F479961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 768 | 356 | 1536 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0003803|Ga0495638_0003803_4623_5000 |
| Length | 119 |
| Sequence | MSLSRIVMRLARNPGTEFAGGDDHRGYALTAPLTADGHLDEAAYAKAKASCSVRRFAPDEDAVDGKLARKGARWFFDYDDEPVHRLGEHRFALGEYVTVTDEDGRPLTYKVMEVVQVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 192 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 295 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 296 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 297 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 299 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 300 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 301 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 305 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 308 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 309 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 310 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 312 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 313 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 315 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 318 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 326 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 328 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 331 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 335 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 337 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 338 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 339 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 340 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 341 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 342 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 343 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 344 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 345 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 346 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 347 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 348 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 349 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 350 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 351 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 352 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 353 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 354 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 355 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 356 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.01 |
| Metatranscriptomes | 0.26 |
| Isolates | 2.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.49 |
| Nodule | 0.26 |
| Rhizoplane | 4.04 |
| Rhizosphere | 73.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0003803 | 3300046460 | Bacteria | 11723 |
| 2 | JGI25153J46596_10042631 | 3300003215 | Bacteria | 1383 |
| 3 | rootL2_10016434 | 3300003322 | Bacteria | 1751 |
| 4 | rootL2_10228638 | 3300003322 | Bacteria | 1585 |
| 5 | Ga0055526_1039481 | 3300003771 | Bacteria | 1202 |
| 6 | Ga0055537_1000562 | 3300003773 | Bacteria | 20988 |
| 7 | Ga0055524_1007120 | 3300003775 | Bacteria | 4790 |
| 8 | Ga0055528_1086361 | 3300003790 | Bacteria | 543 |
| 9 | Ga0055530_10002586 | 3300003791 | Bacteria | 11478 |
| 10 | Ga0055531_10005697 | 3300003794 | Bacteria | 7228 |
| 11 | Ga0055531_10017988 | 3300003794 | Bacteria | 2947 |
| 12 | Ga0055531_10024083 | 3300003794 | Bacteria | 2258 |
| 13 | Ga0055543_1031655 | 3300004625 | Bacteria | 922 |
| 14 | Ga0065165_1000307 | 3300005262 | Bacteria | 80513 |
| 15 | Ga0065165_1002473 | 3300005262 | Bacteria | 15542 |
| 16 | Ga0070658_10098394 | 3300005327 | Bacteria | 2416 |
| 17 | Ga0070658_10310792 | 3300005327 | Bacteria | 1345 |
| 18 | Ga0070683_100816795 | 3300005329 | Bacteria | 894 |
| 19 | Ga0070683_101085257 | 3300005329 | Bacteria | 769 |
| 20 | Ga0070690_100715853 | 3300005330 | Bacteria | 770 |
| 21 | Ga0070670_100000128 | 3300005331 | Bacteria | 71585 |
| 22 | Ga0070670_100062321 | 3300005331 | Bacteria | 3202 |
| 23 | Ga0070670_100092753 | 3300005331 | Bacteria | 2597 |
| 24 | Ga0070670_100112931 | 3300005331 | Bacteria | 2342 |
| 25 | Ga0070670_100406173 | 3300005331 | Bacteria | 1203 |
| 26 | Ga0070666_10060179 | 3300005335 | Bacteria | 2570 |
| 27 | Ga0070666_10066785 | 3300005335 | Bacteria | 2441 |
| 28 | Ga0070666_11214892 | 3300005335 | Bacteria | 562 |
| 29 | Ga0070680_100064204 | 3300005336 | Bacteria | 3009 |
| 30 | Ga0070680_100259869 | 3300005336 | Bacteria | 1469 |
| 31 | Ga0070680_100547686 | 3300005336 | Bacteria | 991 |
| 32 | Ga0070682_100081869 | 3300005337 | Bacteria | 2091 |
| 33 | Ga0070682_101197347 | 3300005337 | Bacteria | 641 |
| 34 | Ga0068868_100212289 | 3300005338 | Bacteria | 1618 |
| 35 | Ga0070660_101326635 | 3300005339 | Bacteria | 611 |
| 36 | Ga0070689_101518801 | 3300005340 | Bacteria | 607 |
| 37 | Ga0070691_10044451 | 3300005341 | Bacteria | 2106 |
| 38 | Ga0070661_100973990 | 3300005344 | Bacteria | 703 |
| 39 | Ga0070668_100000195 | 3300005347 | Bacteria | 39719 |
| 40 | Ga0070668_100003161 | 3300005347 | Bacteria | 12135 |
| 41 | Ga0070668_100004647 | 3300005347 | Bacteria | 10172 |
| 42 | Ga0070668_100036004 | 3300005347 | Bacteria | 3777 |
| 43 | Ga0070668_100102873 | 3300005347 | Bacteria | 2265 |
| 44 | Ga0070669_100001021 | 3300005353 | Bacteria | 20402 |
| 45 | Ga0070669_101357827 | 3300005353 | Bacteria | 616 |
| 46 | Ga0070671_100000895 | 3300005355 | Bacteria | 21726 |
| 47 | Ga0070671_100031377 | 3300005355 | Bacteria | 4389 |
| 48 | Ga0070671_100253576 | 3300005355 | Bacteria | 1495 |
| 49 | Ga0070671_100657676 | 3300005355 | Bacteria | 907 |
| 50 | Ga0070673_101614276 | 3300005364 | Bacteria | 613 |
| 51 | Ga0070688_100432844 | 3300005365 | Bacteria | 980 |
| 52 | Ga0070659_100534103 | 3300005366 | Bacteria | 1003 |
| 53 | Ga0070659_100731711 | 3300005366 | Bacteria | 857 |
| 54 | Ga0070667_100000169 | 3300005367 | Bacteria | 81539 |
| 55 | Ga0070667_100005053 | 3300005367 | Bacteria | 11038 |
| 56 | Ga0070667_100013278 | 3300005367 | Bacteria | 6804 |
| 57 | Ga0070667_100047472 | 3300005367 | Bacteria | 3613 |
| 58 | Ga0070667_102231723 | 3300005367 | Bacteria | 516 |
| 59 | Ga0070678_100281299 | 3300005456 | Bacteria | 1407 |
| 60 | Ga0070662_100236987 | 3300005457 | Bacteria | 1462 |
| 61 | Ga0070662_100239480 | 3300005457 | Bacteria | 1455 |
| 62 | Ga0070681_10076249 | 3300005458 | Bacteria | 3312 |
| 63 | Ga0070681_10102405 | 3300005458 | Bacteria | 2808 |
| 64 | Ga0070681_10858063 | 3300005458 | Bacteria | 826 |
| 65 | Ga0068867_100302549 | 3300005459 | Bacteria | 1319 |
| 66 | Ga0070685_11508223 | 3300005466 | Bacteria | 518 |
| 67 | Ga0070698_100379032 | 3300005471 | Bacteria | 1347 |
| 68 | Ga0070679_100027525 | 3300005530 | Bacteria | 5597 |
| 69 | Ga0070679_100559566 | 3300005530 | Bacteria | 1087 |
| 70 | Ga0068853_100019157 | 3300005539 | Bacteria | 5672 |
| 71 | Ga0068853_100113633 | 3300005539 | Bacteria | 2408 |
| 72 | Ga0068853_100386290 | 3300005539 | Unclassified | 1308 |
| 73 | Ga0068853_100535990 | 3300005539 | Bacteria | 1108 |
| 74 | Ga0068853_100931822 | 3300005539 | Bacteria | 835 |
| 75 | Ga0068853_102479138 | 3300005539 | Bacteria | 502 |
| 76 | Ga0070686_100939036 | 3300005544 | Bacteria | 706 |
| 77 | Ga0070665_100001054 | 3300005548 | Bacteria | 34499 |
| 78 | Ga0070665_100001083 | 3300005548 | Bacteria | 33888 |
| 79 | Ga0070665_100044661 | 3300005548 | Bacteria | 4450 |
| 80 | Ga0070665_100256442 | 3300005548 | Bacteria | 1750 |
| 81 | Ga0070665_102516549 | 3300005548 | Bacteria | 516 |
| 82 | Ga0068855_100010008 | 3300005563 | Bacteria | 11426 |
| 83 | Ga0068855_100044699 | 3300005563 | Bacteria | 5241 |
| 84 | Ga0068855_100133055 | 3300005563 | Bacteria | 2839 |
| 85 | Ga0068855_100146973 | 3300005563 | Bacteria | 2682 |
| 86 | Ga0068855_101551458 | 3300005563 | Bacteria | 679 |
| 87 | Ga0068855_102088162 | 3300005563 | Bacteria | 571 |
| 88 | Ga0070664_101397306 | 3300005564 | Bacteria | 662 |
| 89 | Ga0068857_100653216 | 3300005577 | Bacteria | 997 |
| 90 | Ga0068854_100083216 | 3300005578 | Bacteria | 2366 |
| 91 | Ga0068854_100264202 | 3300005578 | Bacteria | 1379 |
| 92 | Ga0068856_100236821 | 3300005614 | Bacteria | 1841 |
| 93 | Ga0068856_100613248 | 3300005614 | Bacteria | 1109 |
| 94 | Ga0068859_100000407 | 3300005617 | Bacteria | 42783 |
| 95 | Ga0068859_100243535 | 3300005617 | Bacteria | 1888 |
| 96 | Ga0068859_100282802 | 3300005617 | Bacteria | 1752 |
| 97 | Ga0068859_101193542 | 3300005617 | Bacteria | 838 |
| 98 | Ga0068859_103134958 | 3300005617 | Bacteria | 504 |
| 99 | Ga0068864_100000561 | 3300005618 | Bacteria | 31782 |
| 100 | Ga0068864_100012687 | 3300005618 | Bacteria | 6966 |
| 101 | Ga0068864_100045946 | 3300005618 | Bacteria | 3746 |
| 102 | Ga0068864_100155113 | 3300005618 | Bacteria | 2078 |
| 103 | Ga0068864_100846805 | 3300005618 | Bacteria | 901 |
| 104 | Ga0068864_101603112 | 3300005618 | Bacteria | 655 |
| 105 | Ga0068864_102713859 | 3300005618 | Bacteria | 501 |
| 106 | Ga0068866_10801407 | 3300005718 | Bacteria | 655 |
| 107 | Ga0068861_100065578 | 3300005719 | Bacteria | 2797 |
| 108 | Ga0068863_100000101 | 3300005841 | Bacteria | 92384 |
| 109 | Ga0068863_100002206 | 3300005841 | Bacteria | 19342 |
| 110 | Ga0068863_100005153 | 3300005841 | Bacteria | 12895 |
| 111 | Ga0068863_100040434 | 3300005841 | Bacteria | 4434 |
