F479955

General Info

Members Datasets Scaffolds Average Seq Length
768 526 1536 293

Family's Representative Sequence

Representative Sequence 3300027296|Ga0209389_1000004|Ga0209389_100000417
Length 325
Sequence MQSSPTHRASFSIGSEAAARRVVDVLTEVFFEGDAAVAAFERPDGQWDVTLHFAAAPDQAWLRELVVTSAGNEIAETLAFDIVEAKDWVKASLEDLVPVPAGRFVVHGSHDRDRVAANKLKIEIEAALAFGTGHHGTTRGCLLLLDHVLKSARPRRLLDLGTGTGVLAIAAAKALHRAVLASDIDPPSVQVAAENAALNEVGNHVRVIRATGFAAPDFGKCGPFDLVLANILANPLRQLASPMARHLAPGGRLILSGLLTHQAPAVIAAYRARGLVPLRHLRIEGWSSLLLRKMGRVHPRWRCAPSPRLRGEGWGEGESPRGSHL

Samples

Sample ID Description Type Environment
1 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
149 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
296 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
309 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
316 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
321 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
322 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
323 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
324 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
325 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
326 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
327 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
328 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
329 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
330 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
331 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
332 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
333 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
334 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
335 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
336 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
337 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
338 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
339 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
340 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
341 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
342 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
343 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
344 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
345 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
346 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
347 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
348 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
349 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
350 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
351 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
352 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
353 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
354 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
355 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
356 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
357 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
358 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
359 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
360 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
361 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
362 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
363 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
364 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
365 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
366 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
367 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
368 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
369 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
370 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
371 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
372 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
373 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
374 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
375 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
376 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
377 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
378 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
379 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
380 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
381 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
382 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
383 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
384 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
385 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
386 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
387 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
388 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
389 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
390 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
391 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
392 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
393 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
394 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
395 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
396 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
397 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
398 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
399 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
400 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
401 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
402 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
403 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
404 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
405 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
406 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
407 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
408 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
409 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
410 2904699407
411 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
412 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
413 2906610324
414 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
415 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
416 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
417 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
418 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
419 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
420 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
421 2922368715
422 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
423 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
424 2922425934
425 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
426 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
427 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
428 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
429 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
430 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
431 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
432 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
433 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
434 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
435 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
436 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
437 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
438 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
439 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
440 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
441 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
442 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
443 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
444 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
445 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
446 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
447 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
448 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
449 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
450 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
451 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
452 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
453 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
454 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
455 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
456 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
457 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
458 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
459 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
460 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
461 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
462 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
463 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
