F479957

General Info

Members Datasets Scaffolds Average Seq Length
768 386 1537 157

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0202467|Ga0373957_0202467_190_756
Length 188
Sequence VEEVVMTGTAVNPTPAAGRANGIGVNGKEMMMDARIDYLGNPLAMKLVKHINSAWAVLRNSALPAAAQELVKIRASQINGCGFCTDMHIKDALHAGESQQRLNLVAVWREATVFTEAERAALELAEQGTRIADAATGVTDEAWASAAKHYDEDQLAALVSLIAVINAYNRMNVITRQPAGDYQPGQWG

Samples

Sample ID Description Type Environment
1 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
98 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
99 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
308 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
312 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
313 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
317 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
318 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
321 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
322 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
328 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
329 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
330 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
331 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
332 2643221578 Streptomyces sp. Root63 Isolate Unclassified
333 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
334 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
335 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
336 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
337 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
338 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
339 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
340 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
341 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
342 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
343 2808606394 Promicromonospora sp. C35 Isolate Unclassified
344 2808606448 Streptomyces sp. 193411 Isolate Unclassified
345 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
346 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
347 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
348 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
349 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
350 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
351 2862574272 Streptomyces sp. AcE210 Isolate Nodule
352 2867369537 Streptomyces sp. Z26 Isolate Unclassified
353 2867428634 Streptomyces sp. RP5T Isolate Unclassified
354 2867475112 Streptomyces sp. TM32 Isolate Unclassified
355 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
356 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
357 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
358 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
359 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
360 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
361 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
362 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
363 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
364 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
365 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
366 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
367 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
368 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
369 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
370 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
371 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
372 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
373 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
374 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
375 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
376 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
377 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
378 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
379 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
380 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
381 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
382 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
383 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
384 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
385 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
386 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.84
Metatranscriptomes 0.65
Isolates 9.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0.39
Rhizoplane 3.65
Rhizosphere 82.55
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373957_0202467 3300035120 Bacteria 828
2 JGI24751J29686_10052271 3300002459 Bacteria 843
3 rootH1_10020868 3300003316 Bacteria 1997
4 rootH1_10020868 3300003323 Bacteria 5682
5 JGI25160J50197_1065114 3300003354 Bacteria 713
6 JGI25160J50197_1067936 3300003354 Bacteria 688
7 Ga0007429J51699_1055425 3300003579 Bacteria 631
8 Ga0070680_100331997 3300005336 Bacteria 1291
9 Ga0070682_100131654 3300005337 Bacteria 1693
10 Ga0070692_10423261 3300005345 Bacteria 846
11 Ga0070668_100000999 3300005347 Bacteria 19811
12 Ga0070668_100645027 3300005347 Bacteria 930
13 Ga0070667_100703421 3300005367 Bacteria 935
14 Ga0070709_10000243 3300005434 Bacteria 35120
15 Ga0070709_10012029 3300005434 Bacteria 4838
16 Ga0070714_100000182 3300005435 Bacteria 50060
17 Ga0070714_100002623 3300005435 Bacteria 13242
18 Ga0070714_100010478 3300005435 Bacteria 7327
19 Ga0070714_100026307 3300005435 Bacteria 4808
20 Ga0070714_100031751 3300005435 Bacteria 4409
21 Ga0070714_100058634 3300005435 Bacteria 3299
22 Ga0070714_100361420 3300005435 Bacteria 1365
23 Ga0070714_101419948 3300005435 Bacteria 678
24 Ga0070713_100022851 3300005436 Bacteria 4840
25 Ga0070713_100065781 3300005436 Bacteria 3047
26 Ga0070713_100106274 3300005436 Bacteria 2440
27 Ga0070713_100155732 3300005436 Bacteria 2036
28 Ga0070713_100166880 3300005436 Bacteria 1969
29 Ga0070713_100417314 3300005436 Bacteria 1256
30 Ga0070713_100818684 3300005436 Bacteria 893
31 Ga0070710_10050201 3300005437 Bacteria 2337
32 Ga0070710_10258524 3300005437 Bacteria 1122
33 Ga0070711_100005834 3300005439 Bacteria 7392
34 Ga0070711_101723033 3300005439 Bacteria 549
35 Ga0070708_100125524 3300005445 Bacteria 2371
36 Ga0070708_100615482 3300005445 Bacteria 1024
37 Ga0070681_10305117 3300005458 Bacteria 1501
38 Ga0070681_10341121 3300005458 Bacteria 1408
39 Ga0070681_10700953 3300005458 Bacteria 928
40 Ga0070681_10713704 3300005458 Bacteria 919
41 Ga0070706_100002002 3300005467 Bacteria 20967
42 Ga0070706_100005239 3300005467 Bacteria 12364
43 Ga0070706_100039325 3300005467 Bacteria 4367
44 Ga0070706_100069369 3300005467 Bacteria 3260
45 Ga0070706_100095338 3300005467 Bacteria 2762
46 Ga0070706_100329543 3300005467 Bacteria 1424
47 Ga0070706_100855151 3300005467 Bacteria 841
48 Ga0070707_100000797 3300005468 Bacteria 31116
49 Ga0070707_100003785 3300005468 Bacteria 14274
50 Ga0070707_100017217 3300005468 Bacteria 6792
51 Ga0070707_100055232 3300005468 Bacteria 3807
52 Ga0070707_100062019 3300005468 Bacteria 3586
53 Ga0070707_100313726 3300005468 Bacteria 1524
54 Ga0070698_100002141 3300005471 Bacteria 21908
55 Ga0070698_100009098 3300005471 Bacteria 10673
56 Ga0070698_100018894 3300005471 Bacteria 7250
57 Ga0070698_100036167 3300005471 Bacteria 5104
58 Ga0070699_100099753 3300005518 Bacteria 2545