| 112 | Ga0068863_100182680 | 3300005841 | Bacteria | 2013 |
| 113 | Ga0068863_100760766 | 3300005841 | Bacteria | 965 |
| 114 | Ga0068858_100001173 | 3300005842 | Bacteria | 27188 |
| 115 | Ga0068858_100003917 | 3300005842 | Bacteria | 14706 |
| 116 | Ga0068858_100169945 | 3300005842 | Bacteria | 2055 |
| 117 | Ga0068858_100240703 | 3300005842 | Bacteria | 1717 |
| 118 | Ga0068860_100000055 | 3300005843 | Bacteria | 203538 |
| 119 | Ga0068860_100000211 | 3300005843 | Bacteria | 91286 |
| 120 | Ga0068860_100019283 | 3300005843 | Bacteria | 6620 |
| 121 | Ga0068860_100450733 | 3300005843 | Bacteria | 1279 |
| 122 | Ga0068862_100002104 | 3300005844 | Bacteria | 17946 |
| 123 | Ga0068862_100004288 | 3300005844 | Bacteria | 12062 |
| 124 | Ga0068862_100007104 | 3300005844 | Bacteria | 9300 |
| 125 | Ga0068862_100259448 | 3300005844 | Bacteria | 1586 |
| 126 | Ga0068862_100515922 | 3300005844 | Bacteria | 1137 |
| 127 | Ga0070717_10078474 | 3300006028 | Bacteria | 2767 |
| 128 | Ga0070717_10188631 | 3300006028 | Bacteria | 1800 |
| 129 | Ga0075365_10124544 | 3300006038 | Bacteria | 1780 |
| 130 | Ga0075368_10000328 | 3300006042 | Bacteria | 13906 |
| 131 | Ga0075363_100035685 | 3300006048 | Bacteria | 2604 |
| 132 | Ga0075363_100353326 | 3300006048 | Bacteria | 859 |
| 133 | Ga0075364_10001220 | 3300006051 | Bacteria | 13831 |
| 134 | Ga0075362_10042252 | 3300006177 | Bacteria | 2014 |
| 135 | Ga0075367_10000091 | 3300006178 | Bacteria | 24634 |
| 136 | Ga0075366_10160941 | 3300006195 | Unclassified | 1360 |
| 137 | Ga0075366_10349840 | 3300006195 | Bacteria | 907 |
| 138 | Ga0097621_100245349 | 3300006237 | Bacteria | 1567 |
| 139 | Ga0075370_10214311 | 3300006353 | Unclassified | 1137 |
| 140 | Ga0075370_10255984 | 3300006353 | Bacteria | 1038 |
| 141 | Ga0075370_10495532 | 3300006353 | Bacteria | 737 |
| 142 | Ga0068871_100249645 | 3300006358 | Bacteria | 1545 |
| 143 | Ga0068871_100822349 | 3300006358 | Bacteria | 857 |
| 144 | Ga0068871_101365651 | 3300006358 | Bacteria | 667 |
| 145 | Ga0068865_100000477 | 3300006881 | Bacteria | 22364 |
| 146 | Ga0097620_100000407 | 3300006931 | Bacteria | 42783 |
| 147 | Ga0097620_100243532 | 3300006931 | Bacteria | 1888 |
| 148 | Ga0097620_100282797 | 3300006931 | Bacteria | 1752 |
| 149 | Ga0097620_101193971 | 3300006931 | Bacteria | 838 |
| 150 | Ga0097620_101674984 | 3300006931 | Bacteria | 702 |
| 151 | Ga0097620_103134921 | 3300006931 | Bacteria | 504 |
| 152 | Ga0079104_1007780 | 3300006946 | Bacteria | 3829 |
| 153 | Ga0105250_10014820 | 3300009092 | Bacteria | 3197 |
| 154 | Ga0105240_10035366 | 3300009093 | Bacteria | 6439 |
| 155 | Ga0105240_10037452 | 3300009093 | Bacteria | 6234 |
| 156 | Ga0105240_10282148 | 3300009093 | Bacteria | 1907 |
| 157 | Ga0105240_11752273 | 3300009093 | Bacteria | 648 |
| 158 | Ga0105240_12329155 | 3300009093 | Bacteria | 555 |
| 159 | Ga0105245_10536640 | 3300009098 | Bacteria | 1190 |
| 160 | Ga0105245_10944948 | 3300009098 | Bacteria | 905 |
| 161 | Ga0105243_11382139 | 3300009148 | Bacteria | 724 |
| 162 | Ga0105241_10252825 | 3300009174 | Bacteria | 1495 |
| 163 | Ga0105241_10903920 | 3300009174 | Bacteria | 820 |
| 164 | Ga0105242_10150763 | 3300009176 | Bacteria | 2027 |
| 165 | Ga0105248_10000349 | 3300009177 | Bacteria | 54104 |
| 166 | Ga0105248_10004855 | 3300009177 | Bacteria | 14887 |
| 167 | Ga0105248_10008404 | 3300009177 | Bacteria | 11328 |
| 168 | Ga0105248_10011646 | 3300009177 | Bacteria | 9689 |
| 169 | Ga0105248_10027940 | 3300009177 | Bacteria | 6282 |
| 170 | Ga0105248_10637909 | 3300009177 | Bacteria | 1202 |
| 171 | Ga0105248_11186238 | 3300009177 | Bacteria | 863 |
| 172 | Ga0105248_11328574 | 3300009177 | Bacteria | 813 |
| 173 | Ga0105248_11725617 | 3300009177 | Bacteria | 710 |
| 174 | Ga0105248_12927503 | 3300009177 | Bacteria | 544 |
| 175 | Ga0105248_13246027 | 3300009177 | Bacteria | 517 |
| 176 | Ga0105248_13246035 | 3300009177 | Unclassified | 517 |
| 177 | Ga0105237_10145343 | 3300009545 | Bacteria | 2366 |
| 178 | Ga0105237_10500920 | 3300009545 | Bacteria | 1221 |
| 179 | Ga0105237_11471352 | 3300009545 | Bacteria | 688 |
| 180 | Ga0105238_10050097 | 3300009551 | Bacteria | 4205 |
| 181 | Ga0105238_10101189 | 3300009551 | Bacteria | 2864 |
| 182 | Ga0105238_10242319 | 3300009551 | Bacteria | 1781 |
| 183 | Ga0105238_10945484 | 3300009551 | Bacteria | 881 |
| 184 | Ga0105238_11203370 | 3300009551 | Bacteria | 782 |
| 185 | Ga0105249_10001588 | 3300009553 | Bacteria | 19927 |
| 186 | Ga0105249_10027976 | 3300009553 | Bacteria | 5089 |
| 187 | Ga0105249_10231313 | 3300009553 | Bacteria | 1823 |
| 188 | Ga0105249_10290865 | 3300009553 | Bacteria | 1635 |
| 189 | Ga0105249_10391632 | 3300009553 | Bacteria | 1418 |
| 190 | Ga0105249_10987913 | 3300009553 | Bacteria | 910 |
| 191 | Ga0105148_110709 | 3300009978 | Bacteria | 700 |
| 192 | Ga0105239_10476032 | 3300010375 | Bacteria | 1418 |
| 193 | Ga0105239_10695002 | 3300010375 | Bacteria | 1163 |
| 194 | Ga0105239_10858146 | 3300010375 | Bacteria | 1041 |
| 195 | Ga0105239_11348287 | 3300010375 | Bacteria | 823 |
| 196 | Ga0105239_12198955 | 3300010375 | Bacteria | 641 |
| 197 | Ga0157327_1057865 | 3300012512 | Bacteria | 570 |
| 198 | Ga0157373_10004968 | 3300013100 | Bacteria | 9993 |
| 199 | Ga0157373_10042339 | 3300013100 | Bacteria | 3255 |
| 200 | Ga0157373_10546342 | 3300013100 | Bacteria | 840 |
| 201 | Ga0157370_10077369 | 3300013104 | Bacteria | 3134 |
| 202 | Ga0157370_10202801 | 3300013104 | Bacteria | 1840 |
| 203 | Ga0157369_10216591 | 3300013105 | Bacteria | 2005 |
| 204 | Ga0157369_11225965 | 3300013105 | Bacteria | 765 |
| 205 | Ga0157374_11465330 | 3300013296 | Bacteria | 706 |
| 206 | Ga0163162_10009921 | 3300013306 | Bacteria | 9262 |
| 207 | Ga0163162_10083848 | 3300013306 | Bacteria | 3261 |
| 208 | Ga0163162_10281608 | 3300013306 | Bacteria | 1795 |
| 209 | Ga0163162_10970840 | 3300013306 | Bacteria | 960 |
| 210 | Ga0157372_10191636 | 3300013307 | Bacteria | 2368 |
| 211 | Ga0157375_10105627 | 3300013308 | Bacteria | 2907 |
| 212 | Ga0157375_10232188 | 3300013308 | Bacteria | 2004 |
| 213 | Ga0157375_10490998 | 3300013308 | Bacteria | 1392 |
| 214 | Ga0163163_10005243 | 3300014325 | Bacteria | 11177 |
| 215 | Ga0163163_10020813 | 3300014325 | Bacteria | 6184 |
| 216 | Ga0163163_10062687 | 3300014325 | Bacteria | 3685 |
| 217 | Ga0163163_10087163 | 3300014325 | Bacteria | 3132 |
| 218 | Ga0163163_10111538 | 3300014325 | Bacteria | 2764 |
| 219 | Ga0163163_10318530 | 3300014325 | Bacteria | 1609 |
| 220 | Ga0163163_10400194 | 3300014325 | Bacteria | 1431 |
| 221 | Ga0163163_11035983 | 3300014325 | Bacteria | 884 |
| 222 | Ga0163163_13266706 | 3300014325 | Bacteria | 506 |
| 223 | Ga0157380_10329337 | 3300014326 | Bacteria | 1420 |
| 224 | Ga0157380_11088495 | 3300014326 | Bacteria | 838 |
| 225 | Ga0157379_10000119 | 3300014968 | Bacteria | 54670 |
| 226 | Ga0157379_10046669 | 3300014968 | Bacteria | 3865 |
| 227 | Ga0157379_10054996 | 3300014968 | Bacteria | 3557 |
| 228 | Ga0157379_10309300 | 3300014968 | Bacteria | 1441 |
| 229 | Ga0157376_10332579 | 3300014969 | Bacteria | 1448 |
| 230 | Ga0163161_10154145 | 3300017792 | Bacteria | 1748 |
| 231 | Ga0163161_10446667 | 3300017792 | Bacteria | 1044 |
| 232 | Ga0163161_10697563 | 3300017792 | Bacteria | 845 |
| 233 | Ga0163161_11403047 | 3300017792 | Bacteria | 610 |
| 234 | Ga0206356_10375787 | 3300020070 | Bacteria | 612 |
| 235 | Ga0213876_10015560 | 3300021384 | Bacteria | 4025 |
| 236 | Ga0213876_10452455 | 3300021384 | Bacteria | 683 |
| 237 | Ga0213871_10104871 | 3300021441 | Unclassified | 831 |
| 238 | Ga0209026_1000800 | 3300025250 | Bacteria | 17123 |
| 239 | Ga0209026_1010961 | 3300025250 | Bacteria | 1660 |
| 240 | Ga0209565_1000414 | 3300025263 | Bacteria | 35246 |
| 241 | Ga0209673_1001567 | 3300025273 | Bacteria | 20402 |
| 242 | Ga0209673_1071722 | 3300025273 | Bacteria | 822 |
| 243 | Ga0209564_1002030 | 3300025295 | Bacteria | 17560 |
| 244 | Ga0209564_1063882 | 3300025295 | Bacteria | 806 |
| 245 | Ga0209758_1002163 | 3300025297 | Bacteria | 20648 |
| 246 | Ga0209758_1002287 | 3300025297 | Bacteria | 19832 |
| 247 | Ga0209050_1000031 | 3300025298 | Bacteria | 458181 |
| 248 | Ga0209256_1003858 | 3300025299 | Bacteria | 9990 |
| 249 | Ga0209256_1003966 | 3300025299 | Bacteria | 9729 |
| 250 | Ga0209256_1018510 | 3300025299 | Bacteria | 2259 |
| 251 | Ga0209257_1000073 | 3300025304 | Bacteria | 325833 |
| 252 | Ga0209257_1001335 | 3300025304 | Bacteria | 29946 |
| 253 | Ga0209257_1005089 | 3300025304 | Bacteria | 9548 |
| 254 | Ga0207642_11007266 | 3300025899 | Bacteria | 537 |
| 255 | Ga0207710_10333975 | 3300025900 | Bacteria | 770 |
| 256 | Ga0207710_10508737 | 3300025900 | Bacteria | 625 |
| 257 | Ga0207680_10150917 | 3300025903 | Bacteria | 1549 |
| 258 | Ga0207680_10665123 | 3300025903 | Bacteria | 746 |
| 259 | Ga0207705_10086832 | 3300025909 | Bacteria | 2287 |
| 260 | Ga0207705_11085855 | 3300025909 | Bacteria | 617 |
| 261 | Ga0207705_11318851 | 3300025909 | Bacteria | 551 |
| 262 | Ga0207654_10309401 | 3300025911 | Bacteria | 1077 |
| 263 | Ga0207707_10067008 | 3300025912 | Bacteria | 3127 |
| 264 | Ga0207707_10449929 | 3300025912 | Bacteria | 1102 |
| 265 | Ga0207695_10002249 | 3300025913 | Bacteria | 28926 |
| 266 | Ga0207695_10008692 | 3300025913 | Bacteria | 12667 |
| 267 | Ga0207695_10033670 | 3300025913 | Bacteria | 5583 |
| 268 | Ga0207695_10135991 | 3300025913 | Bacteria | 2411 |
