F479957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 768 | 386 | 1537 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300035120|Ga0373957_0202467|Ga0373957_0202467_190_756 |
| Length | 188 |
| Sequence | VEEVVMTGTAVNPTPAAGRANGIGVNGKEMMMDARIDYLGNPLAMKLVKHINSAWAVLRNSALPAAAQELVKIRASQINGCGFCTDMHIKDALHAGESQQRLNLVAVWREATVFTEAERAALELAEQGTRIADAATGVTDEAWASAAKHYDEDQLAALVSLIAVINAYNRMNVITRQPAGDYQPGQWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 69 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 97 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 98 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 99 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 102 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 107 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 112 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 113 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 122 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 135 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 138 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 139 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 312 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 313 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 314 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 315 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 318 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 322 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 327 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 328 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 329 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 330 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 331 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 332 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 333 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 334 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 335 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 336 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 337 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 338 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 339 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 340 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 341 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 342 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 343 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 344 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 345 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 346 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 347 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 348 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 349 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 350 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 351 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 352 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 353 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 354 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 355 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 356 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 357 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 358 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 359 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 360 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 361 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 362 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 363 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 364 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 365 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 366 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 367 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 368 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 369 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 370 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 371 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 372 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 373 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 374 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 375 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 376 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 377 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 378 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 379 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 380 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 381 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 382 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 383 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 384 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 385 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 386 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.84 |
| Metatranscriptomes | 0.65 |
| Isolates | 9.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.25 |
| Nodule | 0.39 |
| Rhizoplane | 3.65 |
| Rhizosphere | 82.55 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373957_0202467 | 3300035120 | Bacteria | 828 |
| 2 | JGI24751J29686_10052271 | 3300002459 | Bacteria | 843 |
| 3 | rootH1_10020868 | 3300003316 | Bacteria | 1997 |
| 4 | rootH1_10020868 | 3300003323 | Bacteria | 5682 |
| 5 | JGI25160J50197_1065114 | 3300003354 | Bacteria | 713 |
| 6 | JGI25160J50197_1067936 | 3300003354 | Bacteria | 688 |
| 7 | Ga0007429J51699_1055425 | 3300003579 | Bacteria | 631 |
| 8 | Ga0070680_100331997 | 3300005336 | Bacteria | 1291 |
| 9 | Ga0070682_100131654 | 3300005337 | Bacteria | 1693 |
| 10 | Ga0070692_10423261 | 3300005345 | Bacteria | 846 |
| 11 | Ga0070668_100000999 | 3300005347 | Bacteria | 19811 |
| 12 | Ga0070668_100645027 | 3300005347 | Bacteria | 930 |
| 13 | Ga0070667_100703421 | 3300005367 | Bacteria | 935 |
| 14 | Ga0070709_10000243 | 3300005434 | Bacteria | 35120 |
| 15 | Ga0070709_10012029 | 3300005434 | Bacteria | 4838 |
| 16 | Ga0070714_100000182 | 3300005435 | Bacteria | 50060 |
| 17 | Ga0070714_100002623 | 3300005435 | Bacteria | 13242 |
| 18 | Ga0070714_100010478 | 3300005435 | Bacteria | 7327 |
| 19 | Ga0070714_100026307 | 3300005435 | Bacteria | 4808 |
| 20 | Ga0070714_100031751 | 3300005435 | Bacteria | 4409 |
| 21 | Ga0070714_100058634 | 3300005435 | Bacteria | 3299 |
| 22 | Ga0070714_100361420 | 3300005435 | Bacteria | 1365 |
| 23 | Ga0070714_101419948 | 3300005435 | Bacteria | 678 |
| 24 | Ga0070713_100022851 | 3300005436 | Bacteria | 4840 |
| 25 | Ga0070713_100065781 | 3300005436 | Bacteria | 3047 |
| 26 | Ga0070713_100106274 | 3300005436 | Bacteria | 2440 |
| 27 | Ga0070713_100155732 | 3300005436 | Bacteria | 2036 |
| 28 | Ga0070713_100166880 | 3300005436 | Bacteria | 1969 |
| 29 | Ga0070713_100417314 | 3300005436 | Bacteria | 1256 |
| 30 | Ga0070713_100818684 | 3300005436 | Bacteria | 893 |
| 31 | Ga0070710_10050201 | 3300005437 | Bacteria | 2337 |
| 32 | Ga0070710_10258524 | 3300005437 | Bacteria | 1122 |
| 33 | Ga0070711_100005834 | 3300005439 | Bacteria | 7392 |
| 34 | Ga0070711_101723033 | 3300005439 | Bacteria | 549 |
| 35 | Ga0070708_100125524 | 3300005445 | Bacteria | 2371 |
| 36 | Ga0070708_100615482 | 3300005445 | Bacteria | 1024 |
| 37 | Ga0070681_10305117 | 3300005458 | Bacteria | 1501 |
| 38 | Ga0070681_10341121 | 3300005458 | Bacteria | 1408 |
| 39 | Ga0070681_10700953 | 3300005458 | Bacteria | 928 |
| 40 | Ga0070681_10713704 | 3300005458 | Bacteria | 919 |
| 41 | Ga0070706_100002002 | 3300005467 | Bacteria | 20967 |
| 42 | Ga0070706_100005239 | 3300005467 | Bacteria | 12364 |
| 43 | Ga0070706_100039325 | 3300005467 | Bacteria | 4367 |
| 44 | Ga0070706_100069369 | 3300005467 | Bacteria | 3260 |
| 45 | Ga0070706_100095338 | 3300005467 | Bacteria | 2762 |
| 46 | Ga0070706_100329543 | 3300005467 | Bacteria | 1424 |
| 47 | Ga0070706_100855151 | 3300005467 | Bacteria | 841 |
| 48 | Ga0070707_100000797 | 3300005468 | Bacteria | 31116 |
| 49 | Ga0070707_100003785 | 3300005468 | Bacteria | 14274 |
| 50 | Ga0070707_100017217 | 3300005468 | Bacteria | 6792 |
| 51 | Ga0070707_100055232 | 3300005468 | Bacteria | 3807 |
| 52 | Ga0070707_100062019 | 3300005468 | Bacteria | 3586 |
| 53 | Ga0070707_100313726 | 3300005468 | Bacteria | 1524 |
| 54 | Ga0070698_100002141 | 3300005471 | Bacteria | 21908 |
| 55 | Ga0070698_100009098 | 3300005471 | Bacteria | 10673 |
| 56 | Ga0070698_100018894 | 3300005471 | Bacteria | 7250 |
| 57 | Ga0070698_100036167 | 3300005471 | Bacteria | 5104 |
| 58 | Ga0070699_100099753 | 3300005518 | Bacteria | 2545 |
| 59 | Ga0070699_100843362 | 3300005518 | Bacteria | 839 |
| 60 | Ga0070679_100680198 | 3300005530 | Bacteria | 972 |
| 61 | Ga0070684_100794916 | 3300005535 | Bacteria | 884 |
| 62 | Ga0070697_100170924 | 3300005536 | Bacteria | 1840 |
| 63 | Ga0068853_100613103 | 3300005539 | Bacteria | 1034 |
| 64 | Ga0068856_101245493 | 3300005614 | Bacteria | 760 |
| 65 | Ga0068852_100186405 | 3300005616 | Bacteria | 1954 |
| 66 | Ga0068863_101604152 | 3300005841 | Bacteria | 660 |
| 67 | Ga0081455_10001878 | 3300005937 | Bacteria | 25279 |
| 68 | Ga0081455_10003313 | 3300005937 | Bacteria | 18620 |
| 69 | Ga0081455_10021368 | 3300005937 | Bacteria | 6072 |
| 70 | Ga0081455_10080421 | 3300005937 | Bacteria | 2672 |
| 71 | Ga0081455_10209498 | 3300005937 | Bacteria | 1453 |
| 72 | Ga0081455_10771896 | 3300005937 | Bacteria | 606 |
| 73 | Ga0070717_10008469 | 3300006028 | Bacteria | 7683 |
| 74 | Ga0070717_10024414 | 3300006028 | Bacteria | 4800 |