59 Ga0070699_100843362 3300005518 Bacteria 839
60 Ga0070679_100680198 3300005530 Bacteria 972
61 Ga0070684_100794916 3300005535 Bacteria 884
62 Ga0070697_100170924 3300005536 Bacteria 1840
63 Ga0068853_100613103 3300005539 Bacteria 1034
64 Ga0068856_101245493 3300005614 Bacteria 760
65 Ga0068852_100186405 3300005616 Bacteria 1954
66 Ga0068863_101604152 3300005841 Bacteria 660
67 Ga0081455_10001878 3300005937 Bacteria 25279
68 Ga0081455_10003313 3300005937 Bacteria 18620
69 Ga0081455_10021368 3300005937 Bacteria 6072
70 Ga0081455_10080421 3300005937 Bacteria 2672
71 Ga0081455_10209498 3300005937 Bacteria 1453
72 Ga0081455_10771896 3300005937 Bacteria 606
73 Ga0070717_10008469 3300006028 Bacteria 7683
74 Ga0070717_10024414 3300006028 Bacteria 4800
75 Ga0070717_10136254 3300006028 Bacteria 2115
76 Ga0070717_10173275 3300006028 Bacteria 1878
77 Ga0070717_10224223 3300006028 Bacteria 1653
78 Ga0070717_10337286 3300006028 Bacteria 1345
79 Ga0070717_10743957 3300006028 Bacteria 891
80 Ga0070717_11775248 3300006028 Bacteria 558
81 Ga0075365_10079608 3300006038 Bacteria 2217
82 Ga0075365_10148913 3300006038 Bacteria 1628
83 Ga0075363_100000934 3300006048 Bacteria 10342
84 Ga0075363_100069457 3300006048 Bacteria 1911
85 Ga0075364_10006246 3300006051 Bacteria 6985
86 Ga0075364_10629625 3300006051 Bacteria 733
87 Ga0070715_10100287 3300006163 Bacteria 1349
88 Ga0070716_100002854 3300006173 Bacteria 8048
89 Ga0070716_100358272 3300006173 Bacteria 1035
90 Ga0070716_100558399 3300006173 Bacteria 855
91 Ga0070712_100075671 3300006175 Bacteria 2422
92 Ga0070712_100125328 3300006175 Bacteria 1939
93 Ga0070712_100246365 3300006175 Bacteria 1426
94 Ga0075362_10096024 3300006177 Bacteria 1381
95 Ga0075367_10036907 3300006178 Bacteria 2836
96 Ga0075367_10295956 3300006178 Bacteria 1019
97 Ga0075369_10068077 3300006186 Bacteria 1564
98 Ga0075370_10183041 3300006353 Bacteria 1233
99 Ga0075433_10473373 3300006852 Bacteria 1103
100 Ga0075434_100133897 3300006871 Bacteria 2498
101 Ga0075436_100178011 3300006914 Bacteria 1503
102 Ga0075436_101026091 3300006914 Bacteria 619
103 Ga0075435_100034581 3300007076 Bacteria 4005
104 Ga0099794_10228130 3300007265 Bacteria 958
105 Ga0099795_10376440 3300007788 Bacteria 640
106 Ga0111539_10038228 3300009094 Bacteria 5789
107 Ga0111539_11223338 3300009094 Bacteria 872
108 Ga0105245_10532095 3300009098 Bacteria 1195
109 Ga0114129_10493987 3300009147 Bacteria 1599
110 Ga0105241_10043884 3300009174 Bacteria 3386
111 Ga0105242_11195285 3300009176 Bacteria 779
112 Ga0105248_10057340 3300009177 Bacteria 4372
113 Ga0105237_10002906 3300009545 Bacteria 20779
114 Ga0105238_10056909 3300009551 Bacteria 3922
115 Ga0105238_10377041 3300009551 Bacteria 1409
116 Ga0105238_10769318 3300009551 Bacteria 977
117 Ga0105239_10096779 3300010375 Bacteria 3261
118 Ga0105239_10225151 3300010375 Bacteria 2104
119 Ga0157370_10101229 3300013104 Bacteria 2699
120 Ga0157369_11700891 3300013105 Bacteria 641
121 Ga0157374_10271997 3300013296 Bacteria 1671
122 Ga0157378_10373596 3300013297 Bacteria 1398
123 Ga0163162_10372860 3300013306 Bacteria 1560
124 Ga0163162_12090630 3300013306 Bacteria 649
125 Ga0157372_10609819 3300013307 Bacteria 1272
126 Ga0157375_10678910 3300013308 Bacteria 1185
127 Ga0157375_12800311 3300013308 Bacteria 583
128 Ga0163163_10789778 3300014325 Bacteria 1013
129 Ga0182008_10791943 3300014497 Bacteria 549
130 Ga0157379_10092229 3300014968 Bacteria 2717
131 Ga0157379_10331580 3300014968 Bacteria 1390
132 Ga0157376_10517381 3300014969 Bacteria 1176
133 Ga0206353_11048574 3300020082 Bacteria 531
134 Ga0224572_1008048 3300024225 Bacteria 1944
135 Ga0209025_1028809 3300025294 Bacteria 2708
136 Ga0209758_1013803 3300025297 Bacteria 4366
137 Ga0207426_1001133 3300025302 Bacteria 24068
138 Ga0207426_1018973 3300025302 Bacteria 2413
139 Ga0207426_1052728 3300025302 Bacteria 1203
140 Ga0207692_10002709 3300025898 Bacteria 6827
141 Ga0207692_10010071 3300025898 Bacteria 3969
142 Ga0207692_10238155 3300025898 Bacteria 1086
143 Ga0207692_10275582 3300025898 Bacteria 1016
144 Ga0207699_10001799 3300025906 Bacteria 10073
145 Ga0207699_10004721 3300025906 Bacteria 6511
146 Ga0207699_10106163 3300025906 Bacteria 1792
147 Ga0207684_10004995 3300025910 Bacteria 12358
148 Ga0207684_10026372 3300025910 Bacteria 4954
149 Ga0207684_10094456 3300025910 Bacteria 2550
150 Ga0207684_10120710 3300025910 Bacteria 2247
151 Ga0207684_10231113 3300025910 Bacteria 1596
152 Ga0207684_10278049 3300025910 Bacteria 1444
153 Ga0207684_10345372 3300025910 Bacteria 1281
154 Ga0207684_10760491 3300025910 Bacteria 821
155 Ga0207707_10379540 3300025912 Bacteria 1215
156 Ga0207671_10271298 3300025914 Bacteria 1337
157 Ga0207671_11194469 3300025914 Bacteria 595
158 Ga0207693_10026948 3300025915 Bacteria 4546
159 Ga0207693_10638234 3300025915 Bacteria 828
160 Ga0207663_10003868 3300025916 Bacteria 7391
161 Ga0207663_10451028 3300025916 Bacteria 992
162 Ga0207663_11402271 3300025916 Bacteria 563
163 Ga0207657_10649598 3300025919 Bacteria 821
164 Ga0207652_10378761 3300025921 Bacteria 1277
165 Ga0207646_10000388 3300025922 Bacteria 59041
166 Ga0207646_10019127 3300025922 Bacteria 6369
167 Ga0207646_10025051 3300025922 Bacteria 5461
168 Ga0207646_10064922 3300025922 Bacteria 3259
169 Ga0207646_10154867 3300025922 Bacteria 2067
170 Ga0207700_10002168 3300025928 Bacteria 11246
171 Ga0207700_10005439 3300025928 Bacteria 7624
172 Ga0207700_10022222 3300025928 Bacteria 4348
173 Ga0207700_10125882 3300025928 Bacteria 2085
174 Ga0207700_10985188 3300025928 Bacteria 754
175 Ga0207700_11418387 3300025928 Bacteria 617
176 Ga0207664_10000185 3300025929 Bacteria 47364
177 Ga0207664_10014432 3300025929 Bacteria 5705
178 Ga0207664_10019092 3300025929 Bacteria 5060
179 Ga0207664_10029998 3300025929 Bacteria 4149
180 Ga0207664_10066428 3300025929 Bacteria 2891
181 Ga0207664_10188484 3300025929 Bacteria 1774
182 Ga0207664_10189469 3300025929 Bacteria 1770
183 Ga0207664_10423453 3300025929 Bacteria 1186
184 Ga0207664_11493683 3300025929 Bacteria 597
185 Ga0207709_10175183 3300025935 Bacteria 1509
186 Ga0207704_10273587 3300025938 Bacteria 1280
187 Ga0207665_10000276 3300025939 Bacteria 35590
188 Ga0207661_10116002 3300025944 Bacteria 2273
189 Ga0207661_10552449 3300025944 Bacteria 1055
190 Ga0207712_10238527 3300025961 Bacteria 1463
191 Ga0207668_10005675 3300025972 Bacteria 7347
192 Ga0207668_10300864 3300025972 Bacteria 1324
193 Ga0207668_11785243 3300025972 Bacteria 555
194 Ga0207658_10894192 3300025986 Bacteria 808
195 Ga0207639_10620742 3300026041 Bacteria 998
196 Ga0207702_11528954 3300026078 Bacteria 661
197 Ga0207641_10930965 3300026088 Bacteria 864
198 Ga0209588_1124427 3300027671 Bacteria 824
199 Ga0207428_10158678 3300027907 Bacteria 1719
200 Ga0307515_10010500 3300028794 Bacteria 17741
201 Ga0310981_1073946 3300029285 Bacteria 568
202 Ga0316180_1150693 3300030736 Bacteria 709
203 Ga0265767_113261 3300030836 Bacteria 577
204 Ga0307513_10001044 3300031456 Bacteria 40198
205 Ga0307508_10002208 3300031616 Bacteria 20759
206 Ga0310113_132598 3300031636 Bacteria 500
207 Ga0307516_10137779 3300031730 Bacteria 2213
208 Ga0307516_10245121 3300031730 Bacteria 1489
209 Ga0307516_10665707 3300031730 Bacteria 697
210 Ga0307407_10037821 3300031903 Bacteria 2669
211 Ga0307507_10032370 3300033179 Bacteria 5460
212 Ga0373926_0014693 3300035083 Bacteria 2664
213 Ga0373934_0054249 3300035086 Bacteria 1591
214 Ga0373934_0117034 3300035086 Bacteria 1083