| 269 | Ga0207695_10150535 | 3300025913 | Bacteria | 2266 |
| 270 | Ga0207671_10161924 | 3300025914 | Bacteria | 1733 |
| 271 | Ga0207671_10492685 | 3300025914 | Bacteria | 977 |
| 272 | Ga0207660_10029717 | 3300025917 | Bacteria | 3752 |
| 273 | Ga0207660_10071525 | 3300025917 | Bacteria | 2524 |
| 274 | Ga0207660_10181127 | 3300025917 | Bacteria | 1636 |
| 275 | Ga0207652_10453961 | 3300025921 | Bacteria | 1155 |
| 276 | Ga0207652_11344565 | 3300025921 | Bacteria | 617 |
| 277 | Ga0207681_10251082 | 3300025923 | Bacteria | 1381 |
| 278 | Ga0207681_10270614 | 3300025923 | Bacteria | 1333 |
| 279 | Ga0207694_10008305 | 3300025924 | Bacteria | 7849 |
| 280 | Ga0207694_10210591 | 3300025924 | Bacteria | 1583 |
| 281 | Ga0207694_10447889 | 3300025924 | Bacteria | 1077 |
| 282 | Ga0207650_10000315 | 3300025925 | Bacteria | 47489 |
| 283 | Ga0207650_10025870 | 3300025925 | Bacteria | 4183 |
| 284 | Ga0207650_10071259 | 3300025925 | Bacteria | 2614 |
| 285 | Ga0207650_10139026 | 3300025925 | Bacteria | 1908 |
| 286 | Ga0207650_11655895 | 3300025925 | Unclassified | 543 |
| 287 | Ga0207644_10000679 | 3300025931 | Bacteria | 21492 |
| 288 | Ga0207644_10056731 | 3300025931 | Bacteria | 2827 |
| 289 | Ga0207644_10080330 | 3300025931 | Bacteria | 2408 |
| 290 | Ga0207644_10464985 | 3300025931 | Unclassified | 1040 |
| 291 | Ga0207644_11505943 | 3300025931 | Bacteria | 565 |
| 292 | Ga0207690_10609643 | 3300025932 | Bacteria | 892 |
| 293 | Ga0207706_10229506 | 3300025933 | Bacteria | 1624 |
| 294 | Ga0207706_10297511 | 3300025933 | Bacteria | 1406 |
| 295 | Ga0207686_10063811 | 3300025934 | Bacteria | 2344 |
| 296 | Ga0207670_11247722 | 3300025936 | Bacteria | 630 |
| 297 | Ga0207669_10736863 | 3300025937 | Bacteria | 813 |
| 298 | Ga0207704_10001880 | 3300025938 | Bacteria | 9398 |
| 299 | Ga0207704_11507440 | 3300025938 | Bacteria | 577 |
| 300 | Ga0207711_10003417 | 3300025941 | Bacteria | 13735 |
| 301 | Ga0207711_10005865 | 3300025941 | Bacteria | 10370 |
| 302 | Ga0207711_10006591 | 3300025941 | Bacteria | 9775 |
| 303 | Ga0207711_10026071 | 3300025941 | Bacteria | 4903 |
| 304 | Ga0207711_10100590 | 3300025941 | Bacteria | 2557 |
| 305 | Ga0207711_10221443 | 3300025941 | Bacteria | 1731 |
| 306 | Ga0207711_10385808 | 3300025941 | Bacteria | 1300 |
| 307 | Ga0207711_10887056 | 3300025941 | Bacteria | 829 |
| 308 | Ga0207711_11370403 | 3300025941 | Bacteria | 650 |
| 309 | Ga0207711_11652685 | 3300025941 | Bacteria | 584 |
| 310 | Ga0207711_11997950 | 3300025941 | Bacteria | 523 |
| 311 | Ga0207689_11005179 | 3300025942 | Bacteria | 703 |
| 312 | Ga0207679_10134411 | 3300025945 | Bacteria | 1989 |
| 313 | Ga0207667_10041076 | 3300025949 | Bacteria | 4920 |
| 314 | Ga0207667_10086365 | 3300025949 | Bacteria | 3246 |
| 315 | Ga0207667_10648781 | 3300025949 | Bacteria | 1061 |
| 316 | Ga0207667_11424947 | 3300025949 | Bacteria | 666 |
| 317 | Ga0207651_10013365 | 3300025960 | Bacteria | 4697 |
| 318 | Ga0207712_10010595 | 3300025961 | Bacteria | 5853 |
| 319 | Ga0207712_10244894 | 3300025961 | Bacteria | 1446 |
| 320 | Ga0207712_11070299 | 3300025961 | Bacteria | 717 |
| 321 | Ga0207668_10000007 | 3300025972 | Bacteria | 190613 |
| 322 | Ga0207668_10001472 | 3300025972 | Bacteria | 13802 |
| 323 | Ga0207668_10015771 | 3300025972 | Bacteria | 4701 |
| 324 | Ga0207668_10034342 | 3300025972 | Bacteria | 3367 |
| 325 | Ga0207668_10037884 | 3300025972 | Bacteria | 3231 |
| 326 | Ga0207668_10047510 | 3300025972 | Bacteria | 2939 |
| 327 | Ga0207640_10027977 | 3300025981 | Bacteria | 3441 |
| 328 | Ga0207640_10081298 | 3300025981 | Bacteria | 2215 |
| 329 | Ga0207640_11872869 | 3300025981 | Bacteria | 543 |
| 330 | Ga0207658_10000052 | 3300025986 | Bacteria | 128748 |
| 331 | Ga0207658_10008069 | 3300025986 | Bacteria | 7174 |
| 332 | Ga0207658_10031797 | 3300025986 | Bacteria | 3751 |
| 333 | Ga0207658_10881350 | 3300025986 | Bacteria | 814 |
| 334 | Ga0207658_11113029 | 3300025986 | Bacteria | 721 |
| 335 | Ga0207703_10000105 | 3300026035 | Bacteria | 99702 |
| 336 | Ga0207703_10002806 | 3300026035 | Bacteria | 14880 |
| 337 | Ga0207703_10061871 | 3300026035 | Bacteria | 3066 |
| 338 | Ga0207703_10217781 | 3300026035 | Bacteria | 1705 |
| 339 | Ga0207703_11039509 | 3300026035 | Bacteria | 786 |
| 340 | Ga0207703_11224539 | 3300026035 | Bacteria | 722 |
| 341 | Ga0207639_10014437 | 3300026041 | Bacteria | 5556 |
| 342 | Ga0207639_10028144 | 3300026041 | Bacteria | 4101 |
| 343 | Ga0207639_10412905 | 3300026041 | Bacteria | 1219 |
| 344 | Ga0207639_10455204 | 3300026041 | Bacteria | 1162 |
| 345 | Ga0207678_10335464 | 3300026067 | Bacteria | 1302 |
| 346 | Ga0207702_10155204 | 3300026078 | Bacteria | 2086 |
| 347 | Ga0207702_10322746 | 3300026078 | Bacteria | 1471 |
| 348 | Ga0207702_11615397 | 3300026078 | Bacteria | 641 |
| 349 | Ga0207641_10000160 | 3300026088 | Bacteria | 95407 |
| 350 | Ga0207641_10002888 | 3300026088 | Bacteria | 15554 |
| 351 | Ga0207641_10006166 | 3300026088 | Bacteria | 10145 |
| 352 | Ga0207641_10081699 | 3300026088 | Bacteria | 2807 |
| 353 | Ga0207641_10280872 | 3300026088 | Bacteria | 1566 |
| 354 | Ga0207641_10412260 | 3300026088 | Bacteria | 1299 |
| 355 | Ga0207641_10469405 | 3300026088 | Bacteria | 1218 |
| 356 | Ga0207641_11804163 | 3300026088 | Bacteria | 613 |
| 357 | Ga0207641_12325624 | 3300026088 | Bacteria | 535 |
| 358 | Ga0207648_11425932 | 3300026089 | Bacteria | 651 |
| 359 | Ga0207676_10000159 | 3300026095 | Bacteria | 59242 |
| 360 | Ga0207676_10000380 | 3300026095 | Bacteria | 37876 |
| 361 | Ga0207676_10003296 | 3300026095 | Bacteria | 11468 |
| 362 | Ga0207676_10035485 | 3300026095 | Bacteria | 3785 |
| 363 | Ga0207676_10338954 | 3300026095 | Bacteria | 1386 |
| 364 | Ga0207676_10445614 | 3300026095 | Bacteria | 1219 |
| 365 | Ga0207676_10656423 | 3300026095 | Bacteria | 1013 |
| 366 | Ga0207676_11351527 | 3300026095 | Bacteria | 708 |
| 367 | Ga0207676_11689004 | 3300026095 | Bacteria | 631 |
| 368 | Ga0207674_10342257 | 3300026116 | Bacteria | 1446 |
| 369 | Ga0207675_100192443 | 3300026118 | Bacteria | 1957 |
| 370 | Ga0207675_100982575 | 3300026118 | Bacteria | 862 |
| 371 | Ga0207683_10233188 | 3300026121 | Bacteria | 1679 |
| 372 | Ga0207683_10380674 | 3300026121 | Bacteria | 1297 |
| 373 | Ga0207698_11183579 | 3300026142 | Bacteria | 778 |
| 374 | Ga0207698_11869394 | 3300026142 | Bacteria | 615 |
| 375 | Ga0207698_12605326 | 3300026142 | Bacteria | 515 |
| 376 | Ga0209281_1013319 | 3300027111 | Bacteria | 1779 |
| 377 | Ga0209981_1008629 | 3300027378 | Bacteria | 1384 |
| 378 | Ga0209999_1007104 | 3300027543 | Bacteria | 2014 |
| 379 | Ga0209813_10022309 | 3300027866 | Bacteria | 1789 |
| 380 | Ga0268266_10002189 | 3300028379 | Bacteria | 21374 |
| 381 | Ga0268266_10056945 | 3300028379 | Bacteria | 3362 |
| 382 | Ga0268266_10111835 | 3300028379 | Bacteria | 2420 |
| 383 | Ga0268266_10244847 | 3300028379 | Bacteria | 1656 |
| 384 | Ga0268265_10001929 | 3300028380 | Bacteria | 16463 |
| 385 | Ga0268265_10003935 | 3300028380 | Bacteria | 10465 |
| 386 | Ga0268265_10008280 | 3300028380 | Bacteria | 7024 |
| 387 | Ga0268265_10030008 | 3300028380 | Bacteria | 3912 |
| 388 | Ga0268265_10120518 | 3300028380 | Bacteria | 2160 |
| 389 | Ga0268265_10228304 | 3300028380 | Bacteria | 1634 |
| 390 | Ga0268265_11336730 | 3300028380 | Bacteria | 717 |
| 391 | Ga0268265_12620744 | 3300028380 | Bacteria | 510 |
| 392 | Ga0268264_10000112 | 3300028381 | Bacteria | 203742 |
| 393 | Ga0268264_10000270 | 3300028381 | Bacteria | 90954 |
| 394 | Ga0268264_10011304 | 3300028381 | Bacteria | 7374 |
| 395 | Ga0268264_10378392 | 3300028381 | Bacteria | 1355 |
| 396 | Ga0268264_11114257 | 3300028381 | Bacteria | 798 |
| 397 | Ga0265334_10006729 | 3300028573 | Bacteria | 4937 |
| 398 | Ga0307517_10013485 | 3300028786 | Bacteria | 11088 |
| 399 | Ga0307517_10168146 | 3300028786 | Bacteria | 1450 |
| 400 | Ga0307517_10244709 | 3300028786 | Bacteria | 1060 |
| 401 | Ga0307515_10058050 | 3300028794 | Bacteria | 5584 |
| 402 | Ga0307515_10064837 | 3300028794 | Bacteria | 5100 |
| 403 | Ga0307515_10128770 | 3300028794 | Bacteria | 2804 |
| 404 | Ga0265338_10022804 | 3300028800 | Bacteria | 6463 |
| 405 | Ga0265338_10026523 | 3300028800 | Bacteria | 5841 |
| 406 | Ga0307511_10052739 | 3300030521 | Bacteria | 3236 |
| 407 | Ga0265339_10467342 | 3300031249 | Bacteria | 584 |
| 408 | Ga0265331_10369690 | 3300031250 | Bacteria | 642 |
| 409 | Ga0265327_10000337 | 3300031251 | Bacteria | 89213 |
| 410 | Ga0307513_10000082 | 3300031456 | Bacteria | 131779 |
| 411 | Ga0307513_10002784 | 3300031456 | Bacteria | 24017 |
| 412 | Ga0307513_10003048 | 3300031456 | Bacteria | 22854 |
| 413 | Ga0307513_10004685 | 3300031456 | Bacteria | 18196 |
| 414 | Ga0307513_10350587 | 3300031456 | Bacteria | 1224 |
| 415 | Ga0307513_10864537 | 3300031456 | Bacteria | 611 |
| 416 | Ga0307408_100839864 | 3300031548 | Bacteria | 837 |
| 417 | Ga0307408_100863080 | 3300031548 | Bacteria | 826 |
| 418 | Ga0307408_101536506 | 3300031548 | Bacteria | 630 |
| 419 | Ga0307408_101783547 | 3300031548 | Bacteria | 588 |
| 420 | Ga0265314_10161642 | 3300031711 | Bacteria | 1362 |
| 421 | Ga0307405_10440912 | 3300031731 | Bacteria | 1030 |
| 422 | Ga0307405_10483447 | 3300031731 | Bacteria | 989 |
| 423 | Ga0307405_10952091 | 3300031731 | Bacteria | 730 |
| 424 | Ga0307413_10195283 | 3300031824 | Bacteria | 1456 |
| 425 | Ga0307410_11402825 | 3300031852 | Bacteria | 613 |
| 426 | Ga0307406_10710809 | 3300031901 | Bacteria | 840 |