| 75 | Ga0070717_10136254 | 3300006028 | Bacteria | 2115 |
| 76 | Ga0070717_10173275 | 3300006028 | Bacteria | 1878 |
| 77 | Ga0070717_10224223 | 3300006028 | Bacteria | 1653 |
| 78 | Ga0070717_10337286 | 3300006028 | Bacteria | 1345 |
| 79 | Ga0070717_10743957 | 3300006028 | Bacteria | 891 |
| 80 | Ga0070717_11775248 | 3300006028 | Bacteria | 558 |
| 81 | Ga0075365_10079608 | 3300006038 | Bacteria | 2217 |
| 82 | Ga0075365_10148913 | 3300006038 | Bacteria | 1628 |
| 83 | Ga0075363_100000934 | 3300006048 | Bacteria | 10342 |
| 84 | Ga0075363_100069457 | 3300006048 | Bacteria | 1911 |
| 85 | Ga0075364_10006246 | 3300006051 | Bacteria | 6985 |
| 86 | Ga0075364_10629625 | 3300006051 | Bacteria | 733 |
| 87 | Ga0070715_10100287 | 3300006163 | Bacteria | 1349 |
| 88 | Ga0070716_100002854 | 3300006173 | Bacteria | 8048 |
| 89 | Ga0070716_100358272 | 3300006173 | Bacteria | 1035 |
| 90 | Ga0070716_100558399 | 3300006173 | Bacteria | 855 |
| 91 | Ga0070712_100075671 | 3300006175 | Bacteria | 2422 |
| 92 | Ga0070712_100125328 | 3300006175 | Bacteria | 1939 |
| 93 | Ga0070712_100246365 | 3300006175 | Bacteria | 1426 |
| 94 | Ga0075362_10096024 | 3300006177 | Bacteria | 1381 |
| 95 | Ga0075367_10036907 | 3300006178 | Bacteria | 2836 |
| 96 | Ga0075367_10295956 | 3300006178 | Bacteria | 1019 |
| 97 | Ga0075369_10068077 | 3300006186 | Bacteria | 1564 |
| 98 | Ga0075370_10183041 | 3300006353 | Bacteria | 1233 |
| 99 | Ga0075433_10473373 | 3300006852 | Bacteria | 1103 |
| 100 | Ga0075434_100133897 | 3300006871 | Bacteria | 2498 |
| 101 | Ga0075436_100178011 | 3300006914 | Bacteria | 1503 |
| 102 | Ga0075436_101026091 | 3300006914 | Bacteria | 619 |
| 103 | Ga0075435_100034581 | 3300007076 | Bacteria | 4005 |
| 104 | Ga0099794_10228130 | 3300007265 | Bacteria | 958 |
| 105 | Ga0099795_10376440 | 3300007788 | Bacteria | 640 |
| 106 | Ga0111539_10038228 | 3300009094 | Bacteria | 5789 |
| 107 | Ga0111539_11223338 | 3300009094 | Bacteria | 872 |
| 108 | Ga0105245_10532095 | 3300009098 | Bacteria | 1195 |
| 109 | Ga0114129_10493987 | 3300009147 | Bacteria | 1599 |
| 110 | Ga0105241_10043884 | 3300009174 | Bacteria | 3386 |
| 111 | Ga0105242_11195285 | 3300009176 | Bacteria | 779 |
| 112 | Ga0105248_10057340 | 3300009177 | Bacteria | 4372 |
| 113 | Ga0105237_10002906 | 3300009545 | Bacteria | 20779 |
| 114 | Ga0105238_10056909 | 3300009551 | Bacteria | 3922 |
| 115 | Ga0105238_10377041 | 3300009551 | Bacteria | 1409 |
| 116 | Ga0105238_10769318 | 3300009551 | Bacteria | 977 |
| 117 | Ga0105239_10096779 | 3300010375 | Bacteria | 3261 |
| 118 | Ga0105239_10225151 | 3300010375 | Bacteria | 2104 |
| 119 | Ga0157370_10101229 | 3300013104 | Bacteria | 2699 |
| 120 | Ga0157369_11700891 | 3300013105 | Bacteria | 641 |
| 121 | Ga0157374_10271997 | 3300013296 | Bacteria | 1671 |
| 122 | Ga0157378_10373596 | 3300013297 | Bacteria | 1398 |
| 123 | Ga0163162_10372860 | 3300013306 | Bacteria | 1560 |
| 124 | Ga0163162_12090630 | 3300013306 | Bacteria | 649 |
| 125 | Ga0157372_10609819 | 3300013307 | Bacteria | 1272 |
| 126 | Ga0157375_10678910 | 3300013308 | Bacteria | 1185 |
| 127 | Ga0157375_12800311 | 3300013308 | Bacteria | 583 |
| 128 | Ga0163163_10789778 | 3300014325 | Bacteria | 1013 |
| 129 | Ga0182008_10791943 | 3300014497 | Bacteria | 549 |
| 130 | Ga0157379_10092229 | 3300014968 | Bacteria | 2717 |
| 131 | Ga0157379_10331580 | 3300014968 | Bacteria | 1390 |
| 132 | Ga0157376_10517381 | 3300014969 | Bacteria | 1176 |
| 133 | Ga0206353_11048574 | 3300020082 | Bacteria | 531 |
| 134 | Ga0224572_1008048 | 3300024225 | Bacteria | 1944 |
| 135 | Ga0209025_1028809 | 3300025294 | Bacteria | 2708 |
| 136 | Ga0209758_1013803 | 3300025297 | Bacteria | 4366 |
| 137 | Ga0207426_1001133 | 3300025302 | Bacteria | 24068 |
| 138 | Ga0207426_1018973 | 3300025302 | Bacteria | 2413 |
| 139 | Ga0207426_1052728 | 3300025302 | Bacteria | 1203 |
| 140 | Ga0207692_10002709 | 3300025898 | Bacteria | 6827 |
| 141 | Ga0207692_10010071 | 3300025898 | Bacteria | 3969 |
| 142 | Ga0207692_10238155 | 3300025898 | Bacteria | 1086 |
| 143 | Ga0207692_10275582 | 3300025898 | Bacteria | 1016 |
| 144 | Ga0207699_10001799 | 3300025906 | Bacteria | 10073 |
| 145 | Ga0207699_10004721 | 3300025906 | Bacteria | 6511 |
| 146 | Ga0207699_10106163 | 3300025906 | Bacteria | 1792 |
| 147 | Ga0207684_10004995 | 3300025910 | Bacteria | 12358 |
| 148 | Ga0207684_10026372 | 3300025910 | Bacteria | 4954 |
| 149 | Ga0207684_10094456 | 3300025910 | Bacteria | 2550 |
| 150 | Ga0207684_10120710 | 3300025910 | Bacteria | 2247 |
| 151 | Ga0207684_10231113 | 3300025910 | Bacteria | 1596 |
| 152 | Ga0207684_10278049 | 3300025910 | Bacteria | 1444 |
| 153 | Ga0207684_10345372 | 3300025910 | Bacteria | 1281 |
| 154 | Ga0207684_10760491 | 3300025910 | Bacteria | 821 |
| 155 | Ga0207707_10379540 | 3300025912 | Bacteria | 1215 |
| 156 | Ga0207671_10271298 | 3300025914 | Bacteria | 1337 |
| 157 | Ga0207671_11194469 | 3300025914 | Bacteria | 595 |
| 158 | Ga0207693_10026948 | 3300025915 | Bacteria | 4546 |
| 159 | Ga0207693_10638234 | 3300025915 | Bacteria | 828 |
| 160 | Ga0207663_10003868 | 3300025916 | Bacteria | 7391 |
| 161 | Ga0207663_10451028 | 3300025916 | Bacteria | 992 |
| 162 | Ga0207663_11402271 | 3300025916 | Bacteria | 563 |
| 163 | Ga0207657_10649598 | 3300025919 | Bacteria | 821 |
| 164 | Ga0207652_10378761 | 3300025921 | Bacteria | 1277 |
| 165 | Ga0207646_10000388 | 3300025922 | Bacteria | 59041 |
| 166 | Ga0207646_10019127 | 3300025922 | Bacteria | 6369 |
| 167 | Ga0207646_10025051 | 3300025922 | Bacteria | 5461 |
| 168 | Ga0207646_10064922 | 3300025922 | Bacteria | 3259 |
| 169 | Ga0207646_10154867 | 3300025922 | Bacteria | 2067 |
| 170 | Ga0207700_10002168 | 3300025928 | Bacteria | 11246 |
| 171 | Ga0207700_10005439 | 3300025928 | Bacteria | 7624 |
| 172 | Ga0207700_10022222 | 3300025928 | Bacteria | 4348 |
| 173 | Ga0207700_10125882 | 3300025928 | Bacteria | 2085 |
| 174 | Ga0207700_10985188 | 3300025928 | Bacteria | 754 |
| 175 | Ga0207700_11418387 | 3300025928 | Bacteria | 617 |
| 176 | Ga0207664_10000185 | 3300025929 | Bacteria | 47364 |
| 177 | Ga0207664_10014432 | 3300025929 | Bacteria | 5705 |
| 178 | Ga0207664_10019092 | 3300025929 | Bacteria | 5060 |
| 179 | Ga0207664_10029998 | 3300025929 | Bacteria | 4149 |
| 180 | Ga0207664_10066428 | 3300025929 | Bacteria | 2891 |
| 181 | Ga0207664_10188484 | 3300025929 | Bacteria | 1774 |
| 182 | Ga0207664_10189469 | 3300025929 | Bacteria | 1770 |
| 183 | Ga0207664_10423453 | 3300025929 | Bacteria | 1186 |
| 184 | Ga0207664_11493683 | 3300025929 | Bacteria | 597 |
| 185 | Ga0207709_10175183 | 3300025935 | Bacteria | 1509 |
| 186 | Ga0207704_10273587 | 3300025938 | Bacteria | 1280 |
| 187 | Ga0207665_10000276 | 3300025939 | Bacteria | 35590 |
| 188 | Ga0207661_10116002 | 3300025944 | Bacteria | 2273 |
| 189 | Ga0207661_10552449 | 3300025944 | Bacteria | 1055 |
| 190 | Ga0207712_10238527 | 3300025961 | Bacteria | 1463 |
| 191 | Ga0207668_10005675 | 3300025972 | Bacteria | 7347 |
| 192 | Ga0207668_10300864 | 3300025972 | Bacteria | 1324 |
| 193 | Ga0207668_11785243 | 3300025972 | Bacteria | 555 |
| 194 | Ga0207658_10894192 | 3300025986 | Bacteria | 808 |
| 195 | Ga0207639_10620742 | 3300026041 | Bacteria | 998 |
| 196 | Ga0207702_11528954 | 3300026078 | Bacteria | 661 |
| 197 | Ga0207641_10930965 | 3300026088 | Bacteria | 864 |
| 198 | Ga0209588_1124427 | 3300027671 | Bacteria | 824 |
| 199 | Ga0207428_10158678 | 3300027907 | Bacteria | 1719 |
| 200 | Ga0307515_10010500 | 3300028794 | Bacteria | 17741 |
| 201 | Ga0310981_1073946 | 3300029285 | Bacteria | 568 |
| 202 | Ga0316180_1150693 | 3300030736 | Bacteria | 709 |
| 203 | Ga0265767_113261 | 3300030836 | Bacteria | 577 |
| 204 | Ga0307513_10001044 | 3300031456 | Bacteria | 40198 |
| 205 | Ga0307508_10002208 | 3300031616 | Bacteria | 20759 |
| 206 | Ga0310113_132598 | 3300031636 | Bacteria | 500 |
| 207 | Ga0307516_10137779 | 3300031730 | Bacteria | 2213 |
| 208 | Ga0307516_10245121 | 3300031730 | Bacteria | 1489 |
| 209 | Ga0307516_10665707 | 3300031730 | Bacteria | 697 |
| 210 | Ga0307407_10037821 | 3300031903 | Bacteria | 2669 |
| 211 | Ga0307507_10032370 | 3300033179 | Bacteria | 5460 |
| 212 | Ga0373926_0014693 | 3300035083 | Bacteria | 2664 |
| 213 | Ga0373934_0054249 | 3300035086 | Bacteria | 1591 |
| 214 | Ga0373934_0117034 | 3300035086 | Bacteria | 1083 |
| 215 | Ga0373940_0031571 | 3300035088 | Bacteria | 1415 |
| 216 | Ga0373944_0042516 | 3300035089 | Bacteria | 1409 |
| 217 | Ga0373951_0077153 | 3300035091 | Bacteria | 857 |
| 218 | Ga0373952_0019090 | 3300035092 | Bacteria | 1424 |
| 219 | Ga0373923_0015828 | 3300035111 | Bacteria | 2853 |
| 220 | Ga0373936_0001085 | 3300035113 | Bacteria | 9744 |
| 221 | Ga0373936_0474554 | 3300035113 | Bacteria | 580 |
| 222 | Ga0373941_0153120 | 3300035115 | Bacteria | 847 |
| 223 | Ga0373953_0033808 | 3300035117 | Bacteria | 2001 |
| 224 | Ga0373954_0077090 | 3300035118 | Bacteria | 1589 |
| 225 | Ga0373957_0064102 | 3300035120 | Bacteria | 1428 |
| 226 | Ga0373957_0194638 | 3300035120 | Bacteria | 843 |
| 227 | Ga0373943_0318743 | 3300035170 | Bacteria | 886 |
| 228 | Ga0373946_0207683 | 3300035171 | Bacteria | 940 |
| 229 | Ga0373955_0064434 | 3300035172 | Bacteria | 2032 |
| 230 | Ga0373955_0382247 | 3300035172 | Bacteria | 854 |
| 231 | Ga0373961_0021928 | 3300035241 | Bacteria | 1703 |
| 232 | Ga0373962_0206467 | 3300035242 | Bacteria | 667 |
| 233 | Ga0373924_0151194 | 3300035410 | Bacteria | 1016 |
| 234 | Ga0373931_0191376 | 3300035691 | Bacteria | 1217 |
| 235 | Ga0373935_0018217 | 3300035692 | Bacteria | 4270 |