215 Ga0373940_0031571 3300035088 Bacteria 1415
216 Ga0373944_0042516 3300035089 Bacteria 1409
217 Ga0373951_0077153 3300035091 Bacteria 857
218 Ga0373952_0019090 3300035092 Bacteria 1424
219 Ga0373923_0015828 3300035111 Bacteria 2853
220 Ga0373936_0001085 3300035113 Bacteria 9744
221 Ga0373936_0474554 3300035113 Bacteria 580
222 Ga0373941_0153120 3300035115 Bacteria 847
223 Ga0373953_0033808 3300035117 Bacteria 2001
224 Ga0373954_0077090 3300035118 Bacteria 1589
225 Ga0373957_0064102 3300035120 Bacteria 1428
226 Ga0373957_0194638 3300035120 Bacteria 843
227 Ga0373943_0318743 3300035170 Bacteria 886
228 Ga0373946_0207683 3300035171 Bacteria 940
229 Ga0373955_0064434 3300035172 Bacteria 2032
230 Ga0373955_0382247 3300035172 Bacteria 854
231 Ga0373961_0021928 3300035241 Bacteria 1703
232 Ga0373962_0206467 3300035242 Bacteria 667
233 Ga0373924_0151194 3300035410 Bacteria 1016
234 Ga0373931_0191376 3300035691 Bacteria 1217
235 Ga0373935_0018217 3300035692 Bacteria 4270
236 Ga0373935_0038838 3300035692 Bacteria 2982
237 Ga0373935_0247500 3300035692 Bacteria 1246
238 Ga0373935_0603689 3300035692 Bacteria 803
239 Ga0373927_0266302 3300035695 Bacteria 1127
240 Ga0373927_0568183 3300035695 Bacteria 749
241 Ga0373933_0006460 3300035724 Bacteria 6388
242 Ga0373933_0157801 3300035724 Bacteria 1439
243 Ga0373937_0007312 3300036401 Bacteria 9558
244 Ga0373937_0067516 3300036401 Bacteria 3294
245 Ga0373925_0288236 3300037068 Bacteria 1323
246 Ga0373925_0441790 3300037068 Bacteria 1064
247 Ga0373925_0730010 3300037068 Bacteria 817
248 Ga0395900_0089759 3300037418 Bacteria 3159
249 Ga0395900_1214336 3300037418 Bacteria 669
250 Ga0395898_0038494 3300037466 Bacteria 4739
251 Ga0395905_0062522 3300037471 Bacteria 3483
252 Ga0436364_0711543 3300037853 Bacteria 3161
253 Ga0395901_0013227 3300038443 Bacteria 8379
254 Ga0439439_0049121 3300041406 Bacteria 1104
255 Ga0451845_0109047 3300041501 Bacteria 933
256 Ga0451853_1842263 3300041512 Bacteria 4386
257 Ga0439448_0033199 3300042005 Bacteria 1646
258 Ga0439449_0172853 3300042007 Bacteria 807
259 Ga0439457_001103 3300042014 Bacteria 8140
260 Ga0466972_0004325 3300044658 Bacteria 7097
261 Ga0466972_0010294 3300044658 Bacteria 4696
262 Ga0466972_0034769 3300044658 Bacteria 2467
263 Ga0466965_0011338 3300044683 Bacteria 4175
264 Ga0466965_0128087 3300044683 Bacteria 1314
265 Ga0466965_0511661 3300044683 Bacteria 674
266 Ga0466966_0000993 3300044684 Bacteria 18195
267 Ga0466966_0005232 3300044684 Bacteria 8531
268 Ga0466966_0037421 3300044684 Bacteria 3129
269 Ga0466961_0002945 3300044693 Bacteria 10572
270 Ga0466961_0014665 3300044693 Bacteria 5035
271 Ga0466961_0218890 3300044693 Bacteria 1174
272 Ga0466961_0328977 3300044693 Bacteria 931
273 Ga0466963_0004374 3300044694 Bacteria 8206
274 Ga0466963_0136025 3300044694 Bacteria 1700
275 Ga0466963_0283505 3300044694 Bacteria 1164
276 Ga0466963_0357103 3300044694 Bacteria 1029
277 Ga0466964_0122966 3300044706 Bacteria 1172
278 Ga0466964_0349969 3300044706 Bacteria 759
279 Ga0466971_0039488 3300044719 Bacteria 2118
280 Ga0466971_0262655 3300044719 Bacteria 824
281 Ga0466970_0005079 3300044765 Bacteria 6506
282 Ga0466970_0419868 3300044765 Bacteria 765
283 Ga0466957_0058405 3300044842 Bacteria 2363
284 Ga0466960_0023801 3300044901 Bacteria 2754
285 Ga0466960_0191888 3300044901 Bacteria 1112
286 Ga0466959_0091410 3300045049 Bacteria 2185
287 Ga0466959_0158740 3300045049 Bacteria 1590
288 Ga0466959_0362554 3300045049 Bacteria 987
289 Ga0466967_0000252 3300045976 Bacteria 23522
290 Ga0466967_0034819 3300045976 Bacteria 4279
291 Ga0466967_0167963 3300045976 Bacteria 2062
292 Ga0495592_0001754 3300046454 Bacteria 15250
293 Ga0495592_0063425 3300046454 Bacteria 2710
294 Ga0495592_0148813 3300046454 Bacteria 1621
295 Ga0495603_0005510 3300046455 Bacteria 7549
296 Ga0495603_0020663 3300046455 Bacteria 3988
297 Ga0495590_0075706 3300046457 Bacteria 1184
298 Ga0495629_0000993 3300046459 Bacteria 22718
299 Ga0495629_0008057 3300046459 Bacteria 7756
300 Ga0495629_0054178 3300046459 Bacteria 2805
301 Ga0495629_0189633 3300046459 Bacteria 1423
302 Ga0495638_0081381 3300046460 Bacteria 1966
303 Ga0495641_0012442 3300046461 Bacteria 4760
304 Ga0495641_0034761 3300046461 Bacteria 2380
305 Ga0495651_0008928 3300046462 Bacteria 7696
306 Ga0495651_0116464 3300046462 Bacteria 1969
307 Ga0495651_0267181 3300046462 Bacteria 1161
308 Ga0495651_0289962 3300046462 Bacteria 1102
309 Ga0495651_0322253 3300046462 Bacteria 1030
310 Ga0495653_0020708 3300046463 Bacteria 5327
311 Ga0495653_0079129 3300046463 Bacteria 2435
312 Ga0495653_0110683 3300046463 Bacteria 1974
313 Ga0495653_0111736 3300046463 Bacteria 1962
314 Ga0495580_0198847 3300046472 Bacteria 1381
315 Ga0495582_0006119 3300046473 Bacteria 6700
316 Ga0495582_0064429 3300046473 Bacteria 2023
317 Ga0495582_0788114 3300046473 Bacteria 550
318 Ga0495605_0044000 3300046474 Bacteria 2210
319 Ga0495639_0016672 3300046475 Bacteria 3190
320 Ga0495639_0094579 3300046475 Bacteria 1405
321 Ga0495662_0020691 3300046476 Bacteria 3183
322 Ga0495662_0050364 3300046476 Bacteria 2010
323 Ga0495662_0069800 3300046476 Bacteria 1702
324 Ga0495664_0028603 3300046477 Bacteria 3254
325 Ga0495664_0029014 3300046477 Bacteria 3234
326 Ga0495664_0056716 3300046477 Bacteria 2330
327 Ga0495664_0069453 3300046477 Bacteria 2103
328 Ga0495664_0324597 3300046477 Bacteria 928
329 Ga0495584_0019775 3300046491 Bacteria 3421
330 Ga0495584_0299868 3300046491 Bacteria 816
331 Ga0495585_0165030 3300046492 Bacteria 1147
332 Ga0495594_0081206 3300046499 Bacteria 1810
333 Ga0495594_0152129 3300046499 Bacteria 1314
334 Ga0495594_0236869 3300046499 Bacteria 1040
335 Ga0495594_0327479 3300046499 Bacteria 872
336 Ga0495596_0077233 3300046500 Bacteria 1293
337 Ga0495583_0004414 3300046506 Bacteria 10087
338 Ga0495583_0007461 3300046506 Bacteria 6863
339 Ga0495606_0013530 3300046507 Bacteria 6436
340 Ga0495606_0034967 3300046507 Bacteria 3441
341 Ga0495606_0084459 3300046507 Bacteria 1966
342 Ga0495608_0003977 3300046511 Bacteria 10612
343 Ga0495608_0039333 3300046511 Bacteria 3170
344 Ga0495608_0662230 3300046511 Bacteria 623
345 Ga0495610_0160122 3300046512 Bacteria 952
346 Ga0495616_0070015 3300046513 Bacteria 1699
347 Ga0495618_0033586 3300046514 Bacteria 3217
348 Ga0495618_0038614 3300046514 Bacteria 3001
349 Ga0495618_0050834 3300046514 Bacteria 2619
350 Ga0495618_0117535 3300046514 Bacteria 1702
351 Ga0495618_0157682 3300046514 Bacteria 1448
352 Ga0495620_0004525 3300046515 Bacteria 7825
353 Ga0495620_0027352 3300046515 Bacteria 2669
354 Ga0495628_0023016 3300046516 Bacteria 5115
355 Ga0495628_0085158 3300046516 Bacteria 2452
356 Ga0495628_0251438 3300046516 Bacteria 1319
357 Ga0495630_0012665 3300046517 Bacteria 6129
358 Ga0495630_0029158 3300046517 Bacteria 4101
359 Ga0495630_0059914 3300046517 Bacteria 2856
360 Ga0495630_0633224 3300046517 Bacteria 819
361 Ga0495632_0032177 3300046519 Bacteria 2705
362 Ga0495643_0009009 3300046522 Bacteria 6265
363 Ga0495643_0026392 3300046522 Bacteria 3278
364 Ga0495643_0141985 3300046522 Bacteria 1196
365 Ga0495644_0131379 3300046523 Bacteria 954
366 Ga0495648_0085944 3300046524 Bacteria 1775
367 Ga0495648_0166182 3300046524 Bacteria 1135
368 Ga0495648_0168824 3300046524 Bacteria 1123
369 Ga0495666_0366943 3300046526 Bacteria 648
370 Ga0495642_0005802 3300046528 Bacteria 4735
371 Ga0495642_0278456 3300046528 Bacteria 732
372 Ga0495652_0019442 3300046529 Bacteria 6049