| 427 | Ga0307412_10911059 | 3300031911 | Bacteria | 771 |
| 428 | Ga0307412_11228432 | 3300031911 | Bacteria | 672 |
| 429 | Ga0307412_11499981 | 3300031911 | Bacteria | 613 |
| 430 | Ga0307416_101669999 | 3300032002 | Bacteria | 742 |
| 431 | Ga0307416_103876817 | 3300032002 | Bacteria | 501 |
| 432 | Ga0307414_10116546 | 3300032004 | Bacteria | 2045 |
| 433 | Ga0307414_11006823 | 3300032004 | Bacteria | 767 |
| 434 | Ga0307411_12250419 | 3300032005 | Bacteria | 512 |
| 435 | Ga0307415_101424359 | 3300032126 | Bacteria | 660 |
| 436 | Ga0307415_101506806 | 3300032126 | Bacteria | 644 |
| 437 | Ga0307415_101922603 | 3300032126 | Bacteria | 575 |
| 438 | Ga0307510_10002252 | 3300033180 | Bacteria | 21803 |
| 439 | Ga0373926_0147979 | 3300035083 | Bacteria | 893 |
| 440 | Ga0373944_0000508 | 3300035089 | Bacteria | 9065 |
| 441 | Ga0373936_0030197 | 3300035113 | Bacteria | 2137 |
| 442 | Ga0373939_0530429 | 3300035114 | Bacteria | 506 |
| 443 | Ga0373943_0289786 | 3300035170 | Bacteria | 927 |
| 444 | Ga0373943_0303427 | 3300035170 | Bacteria | 907 |
| 445 | Ga0373946_0010569 | 3300035171 | Bacteria | 3420 |
| 446 | Ga0373931_0309650 | 3300035691 | Bacteria | 978 |
| 447 | Ga0373931_1063466 | 3300035691 | Bacteria | 550 |
| 448 | Ga0373927_0000296 | 3300035695 | Bacteria | 39241 |
| 449 | Ga0373927_1173864 | 3300035695 | Bacteria | 506 |
| 450 | Ga0373933_0247198 | 3300035724 | Bacteria | 1148 |
| 451 | Ga0373947_0211836 | 3300035725 | Unclassified | 1271 |
| 452 | Ga0373937_0367025 | 3300036401 | Bacteria | 1365 |
| 453 | Ga0373937_0922129 | 3300036401 | Unclassified | 822 |
| 454 | Ga0373925_0000022 | 3300037068 | Bacteria | 160046 |
| 455 | Ga0373925_0292279 | 3300037068 | Bacteria | 1314 |
| 456 | Ga0395899_0000557 | 3300037312 | Bacteria | 40072 |
| 457 | Ga0395899_0140831 | 3300037312 | Bacteria | 1716 |
| 458 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 459 | Ga0395900_0061996 | 3300037418 | Bacteria | 3844 |
| 460 | Ga0395900_1155110 | 3300037418 | Bacteria | 690 |
| 461 | Ga0395898_0018674 | 3300037466 | Bacteria | 7068 |
| 462 | Ga0395898_0042837 | 3300037466 | Bacteria | 4464 |
| 463 | Ga0395898_0313443 | 3300037466 | Bacteria | 1497 |
| 464 | Ga0395905_0006948 | 3300037471 | Bacteria | 11310 |
| 465 | Ga0395905_0163759 | 3300037471 | Bacteria | 2090 |
| 466 | Ga0395905_0177779 | 3300037471 | Bacteria | 1998 |
| 467 | Ga0395905_0299487 | 3300037471 | Bacteria | 1495 |
| 468 | Ga0395905_0309141 | 3300037471 | Bacteria | 1469 |
| 469 | Ga0395905_0876788 | 3300037471 | Bacteria | 800 |
| 470 | Ga0395905_0929335 | 3300037471 | Bacteria | 773 |
| 471 | Ga0395905_1337229 | 3300037471 | Bacteria | 620 |
| 472 | Ga0395905_1571292 | 3300037471 | Bacteria | 562 |
| 473 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 474 | Ga0395901_0295838 | 3300038443 | Bacteria | 1679 |
| 475 | Ga0395901_0729909 | 3300038443 | Bacteria | 985 |
| 476 | Ga0395901_1269057 | 3300038443 | Bacteria | 699 |
| 477 | Ga0395901_1506912 | 3300038443 | Bacteria | 628 |
| 478 | Ga0436365_0233204 | 3300039437 | Bacteria | 633 |
| 479 | Ga0436365_0235294 | 3300039437 | Bacteria | 2381 |
| 480 | Ga0436365_0988854 | 3300039437 | Bacteria | 4957 |
| 481 | Ga0436365_1177820 | 3300039437 | Bacteria | 814 |
| 482 | Ga0436365_1288496 | 3300039437 | Bacteria | 5067 |
| 483 | Ga0436362_1173452 | 3300039453 | Bacteria | 638 |
| 484 | Ga0439465_0053654 | 3300041413 | Bacteria | 1325 |
| 485 | Ga0451789_0641556 | 3300041443 | Bacteria | 589 |
| 486 | Ga0451795_0636755 | 3300041456 | Bacteria | 506 |
| 487 | Ga0451841_1329338 | 3300041498 | Bacteria | 578 |
| 488 | Ga0439431_0055230 | 3300041997 | Bacteria | 1037 |
| 489 | Ga0439445_0109697 | 3300042004 | Bacteria | 787 |
| 490 | Ga0439446_0006467 | 3300042156 | Bacteria | 3056 |
| 491 | Ga0466965_0343402 | 3300044683 | Bacteria | 816 |
| 492 | Ga0466966_0536961 | 3300044684 | Bacteria | 704 |
| 493 | Ga0466961_0468260 | 3300044693 | Bacteria | 762 |
| 494 | Ga0453684_0194302 | 3300044712 | Bacteria | 2371 |
| 495 | Ga0466957_0374883 | 3300044842 | Bacteria | 969 |
| 496 | Ga0466960_0083723 | 3300044901 | Bacteria | 1613 |
| 497 | Ga0466960_0780881 | 3300044901 | Bacteria | 577 |
| 498 | Ga0466959_0949473 | 3300045049 | Bacteria | 573 |
| 499 | Ga0466958_0328728 | 3300045836 | Bacteria | 983 |
| 500 | Ga0495627_001895 | 3300046453 | Bacteria | 10972 |
| 501 | Ga0495590_0030240 | 3300046457 | Bacteria | 1897 |
| 502 | Ga0495629_0080874 | 3300046459 | Bacteria | 2268 |
| 503 | Ga0495638_0002503 | 3300046460 | Bacteria | 14964 |
| 504 | Ga0495638_0039238 | 3300046460 | Bacteria | 3006 |
| 505 | Ga0495653_0538462 | 3300046463 | Bacteria | 724 |
| 506 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 507 | Ga0495650_0025100 | 3300046471 | Bacteria | 2801 |
| 508 | Ga0495605_0274762 | 3300046474 | Unclassified | 717 |
| 509 | Ga0495585_0113228 | 3300046492 | Bacteria | 1441 |
| 510 | Ga0495607_0157106 | 3300046501 | Bacteria | 1158 |
| 511 | Ga0495583_0042084 | 3300046506 | Bacteria | 2136 |
| 512 | Ga0495583_0178122 | 3300046506 | Bacteria | 871 |
| 513 | Ga0495606_0008563 | 3300046507 | Bacteria | 8852 |
| 514 | Ga0495606_0135262 | 3300046507 | Bacteria | 1461 |
| 515 | Ga0495606_0199606 | 3300046507 | Bacteria | 1141 |
| 516 | Ga0495610_0000029 | 3300046512 | Bacteria | 271137 |
| 517 | Ga0495610_0010088 | 3300046512 | Bacteria | 5898 |
| 518 | Ga0495610_0121845 | 3300046512 | Bacteria | 1142 |
| 519 | Ga0495610_0135053 | 3300046512 | Bacteria | 1067 |
| 520 | Ga0495616_0000174 | 3300046513 | Bacteria | 54942 |
| 521 | Ga0495620_0030909 | 3300046515 | Bacteria | 2459 |
| 522 | Ga0495620_0175693 | 3300046515 | Bacteria | 829 |
| 523 | Ga0495620_0365019 | 3300046515 | Bacteria | 547 |
| 524 | Ga0495620_0429407 | 3300046515 | Bacteria | 500 |
| 525 | Ga0495628_0104971 | 3300046516 | Bacteria | 2177 |
| 526 | Ga0495631_0006175 | 3300046518 | Bacteria | 6209 |
| 527 | Ga0495631_0071424 | 3300046518 | Bacteria | 1500 |
| 528 | Ga0495631_0453039 | 3300046518 | Bacteria | 546 |
| 529 | Ga0495632_0012294 | 3300046519 | Bacteria | 4940 |
| 530 | Ga0495637_0013757 | 3300046520 | Bacteria | 3835 |
| 531 | Ga0495637_0022565 | 3300046520 | Bacteria | 2869 |
| 532 | Ga0495637_0048314 | 3300046520 | Bacteria | 1793 |
| 533 | Ga0495643_0143076 | 3300046522 | Bacteria | 1190 |
| 534 | Ga0495643_0145655 | 3300046522 | Bacteria | 1177 |
| 535 | Ga0495643_0166722 | 3300046522 | Bacteria | 1080 |
| 536 | Ga0495644_0132337 | 3300046523 | Bacteria | 951 |
| 537 | Ga0495648_0101293 | 3300046524 | Bacteria | 1589 |
| 538 | Ga0495648_0138288 | 3300046524 | Bacteria | 1285 |
| 539 | Ga0495648_0204437 | 3300046524 | Bacteria | 986 |
| 540 | Ga0495648_0451720 | 3300046524 | Bacteria | 562 |
| 541 | Ga0495663_0020090 | 3300046525 | Bacteria | 1916 |
| 542 | Ga0495663_0321103 | 3300046525 | Bacteria | 560 |
| 543 | Ga0495642_0043680 | 3300046528 | Bacteria | 1828 |
| 544 | Ga0495642_0326066 | 3300046528 | Unclassified | 674 |
| 545 | Ga0495654_0000116 | 3300046530 | Bacteria | 90109 |
| 546 | Ga0495654_0087031 | 3300046530 | Bacteria | 1455 |
| 547 | Ga0495654_0170992 | 3300046530 | Bacteria | 947 |
| 548 | Ga0495609_0105136 | 3300046538 | Bacteria | 1221 |
| 549 | Ga0495609_0139498 | 3300046538 | Bacteria | 1035 |
| 550 | Ga0495621_0051353 | 3300046539 | Bacteria | 1475 |
| 551 | Ga0495621_0373161 | 3300046539 | Bacteria | 601 |
| 552 | Ga0495597_0017381 | 3300046542 | Bacteria | 3386 |
| 553 | Ga0495645_0129428 | 3300046543 | Bacteria | 1770 |
| 554 | Ga0495645_0555491 | 3300046543 | Bacteria | 711 |
| 555 | Ga0495645_0670212 | 3300046543 | Bacteria | 632 |
| 556 | Ga0495622_0005537 | 3300046557 | Bacteria | 5853 |
| 557 | Ga0495633_0367356 | 3300046558 | Bacteria | 651 |
| 558 | Ga0495668_0034575 | 3300046616 | Bacteria | 2834 |
| 559 | Ga0495668_0046706 | 3300046616 | Bacteria | 2405 |
| 560 | Ga0495668_0065544 | 3300046616 | Bacteria | 1999 |
| 561 | Ga0495668_0129417 | 3300046616 | Bacteria | 1382 |
| 562 | Ga0495668_0139269 | 3300046616 | Bacteria | 1328 |
| 563 | Ga0495668_0146867 | 3300046616 | Unclassified | 1291 |
| 564 | Ga0495668_0299814 | 3300046616 | Bacteria | 881 |
| 565 | Ga0495668_0517011 | 3300046616 | Bacteria | 658 |
| 566 | Ga0495668_0765807 | 3300046616 | Bacteria | 534 |
| 567 | Ga0495611_0068983 | 3300046648 | Bacteria | 1614 |
| 568 | Ga0495625_0000051 | 3300046660 | Bacteria | 193325 |
| 569 | Ga0495625_0006547 | 3300046660 | Bacteria | 10345 |
| 570 | Ga0495625_0013474 | 3300046660 | Bacteria | 6568 |
| 571 | Ga0495625_0027323 | 3300046660 | Bacteria | 4298 |
| 572 | Ga0495625_0082583 | 3300046660 | Bacteria | 2234 |
| 573 | Ga0495625_0095257 | 3300046660 | Bacteria | 2052 |
| 574 | Ga0495625_0163634 | 3300046660 | Bacteria | 1489 |
| 575 | Ga0495625_0554546 | 3300046660 | Bacteria | 695 |
| 576 | Ga0495625_0767920 | 3300046660 | Bacteria | 563 |
| 577 | Ga0495599_0851380 | 3300046678 | Bacteria | 519 |
| 578 | Ga0495646_0574800 | 3300046680 | Bacteria | 574 |
| 579 | Ga0495669_0000477 | 3300046684 | Bacteria | 18627 |
| 580 | Ga0495669_0023009 | 3300046684 | Bacteria | 2709 |
| 581 | Ga0495669_0507601 | 3300046684 | Bacteria | 586 |
| 582 | Ga0495624_0385633 | 3300046690 | Bacteria | 841 |
| 583 | Ga0495670_0303454 | 3300046691 | Bacteria | 856 |
| 584 | Ga0495670_0352809 | 3300046691 | Bacteria | 792 |
| 585 | Ga0495671_0142661 | 3300046692 | Bacteria | 1167 |
| 586 | Ga0495589_0014765 | 3300046794 | Bacteria | 4019 |