| 236 | Ga0373935_0038838 | 3300035692 | Bacteria | 2982 |
| 237 | Ga0373935_0247500 | 3300035692 | Bacteria | 1246 |
| 238 | Ga0373935_0603689 | 3300035692 | Bacteria | 803 |
| 239 | Ga0373927_0266302 | 3300035695 | Bacteria | 1127 |
| 240 | Ga0373927_0568183 | 3300035695 | Bacteria | 749 |
| 241 | Ga0373933_0006460 | 3300035724 | Bacteria | 6388 |
| 242 | Ga0373933_0157801 | 3300035724 | Bacteria | 1439 |
| 243 | Ga0373937_0007312 | 3300036401 | Bacteria | 9558 |
| 244 | Ga0373937_0067516 | 3300036401 | Bacteria | 3294 |
| 245 | Ga0373925_0288236 | 3300037068 | Bacteria | 1323 |
| 246 | Ga0373925_0441790 | 3300037068 | Bacteria | 1064 |
| 247 | Ga0373925_0730010 | 3300037068 | Bacteria | 817 |
| 248 | Ga0395900_0089759 | 3300037418 | Bacteria | 3159 |
| 249 | Ga0395900_1214336 | 3300037418 | Bacteria | 669 |
| 250 | Ga0395898_0038494 | 3300037466 | Bacteria | 4739 |
| 251 | Ga0395905_0062522 | 3300037471 | Bacteria | 3483 |
| 252 | Ga0436364_0711543 | 3300037853 | Bacteria | 3161 |
| 253 | Ga0395901_0013227 | 3300038443 | Bacteria | 8379 |
| 254 | Ga0439439_0049121 | 3300041406 | Bacteria | 1104 |
| 255 | Ga0451845_0109047 | 3300041501 | Bacteria | 933 |
| 256 | Ga0451853_1842263 | 3300041512 | Bacteria | 4386 |
| 257 | Ga0439448_0033199 | 3300042005 | Bacteria | 1646 |
| 258 | Ga0439449_0172853 | 3300042007 | Bacteria | 807 |
| 259 | Ga0439457_001103 | 3300042014 | Bacteria | 8140 |
| 260 | Ga0466972_0004325 | 3300044658 | Bacteria | 7097 |
| 261 | Ga0466972_0010294 | 3300044658 | Bacteria | 4696 |
| 262 | Ga0466972_0034769 | 3300044658 | Bacteria | 2467 |
| 263 | Ga0466965_0011338 | 3300044683 | Bacteria | 4175 |
| 264 | Ga0466965_0128087 | 3300044683 | Bacteria | 1314 |
| 265 | Ga0466965_0511661 | 3300044683 | Bacteria | 674 |
| 266 | Ga0466966_0000993 | 3300044684 | Bacteria | 18195 |
| 267 | Ga0466966_0005232 | 3300044684 | Bacteria | 8531 |
| 268 | Ga0466966_0037421 | 3300044684 | Bacteria | 3129 |
| 269 | Ga0466961_0002945 | 3300044693 | Bacteria | 10572 |
| 270 | Ga0466961_0014665 | 3300044693 | Bacteria | 5035 |
| 271 | Ga0466961_0218890 | 3300044693 | Bacteria | 1174 |
| 272 | Ga0466961_0328977 | 3300044693 | Bacteria | 931 |
| 273 | Ga0466963_0004374 | 3300044694 | Bacteria | 8206 |
| 274 | Ga0466963_0136025 | 3300044694 | Bacteria | 1700 |
| 275 | Ga0466963_0283505 | 3300044694 | Bacteria | 1164 |
| 276 | Ga0466963_0357103 | 3300044694 | Bacteria | 1029 |
| 277 | Ga0466964_0122966 | 3300044706 | Bacteria | 1172 |
| 278 | Ga0466964_0349969 | 3300044706 | Bacteria | 759 |
| 279 | Ga0466971_0039488 | 3300044719 | Bacteria | 2118 |
| 280 | Ga0466971_0262655 | 3300044719 | Bacteria | 824 |
| 281 | Ga0466970_0005079 | 3300044765 | Bacteria | 6506 |
| 282 | Ga0466970_0419868 | 3300044765 | Bacteria | 765 |
| 283 | Ga0466957_0058405 | 3300044842 | Bacteria | 2363 |
| 284 | Ga0466960_0023801 | 3300044901 | Bacteria | 2754 |
| 285 | Ga0466960_0191888 | 3300044901 | Bacteria | 1112 |
| 286 | Ga0466959_0091410 | 3300045049 | Bacteria | 2185 |
| 287 | Ga0466959_0158740 | 3300045049 | Bacteria | 1590 |
| 288 | Ga0466959_0362554 | 3300045049 | Bacteria | 987 |
| 289 | Ga0466967_0000252 | 3300045976 | Bacteria | 23522 |
| 290 | Ga0466967_0034819 | 3300045976 | Bacteria | 4279 |
| 291 | Ga0466967_0167963 | 3300045976 | Bacteria | 2062 |
| 292 | Ga0495592_0001754 | 3300046454 | Bacteria | 15250 |
| 293 | Ga0495592_0063425 | 3300046454 | Bacteria | 2710 |
| 294 | Ga0495592_0148813 | 3300046454 | Bacteria | 1621 |
| 295 | Ga0495603_0005510 | 3300046455 | Bacteria | 7549 |
| 296 | Ga0495603_0020663 | 3300046455 | Bacteria | 3988 |
| 297 | Ga0495590_0075706 | 3300046457 | Bacteria | 1184 |
| 298 | Ga0495629_0000993 | 3300046459 | Bacteria | 22718 |
| 299 | Ga0495629_0008057 | 3300046459 | Bacteria | 7756 |
| 300 | Ga0495629_0054178 | 3300046459 | Bacteria | 2805 |
| 301 | Ga0495629_0189633 | 3300046459 | Bacteria | 1423 |
| 302 | Ga0495638_0081381 | 3300046460 | Bacteria | 1966 |
| 303 | Ga0495641_0012442 | 3300046461 | Bacteria | 4760 |
| 304 | Ga0495641_0034761 | 3300046461 | Bacteria | 2380 |
| 305 | Ga0495651_0008928 | 3300046462 | Bacteria | 7696 |
| 306 | Ga0495651_0116464 | 3300046462 | Bacteria | 1969 |
| 307 | Ga0495651_0267181 | 3300046462 | Bacteria | 1161 |
| 308 | Ga0495651_0289962 | 3300046462 | Bacteria | 1102 |
| 309 | Ga0495651_0322253 | 3300046462 | Bacteria | 1030 |
| 310 | Ga0495653_0020708 | 3300046463 | Bacteria | 5327 |
| 311 | Ga0495653_0079129 | 3300046463 | Bacteria | 2435 |
| 312 | Ga0495653_0110683 | 3300046463 | Bacteria | 1974 |
| 313 | Ga0495653_0111736 | 3300046463 | Bacteria | 1962 |
| 314 | Ga0495580_0198847 | 3300046472 | Bacteria | 1381 |
| 315 | Ga0495582_0006119 | 3300046473 | Bacteria | 6700 |
| 316 | Ga0495582_0064429 | 3300046473 | Bacteria | 2023 |
| 317 | Ga0495582_0788114 | 3300046473 | Bacteria | 550 |
| 318 | Ga0495605_0044000 | 3300046474 | Bacteria | 2210 |
| 319 | Ga0495639_0016672 | 3300046475 | Bacteria | 3190 |
| 320 | Ga0495639_0094579 | 3300046475 | Bacteria | 1405 |
| 321 | Ga0495662_0020691 | 3300046476 | Bacteria | 3183 |
| 322 | Ga0495662_0050364 | 3300046476 | Bacteria | 2010 |
| 323 | Ga0495662_0069800 | 3300046476 | Bacteria | 1702 |
| 324 | Ga0495664_0028603 | 3300046477 | Bacteria | 3254 |
| 325 | Ga0495664_0029014 | 3300046477 | Bacteria | 3234 |
| 326 | Ga0495664_0056716 | 3300046477 | Bacteria | 2330 |
| 327 | Ga0495664_0069453 | 3300046477 | Bacteria | 2103 |
| 328 | Ga0495664_0324597 | 3300046477 | Bacteria | 928 |
| 329 | Ga0495584_0019775 | 3300046491 | Bacteria | 3421 |
| 330 | Ga0495584_0299868 | 3300046491 | Bacteria | 816 |
| 331 | Ga0495585_0165030 | 3300046492 | Bacteria | 1147 |
| 332 | Ga0495594_0081206 | 3300046499 | Bacteria | 1810 |
| 333 | Ga0495594_0152129 | 3300046499 | Bacteria | 1314 |
| 334 | Ga0495594_0236869 | 3300046499 | Bacteria | 1040 |
| 335 | Ga0495594_0327479 | 3300046499 | Bacteria | 872 |
| 336 | Ga0495596_0077233 | 3300046500 | Bacteria | 1293 |
| 337 | Ga0495583_0004414 | 3300046506 | Bacteria | 10087 |
| 338 | Ga0495583_0007461 | 3300046506 | Bacteria | 6863 |
| 339 | Ga0495606_0013530 | 3300046507 | Bacteria | 6436 |
| 340 | Ga0495606_0034967 | 3300046507 | Bacteria | 3441 |
| 341 | Ga0495606_0084459 | 3300046507 | Bacteria | 1966 |
| 342 | Ga0495608_0003977 | 3300046511 | Bacteria | 10612 |
| 343 | Ga0495608_0039333 | 3300046511 | Bacteria | 3170 |
| 344 | Ga0495608_0662230 | 3300046511 | Bacteria | 623 |
| 345 | Ga0495610_0160122 | 3300046512 | Bacteria | 952 |
| 346 | Ga0495616_0070015 | 3300046513 | Bacteria | 1699 |
| 347 | Ga0495618_0033586 | 3300046514 | Bacteria | 3217 |
| 348 | Ga0495618_0038614 | 3300046514 | Bacteria | 3001 |
| 349 | Ga0495618_0050834 | 3300046514 | Bacteria | 2619 |
| 350 | Ga0495618_0117535 | 3300046514 | Bacteria | 1702 |
| 351 | Ga0495618_0157682 | 3300046514 | Bacteria | 1448 |
| 352 | Ga0495620_0004525 | 3300046515 | Bacteria | 7825 |
| 353 | Ga0495620_0027352 | 3300046515 | Bacteria | 2669 |
| 354 | Ga0495628_0023016 | 3300046516 | Bacteria | 5115 |
| 355 | Ga0495628_0085158 | 3300046516 | Bacteria | 2452 |
| 356 | Ga0495628_0251438 | 3300046516 | Bacteria | 1319 |
| 357 | Ga0495630_0012665 | 3300046517 | Bacteria | 6129 |
| 358 | Ga0495630_0029158 | 3300046517 | Bacteria | 4101 |
| 359 | Ga0495630_0059914 | 3300046517 | Bacteria | 2856 |
| 360 | Ga0495630_0633224 | 3300046517 | Bacteria | 819 |
| 361 | Ga0495632_0032177 | 3300046519 | Bacteria | 2705 |
| 362 | Ga0495643_0009009 | 3300046522 | Bacteria | 6265 |
| 363 | Ga0495643_0026392 | 3300046522 | Bacteria | 3278 |
| 364 | Ga0495643_0141985 | 3300046522 | Bacteria | 1196 |
| 365 | Ga0495644_0131379 | 3300046523 | Bacteria | 954 |
| 366 | Ga0495648_0085944 | 3300046524 | Bacteria | 1775 |
| 367 | Ga0495648_0166182 | 3300046524 | Bacteria | 1135 |
| 368 | Ga0495648_0168824 | 3300046524 | Bacteria | 1123 |
| 369 | Ga0495666_0366943 | 3300046526 | Bacteria | 648 |
| 370 | Ga0495642_0005802 | 3300046528 | Bacteria | 4735 |
| 371 | Ga0495642_0278456 | 3300046528 | Bacteria | 732 |
| 372 | Ga0495652_0019442 | 3300046529 | Bacteria | 6049 |
| 373 | Ga0495652_0034044 | 3300046529 | Bacteria | 4442 |
| 374 | Ga0495652_0442948 | 3300046529 | Bacteria | 911 |
| 375 | Ga0495654_0024894 | 3300046530 | Bacteria | 3088 |
| 376 | Ga0495665_0003001 | 3300046531 | Bacteria | 9116 |
| 377 | Ga0495665_0003331 | 3300046531 | Bacteria | 8709 |
| 378 | Ga0495665_0067765 | 3300046531 | Bacteria | 1882 |
| 379 | Ga0495640_0019113 | 3300046533 | Bacteria | 5062 |
| 380 | Ga0495640_0022767 | 3300046533 | Bacteria | 4575 |
| 381 | Ga0495640_0029500 | 3300046533 | Bacteria | 3939 |
| 382 | Ga0495640_0058626 | 3300046533 | Bacteria | 2625 |
| 383 | Ga0495640_0068050 | 3300046533 | Bacteria | 2397 |
| 384 | Ga0495640_0195480 | 3300046533 | Bacteria | 1284 |
| 385 | Ga0495587_0001773 | 3300046536 | Bacteria | 14435 |
| 386 | Ga0495587_0033088 | 3300046536 | Bacteria | 3122 |
| 387 | Ga0495597_0021940 | 3300046542 | Bacteria | 2965 |
| 388 | Ga0495597_0035792 | 3300046542 | Bacteria | 2238 |
| 389 | Ga0495645_0007934 | 3300046543 | Bacteria | 7388 |
| 390 | Ga0495645_0053069 | 3300046543 | Bacteria | 2947 |
| 391 | Ga0495645_0062199 | 3300046543 | Bacteria | 2704 |
| 392 | Ga0495645_0506320 | 3300046543 | Bacteria | 754 |
| 393 | Ga0495667_0003876 | 3300046559 | Bacteria | 10035 |
| 394 | Ga0495667_0069027 | 3300046559 | Bacteria | 2307 |
| 395 | Ga0495667_0116064 | 3300046559 | Bacteria | 1729 |
| 396 | Ga0495668_0031753 | 3300046616 | Bacteria | 2976 |
| 397 | Ga0495668_0033519 | 3300046616 | Bacteria | 2885 |
| 398 | Ga0495668_0036947 | 3300046616 | Bacteria | 2735 |