373 Ga0495652_0034044 3300046529 Bacteria 4442
374 Ga0495652_0442948 3300046529 Bacteria 911
375 Ga0495654_0024894 3300046530 Bacteria 3088
376 Ga0495665_0003001 3300046531 Bacteria 9116
377 Ga0495665_0003331 3300046531 Bacteria 8709
378 Ga0495665_0067765 3300046531 Bacteria 1882
379 Ga0495640_0019113 3300046533 Bacteria 5062
380 Ga0495640_0022767 3300046533 Bacteria 4575
381 Ga0495640_0029500 3300046533 Bacteria 3939
382 Ga0495640_0058626 3300046533 Bacteria 2625
383 Ga0495640_0068050 3300046533 Bacteria 2397
384 Ga0495640_0195480 3300046533 Bacteria 1284
385 Ga0495587_0001773 3300046536 Bacteria 14435
386 Ga0495587_0033088 3300046536 Bacteria 3122
387 Ga0495597_0021940 3300046542 Bacteria 2965
388 Ga0495597_0035792 3300046542 Bacteria 2238
389 Ga0495645_0007934 3300046543 Bacteria 7388
390 Ga0495645_0053069 3300046543 Bacteria 2947
391 Ga0495645_0062199 3300046543 Bacteria 2704
392 Ga0495645_0506320 3300046543 Bacteria 754
393 Ga0495667_0003876 3300046559 Bacteria 10035
394 Ga0495667_0069027 3300046559 Bacteria 2307
395 Ga0495667_0116064 3300046559 Bacteria 1729
396 Ga0495668_0031753 3300046616 Bacteria 2976
397 Ga0495668_0033519 3300046616 Bacteria 2885
398 Ga0495668_0036947 3300046616 Bacteria 2735
399 Ga0495634_0024098 3300046642 Bacteria 4273
400 Ga0495634_0028096 3300046642 Bacteria 3907
401 Ga0495634_0106823 3300046642 Bacteria 1803
402 Ga0495634_0108601 3300046642 Bacteria 1786
403 Ga0495611_0011969 3300046648 Bacteria 3685
404 Ga0495611_0052640 3300046648 Bacteria 1837
405 Ga0495625_0109242 3300046660 Bacteria 1892
406 Ga0495625_0122246 3300046660 Bacteria 1770
407 Ga0495625_0135607 3300046660 Bacteria 1664
408 Ga0495635_0028867 3300046663 Bacteria 3856
409 Ga0495635_0105085 3300046663 Bacteria 1929
410 Ga0495635_0139673 3300046663 Bacteria 1650
411 Ga0495635_0279496 3300046663 Bacteria 1121
412 Ga0495661_0017886 3300046665 Bacteria 4672
413 Ga0495588_0163245 3300046674 Bacteria 1178
414 Ga0495657_0001635 3300046675 Bacteria 19237
415 Ga0495657_0009054 3300046675 Bacteria 7570
416 Ga0495657_0103849 3300046675 Bacteria 1807
417 Ga0495657_0223888 3300046675 Bacteria 1139
418 Ga0495657_0491895 3300046675 Bacteria 716
419 Ga0495599_0003611 3300046678 Bacteria 9073
420 Ga0495599_0054988 3300046678 Bacteria 2493
421 Ga0495599_0092148 3300046678 Bacteria 1891
422 Ga0495599_0114681 3300046678 Bacteria 1677
423 Ga0495599_0115970 3300046678 Bacteria 1666
424 Ga0495599_0271997 3300046678 Bacteria 1028
425 Ga0495623_0047445 3300046679 Bacteria 2726
426 Ga0495623_0083852 3300046679 Bacteria 1967
427 Ga0495623_0178721 3300046679 Bacteria 1234
428 Ga0495646_0008226 3300046680 Bacteria 6631
429 Ga0495646_0039848 3300046680 Bacteria 2894
430 Ga0495646_0065285 3300046680 Bacteria 2155
431 Ga0495646_0279090 3300046680 Bacteria 888
432 Ga0495647_0029768 3300046681 Bacteria 2021
433 Ga0495658_0017622 3300046683 Bacteria 3694
434 Ga0495658_0066776 3300046683 Bacteria 2078
435 Ga0495613_0000667 3300046689 Bacteria 27203
436 Ga0495613_0019549 3300046689 Bacteria 5048
437 Ga0495613_0025768 3300046689 Bacteria 4382
438 Ga0495613_0027494 3300046689 Bacteria 4232
439 Ga0495613_0065132 3300046689 Bacteria 2663
440 Ga0495613_0411230 3300046689 Bacteria 921
441 Ga0495613_0841389 3300046689 Bacteria 597
442 Ga0495624_0007553 3300046690 Bacteria 7626
443 Ga0495624_0015616 3300046690 Bacteria 5122
444 Ga0495670_0012054 3300046691 Bacteria 4254
445 Ga0495670_0445345 3300046691 Bacteria 702
446 Ga0495671_0092290 3300046692 Bacteria 1482
447 Ga0495649_0069262 3300046694 Bacteria 1892
448 Ga0495649_0089896 3300046694 Bacteria 1637
449 Ga0495589_0003521 3300046794 Bacteria 8473
450 Ga0495589_0005343 3300046794 Bacteria 6777
451 Ga0495589_0014224 3300046794 Bacteria 4100
452 Ga0495589_0020265 3300046794 Bacteria 3402
453 Ga0495600_0003763 3300046809 Bacteria 8980
454 Ga0495600_0100083 3300046809 Bacteria 1889
455 Ga0495600_0207646 3300046809 Bacteria 1256
456 Ga0495600_0329390 3300046809 Bacteria 959
457 Ga0495600_0643310 3300046809 Bacteria 641
458 Ga0495660_0135237 3300046810 Bacteria 1232
459 Ga0495581_0002854 3300047315 Bacteria 9865
460 Ga0495581_0013447 3300047315 Bacteria 4746
461 Ga0495581_0022850 3300047315 Bacteria 3622
462 Ga0495581_0534629 3300047315 Bacteria 681
463 Ga0495604_0061427 3300047317 Bacteria 2874
464 Ga0495604_0097539 3300047317 Bacteria 2167
465 Ga0495604_0099909 3300047317 Bacteria 2134
466 Ga0495604_0123620 3300047317 Bacteria 1869
467 Ga0495604_0897959 3300047317 Bacteria 553
468 Ga0495636_0018799 3300047318 Bacteria 2773
469 Ga0495636_0160579 3300047318 Bacteria 1012
470 Ga0495674_0005959 3300047319 Bacteria 11690
471 Ga0495674_0090813 3300047319 Bacteria 2609
472 Ga0495674_0206549 3300047319 Bacteria 1628
473 Ga0495674_0289991 3300047319 Bacteria 1338
474 Ga0495674_0796841 3300047319 Bacteria 735
475 Ga0495672_0000619 3300047320 Bacteria 39643
476 Ga0495672_0056233 3300047320 Bacteria 2291
477 Ga0495672_0419299 3300047320 Bacteria 609
478 Ga0495676_0001955 3300047321 Bacteria 18096
479 Ga0495676_0007884 3300047321 Bacteria 9762
480 Ga0495676_0010871 3300047321 Bacteria 8233
481 Ga0495676_0027322 3300047321 Bacteria 4894
482 Ga0495676_0061731 3300047321 Bacteria 2930
483 Ga0495676_0271711 3300047321 Bacteria 1150
484 Ga0495676_0646096 3300047321 Bacteria 687
485 Ga0495676_0652055 3300047321 Bacteria 683
486 Ga0495680_0000649 3300047322 Bacteria 39022
487 Ga0495680_0014200 3300047322 Bacteria 6910
488 Ga0495680_0077746 3300047322 Bacteria 2513
489 Ga0495680_0097901 3300047322 Bacteria 2189
490 Ga0495680_0242127 3300047322 Bacteria 1281
491 Ga0495680_0598194 3300047322 Bacteria 738
492 Ga0495687_008120 3300047443 Bacteria 6059
493 Ga0495687_009260 3300047443 Bacteria 5529
494 Ga0495687_018188 3300047443 Bacteria 3480
495 Ga0495687_030971 3300047443 Bacteria 2459
496 Ga0495687_127248 3300047443 Bacteria 908
497 Ga0495687_135951 3300047443 Bacteria 862
498 Ga0495675_0062605 3300047444 Bacteria 2355
499 Ga0495675_0284882 3300047444 Bacteria 984
500 Ga0495677_0005888 3300047445 Bacteria 4644
501 Ga0495685_001274 3300047447 Bacteria 7697
502 Ga0495685_006240 3300047447 Bacteria 3897
503 Ga0495685_007570 3300047447 Bacteria 3589
504 Ga0495685_099175 3300047447 Bacteria 962
505 Ga0495673_0006744 3300047469 Bacteria 6709
506 Ga0495673_0143977 3300047469 Bacteria 927
507 Ga0495681_0002904 3300047470 Bacteria 12114
508 Ga0495681_0373290 3300047470 Bacteria 538
509 Ga0495684_0037548 3300047471 Bacteria 3715
510 Ga0495684_0070733 3300047471 Bacteria 2652
511 Ga0495686_0151304 3300047472 Bacteria 1362
512 Ga0495593_0003917 3300047673 Bacteria 8892
513 Ga0495593_0007394 3300047673 Bacteria 6434
514 Ga0495593_0028981 3300047673 Bacteria 3039
515 Ga0495593_0126214 3300047673 Bacteria 1300
516 Ga0495602_0095793 3300048088 Bacteria 2449
517 Ga0495602_0261373 3300048088 Bacteria 1284
518 Ga0495602_0584761 3300048088 Bacteria 770
519 Ga0495602_0676528 3300048088 Bacteria 702
520 Ga0495614_0002000 3300048089 Bacteria 8965
521 Ga0495614_0025438 3300048089 Bacteria 2553
522 Ga0495614_0047064 3300048089 Bacteria 1849
523 Ga0495614_0113696 3300048089 Bacteria 1189
524 Ga0495614_0117850 3300048089 Bacteria 1169
525 Ga0495614_0213925 3300048089 Bacteria 874
526 Ga0495626_0065860 3300048091 Bacteria 1639
527 Ga0495626_0293008 3300048091 Bacteria 644
528 Ga0496100_0002164 3300048903 Bacteria 9894
529 Ga0496100_0410728 3300048903 Bacteria 1032