| 587 | Ga0495581_0267263 | 3300047315 | Bacteria | 1000 |
| 588 | Ga0495674_0966016 | 3300047319 | Unclassified | 655 |
| 589 | Ga0495672_0005855 | 3300047320 | Bacteria | 9642 |
| 590 | Ga0495687_157043 | 3300047443 | Bacteria | 770 |
| 591 | Ga0495677_0057749 | 3300047445 | Bacteria | 1435 |
| 592 | Ga0495677_0096197 | 3300047445 | Bacteria | 1118 |
| 593 | Ga0495673_0000082 | 3300047469 | Bacteria | 199141 |
| 594 | Ga0495673_0000123 | 3300047469 | Bacteria | 144484 |
| 595 | Ga0495673_0034715 | 3300047469 | Bacteria | 2330 |
| 596 | Ga0495681_0068251 | 3300047470 | Bacteria | 1618 |
| 597 | Ga0495681_0069336 | 3300047470 | Bacteria | 1602 |
| 598 | Ga0495686_0004520 | 3300047472 | Bacteria | 11400 |
| 599 | Ga0495686_0006301 | 3300047472 | Bacteria | 9117 |
| 600 | Ga0495686_0011451 | 3300047472 | Bacteria | 6247 |
| 601 | Ga0495686_0013415 | 3300047472 | Bacteria | 5684 |
| 602 | Ga0495686_0257975 | 3300047472 | Bacteria | 977 |
| 603 | Ga0495686_0440258 | 3300047472 | Bacteria | 694 |
| 604 | Ga0495615_0289067 | 3300048090 | Bacteria | 528 |
| 605 | Ga0496100_0318744 | 3300048903 | Bacteria | 1167 |
| 606 | Ga0496101_0049620 | 3300048904 | Bacteria | 3020 |
| 607 | Ga0496101_0076253 | 3300048904 | Bacteria | 2470 |
| 608 | Ga0496102_0023819 | 3300048905 | Bacteria | 5440 |
| 609 | Ga0496102_0340101 | 3300048905 | Bacteria | 1413 |
| 610 | Ga0496102_1652384 | 3300048905 | Bacteria | 559 |
| 611 | Ga0496103_0064568 | 3300048906 | Bacteria | 2282 |
| 612 | Ga0496103_0151965 | 3300048906 | Bacteria | 1483 |
| 613 | Ga0496103_0303400 | 3300048906 | Bacteria | 1027 |
| 614 | Ga0496105_0785758 | 3300048908 | Bacteria | 725 |
| 615 | Ga0496106_0019483 | 3300048909 | Bacteria | 5033 |
| 616 | Ga0496106_0028464 | 3300048909 | Bacteria | 4163 |
| 617 | Ga0496106_0109995 | 3300048909 | Bacteria | 2144 |
| 618 | Ga0496107_0000089 | 3300048910 | Bacteria | 43926 |
| 619 | Ga0496108_0200224 | 3300048911 | Bacteria | 1733 |
| 620 | Ga0496109_0059837 | 3300048912 | Bacteria | 3480 |
| 621 | Ga0496110_0203105 | 3300048913 | Bacteria | 1801 |
| 622 | Ga0496110_0722010 | 3300048913 | Bacteria | 899 |
| 623 | Ga0496111_0155001 | 3300048914 | Bacteria | 1700 |
| 624 | Ga0496111_1086618 | 3300048914 | Bacteria | 571 |
| 625 | Ga0496112_0017757 | 3300048915 | Bacteria | 6695 |
| 626 | Ga0496112_0777419 | 3300048915 | Bacteria | 883 |
| 627 | Ga0496113_0100344 | 3300048916 | Bacteria | 2243 |
| 628 | Ga0496113_1138155 | 3300048916 | Bacteria | 611 |
| 629 | Ga0496115_0000844 | 3300048918 | Bacteria | 22363 |
| 630 | Ga0496115_0020431 | 3300048918 | Bacteria | 5109 |
| 631 | Ga0496115_0126466 | 3300048918 | Bacteria | 2106 |
| 632 | Ga0496115_0595446 | 3300048918 | Bacteria | 879 |
| 633 | Ga0496115_1364311 | 3300048918 | Bacteria | 525 |
| 634 | Ga0496117_0071591 | 3300048920 | Bacteria | 2322 |
| 635 | Ga0496118_0066986 | 3300048921 | Bacteria | 2618 |
| 636 | Ga0496119_0018413 | 3300048922 | Bacteria | 5199 |
| 637 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 638 | Ga0496121_0011733 | 3300048924 | Bacteria | 9669 |
| 639 | Ga0496121_0408321 | 3300048924 | Bacteria | 887 |
| 640 | Ga0496122_0284370 | 3300048925 | Bacteria | 902 |
| 641 | Ga0496126_0614604 | 3300048929 | Bacteria | 855 |
| 642 | Ga0495678_002925 | 3300049459 | Bacteria | 10933 |
| 643 | Ga0501032_0067343 | 3300049569 | Bacteria | 2392 |
| 644 | Ga0501033_0163064 | 3300049570 | Bacteria | 1604 |
| 645 | Ga0501033_0636513 | 3300049570 | Bacteria | 729 |
| 646 | Ga0501034_0450498 | 3300049571 | Bacteria | 1205 |
| 647 | Ga0501034_0884725 | 3300049571 | Bacteria | 782 |
| 648 | Ga0501043_0669402 | 3300049579 | Bacteria | 761 |
| 649 | Ga0501046_0520130 | 3300049580 | Bacteria | 851 |
| 650 | Ga0501047_0006760 | 3300049581 | Bacteria | 10776 |
| 651 | Ga0501047_0117683 | 3300049581 | Bacteria | 2539 |
| 652 | Ga0501047_0207573 | 3300049581 | Bacteria | 1818 |
| 653 | Ga0501047_0567498 | 3300049581 | Bacteria | 958 |
| 654 | Ga0501047_0648677 | 3300049581 | Bacteria | 875 |
| 655 | Ga0501048_0108347 | 3300049582 | Bacteria | 1961 |
| 656 | Ga0501070_0811786 | 3300049586 | Bacteria | 734 |
| 657 | Ga0501070_0927346 | 3300049586 | Bacteria | 678 |
| 658 | Ga0501238_001885 | 3300049671 | Bacteria | 2446 |
| 659 | Ga0501257_001918 | 3300049686 | Bacteria | 4330 |
| 660 | Ga0501273_061568 | 3300049770 | Bacteria | 593 |
| 661 | Ga0501035_0222077 | 3300049822 | Bacteria | 1613 |
| 662 | Ga0501035_0790092 | 3300049822 | Bacteria | 759 |
| 663 | Ga0501035_1151900 | 3300049822 | Bacteria | 604 |
| 664 | Ga0501044_0053153 | 3300049823 | Bacteria | 4168 |
| 665 | Ga0501044_0925092 | 3300049823 | Bacteria | 746 |
| 666 | Ga0501044_1382516 | 3300049823 | Bacteria | 570 |
| 667 | nmdc:mga03683_369814_c1 | 3300050489 | Bacteria | 681 |
| 668 | nmdc:mga03n38_34587_c1 | 3300050490 | Bacteria | 2159 |
| 669 | nmdc:mga00v17_282_c1 | 3300050491 | Bacteria | 30074 |
| 670 | nmdc:mga0k408_241688_c1 | 3300050493 | Bacteria | 1078 |
| 671 | nmdc:mga0k408_58819_c1 | 3300050493 | Bacteria | 2232 |
| 672 | nmdc:mga06z11_352155_c1 | 3300050494 | Bacteria | 882 |
| 673 | nmdc:mga07m45_151253_c1 | 3300050496 | Bacteria | 1346 |
| 674 | nmdc:mga07m45_21610_c1 | 3300050496 | Bacteria | 3506 |
| 675 | nmdc:mga07m45_2401_c1 | 3300050496 | Unclassified | 1455 |
| 676 | Ga0500635_0000080 | 3300053080 | Bacteria | 63214 |
| 677 | Ga0500635_0161421 | 3300053080 | Bacteria | 860 |
| 678 | Ga0500578_0001330 | 3300053086 | Bacteria | 25351 |
| 679 | Ga0500578_0064139 | 3300053086 | Bacteria | 2343 |
| 680 | Ga0500643_004128 | 3300053087 | Bacteria | 6678 |
| 681 | Ga0500643_008375 | 3300053087 | Bacteria | 4065 |
| 682 | Ga0500643_012178 | 3300053087 | Bacteria | 3090 |
| 683 | Ga0500643_018221 | 3300053087 | Bacteria | 2334 |
| 684 | Ga0500643_045349 | 3300053087 | Bacteria | 1274 |
| 685 | Ga0500644_0000817 | 3300053088 | Bacteria | 10508 |
| 686 | Ga0500646_0173628 | 3300053090 | Bacteria | 726 |
| 687 | Ga0500583_0112149 | 3300053092 | Bacteria | 1344 |
| 688 | Ga0500651_0043669 | 3300053093 | Bacteria | 2823 |
| 689 | Ga0500566_0025410 | 3300053094 | Bacteria | 3473 |
| 690 | Ga0500641_0000989 | 3300053096 | Bacteria | 10095 |
| 691 | Ga0500641_0033355 | 3300053096 | Bacteria | 2043 |
| 692 | Ga0500641_0109676 | 3300053096 | Bacteria | 1188 |
| 693 | Ga0500650_0129974 | 3300053098 | Bacteria | 1171 |
| 694 | Ga0500554_004309 | 3300053102 | Bacteria | 3004 |
| 695 | Ga0500555_006512 | 3300053103 | Bacteria | 3319 |
| 696 | Ga0500555_092589 | 3300053103 | Bacteria | 775 |
| 697 | Ga0500556_0001038 | 3300053104 | Bacteria | 14488 |
| 698 | Ga0500556_0004885 | 3300053104 | Bacteria | 3795 |
| 699 | Ga0500556_0158860 | 3300053104 | Bacteria | 892 |
| 700 | Ga0500557_234064 | 3300053105 | Bacteria | 580 |
| 701 | Ga0500562_000175 | 3300053108 | Bacteria | 17715 |
| 702 | Ga0500562_000192 | 3300053108 | Bacteria | 16565 |
| 703 | Ga0500562_001492 | 3300053108 | Bacteria | 5771 |
| 704 | Ga0500562_008146 | 3300053108 | Bacteria | 2643 |
| 705 | Ga0500569_003741 | 3300053109 | Bacteria | 3141 |
| 706 | Ga0500572_019183 | 3300053111 | Bacteria | 1783 |
| 707 | Ga0500594_0000343 | 3300053118 | Bacteria | 10448 |
| 708 | Ga0500595_026812 | 3300053119 | Bacteria | 1981 |
| 709 | Ga0500595_094612 | 3300053119 | Bacteria | 861 |
| 710 | Ga0500608_020849 | 3300053122 | Bacteria | 3020 |
| 711 | Ga0500614_021326 | 3300053123 | Bacteria | 1502 |
| 712 | Ga0500614_042601 | 3300053123 | Bacteria | 1160 |
| 713 | Ga0500618_000305 | 3300053125 | Bacteria | 36613 |
| 714 | Ga0500642_0218173 | 3300053130 | Bacteria | 884 |
| 715 | Ga0500652_268592 | 3300053131 | Bacteria | 670 |
| 716 | Ga0500658_0010384 | 3300053134 | Bacteria | 3433 |
| 717 | Ga0500559_0000002 | 3300053136 | Bacteria | 262002 |
| 718 | Ga0500559_0000008 | 3300053136 | Bacteria | 182182 |
| 719 | Ga0500559_0005600 | 3300053136 | Bacteria | 5762 |
| 720 | Ga0500559_0009234 | 3300053136 | Bacteria | 4279 |
| 721 | Ga0500564_008131 | 3300053138 | Bacteria | 4489 |
| 722 | Ga0500564_386497 | 3300053138 | Bacteria | 510 |
| 723 | Ga0500568_0079455 | 3300053139 | Bacteria | 1247 |
| 724 | Ga0500590_086804 | 3300053148 | Bacteria | 1525 |
| 725 | Ga0500604_0257349 | 3300053151 | Bacteria | 604 |
| 726 | Ga0500616_0019532 | 3300053153 | Bacteria | 3818 |
| 727 | Ga0500616_0294367 | 3300053153 | Bacteria | 676 |
| 728 | Ga0500616_0295944 | 3300053153 | Bacteria | 674 |
| 729 | Ga0500622_0000474 | 3300053156 | Bacteria | 37843 |
| 730 | Ga0500622_0014049 | 3300053156 | Bacteria | 4304 |
| 731 | Ga0500622_0187530 | 3300053156 | Bacteria | 950 |
| 732 | Ga0500622_0217929 | 3300053156 | Bacteria | 857 |
| 733 | Ga0500627_0028327 | 3300053158 | Bacteria | 2326 |
| 734 | Ga0500633_0272677 | 3300053160 | Bacteria | 626 |
| 735 | Ga0500639_110398 | 3300053163 | Unclassified | 1339 |
| 736 | Ga0500639_288500 | 3300053163 | Bacteria | 626 |
| 737 | Ga0500636_0008561 | 3300053177 | Bacteria | 5931 |
| 738 | Ga0500637_0002594 | 3300053178 | Bacteria | 8079 |
| 739 | Ga0500637_0490844 | 3300053178 | Bacteria | 611 |
| 740 | Ga0500576_083852 | 3300053725 | Bacteria | 1339 |
| 741 | Ga0500645_000703 | 3300053730 | Bacteria | 20751 |
| 742 | Ga0500645_002828 | 3300053730 | Bacteria | 7477 |
| 743 | Ga0500645_004887 | 3300053730 | Bacteria | 5043 |
| 744 | Ga0500645_034505 | 3300053730 | Bacteria | 1511 |
| 745 | Ga0500609_000232 | 3300053731 | Bacteria | 8044 |
| 746 | Ga0500596_003387 | 3300053735 | Bacteria | 3037 |
| 747 | Ga0587091_214748 | 3300059511 | Bacteria | 523 |
