Ga0495621_0373161
1320 Ga0495597_0017381
1321 Ga0495645_0129428
1322 Ga0495645_0555491
1323 Ga0495645_0670212
1324 Ga0495622_0005537
1325 Ga0495633_0367356
1326 Ga0495668_0034575
1327 Ga0495668_0046706
1328 Ga0495668_0065544
1329 Ga0495668_0129417
1330 Ga0495668_0139269
1331 Ga0495668_0146867
1332 Ga0495668_0299814
1333 Ga0495668_0517011
1334 Ga0495668_0765807
1335 Ga0495611_0068983
1336 Ga0495625_0000051
1337 Ga0495625_0006547
1338 Ga0495625_0013474
1339 Ga0495625_0027323
1340 Ga0495625_0082583
1341 Ga0495625_0095257
1342 Ga0495625_0163634
1343 Ga0495625_0554546
1344 Ga0495625_0767920
1345 Ga0495599_0851380
1346 Ga0495646_0574800
1347 Ga0495669_0000477
1348 Ga0495669_0023009
1349 Ga0495669_0507601
1350 Ga0495624_0385633
1351 Ga0495670_0303454
1352 Ga0495670_0352809
1353 Ga0495671_0142661
1354 Ga0495589_0014765
1355 Ga0495581_0267263
1356 Ga0495674_0966016
1357 Ga0495672_0005855
1358 Ga0495687_157043
1359 Ga0495677_0057749
1360 Ga0495677_0096197
1361 Ga0495673_0000082
1362 Ga0495673_0000123
1363 Ga0495673_0034715
1364 Ga0495681_0068251
1365 Ga0495681_0069336
1366 Ga0495686_0004520
1367 Ga0495686_0006301
1368 Ga0495686_0011451
1369 Ga0495686_0013415
1370 Ga0495686_0257975
1371 Ga0495686_0440258
1372 Ga0495615_0289067
1373 Ga0496100_0318744
1374 Ga0496101_0049620
1375 Ga0496101_0076253
1376 Ga0496102_0023819
1377 Ga0496102_0340101
1378 Ga0496102_1652384
1379 Ga0496103_0064568
1380 Ga0496103_0151965
1381 Ga0496103_0303400
1382 Ga0496105_0785758
1383 Ga0496106_0019483
1384 Ga0496106_0028464
1385 Ga0496106_0109995
1386 Ga0496107_0000089
1387 Ga0496108_0200224
1388 Ga0496109_0059837
1389 Ga0496110_0203105
1390 Ga0496110_0722010
1391 Ga0496111_0155001
1392 Ga0496111_1086618
1393 Ga0496112_0017757
1394 Ga0496112_0777419
1395 Ga0496113_0100344
1396 Ga0496113_1138155
1397 Ga0496115_0000844
1398 Ga0496115_0020431
1399 Ga0496115_0126466
1400 Ga0496115_0595446
1401 Ga0496115_1364311
1402 Ga0496117_0071591
1403 Ga0496118_0066986
1404 Ga0496119_0018413
1405 Ga0496121_0000009
1406 Ga0496121_0011733
1407 Ga0496121_0408321
1408 Ga0496122_0284370
1409 Ga0496126_0614604
1410 Ga0495678_002925
1411 Ga0501032_0067343
1412 Ga0501033_0163064
1413 Ga0501033_0636513
1414 Ga0501034_0450498
1415 Ga0501034_0884725
1416 Ga0501043_0669402
1417 Ga0501046_0520130
1418 Ga0501047_0006760
1419 Ga0501047_0117683
1420 Ga0501047_0207573
1421 Ga0501047_0567498
1422 Ga0501047_0648677
1423 Ga0501048_0108347
1424 Ga0501070_0811786
1425 Ga0501070_0927346
1426 Ga0501238_001885
1427 Ga0501257_001918
1428 Ga0501273_061568
1429 Ga0501035_0222077
1430 Ga0501035_0790092
1431 Ga0501035_1151900
1432 Ga0501044_0053153
1433 Ga0501044_0925092
1434 Ga0501044_1382516
1435 nmdc:mga03683_369814_c1
1436 nmdc:mga03n38_34587_c1
1437 nmdc:mga00v17_282_c1
1438 nmdc:mga0k408_241688_c1
1439 nmdc:mga0k408_58819_c1
1440 nmdc:mga06z11_352155_c1
1441 nmdc:mga07m45_151253_c1
1442 nmdc:mga07m45_21610_c1
1443 nmdc:mga07m45_2401_c1
1444 Ga0500635_0000080
1445 Ga0500635_0161421
1446 Ga0500578_0001330
1447 Ga0500578_0064139
1448 Ga0500643_004128
1449 Ga0500643_008375
1450 Ga0500643_012178
1451 Ga0500643_018221
1452 Ga0500643_045349
1453 Ga0500644_0000817
1454 Ga0500646_0173628