530 Ga0496100_0909821 3300048903 Bacteria 691
531 Ga0496101_0000213 3300048904 Bacteria 43662
532 Ga0496101_0022971 3300048904 Bacteria 4302
533 Ga0496102_0000483 3300048905 Bacteria 44220
534 Ga0496102_0189586 3300048905 Bacteria 1937
535 Ga0496103_0000323 3300048906 Bacteria 43761
536 Ga0496104_0029410 3300048907 Bacteria 5096
537 Ga0496104_1582669 3300048907 Bacteria 558
538 Ga0496105_0026379 3300048908 Bacteria 4738
539 Ga0496106_0082045 3300048909 Bacteria 2478
540 Ga0496107_0038499 3300048910 Bacteria 3430
541 Ga0496107_0280979 3300048910 Bacteria 1239
542 Ga0496108_0031212 3300048911 Bacteria 4419
543 Ga0496108_0473470 3300048911 Bacteria 1094
544 Ga0496109_0021543 3300048912 Bacteria 5701
545 Ga0496110_0331039 3300048913 Bacteria 1387
546 Ga0496111_0288096 3300048914 Bacteria 1218
547 Ga0496112_0165527 3300048915 Bacteria 2177
548 Ga0496112_0662406 3300048915 Bacteria 973
549 Ga0496113_0269281 3300048916 Bacteria 1361
550 Ga0496113_0283272 3300048916 Bacteria 1325
551 Ga0496114_0045716 3300048917 Bacteria 3638
552 Ga0496114_1599420 3300048917 Bacteria 540
553 Ga0496115_0009849 3300048918 Bacteria 7116
554 Ga0496115_0166754 3300048918 Bacteria 1821
555 Ga0496116_0000691 3300048919 Bacteria 43800
556 Ga0496117_0000018 3300048920 Bacteria 479613
557 Ga0496118_0000013 3300048921 Bacteria 574008
558 Ga0496118_0001697 3300048921 Bacteria 32208
559 Ga0496119_0010794 3300048922 Bacteria 7646
560 Ga0496121_0002814 3300048924 Bacteria 25727
561 Ga0496126_0000902 3300048929 Bacteria 51705
562 Ga0496126_0431232 3300048929 Bacteria 1064
563 Ga0495678_045845 3300049459 Bacteria 1722
564 Ga0501031_0012733 3300049568 Bacteria 5495
565 Ga0501031_0033560 3300049568 Bacteria 3348
566 Ga0501032_0003359 3300049569 Bacteria 12282
567 Ga0501032_0013431 3300049569 Bacteria 5824
568 Ga0501032_0151761 3300049569 Bacteria 1523
569 Ga0501033_0003517 3300049570 Bacteria 12827
570 Ga0501033_0463225 3300049570 Bacteria 879
571 Ga0501034_0010616 3300049571 Bacteria 9585
572 Ga0501034_0026168 3300049571 Bacteria 5940
573 Ga0501034_0451395 3300049571 Bacteria 1203
574 Ga0501036_0051553 3300049572 Bacteria 3484
575 Ga0501036_0172234 3300049572 Bacteria 1823
576 Ga0501036_0203509 3300049572 Bacteria 1665
577 Ga0501037_0012416 3300049573 Bacteria 6273
578 Ga0501037_0101866 3300049573 Bacteria 2072
579 Ga0501037_0519244 3300049573 Bacteria 806
580 Ga0501038_0001079 3300049574 Bacteria 24647
581 Ga0501038_0002749 3300049574 Bacteria 16398
582 Ga0501038_0005850 3300049574 Bacteria 11376
583 Ga0501038_0139047 3300049574 Bacteria 1988
584 Ga0501038_0878270 3300049574 Bacteria 663
585 Ga0501039_0002691 3300049575 Bacteria 13262
586 Ga0501039_0645790 3300049575 Bacteria 828
587 Ga0501040_0009051 3300049576 Bacteria 6478
588 Ga0501041_0013295 3300049577 Bacteria 4877
589 Ga0501041_0263362 3300049577 Bacteria 1084
590 Ga0501042_0045254 3300049578 Bacteria 3137
591 Ga0501042_0048153 3300049578 Bacteria 3039
592 Ga0501043_0000422 3300049579 Bacteria 38076
593 Ga0501043_0000795 3300049579 Bacteria 28078
594 Ga0501046_0013409 3300049580 Bacteria 6938
595 Ga0501047_0000628 3300049581 Bacteria 37206
596 Ga0501047_0022072 3300049581 Bacteria 6114
597 Ga0501047_0138091 3300049581 Bacteria 2317
598 Ga0501047_0148092 3300049581 Bacteria 2224
599 Ga0501047_0230241 3300049581 Bacteria 1707
600 Ga0501047_0408213 3300049581 Bacteria 1191
601 Ga0501048_0004797 3300049582 Bacteria 10304
602 Ga0501048_0599668 3300049582 Bacteria 791
603 Ga0501067_0000479 3300049583 Bacteria 21809
604 Ga0501067_0098981 3300049583 Bacteria 1619
605 Ga0501068_0003885 3300049584 Bacteria 8115
606 Ga0501068_0063045 3300049584 Bacteria 2255
607 Ga0501068_0349573 3300049584 Bacteria 950
608 Ga0501069_0014642 3300049585 Bacteria 4194
609 Ga0501069_0113586 3300049585 Bacteria 1544
610 Ga0501070_0010556 3300049586 Bacteria 7806
611 Ga0501070_0026920 3300049586 Bacteria 4822
612 Ga0501070_1107634 3300049586 Bacteria 610
613 Ga0501071_0000984 3300049587 Bacteria 15606
614 Ga0501072_0002372 3300049588 Bacteria 14130
615 Ga0501072_0015988 3300049588 Bacteria 5754
616 Ga0501073_0187485 3300049589 Bacteria 1431
617 Ga0501074_0004061 3300049590 Bacteria 10444
618 Ga0501077_0003437 3300049593 Bacteria 9518
619 Ga0501077_0277216 3300049593 Bacteria 1067
620 Ga0501079_0007311 3300049741 Bacteria 8342
621 Ga0501080_0020194 3300049742 Bacteria 6166
622 Ga0501081_1133296 3300049743 Bacteria 592
623 Ga0501083_0026882 3300049744 Bacteria 3975
624 Ga0501035_0002191 3300049822 Bacteria 19390
625 Ga0501035_0101531 3300049822 Bacteria 2524
626 Ga0501035_0173541 3300049822 Bacteria 1861
627 Ga0501035_0246355 3300049822 Bacteria 1519
628 Ga0501035_0429228 3300049822 Bacteria 1096
629 Ga0501044_0000324 3300049823 Bacteria 60304
630 Ga0501044_0001246 3300049823 Bacteria 30214
631 Ga0501044_0012280 3300049823 Bacteria 9273
632 Ga0501044_0028014 3300049823 Bacteria 5945
633 Ga0501044_0064316 3300049823 Bacteria 3745
634 Ga0501044_0176972 3300049823 Bacteria 2102
635 Ga0501044_0182192 3300049823 Bacteria 2066
636 Ga0501044_0465590 3300049823 Bacteria 1169
637 Ga0501044_1078837 3300049823 Bacteria 673
638 Ga0501045_0002202 3300049824 Bacteria 13212
639 nmdc:mga03683_94358_c1 3300050489 Bacteria 1308
640 nmdc:mga03n38_273804_c1 3300050490 Bacteria 899
641 nmdc:mga03n38_40558_c1 3300050490 Bacteria 2024
642 nmdc:mga0yw44_119033_c1 3300050492 Bacteria 1700
643 nmdc:mga0yw44_4412_c1 3300050492 Bacteria 6446
644 nmdc:mga06z11_89883_c1 3300050494 Bacteria 1665
645 nmdc:mga07m45_50184_c1 3300050496 Bacteria 2350
646 nmdc:mga05p37_982535_c1 3300050507 Bacteria 899
647 nmdc:mga08y16_1345697_c1 3300050511 Bacteria 679
648 nmdc:mga08y16_1978425_c1 3300050511 Bacteria 532
649 nmdc:mga08y16_32181_c1 3300050511 Bacteria 5514
650 nmdc:mga0rr50_125644_c1 3300050513 Bacteria 2048
651 nmdc:mga08x19_258675_c1 3300050514 Bacteria 1203
652 nmdc:mga08x19_83721_c1 3300050514 Bacteria 2097
653 Ga0495601_0026756 3300053077 Bacteria 3564
654 Ga0495601_0077705 3300053077 Bacteria 2126
655 Ga0495601_0390033 3300053077 Bacteria 903
656 Ga0495601_0497974 3300053077 Bacteria 786
657 Ga0495612_0004573 3300053078 Bacteria 5739
658 Ga0495612_0153547 3300053078 Bacteria 1003
659 Ga0495612_0159619 3300053078 Bacteria 984
660 Ga0500610_0085860 3300053079 Bacteria 1638
661 Ga0495655_0038559 3300053083 Bacteria 1206
662 Ga0495595_0075152 3300053084 Bacteria 1602
663 Ga0495619_0065543 3300053085 Bacteria 2423
664 Ga0495619_0195716 3300053085 Bacteria 1399
665 Ga0495619_0281004 3300053085 Bacteria 1153
666 Ga0495619_0597485 3300053085 Bacteria 755
667 Ga0500578_0047477 3300053086 Bacteria 2754
668 Ga0500643_017762 3300053087 Bacteria 2375
669 Ga0500583_0309936 3300053092 Bacteria 771
670 Ga0500651_0296701 3300053093 Bacteria 928
671 Ga0500566_0151278 3300053094 Bacteria 1220
672 Ga0500654_051662 3300053099 Bacteria 2205
673 Ga0500660_069428 3300053100 Bacteria 1659
674 Ga0500556_0224235 3300053104 Bacteria 741
675 Ga0500562_000672 3300053108 Bacteria 8316
676 Ga0500569_002906 3300053109 Bacteria 3435
677 Ga0500621_146797 3300053126 Bacteria 889
678 Ga0500628_002540 3300053129 Bacteria 3011
679 Ga0500652_021787 3300053131 Bacteria 2417
680 Ga0500658_0006846 3300053134 Bacteria 4218
681 Ga0500561_0002571 3300053137 Bacteria 3072
682 Ga0500579_051062 3300053143 Bacteria 2528
683 Ga0500600_0034098 3300053149 Bacteria 2973
684 Ga0500616_0080357 3300053153 Bacteria 1639
685 Ga0500616_0182666 3300053153 Bacteria 943