| 748 | 2511123526 | 2510917020 | Bacteria | 5657507 |
| 749 | 2585150209 | 2582581279 | Bacteria | 4980720 |
| 750 | 2585153243 | 2582581280 | Bacteria | 5994497 |
| 751 | 2585196932 | 2582581293 | Bacteria | 5907401 |
| 752 | 2643748822 | 2643221545 | Bacteria | 5083237 |
| 753 | 2643778978 | 2643221552 | Bacteria | 5708754 |
| 754 | 2643923392 | 2643221583 | Bacteria | 5218014 |
| 755 | 2643930059 | 2643221584 | Bacteria | 5511711 |
| 756 | 2644001985 | 2643221598 | Bacteria | 4578346 |
| 757 | 2644085366 | 2643221614 | Bacteria | 4260023 |
| 758 | 2644342918 | 2643221661 | Bacteria | 4267604 |
| 759 | 2644366218 | 2643221666 | Bacteria | 4265935 |
| 760 | 2644509576 | 2643221691 | Bacteria | 5093099 |
| 761 | 2792463656 | 2791355048 | Bacteria | 5832535 |
| 762 | 2819539275 | 2818991435 | Bacteria | 5433759 |
| 763 | 2819648210 | 2818991454 | Bacteria | 5563326 |
| 764 | 2843748449 | 2843744320 | Bacteria | 5659202 |
| 765 | 2849562354 | 2849560528 | Bacteria | 5393480 |
| 766 | 2849574595 | 2849573788 | Bacteria | 5421256 |
| 767 | 2851155037 | 2851153111 | Bacteria | 5542585 |
| 768 | 2898330064 | 2898329390 | Bacteria | 5168154 |
| 769 | Ga0495638_0003803 | |||
| 770 | JGI25153J46596_10042631 | |||
| 771 | rootL2_10016434 | |||
| 772 | rootL2_10228638 | |||
| 773 | Ga0055526_1039481 | |||
| 774 | Ga0055537_1000562 | |||
| 775 | Ga0055524_1007120 | |||
| 776 | Ga0055528_1086361 | |||
| 777 | Ga0055530_10002586 | |||
| 778 | Ga0055531_10005697 | |||
| 779 | Ga0055531_10017988 | |||
| 780 | Ga0055531_10024083 | |||
| 781 | Ga0055543_1031655 | |||
| 782 | Ga0065165_1000307 | |||
| 783 | Ga0065165_1002473 | |||
| 784 | Ga0070658_10098394 | |||
| 785 | Ga0070658_10310792 | |||
| 786 | Ga0070683_100816795 | |||
| 787 | Ga0070683_101085257 | |||
| 788 | Ga0070690_100715853 | |||
| 789 | Ga0070670_100000128 | |||
| 790 | Ga0070670_100062321 | |||
| 791 | Ga0070670_100092753 | |||
| 792 | Ga0070670_100112931 | |||
| 793 | Ga0070670_100406173 | |||
| 794 | Ga0070666_10060179 | |||
| 795 | Ga0070666_10066785 | |||
| 796 | Ga0070666_11214892 | |||
| 797 | Ga0070680_100064204 | |||
| 798 | Ga0070680_100259869 | |||
| 799 | Ga0070680_100547686 | |||
| 800 | Ga0070682_100081869 | |||
| 801 | Ga0070682_101197347 | |||
| 802 | Ga0068868_100212289 | |||
| 803 | Ga0070660_101326635 | |||
| 804 | Ga0070689_101518801 | |||
| 805 | Ga0070691_10044451 | |||
| 806 | Ga0070661_100973990 | |||
| 807 | Ga0070668_100000195 | |||
| 808 | Ga0070668_100003161 | |||
| 809 | Ga0070668_100004647 | |||
| 810 | Ga0070668_100036004 | |||
| 811 | Ga0070668_100102873 | |||
| 812 | Ga0070669_100001021 | |||
| 813 | Ga0070669_101357827 | |||
| 814 | Ga0070671_100000895 | |||
| 815 | Ga0070671_100031377 | |||
| 816 | Ga0070671_100253576 | |||
| 817 | Ga0070671_100657676 | |||
| 818 | Ga0070673_101614276 | |||
| 819 | Ga0070688_100432844 | |||
| 820 | Ga0070659_100534103 | |||
| 821 | Ga0070659_100731711 | |||
| 822 | Ga0070667_100000169 | |||
| 823 | Ga0070667_100005053 | |||
| 824 | Ga0070667_100013278 | |||
| 825 | Ga0070667_100047472 | |||
| 826 | Ga0070667_102231723 | |||
| 827 | Ga0070678_100281299 | |||
| 828 | Ga0070662_100236987 | |||
| 829 | Ga0070662_100239480 | |||
| 830 | Ga0070681_10076249 | |||
| 831 | Ga0070681_10102405 | |||
| 832 | Ga0070681_10858063 | |||
| 833 | Ga0068867_100302549 | |||
| 834 | Ga0070685_11508223 | |||
| 835 | Ga0070698_100379032 | |||
| 836 | Ga0070679_100027525 | |||
| 837 | Ga0070679_100559566 | |||
| 838 | Ga0068853_100019157 | |||
| 839 | Ga0068853_100113633 | |||
| 840 | Ga0068853_100386290 | |||
| 841 | Ga0068853_100535990 | |||
| 842 | Ga0068853_100931822 | |||
| 843 | Ga0068853_102479138 | |||
| 844 | Ga0070686_100939036 | |||
| 845 | Ga0070665_100001054 | |||
| 846 | Ga0070665_100001083 | |||
| 847 | Ga0070665_100044661 | |||
| 848 | Ga0070665_100256442 | |||
| 849 | Ga0070665_102516549 | |||
| 850 | Ga0068855_100010008 | |||
| 851 | Ga0068855_100044699 | |||
| 852 | Ga0068855_100133055 | |||
| 853 | Ga0068855_100146973 | |||
| 854 | Ga0068855_101551458 | |||
| 855 | Ga0068855_102088162 | |||
| 856 | Ga0070664_101397306 | |||
| 857 | Ga0068857_100653216 | |||
| 858 | Ga0068854_100083216 | |||
| 859 | Ga0068854_100264202 | |||
| 860 | Ga0068856_100236821 | |||
| 861 | Ga0068856_100613248 | |||
| 862 | Ga0068859_100000407 | |||
| 863 | Ga0068859_100243535 | |||
| 864 | Ga0068859_100282802 | |||
| 865 | Ga0068859_101193542 | |||
| 866 | Ga0068859_103134958 | |||
| 867 | Ga0068864_100000561 | |||
| 868 | Ga0068864_100012687 | |||
| 869 | Ga0068864_100045946 | |||
| 870 | Ga0068864_100155113 | |||
| 871 | Ga0068864_100846805 | |||
| 872 | Ga0068864_101603112 | |||
| 873 | Ga0068864_102713859 | |||
| 874 | Ga0068866_10801407 | |||
| 875 | Ga0068861_100065578 | |||
| 876 | Ga0068863_100000101 | |||
| 877 | Ga0068863_100002206 | |||
| 878 | Ga0068863_100005153 | |||
| 879 | Ga0068863_100040434 | |||
| 880 | Ga0068863_100182680 | |||
| 881 | Ga0068863_100760766 | |||
| 882 | Ga0068858_100001173 | |||
| 883 | Ga0068858_100003917 | |||
| 884 | Ga0068858_100169945 | |||
| 885 | Ga0068858_100240703 | |||
| 886 | Ga0068860_100000055 | |||
| 887 | Ga0068860_100000211 | |||
| 888 | Ga0068860_100019283 | |||
| 889 | Ga0068860_100450733 | |||
| 890 | Ga0068862_100002104 | |||
| 891 | Ga0068862_100004288 | |||
| 892 | Ga0068862_100007104 | |||
| 893 | Ga0068862_100259448 | |||
| 894 | Ga0068862_100515922 | |||
| 895 | Ga0070717_10078474 | |||
| 896 | Ga0070717_10188631 | |||
| 897 | Ga0075365_10124544 | |||
| 898 | Ga0075368_10000328 | |||
| 899 | Ga0075363_100035685 | |||
| 900 | Ga0075363_100353326 | |||
| 901 | Ga0075364_10001220 | |||
| 902 | Ga0075362_10042252 | |||
| 903 | Ga0075367_10000091 | |||
| 904 | Ga0075366_10160941 | |||
| 905 | Ga0075366_10349840 | |||
| 906 | Ga0097621_100245349 | |||
| 907 | Ga0075370_10214311 | |||
| 908 | Ga0075370_10255984 | |||
| 909 | Ga0075370_10495532 | |||
| 910 | Ga0068871_100249645 | |||
| 911 | Ga0068871_100822349 | |||
| 912 | Ga0068871_101365651 | |||
| 913 | Ga0068865_100000477 | |||
| 914 | Ga0097620_100000407 | |||
| 915 | Ga0097620_100243532 | |||
| 916 | Ga0097620_100282797 | |||
| 917 | Ga0097620_101193971 | |||
| 918 | Ga0097620_101674984 | |||
| 919 | Ga0097620_103134921 | |||
| 920 | Ga0079104_1007780 | |||
| 921 | Ga0105250_10014820 | |||
| 922 | Ga0105240_10035366 | |||
| 923 | Ga0105240_10037452 | |||
| 924 | Ga0105240_10282148 | |||
| 925 | Ga0105240_11752273 | |||
| 926 | Ga0105240_12329155 | |||
| 927 | Ga0105245_10536640 | |||
| 928 | Ga0105245_10944948 | |||
| 929 | Ga0105243_11382139 | |||
| 930 | Ga0105241_10252825 | |||
| 931 | Ga0105241_10903920 | |||
| 932 | Ga0105242_10150763 | |||
| 933 | Ga0105248_10000349 | |||
| 934 | Ga0105248_10004855 | |||
| 935 | Ga0105248_10008404 | |||
| 936 | Ga0105248_10011646 | |||
| 937 | Ga0105248_10027940 | |||
| 938 | Ga0105248_10637909 | |||
| 939 | Ga0105248_11186238 | |||
| 940 | Ga0105248_11328574 | |||
| 941 | Ga0105248_11725617 | |||
| 942 | Ga0105248_12927503 | |||
| 943 | Ga0105248_13246027 | |||
| 944 | Ga0105248_13246035 | |||
| 945 | Ga0105237_10145343 | |||
| 946 | Ga0105237_10500920 | |||
| 947 | Ga0105237_11471352 | |||
| 948 | Ga0105238_10050097 | |||
| 949 | Ga0105238_10101189 | |||
| 950 | Ga0105238_10242319 | |||
| 951 | Ga0105238_10945484 | |||
| 952 | Ga0105238_11203370 | |||
| 953 | Ga0105249_10001588 | |||
| 954 | Ga0105249_10027976 | |||
| 955 | Ga0105249_10231313 | |||
| 956 | Ga0105249_10290865 | |||
| 957 | Ga0105249_10391632 | |||
| 958 | Ga0105249_10987913 | |||
| 959 | Ga0105148_110709 | |||
| 960 | Ga0105239_10476032 | |||
| 961 | Ga0105239_10695002 | |||
| 962 | Ga0105239_10858146 | |||
| 963 | Ga0105239_11348287 | |||
| 964 | Ga0105239_12198955 | |||
| 965 | Ga0157327_1057865 | |||
| 966 | Ga0157373_10004968 | |||
| 967 | Ga0157373_10042339 | |||
| 968 | Ga0157373_10546342 | |||
| 969 | Ga0157370_10077369 | |||
| 970 | Ga0157370_10202801 | |||
| 971 | Ga0157369_10216591 | |||
| 972 | Ga0157369_11225965 | |||
| 973 | Ga0157374_11465330 | |||
| 974 | Ga0163162_10009921 | |||
| 975 | Ga0163162_10083848 | |||
| 976 | Ga0163162_10281608 | |||
| 977 | Ga0163162_10970840 | |||
| 978 | Ga0157372_10191636 | |||
| 979 | Ga0157375_10105627 | |||
| 980 | Ga0157375_10232188 | |||
| 981 | Ga0157375_10490998 | |||
| 982 | Ga0163163_10005243 | |||
| 983 | Ga0163163_10020813 | |||
| 984 | Ga0163163_10062687 | |||
| 985 | Ga0163163_10087163 | |||
| 986 | Ga0163163_10111538 | |||
| 987 | Ga0163163_10318530 | |||
| 988 | Ga0163163_10400194 | |||
| 989 | Ga0163163_11035983 | |||
| 990 | Ga0163163_13266706 | |||
| 991 | Ga0157380_10329337 | |||
| 992 | Ga0157380_11088495 | |||
| 993 | Ga0157379_10000119 | |||
| 994 | Ga0157379_10046669 | |||
| 995 | Ga0157379_10054996 | |||
| 996 | Ga0157379_10309300 | |||
| 997 | Ga0157376_10332579 | |||
| 998 | Ga0163161_10154145 | |||
| 999 | Ga0163161_10446667 | |||
| 1000 | Ga0163161_10697563 | |||
| 1001 | Ga0163161_11403047 | |||
| 1002 | Ga0206356_10375787 | |||
| 1003 | Ga0213876_10015560 | |||
| 1004 | Ga0213876_10452455 | |||
| 1005 | Ga0213871_10104871 | |||
| 1006 | Ga0209026_1000800 | |||
| 1007 | Ga0209026_1010961 | |||
| 1008 | Ga0209565_1000414 | |||
| 1009 | Ga0209673_1001567 | |||
| 1010 | Ga0209673_1071722 | |||
| 1011 | Ga0209564_1002030 | |||
| 1012 | Ga0209564_1063882 | |||
| 1013 | Ga0209758_1002163 | |||
| 1014 | Ga0209758_1002287 | |||
| 1015 | Ga0209050_1000031 | |||
| 1016 | Ga0209256_1003858 | |||