| 399 | Ga0495634_0024098 | 3300046642 | Bacteria | 4273 |
| 400 | Ga0495634_0028096 | 3300046642 | Bacteria | 3907 |
| 401 | Ga0495634_0106823 | 3300046642 | Bacteria | 1803 |
| 402 | Ga0495634_0108601 | 3300046642 | Bacteria | 1786 |
| 403 | Ga0495611_0011969 | 3300046648 | Bacteria | 3685 |
| 404 | Ga0495611_0052640 | 3300046648 | Bacteria | 1837 |
| 405 | Ga0495625_0109242 | 3300046660 | Bacteria | 1892 |
| 406 | Ga0495625_0122246 | 3300046660 | Bacteria | 1770 |
| 407 | Ga0495625_0135607 | 3300046660 | Bacteria | 1664 |
| 408 | Ga0495635_0028867 | 3300046663 | Bacteria | 3856 |
| 409 | Ga0495635_0105085 | 3300046663 | Bacteria | 1929 |
| 410 | Ga0495635_0139673 | 3300046663 | Bacteria | 1650 |
| 411 | Ga0495635_0279496 | 3300046663 | Bacteria | 1121 |
| 412 | Ga0495661_0017886 | 3300046665 | Bacteria | 4672 |
| 413 | Ga0495588_0163245 | 3300046674 | Bacteria | 1178 |
| 414 | Ga0495657_0001635 | 3300046675 | Bacteria | 19237 |
| 415 | Ga0495657_0009054 | 3300046675 | Bacteria | 7570 |
| 416 | Ga0495657_0103849 | 3300046675 | Bacteria | 1807 |
| 417 | Ga0495657_0223888 | 3300046675 | Bacteria | 1139 |
| 418 | Ga0495657_0491895 | 3300046675 | Bacteria | 716 |
| 419 | Ga0495599_0003611 | 3300046678 | Bacteria | 9073 |
| 420 | Ga0495599_0054988 | 3300046678 | Bacteria | 2493 |
| 421 | Ga0495599_0092148 | 3300046678 | Bacteria | 1891 |
| 422 | Ga0495599_0114681 | 3300046678 | Bacteria | 1677 |
| 423 | Ga0495599_0115970 | 3300046678 | Bacteria | 1666 |
| 424 | Ga0495599_0271997 | 3300046678 | Bacteria | 1028 |
| 425 | Ga0495623_0047445 | 3300046679 | Bacteria | 2726 |
| 426 | Ga0495623_0083852 | 3300046679 | Bacteria | 1967 |
| 427 | Ga0495623_0178721 | 3300046679 | Bacteria | 1234 |
| 428 | Ga0495646_0008226 | 3300046680 | Bacteria | 6631 |
| 429 | Ga0495646_0039848 | 3300046680 | Bacteria | 2894 |
| 430 | Ga0495646_0065285 | 3300046680 | Bacteria | 2155 |
| 431 | Ga0495646_0279090 | 3300046680 | Bacteria | 888 |
| 432 | Ga0495647_0029768 | 3300046681 | Bacteria | 2021 |
| 433 | Ga0495658_0017622 | 3300046683 | Bacteria | 3694 |
| 434 | Ga0495658_0066776 | 3300046683 | Bacteria | 2078 |
| 435 | Ga0495613_0000667 | 3300046689 | Bacteria | 27203 |
| 436 | Ga0495613_0019549 | 3300046689 | Bacteria | 5048 |
| 437 | Ga0495613_0025768 | 3300046689 | Bacteria | 4382 |
| 438 | Ga0495613_0027494 | 3300046689 | Bacteria | 4232 |
| 439 | Ga0495613_0065132 | 3300046689 | Bacteria | 2663 |
| 440 | Ga0495613_0411230 | 3300046689 | Bacteria | 921 |
| 441 | Ga0495613_0841389 | 3300046689 | Bacteria | 597 |
| 442 | Ga0495624_0007553 | 3300046690 | Bacteria | 7626 |
| 443 | Ga0495624_0015616 | 3300046690 | Bacteria | 5122 |
| 444 | Ga0495670_0012054 | 3300046691 | Bacteria | 4254 |
| 445 | Ga0495670_0445345 | 3300046691 | Bacteria | 702 |
| 446 | Ga0495671_0092290 | 3300046692 | Bacteria | 1482 |
| 447 | Ga0495649_0069262 | 3300046694 | Bacteria | 1892 |
| 448 | Ga0495649_0089896 | 3300046694 | Bacteria | 1637 |
| 449 | Ga0495589_0003521 | 3300046794 | Bacteria | 8473 |
| 450 | Ga0495589_0005343 | 3300046794 | Bacteria | 6777 |
| 451 | Ga0495589_0014224 | 3300046794 | Bacteria | 4100 |
| 452 | Ga0495589_0020265 | 3300046794 | Bacteria | 3402 |
| 453 | Ga0495600_0003763 | 3300046809 | Bacteria | 8980 |
| 454 | Ga0495600_0100083 | 3300046809 | Bacteria | 1889 |
| 455 | Ga0495600_0207646 | 3300046809 | Bacteria | 1256 |
| 456 | Ga0495600_0329390 | 3300046809 | Bacteria | 959 |
| 457 | Ga0495600_0643310 | 3300046809 | Bacteria | 641 |
| 458 | Ga0495660_0135237 | 3300046810 | Bacteria | 1232 |
| 459 | Ga0495581_0002854 | 3300047315 | Bacteria | 9865 |
| 460 | Ga0495581_0013447 | 3300047315 | Bacteria | 4746 |
| 461 | Ga0495581_0022850 | 3300047315 | Bacteria | 3622 |
| 462 | Ga0495581_0534629 | 3300047315 | Bacteria | 681 |
| 463 | Ga0495604_0061427 | 3300047317 | Bacteria | 2874 |
| 464 | Ga0495604_0097539 | 3300047317 | Bacteria | 2167 |
| 465 | Ga0495604_0099909 | 3300047317 | Bacteria | 2134 |
| 466 | Ga0495604_0123620 | 3300047317 | Bacteria | 1869 |
| 467 | Ga0495604_0897959 | 3300047317 | Bacteria | 553 |
| 468 | Ga0495636_0018799 | 3300047318 | Bacteria | 2773 |
| 469 | Ga0495636_0160579 | 3300047318 | Bacteria | 1012 |
| 470 | Ga0495674_0005959 | 3300047319 | Bacteria | 11690 |
| 471 | Ga0495674_0090813 | 3300047319 | Bacteria | 2609 |
| 472 | Ga0495674_0206549 | 3300047319 | Bacteria | 1628 |
| 473 | Ga0495674_0289991 | 3300047319 | Bacteria | 1338 |
| 474 | Ga0495674_0796841 | 3300047319 | Bacteria | 735 |
| 475 | Ga0495672_0000619 | 3300047320 | Bacteria | 39643 |
| 476 | Ga0495672_0056233 | 3300047320 | Bacteria | 2291 |
| 477 | Ga0495672_0419299 | 3300047320 | Bacteria | 609 |
| 478 | Ga0495676_0001955 | 3300047321 | Bacteria | 18096 |
| 479 | Ga0495676_0007884 | 3300047321 | Bacteria | 9762 |
| 480 | Ga0495676_0010871 | 3300047321 | Bacteria | 8233 |
| 481 | Ga0495676_0027322 | 3300047321 | Bacteria | 4894 |
| 482 | Ga0495676_0061731 | 3300047321 | Bacteria | 2930 |
| 483 | Ga0495676_0271711 | 3300047321 | Bacteria | 1150 |
| 484 | Ga0495676_0646096 | 3300047321 | Bacteria | 687 |
| 485 | Ga0495676_0652055 | 3300047321 | Bacteria | 683 |
| 486 | Ga0495680_0000649 | 3300047322 | Bacteria | 39022 |
| 487 | Ga0495680_0014200 | 3300047322 | Bacteria | 6910 |
| 488 | Ga0495680_0077746 | 3300047322 | Bacteria | 2513 |
| 489 | Ga0495680_0097901 | 3300047322 | Bacteria | 2189 |
| 490 | Ga0495680_0242127 | 3300047322 | Bacteria | 1281 |
| 491 | Ga0495680_0598194 | 3300047322 | Bacteria | 738 |
| 492 | Ga0495687_008120 | 3300047443 | Bacteria | 6059 |
| 493 | Ga0495687_009260 | 3300047443 | Bacteria | 5529 |
| 494 | Ga0495687_018188 | 3300047443 | Bacteria | 3480 |
| 495 | Ga0495687_030971 | 3300047443 | Bacteria | 2459 |
| 496 | Ga0495687_127248 | 3300047443 | Bacteria | 908 |
| 497 | Ga0495687_135951 | 3300047443 | Bacteria | 862 |
| 498 | Ga0495675_0062605 | 3300047444 | Bacteria | 2355 |
| 499 | Ga0495675_0284882 | 3300047444 | Bacteria | 984 |
| 500 | Ga0495677_0005888 | 3300047445 | Bacteria | 4644 |
| 501 | Ga0495685_001274 | 3300047447 | Bacteria | 7697 |
| 502 | Ga0495685_006240 | 3300047447 | Bacteria | 3897 |
| 503 | Ga0495685_007570 | 3300047447 | Bacteria | 3589 |
| 504 | Ga0495685_099175 | 3300047447 | Bacteria | 962 |
| 505 | Ga0495673_0006744 | 3300047469 | Bacteria | 6709 |
| 506 | Ga0495673_0143977 | 3300047469 | Bacteria | 927 |
| 507 | Ga0495681_0002904 | 3300047470 | Bacteria | 12114 |
| 508 | Ga0495681_0373290 | 3300047470 | Bacteria | 538 |
| 509 | Ga0495684_0037548 | 3300047471 | Bacteria | 3715 |
| 510 | Ga0495684_0070733 | 3300047471 | Bacteria | 2652 |
| 511 | Ga0495686_0151304 | 3300047472 | Bacteria | 1362 |
| 512 | Ga0495593_0003917 | 3300047673 | Bacteria | 8892 |
| 513 | Ga0495593_0007394 | 3300047673 | Bacteria | 6434 |
| 514 | Ga0495593_0028981 | 3300047673 | Bacteria | 3039 |
| 515 | Ga0495593_0126214 | 3300047673 | Bacteria | 1300 |
| 516 | Ga0495602_0095793 | 3300048088 | Bacteria | 2449 |
| 517 | Ga0495602_0261373 | 3300048088 | Bacteria | 1284 |
| 518 | Ga0495602_0584761 | 3300048088 | Bacteria | 770 |
| 519 | Ga0495602_0676528 | 3300048088 | Bacteria | 702 |
| 520 | Ga0495614_0002000 | 3300048089 | Bacteria | 8965 |
| 521 | Ga0495614_0025438 | 3300048089 | Bacteria | 2553 |
| 522 | Ga0495614_0047064 | 3300048089 | Bacteria | 1849 |
| 523 | Ga0495614_0113696 | 3300048089 | Bacteria | 1189 |
| 524 | Ga0495614_0117850 | 3300048089 | Bacteria | 1169 |
| 525 | Ga0495614_0213925 | 3300048089 | Bacteria | 874 |
| 526 | Ga0495626_0065860 | 3300048091 | Bacteria | 1639 |
| 527 | Ga0495626_0293008 | 3300048091 | Bacteria | 644 |
| 528 | Ga0496100_0002164 | 3300048903 | Bacteria | 9894 |
| 529 | Ga0496100_0410728 | 3300048903 | Bacteria | 1032 |
| 530 | Ga0496100_0909821 | 3300048903 | Bacteria | 691 |
| 531 | Ga0496101_0000213 | 3300048904 | Bacteria | 43662 |
| 532 | Ga0496101_0022971 | 3300048904 | Bacteria | 4302 |
| 533 | Ga0496102_0000483 | 3300048905 | Bacteria | 44220 |
| 534 | Ga0496102_0189586 | 3300048905 | Bacteria | 1937 |
| 535 | Ga0496103_0000323 | 3300048906 | Bacteria | 43761 |
| 536 | Ga0496104_0029410 | 3300048907 | Bacteria | 5096 |
| 537 | Ga0496104_1582669 | 3300048907 | Bacteria | 558 |
| 538 | Ga0496105_0026379 | 3300048908 | Bacteria | 4738 |
| 539 | Ga0496106_0082045 | 3300048909 | Bacteria | 2478 |
| 540 | Ga0496107_0038499 | 3300048910 | Bacteria | 3430 |
| 541 | Ga0496107_0280979 | 3300048910 | Bacteria | 1239 |
| 542 | Ga0496108_0031212 | 3300048911 | Bacteria | 4419 |
| 543 | Ga0496108_0473470 | 3300048911 | Bacteria | 1094 |
| 544 | Ga0496109_0021543 | 3300048912 | Bacteria | 5701 |
| 545 | Ga0496110_0331039 | 3300048913 | Bacteria | 1387 |
| 546 | Ga0496111_0288096 | 3300048914 | Bacteria | 1218 |
| 547 | Ga0496112_0165527 | 3300048915 | Bacteria | 2177 |
| 548 | Ga0496112_0662406 | 3300048915 | Bacteria | 973 |
| 549 | Ga0496113_0269281 | 3300048916 | Bacteria | 1361 |
| 550 | Ga0496113_0283272 | 3300048916 | Bacteria | 1325 |
| 551 | Ga0496114_0045716 | 3300048917 | Bacteria | 3638 |
| 552 | Ga0496114_1599420 | 3300048917 | Bacteria | 540 |
| 553 | Ga0496115_0009849 | 3300048918 | Bacteria | 7116 |
| 554 | Ga0496115_0166754 | 3300048918 | Bacteria | 1821 |
| 555 | Ga0496116_0000691 | 3300048919 | Bacteria | 43800 |
| 556 | Ga0496117_0000018 | 3300048920 | Bacteria | 479613 |
| 557 | Ga0496118_0000013 | 3300048921 | Bacteria | 574008 |
| 558 | Ga0496118_0001697 | 3300048921 | Bacteria | 32208 |
| 559 | Ga0496119_0010794 | 3300048922 | Bacteria | 7646 |
| 560 | Ga0496121_0002814 | 3300048924 | Bacteria | 25727 |