686 Ga0500633_0000747 3300053160 Bacteria 5540
687 Ga0500634_0010789 3300053161 Bacteria 4680
688 Ga0500656_001114 3300053732 Bacteria 2228
689 Ga0501084_0069917 3300054114 Bacteria 2939
690 Ga0501082_0012873 3300060353 Bacteria 7190
691 Ga0466962_0010842 3300061719 Bacteria 4381
692 Ga0466962_0014347 3300061719 Bacteria 3819
693 Ga0466962_0019302 3300061719 Bacteria 3275
694 Ga0466962_0238048 3300061719 Bacteria 893
695 Ga0530510_0145049 3300061734 Bacteria 1751
696 Ga0530510_0158491 3300061734 Bacteria 1674
697 2515857636 2515154155 Bacteria 7985436
698 2552107031 2551306166 Bacteria 9731570
699 2554257814 2554235005 Bacteria 6457341
700 2616698486 2616644814 Bacteria 11555299
701 2616698859 2616644814 Bacteria 11555299
702 2616701271 2616644814 Bacteria 11555299
703 2616901814 2616644941 Bacteria 8510691
704 2643902735 2643221578 Bacteria 9213798
705 2643942161 2643221587 Bacteria 7586415
706 2644404756 2643221673 Bacteria 9196637
707 2644429244 2643221677 Bacteria 7584031
708 2676484646 2675903059 Bacteria 8644972
709 2739604554 2739367654 Bacteria 6049412
710 2784588153 2784132148 Bacteria 8627943
711 2785342573 2784746763 Bacteria 9783172
712 2785366516 2784746768 Bacteria 10036182
713 2795793738 2795385472 Bacteria 6627535
714 2808916410 2808606375 Bacteria 9466072
715 2809027725 2808606394 Bacteria 6248540
716 2809229683 2808606448 Bacteria 8656184
717 2809231765 2808606448 Bacteria 8656184
718 2812483176 2811994917 Bacteria 7761064
719 2816509160 2816332139 Bacteria 9138787
720 2819694553 2818991463 Bacteria 7948711
721 2819741060 2818991472 Bacteria 10089953
722 2862383061 2862382967 Bacteria 10317375
723 2862515790 2862507626 Bacteria 9425308
724 2862574561 2862574272 Bacteria 10567477
725 2867371208 2867369537 Bacteria 6501581
726 2867429013 2867428634 Bacteria 9590268
727 2867429548 2867428634 Bacteria 9590268
728 2867477120 2867475112 Bacteria 6909112
729 2870790824 2870782633 Bacteria 9624083
730 2873151952 2873151551 Bacteria 8625867
731 2873152722 2873151551 Bacteria 8625867
732 2877684022 2877676314 Bacteria 9512378
733 2895434089 2895427314 Bacteria 13147766
734 2899371635 2899370129 Bacteria 6781179
735 2902794973 2902792274 Bacteria 7270173
736 2912715437 2912715099 Bacteria 9460473
737 2917742498 2917736166 Bacteria 9690793
738 2928146980 2928142448 Bacteria 5288925
739 2954387575 2954380949 Bacteria 10050426
740 2954389332 2954380949 Bacteria 10050426
741 2954700116 2954691527 Bacteria 10720516
742 2954701288 2954691527 Bacteria 10720516
743 2954702111 2954701450 Bacteria 10834262
744 2954718915 2954711539 Bacteria 10867210
745 2954728885 2954721474 Bacteria 10456478
746 2954729487 2954721474 Bacteria 10456478
747 2954732321 2954731030 Bacteria 10243860
748 2954732927 2954731030 Bacteria 10243860
749 2954747784 2954740390 Bacteria 10229294
750 2954748390 2954740390 Bacteria 10229294
751 2954751804 2954749733 Bacteria 10366972
752 2954766908 2954759201 Bacteria 9358192
753 2954767520 2954759201 Bacteria 9358192
754 2966602645 2966598605 Bacteria 7676064
755 2990044968 2990044586 Bacteria 6603797
756 2995465839 2995463766 Bacteria 8577691
757 2995466693 2995463766 Bacteria 8577691
758 8008491434 8008485437 Bacteria 7198341
759 8008565773 8008558824 Bacteria 10610750
760 8023629867 8023623736 Bacteria 8593882
761 8023631403 8023623736 Bacteria 8593882
762 8025530764 8025524527 Bacteria 7197316
763 8025537235 8025530807 Bacteria 8495698
764 8047899020 8047893842 Bacteria 11723082
765 8048359900 8048356638 Bacteria 11044339
766 8048375984 8048369669 Bacteria 11666822
767 8048382136 8048379754 Bacteria 11877923
768 8048410436 8048406513 Bacteria 8936924
769 8057575190 8057568493 Bacteria 7221719
770 Ga0373957_0202467
771 JGI24751J29686_10052271
772 rootH1_10020868
773 JGI25160J50197_1065114
774 JGI25160J50197_1067936
775 Ga0007429J51699_1055425
776 Ga0070680_100331997
777 Ga0070682_100131654
778 Ga0070692_10423261
779 Ga0070668_100000999
780 Ga0070668_100645027
781 Ga0070667_100703421
782 Ga0070709_10000243
783 Ga0070709_10012029
784 Ga0070714_100000182
785 Ga0070714_100002623
786 Ga0070714_100010478
787 Ga0070714_100026307
788 Ga0070714_100031751
789 Ga0070714_100058634
790 Ga0070714_100361420
791 Ga0070714_101419948
792 Ga0070713_100022851
793 Ga0070713_100065781
794 Ga0070713_100106274
795 Ga0070713_100155732
796 Ga0070713_100166880
797 Ga0070713_100417314
798 Ga0070713_100818684
799 Ga0070710_10050201
800 Ga0070710_10258524
801 Ga0070711_100005834
802 Ga0070711_101723033
803 Ga0070708_100125524
804 Ga0070708_100615482
805 Ga0070681_10305117
806 Ga0070681_10341121
807 Ga0070681_10700953
808 Ga0070681_10713704
809 Ga0070706_100002002
810 Ga0070706_100005239
811 Ga0070706_100039325
812 Ga0070706_100069369
813 Ga0070706_100095338
814 Ga0070706_100329543
815 Ga0070706_100855151
816 Ga0070707_100000797
817 Ga0070707_100003785
818 Ga0070707_100017217
819 Ga0070707_100055232
820 Ga0070707_100062019
821 Ga0070707_100313726
822 Ga0070698_100002141
823 Ga0070698_100009098
824 Ga0070698_100018894
825 Ga0070698_100036167
826 Ga0070699_100099753
827 Ga0070699_100843362
828 Ga0070679_100680198
829 Ga0070684_100794916
830 Ga0070697_100170924
831 Ga0068853_100613103
832 Ga0068856_101245493
833 Ga0068852_100186405
834 Ga0068863_101604152
835 Ga0081455_10001878
836 Ga0081455_10003313
837 Ga0081455_10021368
838 Ga0081455_10080421
839 Ga0081455_10209498
840 Ga0081455_10771896
841 Ga0070717_10008469
842 Ga0070717_10024414
843 Ga0070717_10136254
844 Ga0070717_10173275
845 Ga0070717_10224223
846 Ga0070717_10337286
847 Ga0070717_10743957
848 Ga0070717_11775248
849 Ga0075365_10079608
850 Ga0075365_10148913
851 Ga0075363_100000934
852 Ga0075363_100069457
853 Ga0075364_10006246
854 Ga0075364_10629625
855 Ga0070715_10100287
856 Ga0070716_100002854
857 Ga0070716_100358272
858 Ga0070716_100558399
859 Ga0070712_100075671
860 Ga0070712_100125328
861 Ga0070712_100246365
862 Ga0075362_10096024
863 Ga0075367_10036907
864 Ga0075367_10295956
865 Ga0075369_10068077
866 Ga0075370_10183041
867 Ga0075433_10473373
868 Ga0075434_100133897
869 Ga0075436_100178011
870 Ga0075436_101026091
871 Ga0075435_100034581
872 Ga0099794_10228130
873 Ga0099795_10376440
874 Ga0111539_10038228
875 Ga0111539_11223338
876 Ga0105245_10532095
877 Ga0114129_10493987
878 Ga0105241_10043884
879 Ga0105242_11195285
880 Ga0105248_10057340
881 Ga0105237_10002906
882 Ga0105238_10056909
883 Ga0105238_10377041
884 Ga0105238_10769318
885 Ga0105239_10096779
886 Ga0105239_10225151
887 Ga0157370_10101229
888 Ga0157369_11700891
889 Ga0157374_10271997
890 Ga0157378_10373596
891 Ga0163162_10372860
892 Ga0163162_12090630
893 Ga0157372_10609819
894 Ga0157375_10678910
895 Ga0157375_12800311
896 Ga0163163_10789778
897 Ga0182008_10791943
898 Ga0157379_10092229
899 Ga0157379_10331580
900 Ga0157376_10517381
901 Ga0206353_11048574
902 Ga0224572_1008048
903 Ga0209025_1028809
904 Ga0209758_1013803
905 Ga0207426_1001133
906 Ga0207426_1018973
907 Ga0207426_1052728
908 Ga0207692_10002709
909 Ga0207692_10010071
910 Ga0207692_10238155
911 Ga0207692_10275582
912 Ga0207699_10001799
913 Ga0207699_10004721
914 Ga0207699_10106163
915 Ga0207684_10004995
916 Ga0207684_10026372
917 Ga0207684_10094456
918 Ga0207684_10120710
919 Ga0207684_10231113
920 Ga0207684_10278049
921 Ga0207684_10345372
922 Ga0207684_10760491
923 Ga0207707_10379540
924 Ga0207671_10271298
925 Ga0207671_11194469
926 Ga0207693_10026948
927 Ga0207693_10638234
928 Ga0207663_10003868