| 1017 | Ga0209256_1003966 | |||
| 1018 | Ga0209256_1018510 | |||
| 1019 | Ga0209257_1000073 | |||
| 1020 | Ga0209257_1001335 | |||
| 1021 | Ga0209257_1005089 | |||
| 1022 | Ga0207642_11007266 | |||
| 1023 | Ga0207710_10333975 | |||
| 1024 | Ga0207710_10508737 | |||
| 1025 | Ga0207680_10150917 | |||
| 1026 | Ga0207680_10665123 | |||
| 1027 | Ga0207705_10086832 | |||
| 1028 | Ga0207705_11085855 | |||
| 1029 | Ga0207705_11318851 | |||
| 1030 | Ga0207654_10309401 | |||
| 1031 | Ga0207707_10067008 | |||
| 1032 | Ga0207707_10449929 | |||
| 1033 | Ga0207695_10002249 | |||
| 1034 | Ga0207695_10008692 | |||
| 1035 | Ga0207695_10033670 | |||
| 1036 | Ga0207695_10135991 | |||
| 1037 | Ga0207695_10150535 | |||
| 1038 | Ga0207671_10161924 | |||
| 1039 | Ga0207671_10492685 | |||
| 1040 | Ga0207660_10029717 | |||
| 1041 | Ga0207660_10071525 | |||
| 1042 | Ga0207660_10181127 | |||
| 1043 | Ga0207652_10453961 | |||
| 1044 | Ga0207652_11344565 | |||
| 1045 | Ga0207681_10251082 | |||
| 1046 | Ga0207681_10270614 | |||
| 1047 | Ga0207694_10008305 | |||
| 1048 | Ga0207694_10210591 | |||
| 1049 | Ga0207694_10447889 | |||
| 1050 | Ga0207650_10000315 | |||
| 1051 | Ga0207650_10025870 | |||
| 1052 | Ga0207650_10071259 | |||
| 1053 | Ga0207650_10139026 | |||
| 1054 | Ga0207650_11655895 | |||
| 1055 | Ga0207644_10000679 | |||
| 1056 | Ga0207644_10056731 | |||
| 1057 | Ga0207644_10080330 | |||
| 1058 | Ga0207644_10464985 | |||
| 1059 | Ga0207644_11505943 | |||
| 1060 | Ga0207690_10609643 | |||
| 1061 | Ga0207706_10229506 | |||
| 1062 | Ga0207706_10297511 | |||
| 1063 | Ga0207686_10063811 | |||
| 1064 | Ga0207670_11247722 | |||
| 1065 | Ga0207669_10736863 | |||
| 1066 | Ga0207704_10001880 | |||
| 1067 | Ga0207704_11507440 | |||
| 1068 | Ga0207711_10003417 | |||
| 1069 | Ga0207711_10005865 | |||
| 1070 | Ga0207711_10006591 | |||
| 1071 | Ga0207711_10026071 | |||
| 1072 | Ga0207711_10100590 | |||
| 1073 | Ga0207711_10221443 | |||
| 1074 | Ga0207711_10385808 | |||
| 1075 | Ga0207711_10887056 | |||
| 1076 | Ga0207711_11370403 | |||
| 1077 | Ga0207711_11652685 | |||
| 1078 | Ga0207711_11997950 | |||
| 1079 | Ga0207689_11005179 | |||
| 1080 | Ga0207679_10134411 | |||
| 1081 | Ga0207667_10041076 | |||
| 1082 | Ga0207667_10086365 | |||
| 1083 | Ga0207667_10648781 | |||
| 1084 | Ga0207667_11424947 | |||
| 1085 | Ga0207651_10013365 | |||
| 1086 | Ga0207712_10010595 | |||
| 1087 | Ga0207712_10244894 | |||
| 1088 | Ga0207712_11070299 | |||
| 1089 | Ga0207668_10000007 | |||
| 1090 | Ga0207668_10001472 | |||
| 1091 | Ga0207668_10015771 | |||
| 1092 | Ga0207668_10034342 | |||
| 1093 | Ga0207668_10037884 | |||
| 1094 | Ga0207668_10047510 | |||
| 1095 | Ga0207640_10027977 | |||
| 1096 | Ga0207640_10081298 | |||
| 1097 | Ga0207640_11872869 | |||
| 1098 | Ga0207658_10000052 | |||
| 1099 | Ga0207658_10008069 | |||
| 1100 | Ga0207658_10031797 | |||
| 1101 | Ga0207658_10881350 | |||
| 1102 | Ga0207658_11113029 | |||
| 1103 | Ga0207703_10000105 | |||
| 1104 | Ga0207703_10002806 | |||
| 1105 | Ga0207703_10061871 | |||
| 1106 | Ga0207703_10217781 | |||
| 1107 | Ga0207703_11039509 | |||
| 1108 | Ga0207703_11224539 | |||
| 1109 | Ga0207639_10014437 | |||
| 1110 | Ga0207639_10028144 | |||
| 1111 | Ga0207639_10412905 | |||
| 1112 | Ga0207639_10455204 | |||
| 1113 | Ga0207678_10335464 | |||
| 1114 | Ga0207702_10155204 | |||
| 1115 | Ga0207702_10322746 | |||
| 1116 | Ga0207702_11615397 | |||
| 1117 | Ga0207641_10000160 | |||
| 1118 | Ga0207641_10002888 | |||
| 1119 | Ga0207641_10006166 | |||
| 1120 | Ga0207641_10081699 | |||
| 1121 | Ga0207641_10280872 | |||
| 1122 | Ga0207641_10412260 | |||
| 1123 | Ga0207641_10469405 | |||
| 1124 | Ga0207641_11804163 | |||
| 1125 | Ga0207641_12325624 | |||
| 1126 | Ga0207648_11425932 | |||
| 1127 | Ga0207676_10000159 | |||
| 1128 | Ga0207676_10000380 | |||
| 1129 | Ga0207676_10003296 | |||
| 1130 | Ga0207676_10035485 | |||
| 1131 | Ga0207676_10338954 | |||
| 1132 | Ga0207676_10445614 | |||
| 1133 | Ga0207676_10656423 | |||
| 1134 | Ga0207676_11351527 | |||
| 1135 | Ga0207676_11689004 | |||
| 1136 | Ga0207674_10342257 | |||
| 1137 | Ga0207675_100192443 | |||
| 1138 | Ga0207675_100982575 | |||
| 1139 | Ga0207683_10233188 | |||
| 1140 | Ga0207683_10380674 | |||
| 1141 | Ga0207698_11183579 | |||
| 1142 | Ga0207698_11869394 | |||
| 1143 | Ga0207698_12605326 | |||
| 1144 | Ga0209281_1013319 | |||
| 1145 | Ga0209981_1008629 | |||
| 1146 | Ga0209999_1007104 | |||
| 1147 | Ga0209813_10022309 | |||
| 1148 | Ga0268266_10002189 | |||
| 1149 | Ga0268266_10056945 | |||
| 1150 | Ga0268266_10111835 | |||
| 1151 | Ga0268266_10244847 | |||
| 1152 | Ga0268265_10001929 | |||
| 1153 | Ga0268265_10003935 | |||
| 1154 | Ga0268265_10008280 | |||
| 1155 | Ga0268265_10030008 | |||
| 1156 | Ga0268265_10120518 | |||
| 1157 | Ga0268265_10228304 | |||
| 1158 | Ga0268265_11336730 | |||
| 1159 | Ga0268265_12620744 | |||
| 1160 | Ga0268264_10000112 | |||
| 1161 | Ga0268264_10000270 | |||
| 1162 | Ga0268264_10011304 | |||
| 1163 | Ga0268264_10378392 | |||
| 1164 | Ga0268264_11114257 | |||
| 1165 | Ga0265334_10006729 | |||
| 1166 | Ga0307517_10013485 | |||
| 1167 | Ga0307517_10168146 | |||
| 1168 | Ga0307517_10244709 | |||
| 1169 | Ga0307515_10058050 | |||
| 1170 | Ga0307515_10064837 | |||
| 1171 | Ga0307515_10128770 | |||
| 1172 | Ga0265338_10022804 | |||
| 1173 | Ga0265338_10026523 | |||
| 1174 | Ga0307511_10052739 | |||
| 1175 | Ga0265339_10467342 | |||
| 1176 | Ga0265331_10369690 | |||
| 1177 | Ga0265327_10000337 | |||
| 1178 | Ga0307513_10000082 | |||
| 1179 | Ga0307513_10002784 | |||
| 1180 | Ga0307513_10003048 | |||
| 1181 | Ga0307513_10004685 | |||
| 1182 | Ga0307513_10350587 | |||
| 1183 | Ga0307513_10864537 | |||
| 1184 | Ga0307408_100839864 | |||
| 1185 | Ga0307408_100863080 | |||
| 1186 | Ga0307408_101536506 | |||
| 1187 | Ga0307408_101783547 | |||
| 1188 | Ga0265314_10161642 | |||
| 1189 | Ga0307405_10440912 | |||
| 1190 | Ga0307405_10483447 | |||
| 1191 | Ga0307405_10952091 | |||
| 1192 | Ga0307413_10195283 | |||
| 1193 | Ga0307410_11402825 | |||
| 1194 | Ga0307406_10710809 | |||
| 1195 | Ga0307412_10911059 | |||
| 1196 | Ga0307412_11228432 | |||
| 1197 | Ga0307412_11499981 | |||
| 1198 | Ga0307416_101669999 | |||
| 1199 | Ga0307416_103876817 | |||
| 1200 | Ga0307414_10116546 | |||
| 1201 | Ga0307414_11006823 | |||
| 1202 | Ga0307411_12250419 | |||
| 1203 | Ga0307415_101424359 | |||
| 1204 | Ga0307415_101506806 | |||
| 1205 | Ga0307415_101922603 | |||
| 1206 | Ga0307510_10002252 | |||
| 1207 | Ga0373926_0147979 | |||
| 1208 | Ga0373944_0000508 | |||
| 1209 | Ga0373936_0030197 | |||
| 1210 | Ga0373939_0530429 | |||
| 1211 | Ga0373943_0289786 | |||
| 1212 | Ga0373943_0303427 | |||
| 1213 | Ga0373946_0010569 | |||
| 1214 | Ga0373931_0309650 | |||
| 1215 | Ga0373931_1063466 | |||
| 1216 | Ga0373927_0000296 | |||
| 1217 | Ga0373927_1173864 | |||
| 1218 | Ga0373933_0247198 | |||
| 1219 | Ga0373947_0211836 | |||
| 1220 | Ga0373937_0367025 | |||
| 1221 | Ga0373937_0922129 | |||
| 1222 | Ga0373925_0000022 | |||
| 1223 | Ga0373925_0292279 | |||
| 1224 | Ga0395899_0000557 | |||
| 1225 | Ga0395899_0140831 | |||
| 1226 | Ga0395900_0000010 | |||
| 1227 | Ga0395900_0061996 | |||
| 1228 | Ga0395900_1155110 | |||
| 1229 | Ga0395898_0018674 | |||
| 1230 | Ga0395898_0042837 | |||
| 1231 | Ga0395898_0313443 | |||
| 1232 | Ga0395905_0006948 | |||
| 1233 | Ga0395905_0163759 | |||
| 1234 | Ga0395905_0177779 | |||
| 1235 | Ga0395905_0299487 | |||
| 1236 | Ga0395905_0309141 | |||
| 1237 | Ga0395905_0876788 | |||
| 1238 | Ga0395905_0929335 | |||
| 1239 | Ga0395905_1337229 | |||
| 1240 | Ga0395905_1571292 | |||
| 1241 | Ga0395901_0000007 | |||
| 1242 | Ga0395901_0295838 | |||
| 1243 | Ga0395901_0729909 | |||
| 1244 | Ga0395901_1269057 | |||
| 1245 | Ga0395901_1506912 | |||
| 1246 | Ga0436365_0233204 | |||
| 1247 | Ga0436365_0235294 | |||
| 1248 | Ga0436365_0988854 | |||
| 1249 | Ga0436365_1177820 | |||
| 1250 | Ga0436365_1288496 | |||
| 1251 | Ga0436362_1173452 | |||
| 1252 | Ga0439465_0053654 | |||
| 1253 | Ga0451789_0641556 | |||
| 1254 | Ga0451795_0636755 | |||
| 1255 | Ga0451841_1329338 | |||
| 1256 | Ga0439431_0055230 | |||
| 1257 | Ga0439445_0109697 | |||
| 1258 | Ga0439446_0006467 | |||
| 1259 | Ga0466965_0343402 | |||
| 1260 | Ga0466966_0536961 | |||
| 1261 | Ga0466961_0468260 | |||
| 1262 | Ga0453684_0194302 | |||
| 1263 | Ga0466957_0374883 | |||
| 1264 | Ga0466960_0083723 | |||
| 1265 | Ga0466960_0780881 | |||
| 1266 | Ga0466959_0949473 | |||
| 1267 | Ga0466958_0328728 | |||
| 1268 | Ga0495627_001895 | |||
| 1269 | Ga0495590_0030240 | |||
| 1270 | Ga0495629_0080874 | |||
| 1271 | Ga0495638_0002503 | |||
| 1272 | Ga0495638_0039238 | |||
| 1273 | Ga0495653_0538462 | |||
| 1274 | Ga0495650_0000007 | |||
| 1275 | Ga0495650_0025100 | |||
| 1276 | Ga0495605_0274762 | |||
| 1277 | Ga0495585_0113228 | |||
| 1278 | Ga0495607_0157106 | |||
| 1279 | Ga0495583_0042084 | |||
| 1280 | Ga0495583_0178122 | |||
| 1281 | Ga0495606_0008563 | |||
| 1282 | Ga0495606_0135262 | |||
| 1283 | Ga0495606_0199606 | |||
| 1284 | Ga0495610_0000029 | |||
| 1285 | Ga0495610_0010088 | |||
| 1286 | Ga0495610_0121845 | |||
| 1287 | Ga0495610_0135053 | |||
| 1288 | Ga0495616_0000174 | |||
| 1289 | Ga0495620_0030909 | |||
| 1290 | Ga0495620_0175693 | |||
| 1291 | Ga0495620_0365019 | |||
| 1292 | Ga0495620_0429407 | |||
| 1293 | Ga0495628_0104971 | |||
| 1294 | Ga0495631_0006175 | |||
| 1295 | Ga0495631_0071424 | |||
| 1296 | Ga0495631_0453039 | |||