| 561 | Ga0496126_0000902 | 3300048929 | Bacteria | 51705 |
| 562 | Ga0496126_0431232 | 3300048929 | Bacteria | 1064 |
| 563 | Ga0495678_045845 | 3300049459 | Bacteria | 1722 |
| 564 | Ga0501031_0012733 | 3300049568 | Bacteria | 5495 |
| 565 | Ga0501031_0033560 | 3300049568 | Bacteria | 3348 |
| 566 | Ga0501032_0003359 | 3300049569 | Bacteria | 12282 |
| 567 | Ga0501032_0013431 | 3300049569 | Bacteria | 5824 |
| 568 | Ga0501032_0151761 | 3300049569 | Bacteria | 1523 |
| 569 | Ga0501033_0003517 | 3300049570 | Bacteria | 12827 |
| 570 | Ga0501033_0463225 | 3300049570 | Bacteria | 879 |
| 571 | Ga0501034_0010616 | 3300049571 | Bacteria | 9585 |
| 572 | Ga0501034_0026168 | 3300049571 | Bacteria | 5940 |
| 573 | Ga0501034_0451395 | 3300049571 | Bacteria | 1203 |
| 574 | Ga0501036_0051553 | 3300049572 | Bacteria | 3484 |
| 575 | Ga0501036_0172234 | 3300049572 | Bacteria | 1823 |
| 576 | Ga0501036_0203509 | 3300049572 | Bacteria | 1665 |
| 577 | Ga0501037_0012416 | 3300049573 | Bacteria | 6273 |
| 578 | Ga0501037_0101866 | 3300049573 | Bacteria | 2072 |
| 579 | Ga0501037_0519244 | 3300049573 | Bacteria | 806 |
| 580 | Ga0501038_0001079 | 3300049574 | Bacteria | 24647 |
| 581 | Ga0501038_0002749 | 3300049574 | Bacteria | 16398 |
| 582 | Ga0501038_0005850 | 3300049574 | Bacteria | 11376 |
| 583 | Ga0501038_0139047 | 3300049574 | Bacteria | 1988 |
| 584 | Ga0501038_0878270 | 3300049574 | Bacteria | 663 |
| 585 | Ga0501039_0002691 | 3300049575 | Bacteria | 13262 |
| 586 | Ga0501039_0645790 | 3300049575 | Bacteria | 828 |
| 587 | Ga0501040_0009051 | 3300049576 | Bacteria | 6478 |
| 588 | Ga0501041_0013295 | 3300049577 | Bacteria | 4877 |
| 589 | Ga0501041_0263362 | 3300049577 | Bacteria | 1084 |
| 590 | Ga0501042_0045254 | 3300049578 | Bacteria | 3137 |
| 591 | Ga0501042_0048153 | 3300049578 | Bacteria | 3039 |
| 592 | Ga0501043_0000422 | 3300049579 | Bacteria | 38076 |
| 593 | Ga0501043_0000795 | 3300049579 | Bacteria | 28078 |
| 594 | Ga0501046_0013409 | 3300049580 | Bacteria | 6938 |
| 595 | Ga0501047_0000628 | 3300049581 | Bacteria | 37206 |
| 596 | Ga0501047_0022072 | 3300049581 | Bacteria | 6114 |
| 597 | Ga0501047_0138091 | 3300049581 | Bacteria | 2317 |
| 598 | Ga0501047_0148092 | 3300049581 | Bacteria | 2224 |
| 599 | Ga0501047_0230241 | 3300049581 | Bacteria | 1707 |
| 600 | Ga0501047_0408213 | 3300049581 | Bacteria | 1191 |
| 601 | Ga0501048_0004797 | 3300049582 | Bacteria | 10304 |
| 602 | Ga0501048_0599668 | 3300049582 | Bacteria | 791 |
| 603 | Ga0501067_0000479 | 3300049583 | Bacteria | 21809 |
| 604 | Ga0501067_0098981 | 3300049583 | Bacteria | 1619 |
| 605 | Ga0501068_0003885 | 3300049584 | Bacteria | 8115 |
| 606 | Ga0501068_0063045 | 3300049584 | Bacteria | 2255 |
| 607 | Ga0501068_0349573 | 3300049584 | Bacteria | 950 |
| 608 | Ga0501069_0014642 | 3300049585 | Bacteria | 4194 |
| 609 | Ga0501069_0113586 | 3300049585 | Bacteria | 1544 |
| 610 | Ga0501070_0010556 | 3300049586 | Bacteria | 7806 |
| 611 | Ga0501070_0026920 | 3300049586 | Bacteria | 4822 |
| 612 | Ga0501070_1107634 | 3300049586 | Bacteria | 610 |
| 613 | Ga0501071_0000984 | 3300049587 | Bacteria | 15606 |
| 614 | Ga0501072_0002372 | 3300049588 | Bacteria | 14130 |
| 615 | Ga0501072_0015988 | 3300049588 | Bacteria | 5754 |
| 616 | Ga0501073_0187485 | 3300049589 | Bacteria | 1431 |
| 617 | Ga0501074_0004061 | 3300049590 | Bacteria | 10444 |
| 618 | Ga0501077_0003437 | 3300049593 | Bacteria | 9518 |
| 619 | Ga0501077_0277216 | 3300049593 | Bacteria | 1067 |
| 620 | Ga0501079_0007311 | 3300049741 | Bacteria | 8342 |
| 621 | Ga0501080_0020194 | 3300049742 | Bacteria | 6166 |
| 622 | Ga0501081_1133296 | 3300049743 | Bacteria | 592 |
| 623 | Ga0501083_0026882 | 3300049744 | Bacteria | 3975 |
| 624 | Ga0501035_0002191 | 3300049822 | Bacteria | 19390 |
| 625 | Ga0501035_0101531 | 3300049822 | Bacteria | 2524 |
| 626 | Ga0501035_0173541 | 3300049822 | Bacteria | 1861 |
| 627 | Ga0501035_0246355 | 3300049822 | Bacteria | 1519 |
| 628 | Ga0501035_0429228 | 3300049822 | Bacteria | 1096 |
| 629 | Ga0501044_0000324 | 3300049823 | Bacteria | 60304 |
| 630 | Ga0501044_0001246 | 3300049823 | Bacteria | 30214 |
| 631 | Ga0501044_0012280 | 3300049823 | Bacteria | 9273 |
| 632 | Ga0501044_0028014 | 3300049823 | Bacteria | 5945 |
| 633 | Ga0501044_0064316 | 3300049823 | Bacteria | 3745 |
| 634 | Ga0501044_0176972 | 3300049823 | Bacteria | 2102 |
| 635 | Ga0501044_0182192 | 3300049823 | Bacteria | 2066 |
| 636 | Ga0501044_0465590 | 3300049823 | Bacteria | 1169 |
| 637 | Ga0501044_1078837 | 3300049823 | Bacteria | 673 |
| 638 | Ga0501045_0002202 | 3300049824 | Bacteria | 13212 |
| 639 | nmdc:mga03683_94358_c1 | 3300050489 | Bacteria | 1308 |
| 640 | nmdc:mga03n38_273804_c1 | 3300050490 | Bacteria | 899 |
| 641 | nmdc:mga03n38_40558_c1 | 3300050490 | Bacteria | 2024 |
| 642 | nmdc:mga0yw44_119033_c1 | 3300050492 | Bacteria | 1700 |
| 643 | nmdc:mga0yw44_4412_c1 | 3300050492 | Bacteria | 6446 |
| 644 | nmdc:mga06z11_89883_c1 | 3300050494 | Bacteria | 1665 |
| 645 | nmdc:mga07m45_50184_c1 | 3300050496 | Bacteria | 2350 |
| 646 | nmdc:mga05p37_982535_c1 | 3300050507 | Bacteria | 899 |
| 647 | nmdc:mga08y16_1345697_c1 | 3300050511 | Bacteria | 679 |
| 648 | nmdc:mga08y16_1978425_c1 | 3300050511 | Bacteria | 532 |
| 649 | nmdc:mga08y16_32181_c1 | 3300050511 | Bacteria | 5514 |
| 650 | nmdc:mga0rr50_125644_c1 | 3300050513 | Bacteria | 2048 |
| 651 | nmdc:mga08x19_258675_c1 | 3300050514 | Bacteria | 1203 |
| 652 | nmdc:mga08x19_83721_c1 | 3300050514 | Bacteria | 2097 |
| 653 | Ga0495601_0026756 | 3300053077 | Bacteria | 3564 |
| 654 | Ga0495601_0077705 | 3300053077 | Bacteria | 2126 |
| 655 | Ga0495601_0390033 | 3300053077 | Bacteria | 903 |
| 656 | Ga0495601_0497974 | 3300053077 | Bacteria | 786 |
| 657 | Ga0495612_0004573 | 3300053078 | Bacteria | 5739 |
| 658 | Ga0495612_0153547 | 3300053078 | Bacteria | 1003 |
| 659 | Ga0495612_0159619 | 3300053078 | Bacteria | 984 |
| 660 | Ga0500610_0085860 | 3300053079 | Bacteria | 1638 |
| 661 | Ga0495655_0038559 | 3300053083 | Bacteria | 1206 |
| 662 | Ga0495595_0075152 | 3300053084 | Bacteria | 1602 |
| 663 | Ga0495619_0065543 | 3300053085 | Bacteria | 2423 |
| 664 | Ga0495619_0195716 | 3300053085 | Bacteria | 1399 |
| 665 | Ga0495619_0281004 | 3300053085 | Bacteria | 1153 |
| 666 | Ga0495619_0597485 | 3300053085 | Bacteria | 755 |
| 667 | Ga0500578_0047477 | 3300053086 | Bacteria | 2754 |
| 668 | Ga0500643_017762 | 3300053087 | Bacteria | 2375 |
| 669 | Ga0500583_0309936 | 3300053092 | Bacteria | 771 |
| 670 | Ga0500651_0296701 | 3300053093 | Bacteria | 928 |
| 671 | Ga0500566_0151278 | 3300053094 | Bacteria | 1220 |
| 672 | Ga0500654_051662 | 3300053099 | Bacteria | 2205 |
| 673 | Ga0500660_069428 | 3300053100 | Bacteria | 1659 |
| 674 | Ga0500556_0224235 | 3300053104 | Bacteria | 741 |
| 675 | Ga0500562_000672 | 3300053108 | Bacteria | 8316 |
| 676 | Ga0500569_002906 | 3300053109 | Bacteria | 3435 |
| 677 | Ga0500621_146797 | 3300053126 | Bacteria | 889 |
| 678 | Ga0500628_002540 | 3300053129 | Bacteria | 3011 |
| 679 | Ga0500652_021787 | 3300053131 | Bacteria | 2417 |
| 680 | Ga0500658_0006846 | 3300053134 | Bacteria | 4218 |
| 681 | Ga0500561_0002571 | 3300053137 | Bacteria | 3072 |
| 682 | Ga0500579_051062 | 3300053143 | Bacteria | 2528 |
| 683 | Ga0500600_0034098 | 3300053149 | Bacteria | 2973 |
| 684 | Ga0500616_0080357 | 3300053153 | Bacteria | 1639 |
| 685 | Ga0500616_0182666 | 3300053153 | Bacteria | 943 |
| 686 | Ga0500633_0000747 | 3300053160 | Bacteria | 5540 |
| 687 | Ga0500634_0010789 | 3300053161 | Bacteria | 4680 |
| 688 | Ga0500656_001114 | 3300053732 | Bacteria | 2228 |
| 689 | Ga0501084_0069917 | 3300054114 | Bacteria | 2939 |
| 690 | Ga0501082_0012873 | 3300060353 | Bacteria | 7190 |
| 691 | Ga0466962_0010842 | 3300061719 | Bacteria | 4381 |
| 692 | Ga0466962_0014347 | 3300061719 | Bacteria | 3819 |
| 693 | Ga0466962_0019302 | 3300061719 | Bacteria | 3275 |
| 694 | Ga0466962_0238048 | 3300061719 | Bacteria | 893 |
| 695 | Ga0530510_0145049 | 3300061734 | Bacteria | 1751 |
| 696 | Ga0530510_0158491 | 3300061734 | Bacteria | 1674 |
| 697 | 2515857636 | 2515154155 | Bacteria | 7985436 |
| 698 | 2552107031 | 2551306166 | Bacteria | 9731570 |
| 699 | 2554257814 | 2554235005 | Bacteria | 6457341 |
| 700 | 2616698486 | 2616644814 | Bacteria | 11555299 |
| 701 | 2616698859 | 2616644814 | Bacteria | 11555299 |
| 702 | 2616701271 | 2616644814 | Bacteria | 11555299 |
| 703 | 2616901814 | 2616644941 | Bacteria | 8510691 |
| 704 | 2643902735 | 2643221578 | Bacteria | 9213798 |
| 705 | 2643942161 | 2643221587 | Bacteria | 7586415 |
| 706 | 2644404756 | 2643221673 | Bacteria | 9196637 |
| 707 | 2644429244 | 2643221677 | Bacteria | 7584031 |
| 708 | 2676484646 | 2675903059 | Bacteria | 8644972 |
| 709 | 2739604554 | 2739367654 | Bacteria | 6049412 |
| 710 | 2784588153 | 2784132148 | Bacteria | 8627943 |
| 711 | 2785342573 | 2784746763 | Bacteria | 9783172 |
| 712 | 2785366516 | 2784746768 | Bacteria | 10036182 |
| 713 | 2795793738 | 2795385472 | Bacteria | 6627535 |
| 714 | 2808916410 | 2808606375 | Bacteria | 9466072 |
| 715 | 2809027725 | 2808606394 | Bacteria | 6248540 |
| 716 | 2809229683 | 2808606448 | Bacteria | 8656184 |
| 717 | 2809231765 | 2808606448 | Bacteria | 8656184 |
| 718 | 2812483176 | 2811994917 | Bacteria | 7761064 |
| 719 | 2816509160 | 2816332139 | Bacteria | 9138787 |
| 720 | 2819694553 | 2818991463 | Bacteria | 7948711 |
| 721 | 2819741060 | 2818991472 | Bacteria | 10089953 |
| 722 | 2862383061 | 2862382967 | Bacteria | 10317375 |
| 723 | 2862515790 | 2862507626 | Bacteria | 9425308 |