1455 Ga0500583_0112149
1456 Ga0500651_0043669
1457 Ga0500566_0025410
1458 Ga0500641_0000989
1459 Ga0500641_0033355
1460 Ga0500641_0109676
1461 Ga0500650_0129974
1462 Ga0500554_004309
1463 Ga0500555_006512
1464 Ga0500555_092589
1465 Ga0500556_0001038
1466 Ga0500556_0004885
1467 Ga0500556_0158860
1468 Ga0500557_234064
1469 Ga0500562_000175
1470 Ga0500562_000192
1471 Ga0500562_001492
1472 Ga0500562_008146
1473 Ga0500569_003741
1474 Ga0500572_019183
1475 Ga0500594_0000343
1476 Ga0500595_026812
1477 Ga0500595_094612
1478 Ga0500608_020849
1479 Ga0500614_021326
1480 Ga0500614_042601
1481 Ga0500618_000305
1482 Ga0500642_0218173
1483 Ga0500652_268592
1484 Ga0500658_0010384
1485 Ga0500559_0000002
1486 Ga0500559_0000008
1487 Ga0500559_0005600
1488 Ga0500559_0009234
1489 Ga0500564_008131
1490 Ga0500564_386497
1491 Ga0500568_0079455
1492 Ga0500590_086804
1493 Ga0500604_0257349
1494 Ga0500616_0019532
1495 Ga0500616_0294367
1496 Ga0500616_0295944
1497 Ga0500622_0000474
1498 Ga0500622_0014049
1499 Ga0500622_0187530
1500 Ga0500622_0217929
1501 Ga0500627_0028327
1502 Ga0500633_0272677
1503 Ga0500639_110398
1504 Ga0500639_288500
1505 Ga0500636_0008561
1506 Ga0500637_0002594
1507 Ga0500637_0490844
1508 Ga0500576_083852
1509 Ga0500645_000703
1510 Ga0500645_002828
1511 Ga0500645_004887
1512 Ga0500645_034505
1513 Ga0500609_000232
1514 Ga0500596_003387
1515 Ga0587091_214748
1516 2511123526
1517 2585150209
1518 2585153243
1519 2585196932
1520 2643748822
1521 2643778978
1522 2643923392
1523 2643930059
1524 2644001985
1525 2644085366
1526 2644342918
1527 2644366218
1528 2644509576
1529 2792463656
1530 2819539275
1531 2819648210
1532 2843748449
1533 2849562354
1534 2849574595
1535 2851155037
1536 2898330064

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xdp-assembly1.cif.gz_A-2 crystal structure of the tudor domain of human jmjd2c 0.6351 98 123
2mam-assembly1.cif.gz_A solution structure of the interdigitated double tudor domain of rbbp1 0.6053 92 122
3ge2-assembly1.cif.gz_A-2 crystal structure of putative lipoprotein sp_0198 from streptococcus pneumoniae 0.5657 5 116
5cyb-assembly1.cif.gz_A-2 structure of a lipocalin lipoprotein affecting virulence in streptococcus pneumoniae 0.5505 22 116
3f6z-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa mlic in complex with hen egg white lysozyme 0.5409 3 117
ID Description Score Start End Superfamily
af_A0A1D6PZ26_96_197_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.6133 99 120 3.10.330.10
af_Q54GX5_101_179_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.6088 100 122 3.10.330.10
2gfaA02 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.5564 98 118 3.10.330.70
af_Q22146_6_124_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.5554 51 78 3.30.505.10
af_Q59037_3_203_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5326 24 84 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4R6RBY9-F1-model_v4 Uncharacterized protein 0.9413 3 123
AF-A0A7C1MNV7-F1-model_v4 deleted 0.9324 1 123
AF-A0A290MIP1-F1-model_v4 Uncharacterized protein 0.932 1 123
AF-A0A2W5WZJ2-F1-model_v4 Uncharacterized protein 0.9317 1 123
AF-A0A0P0NZK2-F1-model_v4 Uncharacterized protein 0.9272 1 123

Map