| 1297 | Ga0495632_0012294 | |||
| 1298 | Ga0495637_0013757 | |||
| 1299 | Ga0495637_0022565 | |||
| 1300 | Ga0495637_0048314 | |||
| 1301 | Ga0495643_0143076 | |||
| 1302 | Ga0495643_0145655 | |||
| 1303 | Ga0495643_0166722 | |||
| 1304 | Ga0495644_0132337 | |||
| 1305 | Ga0495648_0101293 | |||
| 1306 | Ga0495648_0138288 | |||
| 1307 | Ga0495648_0204437 | |||
| 1308 | Ga0495648_0451720 | |||
| 1309 | Ga0495663_0020090 | |||
| 1310 | Ga0495663_0321103 | |||
| 1311 | Ga0495642_0043680 | |||
| 1312 | Ga0495642_0326066 | |||
| 1313 | Ga0495654_0000116 | |||
| 1314 | Ga0495654_0087031 | |||
| 1315 | Ga0495654_0170992 | |||
| 1316 | Ga0495609_0105136 | |||
| 1317 | Ga0495609_0139498 | |||
| 1318 | Ga0495621_0051353 | |||
| 1319 | Ga0495621_0373161 | |||
| 1320 | Ga0495597_0017381 | |||
| 1321 | Ga0495645_0129428 | |||
| 1322 | Ga0495645_0555491 | |||
| 1323 | Ga0495645_0670212 | |||
| 1324 | Ga0495622_0005537 | |||
| 1325 | Ga0495633_0367356 | |||
| 1326 | Ga0495668_0034575 | |||
| 1327 | Ga0495668_0046706 | |||
| 1328 | Ga0495668_0065544 | |||
| 1329 | Ga0495668_0129417 | |||
| 1330 | Ga0495668_0139269 | |||
| 1331 | Ga0495668_0146867 | |||
| 1332 | Ga0495668_0299814 | |||
| 1333 | Ga0495668_0517011 | |||
| 1334 | Ga0495668_0765807 | |||
| 1335 | Ga0495611_0068983 | |||
| 1336 | Ga0495625_0000051 | |||
| 1337 | Ga0495625_0006547 | |||
| 1338 | Ga0495625_0013474 | |||
| 1339 | Ga0495625_0027323 | |||
| 1340 | Ga0495625_0082583 | |||
| 1341 | Ga0495625_0095257 | |||
| 1342 | Ga0495625_0163634 | |||
| 1343 | Ga0495625_0554546 | |||
| 1344 | Ga0495625_0767920 | |||
| 1345 | Ga0495599_0851380 | |||
| 1346 | Ga0495646_0574800 | |||
| 1347 | Ga0495669_0000477 | |||
| 1348 | Ga0495669_0023009 | |||
| 1349 | Ga0495669_0507601 | |||
| 1350 | Ga0495624_0385633 | |||
| 1351 | Ga0495670_0303454 | |||
| 1352 | Ga0495670_0352809 | |||
| 1353 | Ga0495671_0142661 | |||
| 1354 | Ga0495589_0014765 | |||
| 1355 | Ga0495581_0267263 | |||
| 1356 | Ga0495674_0966016 | |||
| 1357 | Ga0495672_0005855 | |||
| 1358 | Ga0495687_157043 | |||
| 1359 | Ga0495677_0057749 | |||
| 1360 | Ga0495677_0096197 | |||
| 1361 | Ga0495673_0000082 | |||
| 1362 | Ga0495673_0000123 | |||
| 1363 | Ga0495673_0034715 | |||
| 1364 | Ga0495681_0068251 | |||
| 1365 | Ga0495681_0069336 | |||
| 1366 | Ga0495686_0004520 | |||
| 1367 | Ga0495686_0006301 | |||
| 1368 | Ga0495686_0011451 | |||
| 1369 | Ga0495686_0013415 | |||
| 1370 | Ga0495686_0257975 | |||
| 1371 | Ga0495686_0440258 | |||
| 1372 | Ga0495615_0289067 | |||
| 1373 | Ga0496100_0318744 | |||
| 1374 | Ga0496101_0049620 | |||
| 1375 | Ga0496101_0076253 | |||
| 1376 | Ga0496102_0023819 | |||
| 1377 | Ga0496102_0340101 | |||
| 1378 | Ga0496102_1652384 | |||
| 1379 | Ga0496103_0064568 | |||
| 1380 | Ga0496103_0151965 | |||
| 1381 | Ga0496103_0303400 | |||
| 1382 | Ga0496105_0785758 | |||
| 1383 | Ga0496106_0019483 | |||
| 1384 | Ga0496106_0028464 | |||
| 1385 | Ga0496106_0109995 | |||
| 1386 | Ga0496107_0000089 | |||
| 1387 | Ga0496108_0200224 | |||
| 1388 | Ga0496109_0059837 | |||
| 1389 | Ga0496110_0203105 | |||
| 1390 | Ga0496110_0722010 | |||
| 1391 | Ga0496111_0155001 | |||
| 1392 | Ga0496111_1086618 | |||
| 1393 | Ga0496112_0017757 | |||
| 1394 | Ga0496112_0777419 | |||
| 1395 | Ga0496113_0100344 | |||
| 1396 | Ga0496113_1138155 | |||
| 1397 | Ga0496115_0000844 | |||
| 1398 | Ga0496115_0020431 | |||
| 1399 | Ga0496115_0126466 | |||
| 1400 | Ga0496115_0595446 | |||
| 1401 | Ga0496115_1364311 | |||
| 1402 | Ga0496117_0071591 | |||
| 1403 | Ga0496118_0066986 | |||
| 1404 | Ga0496119_0018413 | |||
| 1405 | Ga0496121_0000009 | |||
| 1406 | Ga0496121_0011733 | |||
| 1407 | Ga0496121_0408321 | |||
| 1408 | Ga0496122_0284370 | |||
| 1409 | Ga0496126_0614604 | |||
| 1410 | Ga0495678_002925 | |||
| 1411 | Ga0501032_0067343 | |||
| 1412 | Ga0501033_0163064 | |||
| 1413 | Ga0501033_0636513 | |||
| 1414 | Ga0501034_0450498 | |||
| 1415 | Ga0501034_0884725 | |||
| 1416 | Ga0501043_0669402 | |||
| 1417 | Ga0501046_0520130 | |||
| 1418 | Ga0501047_0006760 | |||
| 1419 | Ga0501047_0117683 | |||
| 1420 | Ga0501047_0207573 | |||
| 1421 | Ga0501047_0567498 | |||
| 1422 | Ga0501047_0648677 | |||
| 1423 | Ga0501048_0108347 | |||
| 1424 | Ga0501070_0811786 | |||
| 1425 | Ga0501070_0927346 | |||
| 1426 | Ga0501238_001885 | |||
| 1427 | Ga0501257_001918 | |||
| 1428 | Ga0501273_061568 | |||
| 1429 | Ga0501035_0222077 | |||
| 1430 | Ga0501035_0790092 | |||
| 1431 | Ga0501035_1151900 | |||
| 1432 | Ga0501044_0053153 | |||
| 1433 | Ga0501044_0925092 | |||
| 1434 | Ga0501044_1382516 | |||
| 1435 | nmdc:mga03683_369814_c1 | |||
| 1436 | nmdc:mga03n38_34587_c1 | |||
| 1437 | nmdc:mga00v17_282_c1 | |||
| 1438 | nmdc:mga0k408_241688_c1 | |||
| 1439 | nmdc:mga0k408_58819_c1 | |||
| 1440 | nmdc:mga06z11_352155_c1 | |||
| 1441 | nmdc:mga07m45_151253_c1 | |||
| 1442 | nmdc:mga07m45_21610_c1 | |||
| 1443 | nmdc:mga07m45_2401_c1 | |||
| 1444 | Ga0500635_0000080 | |||
| 1445 | Ga0500635_0161421 | |||
| 1446 | Ga0500578_0001330 | |||
| 1447 | Ga0500578_0064139 | |||
| 1448 | Ga0500643_004128 | |||
| 1449 | Ga0500643_008375 | |||
| 1450 | Ga0500643_012178 | |||
| 1451 | Ga0500643_018221 | |||
| 1452 | Ga0500643_045349 | |||
| 1453 | Ga0500644_0000817 | |||
| 1454 | Ga0500646_0173628 | |||
| 1455 | Ga0500583_0112149 | |||
| 1456 | Ga0500651_0043669 | |||
| 1457 | Ga0500566_0025410 | |||
| 1458 | Ga0500641_0000989 | |||
| 1459 | Ga0500641_0033355 | |||
| 1460 | Ga0500641_0109676 | |||
| 1461 | Ga0500650_0129974 | |||
| 1462 | Ga0500554_004309 | |||
| 1463 | Ga0500555_006512 | |||
| 1464 | Ga0500555_092589 | |||
| 1465 | Ga0500556_0001038 | |||
| 1466 | Ga0500556_0004885 | |||
| 1467 | Ga0500556_0158860 | |||
| 1468 | Ga0500557_234064 | |||
| 1469 | Ga0500562_000175 | |||
| 1470 | Ga0500562_000192 | |||
| 1471 | Ga0500562_001492 | |||
| 1472 | Ga0500562_008146 | |||
| 1473 | Ga0500569_003741 | |||
| 1474 | Ga0500572_019183 | |||
| 1475 | Ga0500594_0000343 | |||
| 1476 | Ga0500595_026812 | |||
| 1477 | Ga0500595_094612 | |||
| 1478 | Ga0500608_020849 | |||
| 1479 | Ga0500614_021326 | |||
| 1480 | Ga0500614_042601 | |||
| 1481 | Ga0500618_000305 | |||
| 1482 | Ga0500642_0218173 | |||
| 1483 | Ga0500652_268592 | |||
| 1484 | Ga0500658_0010384 | |||
| 1485 | Ga0500559_0000002 | |||
| 1486 | Ga0500559_0000008 | |||
| 1487 | Ga0500559_0005600 | |||
| 1488 | Ga0500559_0009234 | |||
| 1489 | Ga0500564_008131 | |||
| 1490 | Ga0500564_386497 | |||
| 1491 | Ga0500568_0079455 | |||
| 1492 | Ga0500590_086804 | |||
| 1493 | Ga0500604_0257349 | |||
| 1494 | Ga0500616_0019532 | |||
| 1495 | Ga0500616_0294367 | |||
| 1496 | Ga0500616_0295944 | |||
| 1497 | Ga0500622_0000474 | |||
| 1498 | Ga0500622_0014049 | |||
| 1499 | Ga0500622_0187530 | |||
| 1500 | Ga0500622_0217929 | |||
| 1501 | Ga0500627_0028327 | |||
| 1502 | Ga0500633_0272677 | |||
| 1503 | Ga0500639_110398 | |||
| 1504 | Ga0500639_288500 | |||
| 1505 | Ga0500636_0008561 | |||
| 1506 | Ga0500637_0002594 | |||
| 1507 | Ga0500637_0490844 | |||
| 1508 | Ga0500576_083852 | |||
| 1509 | Ga0500645_000703 | |||
| 1510 | Ga0500645_002828 | |||
| 1511 | Ga0500645_004887 | |||
| 1512 | Ga0500645_034505 | |||
| 1513 | Ga0500609_000232 | |||
| 1514 | Ga0500596_003387 | |||
| 1515 | Ga0587091_214748 | |||
| 1516 | 2511123526 | |||
| 1517 | 2585150209 | |||
| 1518 | 2585153243 | |||
| 1519 | 2585196932 | |||
| 1520 | 2643748822 | |||
| 1521 | 2643778978 | |||
| 1522 | 2643923392 | |||
| 1523 | 2643930059 | |||
| 1524 | 2644001985 | |||
| 1525 | 2644085366 | |||
| 1526 | 2644342918 | |||
| 1527 | 2644366218 | |||
| 1528 | 2644509576 | |||
| 1529 | 2792463656 | |||
| 1530 | 2819539275 | |||
| 1531 | 2819648210 | |||
| 1532 | 2843748449 | |||
| 1533 | 2849562354 | |||
| 1534 | 2849574595 | |||
| 1535 | 2851155037 | |||
| 1536 | 2898330064 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xdp-assembly1.cif.gz_A-2 | crystal structure of the tudor domain of human jmjd2c | 0.6351 | 98 | 123 |
| 2mam-assembly1.cif.gz_A | solution structure of the interdigitated double tudor domain of rbbp1 | 0.6053 | 92 | 122 |
| 3ge2-assembly1.cif.gz_A-2 | crystal structure of putative lipoprotein sp_0198 from streptococcus pneumoniae | 0.5657 | 5 | 116 |
| 5cyb-assembly1.cif.gz_A-2 | structure of a lipocalin lipoprotein affecting virulence in streptococcus pneumoniae | 0.5505 | 22 | 116 |
| 3f6z-assembly1.cif.gz_B | crystal structure of pseudomonas aeruginosa mlic in complex with hen egg white lysozyme | 0.5409 | 3 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6PZ26_96_197_3.10.330.10 | Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; | 0.6133 | 99 | 120 | 3.10.330.10 |
| af_Q54GX5_101_179_3.10.330.10 | Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; | 0.6088 | 100 | 122 | 3.10.330.10 |
| 2gfaA02 | Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; | 0.5564 | 98 | 118 | 3.10.330.70 |
| af_Q22146_6_124_3.30.505.10 | Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain | 0.5554 | 51 | 78 | 3.30.505.10 |
| af_Q59037_3_203_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5326 | 24 | 84 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6RBY9-F1-model_v4 | Uncharacterized protein | 0.9413 | 3 | 123 |
|
| AF-A0A7C1MNV7-F1-model_v4 | deleted | 0.9324 | 1 | 123 |
|
| AF-A0A290MIP1-F1-model_v4 | Uncharacterized protein | 0.932 | 1 | 123 |
|
| AF-A0A2W5WZJ2-F1-model_v4 | Uncharacterized protein | 0.9317 | 1 | 123 |
|
| AF-A0A0P0NZK2-F1-model_v4 | Uncharacterized protein | 0.9272 | 1 | 123 |
|