| 724 | 2862574561 | 2862574272 | Bacteria | 10567477 |
| 725 | 2867371208 | 2867369537 | Bacteria | 6501581 |
| 726 | 2867429013 | 2867428634 | Bacteria | 9590268 |
| 727 | 2867429548 | 2867428634 | Bacteria | 9590268 |
| 728 | 2867477120 | 2867475112 | Bacteria | 6909112 |
| 729 | 2870790824 | 2870782633 | Bacteria | 9624083 |
| 730 | 2873151952 | 2873151551 | Bacteria | 8625867 |
| 731 | 2873152722 | 2873151551 | Bacteria | 8625867 |
| 732 | 2877684022 | 2877676314 | Bacteria | 9512378 |
| 733 | 2895434089 | 2895427314 | Bacteria | 13147766 |
| 734 | 2899371635 | 2899370129 | Bacteria | 6781179 |
| 735 | 2902794973 | 2902792274 | Bacteria | 7270173 |
| 736 | 2912715437 | 2912715099 | Bacteria | 9460473 |
| 737 | 2917742498 | 2917736166 | Bacteria | 9690793 |
| 738 | 2928146980 | 2928142448 | Bacteria | 5288925 |
| 739 | 2954387575 | 2954380949 | Bacteria | 10050426 |
| 740 | 2954389332 | 2954380949 | Bacteria | 10050426 |
| 741 | 2954700116 | 2954691527 | Bacteria | 10720516 |
| 742 | 2954701288 | 2954691527 | Bacteria | 10720516 |
| 743 | 2954702111 | 2954701450 | Bacteria | 10834262 |
| 744 | 2954718915 | 2954711539 | Bacteria | 10867210 |
| 745 | 2954728885 | 2954721474 | Bacteria | 10456478 |
| 746 | 2954729487 | 2954721474 | Bacteria | 10456478 |
| 747 | 2954732321 | 2954731030 | Bacteria | 10243860 |
| 748 | 2954732927 | 2954731030 | Bacteria | 10243860 |
| 749 | 2954747784 | 2954740390 | Bacteria | 10229294 |
| 750 | 2954748390 | 2954740390 | Bacteria | 10229294 |
| 751 | 2954751804 | 2954749733 | Bacteria | 10366972 |
| 752 | 2954766908 | 2954759201 | Bacteria | 9358192 |
| 753 | 2954767520 | 2954759201 | Bacteria | 9358192 |
| 754 | 2966602645 | 2966598605 | Bacteria | 7676064 |
| 755 | 2990044968 | 2990044586 | Bacteria | 6603797 |
| 756 | 2995465839 | 2995463766 | Bacteria | 8577691 |
| 757 | 2995466693 | 2995463766 | Bacteria | 8577691 |
| 758 | 8008491434 | 8008485437 | Bacteria | 7198341 |
| 759 | 8008565773 | 8008558824 | Bacteria | 10610750 |
| 760 | 8023629867 | 8023623736 | Bacteria | 8593882 |
| 761 | 8023631403 | 8023623736 | Bacteria | 8593882 |
| 762 | 8025530764 | 8025524527 | Bacteria | 7197316 |
| 763 | 8025537235 | 8025530807 | Bacteria | 8495698 |
| 764 | 8047899020 | 8047893842 | Bacteria | 11723082 |
| 765 | 8048359900 | 8048356638 | Bacteria | 11044339 |
| 766 | 8048375984 | 8048369669 | Bacteria | 11666822 |
| 767 | 8048382136 | 8048379754 | Bacteria | 11877923 |
| 768 | 8048410436 | 8048406513 | Bacteria | 8936924 |
| 769 | 8057575190 | 8057568493 | Bacteria | 7221719 |
| 770 | Ga0373957_0202467 | |||
| 771 | JGI24751J29686_10052271 | |||
| 772 | rootH1_10020868 | |||
| 773 | JGI25160J50197_1065114 | |||
| 774 | JGI25160J50197_1067936 | |||
| 775 | Ga0007429J51699_1055425 | |||
| 776 | Ga0070680_100331997 | |||
| 777 | Ga0070682_100131654 | |||
| 778 | Ga0070692_10423261 | |||
| 779 | Ga0070668_100000999 | |||
| 780 | Ga0070668_100645027 | |||
| 781 | Ga0070667_100703421 | |||
| 782 | Ga0070709_10000243 | |||
| 783 | Ga0070709_10012029 | |||
| 784 | Ga0070714_100000182 | |||
| 785 | Ga0070714_100002623 | |||
| 786 | Ga0070714_100010478 | |||
| 787 | Ga0070714_100026307 | |||
| 788 | Ga0070714_100031751 | |||
| 789 | Ga0070714_100058634 | |||
| 790 | Ga0070714_100361420 | |||
| 791 | Ga0070714_101419948 | |||
| 792 | Ga0070713_100022851 | |||
| 793 | Ga0070713_100065781 | |||
| 794 | Ga0070713_100106274 | |||
| 795 | Ga0070713_100155732 | |||
| 796 | Ga0070713_100166880 | |||
| 797 | Ga0070713_100417314 | |||
| 798 | Ga0070713_100818684 | |||
| 799 | Ga0070710_10050201 | |||
| 800 | Ga0070710_10258524 | |||
| 801 | Ga0070711_100005834 | |||
| 802 | Ga0070711_101723033 | |||
| 803 | Ga0070708_100125524 | |||
| 804 | Ga0070708_100615482 | |||
| 805 | Ga0070681_10305117 | |||
| 806 | Ga0070681_10341121 | |||
| 807 | Ga0070681_10700953 | |||
| 808 | Ga0070681_10713704 | |||
| 809 | Ga0070706_100002002 | |||
| 810 | Ga0070706_100005239 | |||
| 811 | Ga0070706_100039325 | |||
| 812 | Ga0070706_100069369 | |||
| 813 | Ga0070706_100095338 | |||
| 814 | Ga0070706_100329543 | |||
| 815 | Ga0070706_100855151 | |||
| 816 | Ga0070707_100000797 | |||
| 817 | Ga0070707_100003785 | |||
| 818 | Ga0070707_100017217 | |||
| 819 | Ga0070707_100055232 | |||
| 820 | Ga0070707_100062019 | |||
| 821 | Ga0070707_100313726 | |||
| 822 | Ga0070698_100002141 | |||
| 823 | Ga0070698_100009098 | |||
| 824 | Ga0070698_100018894 | |||
| 825 | Ga0070698_100036167 | |||
| 826 | Ga0070699_100099753 | |||
| 827 | Ga0070699_100843362 | |||
| 828 | Ga0070679_100680198 | |||
| 829 | Ga0070684_100794916 | |||
| 830 | Ga0070697_100170924 | |||
| 831 | Ga0068853_100613103 | |||
| 832 | Ga0068856_101245493 | |||
| 833 | Ga0068852_100186405 | |||
| 834 | Ga0068863_101604152 | |||
| 835 | Ga0081455_10001878 | |||
| 836 | Ga0081455_10003313 | |||
| 837 | Ga0081455_10021368 | |||
| 838 | Ga0081455_10080421 | |||
| 839 | Ga0081455_10209498 | |||
| 840 | Ga0081455_10771896 | |||
| 841 | Ga0070717_10008469 | |||
| 842 | Ga0070717_10024414 | |||
| 843 | Ga0070717_10136254 | |||
| 844 | Ga0070717_10173275 | |||
| 845 | Ga0070717_10224223 | |||
| 846 | Ga0070717_10337286 | |||
| 847 | Ga0070717_10743957 | |||
| 848 | Ga0070717_11775248 | |||
| 849 | Ga0075365_10079608 | |||
| 850 | Ga0075365_10148913 | |||
| 851 | Ga0075363_100000934 | |||
| 852 | Ga0075363_100069457 | |||
| 853 | Ga0075364_10006246 | |||
| 854 | Ga0075364_10629625 | |||
| 855 | Ga0070715_10100287 | |||
| 856 | Ga0070716_100002854 | |||
| 857 | Ga0070716_100358272 | |||
| 858 | Ga0070716_100558399 | |||
| 859 | Ga0070712_100075671 | |||
| 860 | Ga0070712_100125328 | |||
| 861 | Ga0070712_100246365 | |||
| 862 | Ga0075362_10096024 | |||
| 863 | Ga0075367_10036907 | |||
| 864 | Ga0075367_10295956 | |||
| 865 | Ga0075369_10068077 | |||
| 866 | Ga0075370_10183041 | |||
| 867 | Ga0075433_10473373 | |||
| 868 | Ga0075434_100133897 | |||
| 869 | Ga0075436_100178011 | |||
| 870 | Ga0075436_101026091 | |||
| 871 | Ga0075435_100034581 | |||
| 872 | Ga0099794_10228130 | |||
| 873 | Ga0099795_10376440 | |||
| 874 | Ga0111539_10038228 | |||
| 875 | Ga0111539_11223338 | |||
| 876 | Ga0105245_10532095 | |||
| 877 | Ga0114129_10493987 | |||
| 878 | Ga0105241_10043884 | |||
| 879 | Ga0105242_11195285 | |||
| 880 | Ga0105248_10057340 | |||
| 881 | Ga0105237_10002906 | |||
| 882 | Ga0105238_10056909 | |||
| 883 | Ga0105238_10377041 | |||
| 884 | Ga0105238_10769318 | |||
| 885 | Ga0105239_10096779 | |||
| 886 | Ga0105239_10225151 | |||
| 887 | Ga0157370_10101229 | |||
| 888 | Ga0157369_11700891 | |||
| 889 | Ga0157374_10271997 | |||
| 890 | Ga0157378_10373596 | |||
| 891 | Ga0163162_10372860 | |||
| 892 | Ga0163162_12090630 | |||
| 893 | Ga0157372_10609819 | |||
| 894 | Ga0157375_10678910 | |||
| 895 | Ga0157375_12800311 | |||
| 896 | Ga0163163_10789778 | |||
| 897 | Ga0182008_10791943 | |||
| 898 | Ga0157379_10092229 | |||
| 899 | Ga0157379_10331580 | |||
| 900 | Ga0157376_10517381 | |||
| 901 | Ga0206353_11048574 | |||
| 902 | Ga0224572_1008048 | |||
| 903 | Ga0209025_1028809 | |||
| 904 | Ga0209758_1013803 | |||
| 905 | Ga0207426_1001133 | |||
| 906 | Ga0207426_1018973 | |||
| 907 | Ga0207426_1052728 | |||
| 908 | Ga0207692_10002709 | |||
| 909 | Ga0207692_10010071 | |||
| 910 | Ga0207692_10238155 | |||
| 911 | Ga0207692_10275582 | |||
| 912 | Ga0207699_10001799 | |||
| 913 | Ga0207699_10004721 | |||
| 914 | Ga0207699_10106163 | |||
| 915 | Ga0207684_10004995 | |||
| 916 | Ga0207684_10026372 | |||
| 917 | Ga0207684_10094456 | |||
| 918 | Ga0207684_10120710 | |||
| 919 | Ga0207684_10231113 | |||
| 920 | Ga0207684_10278049 | |||
| 921 | Ga0207684_10345372 | |||
| 922 | Ga0207684_10760491 | |||
| 923 | Ga0207707_10379540 | |||
| 924 | Ga0207671_10271298 | |||
| 925 | Ga0207671_11194469 | |||
| 926 | Ga0207693_10026948 | |||
| 927 | Ga0207693_10638234 | |||
| 928 | Ga0207663_10003868 | |||
| 929 | Ga0207663_10451028 | |||
| 930 | Ga0207663_11402271 | |||
| 931 | Ga0207657_10649598 | |||
| 932 | Ga0207652_10378761 | |||
| 933 | Ga0207646_10000388 | |||
| 934 | Ga0207646_10019127 | |||
| 935 | Ga0207646_10025051 | |||
| 936 | Ga0207646_10064922 | |||
| 937 | Ga0207646_10154867 | |||
| 938 | Ga0207700_10002168 | |||
| 939 | Ga0207700_10005439 | |||
| 940 | Ga0207700_10022222 | |||
| 941 | Ga0207700_10125882 | |||
| 942 | Ga0207700_10985188 | |||
| 943 | Ga0207700_11418387 | |||
| 944 | Ga0207664_10000185 | |||
| 945 | Ga0207664_10014432 | |||
| 946 | Ga0207664_10019092 | |||
| 947 | Ga0207664_10029998 | |||
| 948 | Ga0207664_10066428 | |||
| 949 | Ga0207664_10188484 | |||
| 950 | Ga0207664_10189469 | |||
| 951 | Ga0207664_10423453 | |||
| 952 | Ga0207664_11493683 | |||
| 953 | Ga0207709_10175183 | |||
| 954 | Ga0207704_10273587 | |||
| 955 | Ga0207665_10000276 | |||
| 956 | Ga0207661_10116002 | |||
| 957 | Ga0207661_10552449 | |||
| 958 | Ga0207712_10238527 | |||
| 959 | Ga0207668_10005675 | |||
| 960 | Ga0207668_10300864 | |||
| 961 | Ga0207668_11785243 | |||
| 962 | Ga0207658_10894192 | |||
| 963 | Ga0207639_10620742 | |||
| 964 | Ga0207702_11528954 | |||
| 965 | Ga0207641_10930965 | |||
| 966 | Ga0209588_1124427 | |||
| 967 | Ga0207428_10158678 | |||
| 968 | Ga0307515_10010500 | |||
| 969 | Ga0310981_1073946 | |||
| 970 | Ga0316180_1150693 | |||
| 971 | Ga0265767_113261 | |||
| 972 | Ga0307513_10001044 | |||
| 973 | Ga0307508_10002208 | |||
| 974 | Ga0310113_132598 | |||
| 975 | Ga0307516_10137779 | |||
| 976 | Ga0307516_10245121 | |||
| 977 | Ga0307516_10665707 | |||
| 978 | Ga0307407_10037821 | |||
| 979 | Ga0307507_10032370 | |||
| 980 | Ga0373926_0014693 | |||
| 981 | Ga0373934_0054249 | |||