929 Ga0207663_10451028
930 Ga0207663_11402271
931 Ga0207657_10649598
932 Ga0207652_10378761
933 Ga0207646_10000388
934 Ga0207646_10019127
935 Ga0207646_10025051
936 Ga0207646_10064922
937 Ga0207646_10154867
938 Ga0207700_10002168
939 Ga0207700_10005439
940 Ga0207700_10022222
941 Ga0207700_10125882
942 Ga0207700_10985188
943 Ga0207700_11418387
944 Ga0207664_10000185
945 Ga0207664_10014432
946 Ga0207664_10019092
947 Ga0207664_10029998
948 Ga0207664_10066428
949 Ga0207664_10188484
950 Ga0207664_10189469
951 Ga0207664_10423453
952 Ga0207664_11493683
953 Ga0207709_10175183
954 Ga0207704_10273587
955 Ga0207665_10000276
956 Ga0207661_10116002
957 Ga0207661_10552449
958 Ga0207712_10238527
959 Ga0207668_10005675
960 Ga0207668_10300864
961 Ga0207668_11785243
962 Ga0207658_10894192
963 Ga0207639_10620742
964 Ga0207702_11528954
965 Ga0207641_10930965
966 Ga0209588_1124427
967 Ga0207428_10158678
968 Ga0307515_10010500
969 Ga0310981_1073946
970 Ga0316180_1150693
971 Ga0265767_113261
972 Ga0307513_10001044
973 Ga0307508_10002208
974 Ga0310113_132598
975 Ga0307516_10137779
976 Ga0307516_10245121
977 Ga0307516_10665707
978 Ga0307407_10037821
979 Ga0307507_10032370
980 Ga0373926_0014693
981 Ga0373934_0054249
982 Ga0373934_0117034
983 Ga0373940_0031571
984 Ga0373944_0042516
985 Ga0373951_0077153
986 Ga0373952_0019090
987 Ga0373923_0015828
988 Ga0373936_0001085
989 Ga0373936_0474554
990 Ga0373941_0153120
991 Ga0373953_0033808
992 Ga0373954_0077090
993 Ga0373957_0064102
994 Ga0373957_0194638
995 Ga0373943_0318743
996 Ga0373946_0207683
997 Ga0373955_0064434
998 Ga0373955_0382247
999 Ga0373961_0021928
1000 Ga0373962_0206467
1001 Ga0373924_0151194
1002 Ga0373931_0191376
1003 Ga0373935_0018217
1004 Ga0373935_0038838
1005 Ga0373935_0247500
1006 Ga0373935_0603689
1007 Ga0373927_0266302
1008 Ga0373927_0568183
1009 Ga0373933_0006460
1010 Ga0373933_0157801
1011 Ga0373937_0007312
1012 Ga0373937_0067516
1013 Ga0373925_0288236
1014 Ga0373925_0441790
1015 Ga0373925_0730010
1016 Ga0395900_0089759
1017 Ga0395900_1214336
1018 Ga0395898_0038494
1019 Ga0395905_0062522
1020 Ga0436364_0711543
1021 Ga0395901_0013227
1022 Ga0439439_0049121
1023 Ga0451845_0109047
1024 Ga0451853_1842263
1025 Ga0439448_0033199
1026 Ga0439449_0172853
1027 Ga0439457_001103
1028 Ga0466972_0004325
1029 Ga0466972_0010294
1030 Ga0466972_0034769
1031 Ga0466965_0011338
1032 Ga0466965_0128087
1033 Ga0466965_0511661
1034 Ga0466966_0000993
1035 Ga0466966_0005232
1036 Ga0466966_0037421
1037 Ga0466961_0002945
1038 Ga0466961_0014665
1039 Ga0466961_0218890
1040 Ga0466961_0328977
1041 Ga0466963_0004374
1042 Ga0466963_0136025
1043 Ga0466963_0283505
1044 Ga0466963_0357103
1045 Ga0466964_0122966
1046 Ga0466964_0349969
1047 Ga0466971_0039488
1048 Ga0466971_0262655
1049 Ga0466970_0005079
1050 Ga0466970_0419868
1051 Ga0466957_0058405
1052 Ga0466960_0023801
1053 Ga0466960_0191888
1054 Ga0466959_0091410
1055 Ga0466959_0158740
1056 Ga0466959_0362554
1057 Ga0466967_0000252
1058 Ga0466967_0034819
1059 Ga0466967_0167963
1060 Ga0495592_0001754
1061 Ga0495592_0063425
1062 Ga0495592_0148813
1063 Ga0495603_0005510
1064 Ga0495603_0020663
1065 Ga0495590_0075706
1066 Ga0495629_0000993
1067 Ga0495629_0008057
1068 Ga0495629_0054178
1069 Ga0495629_0189633
1070 Ga0495638_0081381
1071 Ga0495641_0012442
1072 Ga0495641_0034761
1073 Ga0495651_0008928
1074 Ga0495651_0116464
1075 Ga0495651_0267181
1076 Ga0495651_0289962
1077 Ga0495651_0322253
1078 Ga0495653_0020708
1079 Ga0495653_0079129
1080 Ga0495653_0110683
1081 Ga0495653_0111736
1082 Ga0495580_0198847
1083 Ga0495582_0006119
1084 Ga0495582_0064429
1085 Ga0495582_0788114
1086 Ga0495605_0044000
1087 Ga0495639_0016672
1088 Ga0495639_0094579
1089 Ga0495662_0020691
1090 Ga0495662_0050364
1091 Ga0495662_0069800
1092 Ga0495664_0028603
1093 Ga0495664_0029014
1094 Ga0495664_0056716
1095 Ga0495664_0069453
1096 Ga0495664_0324597
1097 Ga0495584_0019775
1098 Ga0495584_0299868
1099 Ga0495585_0165030
1100 Ga0495594_0081206
1101 Ga0495594_0152129
1102 Ga0495594_0236869
1103 Ga0495594_0327479
1104 Ga0495596_0077233
1105 Ga0495583_0004414
1106 Ga0495583_0007461
1107 Ga0495606_0013530
1108 Ga0495606_0034967
1109 Ga0495606_0084459
1110 Ga0495608_0003977
1111 Ga0495608_0039333
1112 Ga0495608_0662230
1113 Ga0495610_0160122
1114 Ga0495616_0070015
1115 Ga0495618_0033586
1116 Ga0495618_0038614
1117 Ga0495618_0050834
1118 Ga0495618_0117535
1119 Ga0495618_0157682
1120 Ga0495620_0004525
1121 Ga0495620_0027352
1122 Ga0495628_0023016
1123 Ga0495628_0085158
1124 Ga0495628_0251438
1125 Ga0495630_0012665
1126 Ga0495630_0029158
1127 Ga0495630_0059914
1128 Ga0495630_0633224
1129 Ga0495632_0032177
1130 Ga0495643_0009009
1131 Ga0495643_0026392
1132 Ga0495643_0141985
1133 Ga0495644_0131379
1134 Ga0495648_0085944
1135 Ga0495648_0166182
1136 Ga0495648_0168824
1137 Ga0495666_0366943
1138 Ga0495642_0005802
1139 Ga0495642_0278456
1140 Ga0495652_0019442
1141 Ga0495652_0034044
1142 Ga0495652_0442948
1143 Ga0495654_0024894
1144 Ga0495665_0003001
1145 Ga0495665_0003331
1146 Ga0495665_0067765
1147 Ga0495640_0019113
1148 Ga0495640_0022767
1149 Ga0495640_0029500
1150 Ga0495640_0058626
1151 Ga0495640_0068050
1152 Ga0495640_0195480
1153 Ga0495587_0001773
1154 Ga0495587_0033088
1155 Ga0495597_0021940
1156 Ga0495597_0035792
1157 Ga0495645_0007934
1158 Ga0495645_0053069
1159 Ga0495645_0062199
1160 Ga0495645_0506320
1161 Ga0495667_0003876
1162 Ga0495667_0069027
1163 Ga0495667_0116064
1164 Ga0495668_0031753
1165 Ga0495668_0033519
1166 Ga0495668_0036947
1167 Ga0495634_0024098
1168 Ga0495634_0028096
1169 Ga0495634_0106823
1170 Ga0495634_0108601
1171 Ga0495611_0011969
1172 Ga0495611_0052640
1173 Ga0495625_0109242
1174 Ga0495625_0122246
1175 Ga0495625_0135607
1176 Ga0495635_0028867
1177 Ga0495635_0105085
1178 Ga0495635_0139673
1179 Ga0495635_0279496
1180 Ga0495661_0017886
1181 Ga0495588_0163245
1182 Ga0495657_0001635
1183 Ga0495657_0009054
1184 Ga0495657_0103849
1185 Ga0495657_0223888
1186 Ga0495657_0491895
1187 Ga0495599_0003611
1188 Ga0495599_0054988
1189 Ga0495599_0092148
1190 Ga0495599_0114681
1191 Ga0495599_0115970
1192 Ga0495599_0271997
1193 Ga0495623_0047445
1194 Ga0495623_0083852
1195 Ga0495623_0178721
1196 Ga0495646_0008226
1197 Ga0495646_0039848
1198 Ga0495646_0065285
1199 Ga0495646_0279090
1200 Ga0495647_0029768
1201 Ga0495658_0017622
1202 Ga0495658_0066776
1203 Ga0495613_0000667
1204 Ga0495613_0019549
1205 Ga0495613_0025768
1206 Ga0495613_0027494
1207 Ga0495613_0065132
1208 Ga0495613_0411230
1209 Ga0495613_0841389
1210 Ga0495624_0007553
1211 Ga0495624_0015616
1212 Ga0495670_0012054
1213 Ga0495670_0445345
1214 Ga0495671_0092290
1215 Ga0495649_0069262
1216 Ga0495649_0089896
1217 Ga0495589_0003521
1218 Ga0495589_0005343
1219 Ga0495589_0014224
1220 Ga0495589_0020265
1221 Ga0495600_0003763
1222 Ga0495600_0100083
1223 Ga0495600_0207646
1224 Ga0495600_0329390
1225 Ga0495600_0643310
1226 Ga0495660_0135237
1227 Ga0495581_0002854
1228 Ga0495581_0013447
1229 Ga0495581_0022850
1230 Ga0495581_0534629
1231 Ga0495604_0061427
1232 Ga0495604_0097539
1233 Ga0495604_0099909
1234 Ga0495604_0123620
1235 Ga0495604_0897959
1236 Ga0495636_0018799
1237 Ga0495636_0160579
1238 Ga0495674_0005959
1239 Ga0495674_0090813
1240 Ga0495674_0206549
1241 Ga0495674_0289991
1242 Ga0495674_0796841
1243 Ga0495672_0000619
1244 Ga0495672_0056233
1245 Ga0495672_0419299
1246 Ga0495676_0001955
1247 Ga0495676_0007884
1248 Ga0495676_0010871
1249 Ga0495676_0027322
1250 Ga0495676_0061731
1251 Ga0495676_0271711