| 982 | Ga0373934_0117034 | |||
| 983 | Ga0373940_0031571 | |||
| 984 | Ga0373944_0042516 | |||
| 985 | Ga0373951_0077153 | |||
| 986 | Ga0373952_0019090 | |||
| 987 | Ga0373923_0015828 | |||
| 988 | Ga0373936_0001085 | |||
| 989 | Ga0373936_0474554 | |||
| 990 | Ga0373941_0153120 | |||
| 991 | Ga0373953_0033808 | |||
| 992 | Ga0373954_0077090 | |||
| 993 | Ga0373957_0064102 | |||
| 994 | Ga0373957_0194638 | |||
| 995 | Ga0373943_0318743 | |||
| 996 | Ga0373946_0207683 | |||
| 997 | Ga0373955_0064434 | |||
| 998 | Ga0373955_0382247 | |||
| 999 | Ga0373961_0021928 | |||
| 1000 | Ga0373962_0206467 | |||
| 1001 | Ga0373924_0151194 | |||
| 1002 | Ga0373931_0191376 | |||
| 1003 | Ga0373935_0018217 | |||
| 1004 | Ga0373935_0038838 | |||
| 1005 | Ga0373935_0247500 | |||
| 1006 | Ga0373935_0603689 | |||
| 1007 | Ga0373927_0266302 | |||
| 1008 | Ga0373927_0568183 | |||
| 1009 | Ga0373933_0006460 | |||
| 1010 | Ga0373933_0157801 | |||
| 1011 | Ga0373937_0007312 | |||
| 1012 | Ga0373937_0067516 | |||
| 1013 | Ga0373925_0288236 | |||
| 1014 | Ga0373925_0441790 | |||
| 1015 | Ga0373925_0730010 | |||
| 1016 | Ga0395900_0089759 | |||
| 1017 | Ga0395900_1214336 | |||
| 1018 | Ga0395898_0038494 | |||
| 1019 | Ga0395905_0062522 | |||
| 1020 | Ga0436364_0711543 | |||
| 1021 | Ga0395901_0013227 | |||
| 1022 | Ga0439439_0049121 | |||
| 1023 | Ga0451845_0109047 | |||
| 1024 | Ga0451853_1842263 | |||
| 1025 | Ga0439448_0033199 | |||
| 1026 | Ga0439449_0172853 | |||
| 1027 | Ga0439457_001103 | |||
| 1028 | Ga0466972_0004325 | |||
| 1029 | Ga0466972_0010294 | |||
| 1030 | Ga0466972_0034769 | |||
| 1031 | Ga0466965_0011338 | |||
| 1032 | Ga0466965_0128087 | |||
| 1033 | Ga0466965_0511661 | |||
| 1034 | Ga0466966_0000993 | |||
| 1035 | Ga0466966_0005232 | |||
| 1036 | Ga0466966_0037421 | |||
| 1037 | Ga0466961_0002945 | |||
| 1038 | Ga0466961_0014665 | |||
| 1039 | Ga0466961_0218890 | |||
| 1040 | Ga0466961_0328977 | |||
| 1041 | Ga0466963_0004374 | |||
| 1042 | Ga0466963_0136025 | |||
| 1043 | Ga0466963_0283505 | |||
| 1044 | Ga0466963_0357103 | |||
| 1045 | Ga0466964_0122966 | |||
| 1046 | Ga0466964_0349969 | |||
| 1047 | Ga0466971_0039488 | |||
| 1048 | Ga0466971_0262655 | |||
| 1049 | Ga0466970_0005079 | |||
| 1050 | Ga0466970_0419868 | |||
| 1051 | Ga0466957_0058405 | |||
| 1052 | Ga0466960_0023801 | |||
| 1053 | Ga0466960_0191888 | |||
| 1054 | Ga0466959_0091410 | |||
| 1055 | Ga0466959_0158740 | |||
| 1056 | Ga0466959_0362554 | |||
| 1057 | Ga0466967_0000252 | |||
| 1058 | Ga0466967_0034819 | |||
| 1059 | Ga0466967_0167963 | |||
| 1060 | Ga0495592_0001754 | |||
| 1061 | Ga0495592_0063425 | |||
| 1062 | Ga0495592_0148813 | |||
| 1063 | Ga0495603_0005510 | |||
| 1064 | Ga0495603_0020663 | |||
| 1065 | Ga0495590_0075706 | |||
| 1066 | Ga0495629_0000993 | |||
| 1067 | Ga0495629_0008057 | |||
| 1068 | Ga0495629_0054178 | |||
| 1069 | Ga0495629_0189633 | |||
| 1070 | Ga0495638_0081381 | |||
| 1071 | Ga0495641_0012442 | |||
| 1072 | Ga0495641_0034761 | |||
| 1073 | Ga0495651_0008928 | |||
| 1074 | Ga0495651_0116464 | |||
| 1075 | Ga0495651_0267181 | |||
| 1076 | Ga0495651_0289962 | |||
| 1077 | Ga0495651_0322253 | |||
| 1078 | Ga0495653_0020708 | |||
| 1079 | Ga0495653_0079129 | |||
| 1080 | Ga0495653_0110683 | |||
| 1081 | Ga0495653_0111736 | |||
| 1082 | Ga0495580_0198847 | |||
| 1083 | Ga0495582_0006119 | |||
| 1084 | Ga0495582_0064429 | |||
| 1085 | Ga0495582_0788114 | |||
| 1086 | Ga0495605_0044000 | |||
| 1087 | Ga0495639_0016672 | |||
| 1088 | Ga0495639_0094579 | |||
| 1089 | Ga0495662_0020691 | |||
| 1090 | Ga0495662_0050364 | |||
| 1091 | Ga0495662_0069800 | |||
| 1092 | Ga0495664_0028603 | |||
| 1093 | Ga0495664_0029014 | |||
| 1094 | Ga0495664_0056716 | |||
| 1095 | Ga0495664_0069453 | |||
| 1096 | Ga0495664_0324597 | |||
| 1097 | Ga0495584_0019775 | |||
| 1098 | Ga0495584_0299868 | |||
| 1099 | Ga0495585_0165030 | |||
| 1100 | Ga0495594_0081206 | |||
| 1101 | Ga0495594_0152129 | |||
| 1102 | Ga0495594_0236869 | |||
| 1103 | Ga0495594_0327479 | |||
| 1104 | Ga0495596_0077233 | |||
| 1105 | Ga0495583_0004414 | |||
| 1106 | Ga0495583_0007461 | |||
| 1107 | Ga0495606_0013530 | |||
| 1108 | Ga0495606_0034967 | |||
| 1109 | Ga0495606_0084459 | |||
| 1110 | Ga0495608_0003977 | |||
| 1111 | Ga0495608_0039333 | |||
| 1112 | Ga0495608_0662230 | |||
| 1113 | Ga0495610_0160122 | |||
| 1114 | Ga0495616_0070015 | |||
| 1115 | Ga0495618_0033586 | |||
| 1116 | Ga0495618_0038614 | |||
| 1117 | Ga0495618_0050834 | |||
| 1118 | Ga0495618_0117535 | |||
| 1119 | Ga0495618_0157682 | |||
| 1120 | Ga0495620_0004525 | |||
| 1121 | Ga0495620_0027352 | |||
| 1122 | Ga0495628_0023016 | |||
| 1123 | Ga0495628_0085158 | |||
| 1124 | Ga0495628_0251438 | |||
| 1125 | Ga0495630_0012665 | |||
| 1126 | Ga0495630_0029158 | |||
| 1127 | Ga0495630_0059914 | |||
| 1128 | Ga0495630_0633224 | |||
| 1129 | Ga0495632_0032177 | |||
| 1130 | Ga0495643_0009009 | |||
| 1131 | Ga0495643_0026392 | |||
| 1132 | Ga0495643_0141985 | |||
| 1133 | Ga0495644_0131379 | |||
| 1134 | Ga0495648_0085944 | |||
| 1135 | Ga0495648_0166182 | |||
| 1136 | Ga0495648_0168824 | |||
| 1137 | Ga0495666_0366943 | |||
| 1138 | Ga0495642_0005802 | |||
| 1139 | Ga0495642_0278456 | |||
| 1140 | Ga0495652_0019442 | |||
| 1141 | Ga0495652_0034044 | |||
| 1142 | Ga0495652_0442948 | |||
| 1143 | Ga0495654_0024894 | |||
| 1144 | Ga0495665_0003001 | |||
| 1145 | Ga0495665_0003331 | |||
| 1146 | Ga0495665_0067765 | |||
| 1147 | Ga0495640_0019113 | |||
| 1148 | Ga0495640_0022767 | |||
| 1149 | Ga0495640_0029500 | |||
| 1150 | Ga0495640_0058626 | |||
| 1151 | Ga0495640_0068050 | |||
| 1152 | Ga0495640_0195480 | |||
| 1153 | Ga0495587_0001773 | |||
| 1154 | Ga0495587_0033088 | |||
| 1155 | Ga0495597_0021940 | |||
| 1156 | Ga0495597_0035792 | |||
| 1157 | Ga0495645_0007934 | |||
| 1158 | Ga0495645_0053069 | |||
| 1159 | Ga0495645_0062199 | |||
| 1160 | Ga0495645_0506320 | |||
| 1161 | Ga0495667_0003876 | |||
| 1162 | Ga0495667_0069027 | |||
| 1163 | Ga0495667_0116064 | |||
| 1164 | Ga0495668_0031753 | |||
| 1165 | Ga0495668_0033519 | |||
| 1166 | Ga0495668_0036947 | |||
| 1167 | Ga0495634_0024098 | |||
| 1168 | Ga0495634_0028096 | |||
| 1169 | Ga0495634_0106823 | |||
| 1170 | Ga0495634_0108601 | |||
| 1171 | Ga0495611_0011969 | |||
| 1172 | Ga0495611_0052640 | |||
| 1173 | Ga0495625_0109242 | |||
| 1174 | Ga0495625_0122246 | |||
| 1175 | Ga0495625_0135607 | |||
| 1176 | Ga0495635_0028867 | |||
| 1177 | Ga0495635_0105085 | |||
| 1178 | Ga0495635_0139673 | |||
| 1179 | Ga0495635_0279496 | |||
| 1180 | Ga0495661_0017886 | |||
| 1181 | Ga0495588_0163245 | |||
| 1182 | Ga0495657_0001635 | |||
| 1183 | Ga0495657_0009054 | |||
| 1184 | Ga0495657_0103849 | |||
| 1185 | Ga0495657_0223888 | |||
| 1186 | Ga0495657_0491895 | |||
| 1187 | Ga0495599_0003611 | |||
| 1188 | Ga0495599_0054988 | |||
| 1189 | Ga0495599_0092148 | |||
| 1190 | Ga0495599_0114681 | |||
| 1191 | Ga0495599_0115970 | |||
| 1192 | Ga0495599_0271997 | |||
| 1193 | Ga0495623_0047445 | |||
| 1194 | Ga0495623_0083852 | |||
| 1195 | Ga0495623_0178721 | |||
| 1196 | Ga0495646_0008226 | |||
| 1197 | Ga0495646_0039848 | |||
| 1198 | Ga0495646_0065285 | |||
| 1199 | Ga0495646_0279090 | |||
| 1200 | Ga0495647_0029768 | |||
| 1201 | Ga0495658_0017622 | |||
| 1202 | Ga0495658_0066776 | |||
| 1203 | Ga0495613_0000667 | |||
| 1204 | Ga0495613_0019549 | |||
| 1205 | Ga0495613_0025768 | |||
| 1206 | Ga0495613_0027494 | |||
| 1207 | Ga0495613_0065132 | |||
| 1208 | Ga0495613_0411230 | |||
| 1209 | Ga0495613_0841389 | |||
| 1210 | Ga0495624_0007553 | |||
| 1211 | Ga0495624_0015616 | |||
| 1212 | Ga0495670_0012054 | |||
| 1213 | Ga0495670_0445345 | |||
| 1214 | Ga0495671_0092290 | |||
| 1215 | Ga0495649_0069262 | |||
| 1216 | Ga0495649_0089896 | |||
| 1217 | Ga0495589_0003521 | |||
| 1218 | Ga0495589_0005343 | |||
| 1219 | Ga0495589_0014224 | |||
| 1220 | Ga0495589_0020265 | |||
| 1221 | Ga0495600_0003763 | |||
| 1222 | Ga0495600_0100083 | |||
| 1223 | Ga0495600_0207646 | |||
| 1224 | Ga0495600_0329390 | |||
| 1225 | Ga0495600_0643310 | |||
| 1226 | Ga0495660_0135237 | |||
| 1227 | Ga0495581_0002854 | |||
| 1228 | Ga0495581_0013447 | |||
| 1229 | Ga0495581_0022850 | |||
| 1230 | Ga0495581_0534629 | |||
| 1231 | Ga0495604_0061427 | |||
| 1232 | Ga0495604_0097539 | |||
| 1233 | Ga0495604_0099909 | |||
| 1234 | Ga0495604_0123620 | |||
| 1235 | Ga0495604_0897959 | |||
| 1236 | Ga0495636_0018799 | |||
| 1237 | Ga0495636_0160579 | |||
| 1238 | Ga0495674_0005959 | |||
| 1239 | Ga0495674_0090813 | |||
| 1240 | Ga0495674_0206549 | |||
| 1241 | Ga0495674_0289991 | |||
| 1242 | Ga0495674_0796841 | |||
| 1243 | Ga0495672_0000619 | |||
| 1244 | Ga0495672_0056233 | |||
| 1245 | Ga0495672_0419299 | |||
| 1246 | Ga0495676_0001955 | |||
| 1247 | Ga0495676_0007884 | |||
| 1248 | Ga0495676_0010871 | |||
| 1249 | Ga0495676_0027322 | |||
| 1250 | Ga0495676_0061731 | |||
| 1251 | Ga0495676_0271711 | |||
| 1252 | Ga0495676_0646096 | |||
| 1253 | Ga0495676_0652055 | |||
| 1254 | Ga0495680_0000649 | |||
| 1255 | Ga0495680_0014200 | |||
| 1256 | Ga0495680_0077746 | |||
| 1257 | Ga0495680_0097901 | |||
| 1258 | Ga0495680_0242127 | |||
| 1259 | Ga0495680_0598194 | |||
| 1260 | Ga0495687_008120 | |||
| 1261 | Ga0495687_009260 | |||
| 1262 | Ga0495687_018188 | |||
| 1263 | Ga0495687_030971 | |||
| 1264 | Ga0495687_127248 | |||
| 1265 | Ga0495687_135951 | |||
| 1266 | Ga0495675_0062605 | |||
| 1267 | Ga0495675_0284882 | |||
| 1268 | Ga0495677_0005888 | |||
| 1269 | Ga0495685_001274 | |||
| 1270 | Ga0495685_006240 | |||
| 1271 | Ga0495685_007570 | |||
| 1272 | Ga0495685_099175 | |||
| 1273 | Ga0495673_0006744 | |||
| 1274 | Ga0495673_0143977 | |||
| 1275 | Ga0495681_0002904 | |||
| 1276 | Ga0495681_0373290 | |||
| 1277 | Ga0495684_0037548 | |||
| 1278 | Ga0495684_0070733 | |||
| 1279 | Ga0495686_0151304 | |||
| 1280 | Ga0495593_0003917 | |||
| 1281 | Ga0495593_0007394 | |||
| 1282 | Ga0495593_0028981 | |||
| 1283 | Ga0495593_0126214 | |||
| 1284 | Ga0495602_0095793 | |||
| 1285 | Ga0495602_0261373 | |||
| 1286 | Ga0495602_0584761 | |||
| 1287 | Ga0495602_0676528 | |||
| 1288 | Ga0495614_0002000 | |||
| 1289 | Ga0495614_0025438 | |||
| 1290 | Ga0495614_0047064 | |||
| 1291 | Ga0495614_0113696 | |||
| 1292 | Ga0495614_0117850 | |||
| 1293 | Ga0495614_0213925 | |||
| 1294 | Ga0495626_0065860 | |||
| 1295 | Ga0495626_0293008 | |||
| 1296 | Ga0496100_0002164 | |||
| 1297 | Ga0496100_0410728 | |||
| 1298 | Ga0496100_0909821 | |||
| 1299 | Ga0496101_0000213 | |||
| 1300 | Ga0496101_0022971 | |||
| 1301 | Ga0496102_0000483 | |||
| 1302 | Ga0496102_0189586 | |||
| 1303 | Ga0496103_0000323 | |||
| 1304 | Ga0496104_0029410 | |||
| 1305 | Ga0496104_1582669 | |||
| 1306 | Ga0496105_0026379 | |||
| 1307 | Ga0496106_0082045 | |||
| 1308 | Ga0496107_0038499 | |||
| 1309 | Ga0496107_0280979 | |||
| 1310 | Ga0496108_0031212 | |||
| 1311 | Ga0496108_0473470 | |||
| 1312 | Ga0496109_0021543 | |||
| 1313 | Ga0496110_0331039 | |||
| 1314 | Ga0496111_0288096 | |||
| 1315 | Ga0496112_0165527 | |||
| 1316 | Ga0496112_0662406 | |||
| 1317 | Ga0496113_0269281 | |||
| 1318 | Ga0496113_0283272 | |||
| 1319 | Ga0496114_0045716 | |||
| 1320 | Ga0496114_1599420 | |||
| 1321 | Ga0496115_0009849 | |||
| 1322 | Ga0496115_0166754 | |||
| 1323 | Ga0496116_0000691 | |||
| 1324 | Ga0496117_0000018 | |||
| 1325 | Ga0496118_0000013 | |||
| 1326 | Ga0496118_0001697 | |||
| 1327 | Ga0496119_0010794 | |||
| 1328 | Ga0496121_0002814 | |||
| 1329 | Ga0496126_0000902 | |||
| 1330 | Ga0496126_0431232 | |||
| 1331 | Ga0495678_045845 | |||
| 1332 | Ga0501031_0012733 | |||
| 1333 | Ga0501031_0033560 | |||
| 1334 | Ga0501032_0003359 | |||
| 1335 | Ga0501032_0013431 | |||
| 1336 | Ga0501032_0151761 | |||
| 1337 | Ga0501033_0003517 | |||
| 1338 | Ga0501033_0463225 | |||
| 1339 | Ga0501034_0010616 | |||
| 1340 | Ga0501034_0026168 | |||
| 1341 | Ga0501034_0451395 | |||
| 1342 | Ga0501036_0051553 | |||
| 1343 | Ga0501036_0172234 | |||
| 1344 | Ga0501036_0203509 | |||
| 1345 | Ga0501037_0012416 | |||
| 1346 | Ga0501037_0101866 | |||
| 1347 | Ga0501037_0519244 | |||
| 1348 | Ga0501038_0001079 | |||
| 1349 | Ga0501038_0002749 | |||
| 1350 | Ga0501038_0005850 | |||
| 1351 | Ga0501038_0139047 | |||
| 1352 | Ga0501038_0878270 | |||
| 1353 | Ga0501039_0002691 | |||
| 1354 | Ga0501039_0645790 | |||
| 1355 | Ga0501040_0009051 | |||
| 1356 | Ga0501041_0013295 | |||
| 1357 | Ga0501041_0263362 | |||
| 1358 | Ga0501042_0045254 | |||
| 1359 | Ga0501042_0048153 | |||
| 1360 | Ga0501043_0000422 | |||
| 1361 | Ga0501043_0000795 | |||
| 1362 | Ga0501046_0013409 | |||
| 1363 | Ga0501047_0000628 | |||
| 1364 | Ga0501047_0022072 | |||
| 1365 | Ga0501047_0138091 | |||
| 1366 | Ga0501047_0148092 | |||
| 1367 | Ga0501047_0230241 | |||
| 1368 | Ga0501047_0408213 | |||
| 1369 | Ga0501048_0004797 | |||
| 1370 | Ga0501048_0599668 | |||
| 1371 | Ga0501067_0000479 | |||
| 1372 | Ga0501067_0098981 | |||
| 1373 | Ga0501068_0003885 | |||
| 1374 | Ga0501068_0063045 | |||
| 1375 | Ga0501068_0349573 | |||
| 1376 | Ga0501069_0014642 | |||
| 1377 | Ga0501069_0113586 | |||
| 1378 | Ga0501070_0010556 | |||
| 1379 | Ga0501070_0026920 | |||
| 1380 | Ga0501070_1107634 | |||
| 1381 | Ga0501071_0000984 | |||
| 1382 | Ga0501072_0002372 | |||
| 1383 | Ga0501072_0015988 | |||
| 1384 | Ga0501073_0187485 | |||
| 1385 | Ga0501074_0004061 | |||
| 1386 | Ga0501077_0003437 | |||
| 1387 | Ga0501077_0277216 | |||
| 1388 | Ga0501079_0007311 | |||
| 1389 | Ga0501080_0020194 | |||
| 1390 | Ga0501081_1133296 | |||
| 1391 | Ga0501083_0026882 | |||
| 1392 | Ga0501035_0002191 | |||
| 1393 | Ga0501035_0101531 | |||
| 1394 | Ga0501035_0173541 | |||
| 1395 | Ga0501035_0246355 | |||
| 1396 | Ga0501035_0429228 | |||
| 1397 | Ga0501044_0000324 | |||
| 1398 | Ga0501044_0001246 | |||
| 1399 | Ga0501044_0012280 | |||
| 1400 | Ga0501044_0028014 | |||
| 1401 | Ga0501044_0064316 | |||
| 1402 | Ga0501044_0176972 | |||
| 1403 | Ga0501044_0182192 | |||
| 1404 | Ga0501044_0465590 | |||
| 1405 | Ga0501044_1078837 | |||
| 1406 | Ga0501045_0002202 | |||
| 1407 | nmdc:mga03683_94358_c1 | |||
| 1408 | nmdc:mga03n38_273804_c1 | |||
| 1409 | nmdc:mga03n38_40558_c1 | |||
| 1410 | nmdc:mga0yw44_119033_c1 | |||
| 1411 | nmdc:mga0yw44_4412_c1 | |||
| 1412 | nmdc:mga06z11_89883_c1 | |||
| 1413 | nmdc:mga07m45_50184_c1 | |||
| 1414 | nmdc:mga05p37_982535_c1 | |||
| 1415 | nmdc:mga08y16_1345697_c1 | |||
| 1416 | nmdc:mga08y16_1978425_c1 | |||
| 1417 | nmdc:mga08y16_32181_c1 | |||
| 1418 | nmdc:mga0rr50_125644_c1 | |||
| 1419 | nmdc:mga08x19_258675_c1 | |||
| 1420 | nmdc:mga08x19_83721_c1 | |||
| 1421 | Ga0495601_0026756 | |||
| 1422 | Ga0495601_0077705 | |||
| 1423 | Ga0495601_0390033 | |||
| 1424 | Ga0495601_0497974 | |||
| 1425 | Ga0495612_0004573 | |||
| 1426 | Ga0495612_0153547 | |||
| 1427 | Ga0495612_0159619 | |||
| 1428 | Ga0500610_0085860 | |||
| 1429 | Ga0495655_0038559 | |||
| 1430 | Ga0495595_0075152 | |||
| 1431 | Ga0495619_0065543 | |||
| 1432 | Ga0495619_0195716 | |||
| 1433 | Ga0495619_0281004 | |||
| 1434 | Ga0495619_0597485 | |||
| 1435 | Ga0500578_0047477 | |||
| 1436 | Ga0500643_017762 | |||
| 1437 | Ga0500583_0309936 | |||
| 1438 | Ga0500651_0296701 | |||
| 1439 | Ga0500566_0151278 | |||
| 1440 | Ga0500654_051662 | |||
| 1441 | Ga0500660_069428 | |||
| 1442 | Ga0500556_0224235 | |||
| 1443 | Ga0500562_000672 | |||
| 1444 | Ga0500569_002906 | |||
| 1445 | Ga0500621_146797 | |||
| 1446 | Ga0500628_002540 | |||
| 1447 | Ga0500652_021787 | |||
| 1448 | Ga0500658_0006846 | |||
| 1449 | Ga0500561_0002571 | |||
| 1450 | Ga0500579_051062 | |||
| 1451 | Ga0500600_0034098 | |||
| 1452 | Ga0500616_0080357 | |||
| 1453 | Ga0500616_0182666 | |||
| 1454 | Ga0500633_0000747 | |||
| 1455 | Ga0500634_0010789 | |||
| 1456 | Ga0500656_001114 | |||
| 1457 | Ga0501084_0069917 | |||
| 1458 | Ga0501082_0012873 | |||
| 1459 | Ga0466962_0010842 | |||
| 1460 | Ga0466962_0014347 | |||
| 1461 | Ga0466962_0019302 | |||
| 1462 | Ga0466962_0238048 | |||
| 1463 | Ga0530510_0145049 | |||
| 1464 | Ga0530510_0158491 | |||
| 1465 | 2515857636 | |||
| 1466 | 2552107031 | |||
| 1467 | 2554257814 | |||
| 1468 | 2616698486 | |||
| 1469 | 2616698859 | |||
| 1470 | 2616701271 | |||
| 1471 | 2616901814 | |||
| 1472 | 2643902735 | |||
| 1473 | 2643942161 | |||
| 1474 | 2644404756 | |||
| 1475 | 2644429244 | |||
| 1476 | 2676484646 | |||
| 1477 | 2739604554 | |||
| 1478 | 2784588153 | |||
| 1479 | 2785342573 | |||
| 1480 | 2785366516 | |||
| 1481 | 2795793738 | |||
| 1482 | 2808916410 | |||
| 1483 | 2809027725 | |||
| 1484 | 2809229683 | |||
| 1485 | 2809231765 | |||
| 1486 | 2812483176 | |||
| 1487 | 2816509160 | |||
| 1488 | 2819694553 | |||
| 1489 | 2819741060 | |||
| 1490 | 2862383061 | |||
| 1491 | 2862515790 | |||
| 1492 | 2862574561 | |||
| 1493 | 2867371208 | |||
| 1494 | 2867429013 | |||
| 1495 | 2867429548 | |||
| 1496 | 2867477120 | |||
| 1497 | 2870790824 | |||
| 1498 | 2873151952 | |||
| 1499 | 2873152722 | |||
| 1500 | 2877684022 | |||
| 1501 | 2895434089 | |||
| 1502 | 2899371635 | |||
| 1503 | 2902794973 | |||
| 1504 | 2912715437 | |||
| 1505 | 2917742498 | |||
| 1506 | 2928146980 | |||
| 1507 | 2954387575 | |||
| 1508 | 2954389332 | |||
| 1509 | 2954700116 | |||
| 1510 | 2954701288 | |||
| 1511 | 2954702111 | |||
| 1512 | 2954718915 | |||
| 1513 | 2954728885 | |||
| 1514 | 2954729487 | |||
| 1515 | 2954732321 | |||
| 1516 | 2954732927 | |||
| 1517 | 2954747784 | |||
| 1518 | 2954748390 | |||
| 1519 | 2954751804 | |||
| 1520 | 2954766908 | |||
| 1521 | 2954767520 | |||
| 1522 | 2966602645 | |||
| 1523 | 2990044968 | |||
| 1524 | 2995465839 | |||
| 1525 | 2995466693 | |||
| 1526 | 8008491434 | |||
| 1527 | 8008565773 | |||
| 1528 | 8023629867 | |||
| 1529 | 8023631403 | |||
| 1530 | 8025530764 | |||
| 1531 | 8025537235 | |||
| 1532 | 8047899020 | |||
| 1533 | 8048359900 | |||
| 1534 | 8048375984 | |||
| 1535 | 8048382136 | |||
| 1536 | 8048410436 | |||
| 1537 | 8057575190 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9596 | 15 | 143 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9247 | 15 | 143 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9233 | 2 | 149 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9193 | 1 | 151 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9173 | 2 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9259 | 2 | 140 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9204 | 2 | 140 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9187 | 6 | 144 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.918 | 2 | 150 | 1.20.1290.10 |
| af_P76222_42_172_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9135 | 17 | 147 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A117ILX8-F1-model_v4 | Alkylhydroperoxidase AhpD core domain-containing protein | 0.9965 | 1 | 155 |
GO:0051920
|
| AF-A0A2P8DY12-F1-model_v4 | AhpD family alkylhydroperoxidase | 0.9954 | 37 | 155 |
GO:0051920
|
| AF-A0A286DSL4-F1-model_v4 | Alkylhydroperoxidase AhpD family core domain-containing protein | 0.9927 | 40 | 155 |
GO:0051920
|
| AF-A0A7X1MB92-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9923 | 1 | 155 |
GO:0051920
|
| AF-A0A089X0T3-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9921 | 1 | 155 |
GO:0051920
|