1252 Ga0495676_0646096
1253 Ga0495676_0652055
1254 Ga0495680_0000649
1255 Ga0495680_0014200
1256 Ga0495680_0077746
1257 Ga0495680_0097901
1258 Ga0495680_0242127
1259 Ga0495680_0598194
1260 Ga0495687_008120
1261 Ga0495687_009260
1262 Ga0495687_018188
1263 Ga0495687_030971
1264 Ga0495687_127248
1265 Ga0495687_135951
1266 Ga0495675_0062605
1267 Ga0495675_0284882
1268 Ga0495677_0005888
1269 Ga0495685_001274
1270 Ga0495685_006240
1271 Ga0495685_007570
1272 Ga0495685_099175
1273 Ga0495673_0006744
1274 Ga0495673_0143977
1275 Ga0495681_0002904
1276 Ga0495681_0373290
1277 Ga0495684_0037548
1278 Ga0495684_0070733
1279 Ga0495686_0151304
1280 Ga0495593_0003917
1281 Ga0495593_0007394
1282 Ga0495593_0028981
1283 Ga0495593_0126214
1284 Ga0495602_0095793
1285 Ga0495602_0261373
1286 Ga0495602_0584761
1287 Ga0495602_0676528
1288 Ga0495614_0002000
1289 Ga0495614_0025438
1290 Ga0495614_0047064
1291 Ga0495614_0113696
1292 Ga0495614_0117850
1293 Ga0495614_0213925
1294 Ga0495626_0065860
1295 Ga0495626_0293008
1296 Ga0496100_0002164
1297 Ga0496100_0410728
1298 Ga0496100_0909821
1299 Ga0496101_0000213
1300 Ga0496101_0022971
1301 Ga0496102_0000483
1302 Ga0496102_0189586
1303 Ga0496103_0000323
1304 Ga0496104_0029410
1305 Ga0496104_1582669
1306 Ga0496105_0026379
1307 Ga0496106_0082045
1308 Ga0496107_0038499
1309 Ga0496107_0280979
1310 Ga0496108_0031212
1311 Ga0496108_0473470
1312 Ga0496109_0021543
1313 Ga0496110_0331039
1314 Ga0496111_0288096
1315 Ga0496112_0165527
1316 Ga0496112_0662406
1317 Ga0496113_0269281
1318 Ga0496113_0283272
1319 Ga0496114_0045716
1320 Ga0496114_1599420
1321 Ga0496115_0009849
1322 Ga0496115_0166754
1323 Ga0496116_0000691
1324 Ga0496117_0000018
1325 Ga0496118_0000013
1326 Ga0496118_0001697
1327 Ga0496119_0010794
1328 Ga0496121_0002814
1329 Ga0496126_0000902
1330 Ga0496126_0431232
1331 Ga0495678_045845
1332 Ga0501031_0012733
1333 Ga0501031_0033560
1334 Ga0501032_0003359
1335 Ga0501032_0013431
1336 Ga0501032_0151761
1337 Ga0501033_0003517
1338 Ga0501033_0463225
1339 Ga0501034_0010616
1340 Ga0501034_0026168
1341 Ga0501034_0451395
1342 Ga0501036_0051553
1343 Ga0501036_0172234
1344 Ga0501036_0203509
1345 Ga0501037_0012416
1346 Ga0501037_0101866
1347 Ga0501037_0519244
1348 Ga0501038_0001079
1349 Ga0501038_0002749
1350 Ga0501038_0005850
1351 Ga0501038_0139047
1352 Ga0501038_0878270
1353 Ga0501039_0002691
1354 Ga0501039_0645790
1355 Ga0501040_0009051
1356 Ga0501041_0013295
1357 Ga0501041_0263362
1358 Ga0501042_0045254
1359 Ga0501042_0048153
1360 Ga0501043_0000422
1361 Ga0501043_0000795
1362 Ga0501046_0013409
1363 Ga0501047_0000628
1364 Ga0501047_0022072
1365 Ga0501047_0138091
1366 Ga0501047_0148092
1367 Ga0501047_0230241
1368 Ga0501047_0408213
1369 Ga0501048_0004797
1370 Ga0501048_0599668
1371 Ga0501067_0000479
1372 Ga0501067_0098981
1373 Ga0501068_0003885
1374 Ga0501068_0063045
1375 Ga0501068_0349573
1376 Ga0501069_0014642
1377 Ga0501069_0113586
1378 Ga0501070_0010556
1379 Ga0501070_0026920
1380 Ga0501070_1107634
1381 Ga0501071_0000984
1382 Ga0501072_0002372
1383 Ga0501072_0015988
1384 Ga0501073_0187485
1385 Ga0501074_0004061
1386 Ga0501077_0003437
1387 Ga0501077_0277216
1388 Ga0501079_0007311
1389 Ga0501080_0020194
1390 Ga0501081_1133296
1391 Ga0501083_0026882
1392 Ga0501035_0002191
1393 Ga0501035_0101531
1394 Ga0501035_0173541
1395 Ga0501035_0246355
1396 Ga0501035_0429228
1397 Ga0501044_0000324
1398 Ga0501044_0001246
1399 Ga0501044_0012280
1400 Ga0501044_0028014
1401 Ga0501044_0064316
1402 Ga0501044_0176972
1403 Ga0501044_0182192
1404 Ga0501044_0465590
1405 Ga0501044_1078837
1406 Ga0501045_0002202
1407 nmdc:mga03683_94358_c1
1408 nmdc:mga03n38_273804_c1
1409 nmdc:mga03n38_40558_c1
1410 nmdc:mga0yw44_119033_c1
1411 nmdc:mga0yw44_4412_c1
1412 nmdc:mga06z11_89883_c1
1413 nmdc:mga07m45_50184_c1
1414 nmdc:mga05p37_982535_c1
1415 nmdc:mga08y16_1345697_c1
1416 nmdc:mga08y16_1978425_c1
1417 nmdc:mga08y16_32181_c1
1418 nmdc:mga0rr50_125644_c1
1419 nmdc:mga08x19_258675_c1
1420 nmdc:mga08x19_83721_c1
1421 Ga0495601_0026756
1422 Ga0495601_0077705
1423 Ga0495601_0390033
1424 Ga0495601_0497974
1425 Ga0495612_0004573
1426 Ga0495612_0153547
1427 Ga0495612_0159619
1428 Ga0500610_0085860
1429 Ga0495655_0038559
1430 Ga0495595_0075152
1431 Ga0495619_0065543
1432 Ga0495619_0195716
1433 Ga0495619_0281004
1434 Ga0495619_0597485
1435 Ga0500578_0047477
1436 Ga0500643_017762
1437 Ga0500583_0309936
1438 Ga0500651_0296701
1439 Ga0500566_0151278
1440 Ga0500654_051662
1441 Ga0500660_069428
1442 Ga0500556_0224235
1443 Ga0500562_000672
1444 Ga0500569_002906
1445 Ga0500621_146797
1446 Ga0500628_002540
1447 Ga0500652_021787
1448 Ga0500658_0006846
1449 Ga0500561_0002571
1450 Ga0500579_051062
1451 Ga0500600_0034098
1452 Ga0500616_0080357
1453 Ga0500616_0182666
1454 Ga0500633_0000747
1455 Ga0500634_0010789
1456 Ga0500656_001114
1457 Ga0501084_0069917
1458 Ga0501082_0012873
1459 Ga0466962_0010842
1460 Ga0466962_0014347
1461 Ga0466962_0019302
1462 Ga0466962_0238048
1463 Ga0530510_0145049
1464 Ga0530510_0158491
1465 2515857636
1466 2552107031
1467 2554257814
1468 2616698486
1469 2616698859
1470 2616701271
1471 2616901814
1472 2643902735
1473 2643942161
1474 2644404756
1475 2644429244
1476 2676484646
1477 2739604554
1478 2784588153
1479 2785342573
1480 2785366516
1481 2795793738
1482 2808916410
1483 2809027725
1484 2809229683
1485 2809231765
1486 2812483176
1487 2816509160
1488 2819694553
1489 2819741060
1490 2862383061
1491 2862515790
1492 2862574561
1493 2867371208
1494 2867429013
1495 2867429548
1496 2867477120
1497 2870790824
1498 2873151952
1499 2873152722
1500 2877684022
1501 2895434089
1502 2899371635
1503 2902794973
1504 2912715437
1505 2917742498
1506 2928146980
1507 2954387575
1508 2954389332
1509 2954700116
1510 2954701288
1511 2954702111
1512 2954718915
1513 2954728885
1514 2954729487
1515 2954732321
1516 2954732927
1517 2954747784
1518 2954748390
1519 2954751804
1520 2954766908
1521 2954767520
1522 2966602645
1523 2990044968
1524 2995465839
1525 2995466693
1526 8008491434
1527 8008565773
1528 8023629867
1529 8023631403
1530 8025530764
1531 8025537235
1532 8047899020
1533 8048359900
1534 8048375984
1535 8048382136
1536 8048410436
1537 8057575190

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

42

127

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9596 15 143
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9247 15 143
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9233 2 149
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9193 1 151
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9173 2 149
ID Description Score Start End Superfamily
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9259 2 140 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9204 2 140 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9187 6 144 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.918 2 150 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9135 17 147 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A117ILX8-F1-model_v4 Alkylhydroperoxidase AhpD core domain-containing protein 0.9965 1 155 GO:0051920
AF-A0A2P8DY12-F1-model_v4 AhpD family alkylhydroperoxidase 0.9954 37 155 GO:0051920
AF-A0A286DSL4-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9927 40 155 GO:0051920
AF-A0A7X1MB92-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9923 1 155 GO:0051920
AF-A0A089X0T3-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9921 1 155 GO:0051920

Map