464 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
465 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
466 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
467 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
468 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
469 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
470 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
471 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
472 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
473 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
474 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
475 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
476 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
477 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
478 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
479 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
480 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
481 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
482 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
483 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
484 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
485 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
486 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
487 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
488 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
489 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
490 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
491 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
492 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
493 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
494 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
495 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
496 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
497 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
498 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
499 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
500 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
501 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
502 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
503 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
504 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
505 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
506 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
507 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
508 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
509 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
510 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
511 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
512 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
513 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
514 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
515 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
516 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
517 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
518 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
519 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
520 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
521 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
522 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
523 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
524 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
525 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
526 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.43
Metatranscriptomes 0
Isolates 26.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 20.31
Rhizoplane 7.94
Rhizosphere 47.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209389_1000004 3300027296 Bacteria 263759
2 JGI24737J22298_10009803 3300001990 Bacteria 3173
3 JGI25406J46586_10000789 3300003203 Bacteria 14957
4 JGI25165J46597_1004357 3300003214 Bacteria 3066
5 JGI25153J46596_10001899 3300003215 Bacteria 12392
6 JGI25153J46596_10001991 3300003215 Bacteria 12070
7 JGI25153J46596_10003569 3300003215 Bacteria 8658
8 JGI25153J46596_10018363 3300003215 Bacteria 2720
9 JGI25153J46596_10024393 3300003215 Bacteria 2181
10 JGI25160J50197_1000916 3300003354 Bacteria 15497
11 JGI25160J50197_1001939 3300003354 Bacteria 9884
12 JGI25404J52841_10037078 3300003659 Bacteria 1037
13 Ga0055539_1005368 3300003752 Bacteria 1669
14 Ga0055531_10005121 3300003794 Bacteria 7739
15 Ga0055543_1002598 3300004625 Bacteria 5841
16 Ga0065165_1001630 3300005262 Bacteria 22843
17 Ga0065165_1001784 3300005262 Bacteria 21259
18 Ga0065165_1024054 3300005262 Bacteria 2054
19 Ga0070658_10071339 3300005327 Bacteria 2845
20 Ga0070676_10057578 3300005328 Bacteria 2300
21 Ga0070683_100060604 3300005329 Bacteria 3517
22 Ga0070670_100103237 3300005331 Bacteria 2456
23 Ga0070680_100059827 3300005336 Bacteria 3118
24 Ga0068868_100019643 3300005338 Bacteria 5065
25 Ga0068868_100044721 3300005338 Bacteria 3463
26 Ga0068868_100589364 3300005338 Bacteria 984
27 Ga0070661_100014272 3300005344 Bacteria 5596
28 Ga0070661_100075405 3300005344 Bacteria 2485
29 Ga0070668_100054638 3300005347 Bacteria 3080
30 Ga0070668_100062303 3300005347 Bacteria 2889
31 Ga0070671_100011785 3300005355 Bacteria 7033
32 Ga0070671_100132386 3300005355 Bacteria 2100
33 Ga0070674_100060517 3300005356 Bacteria 2640
34 Ga0070659_100355787 3300005366 Bacteria 1229
35 Ga0070714_100041846 3300005435 Bacteria 3868
36 Ga0070663_100030983 3300005455 Bacteria 3671
37 Ga0070663_100057313 3300005455 Bacteria 2794
38 Ga0070663_100067313 3300005455 Bacteria 2597
39 Ga0070663_100074653 3300005455 Bacteria 2476
40 Ga0070663_100194164 3300005455 Bacteria 1581
41 Ga0070678_100596663 3300005456 Bacteria 985
42 Ga0070662_100136128 3300005457 Bacteria 1899
43 Ga0070681_10008669 3300005458 Bacteria 9972
44 Ga0070681_10032246 3300005458 Bacteria 5258
45 Ga0070681_10184737 3300005458 Bacteria 2005
46 Ga0068867_100195679 3300005459 Bacteria 1616
47 Ga0070685_10135025 3300005466 Bacteria 1547
48 Ga0070699_100113835 3300005518 Bacteria 2376
49 Ga0070679_100124252 3300005530 Bacteria 2563
50 Ga0070679_100132784 3300005530 Bacteria 2470
51 Ga0070684_100004058 3300005535 Bacteria 11084
52 Ga0070684_100201256 3300005535 Bacteria 1814
53 Ga0068853_100053427 3300005539 Bacteria 3479
54 Ga0068853_100175380 3300005539 Bacteria 1941
55 Ga0068853_100287618 3300005539 Bacteria 1517
56 Ga0068853_100295122 3300005539 Bacteria 1497
57 Ga0070686_100112778 3300005544 Bacteria 1855
58 Ga0070665_100042560 3300005548 Bacteria 4565
59 Ga0070665_100063876 3300005548 Bacteria 3691
60 Ga0070665_100076670 3300005548 Bacteria 3350
61 Ga0070665_100109514 3300005548 Bacteria 2764
62 Ga0070665_100131256 3300005548 Bacteria 2507
63 Ga0070665_100187099 3300005548 Bacteria 2072
64 Ga0068855_100074350 3300005563 Bacteria 3947
65 Ga0068855_100090633 3300005563 Bacteria 3528
66 Ga0068855_100186078 3300005563 Bacteria 2345
67 Ga0068855_100189915 3300005563 Bacteria 2318
68 Ga0068855_100215132 3300005563 Bacteria 2158
69 Ga0070664_100107626 3300005564 Bacteria 2430
70 Ga0068857_100015211 3300005577 Bacteria 6715
71 Ga0068854_100051650 3300005578 Bacteria 2946
72 Ga0068854_100118298 3300005578 Bacteria 2007
73 Ga0068856_100039332 3300005614 Bacteria 4643
74 Ga0068856_100082555 3300005614 Bacteria 3189
75 Ga0068852_100011393 3300005616 Bacteria 6692
76 Ga0068852_100084678 3300005616 Bacteria 2822
77 Ga0068852_100480214 3300005616 Bacteria 1235
78 Ga0068852_100534920 3300005616 Bacteria 1171
79 Ga0068859_100147073 3300005617 Bacteria 2431
80 Ga0068859_100272128 3300005617 Bacteria 1786
81 Ga0068859_100447760 3300005617 Bacteria 1387
82 Ga0068864_100008536 3300005618 Bacteria 8454
83 Ga0068861_100008090 3300005719 Bacteria 7233
84 Ga0068861_100131165 3300005719 Bacteria 2034
85 Ga0068851_10009624 3300005834 Bacteria 4499
86 Ga0068870_10135865 3300005840 Bacteria 1433
87 Ga0068858_100017551 3300005842 Bacteria 6712
88 Ga0068858_100173599 3300005842 Bacteria 2034
89 Ga0068862_100072594 3300005844 Bacteria 2973
90 Ga0068862_100203175 3300005844 Bacteria 1787
91 Ga0081455_10008108 3300005937 Bacteria 10963
92 Ga0081455_10042864 3300005937 Bacteria 3965
93 Ga0081455_10046021 3300005937 Bacteria 3791
94 Ga0081540_1001402 3300005983 Bacteria 20842
95 Ga0081540_1001927 3300005983 Bacteria 17390
96 Ga0081540_1002927 3300005983 Bacteria 13745
97 Ga0081540_1006969 3300005983 Bacteria 8140
98 Ga0081540_1009737 3300005983 Bacteria 6588
99 Ga0081540_1021051 3300005983 Bacteria 3901
100 Ga0081540_1024046 3300005983 Bacteria 3545
101 Ga0081540_1030582 3300005983 Bacteria 2979
102 Ga0081540_1040874 3300005983 Bacteria 2411
103 Ga0081539_10002973 3300005985 Bacteria 22242
104 Ga0081539_10010397 3300005985 Bacteria 7567
105 Ga0075365_10009233 3300006038 Bacteria 5656
106 Ga0075365_10052610 3300006038 Bacteria 2694
107 Ga0075365_10139503 3300006038 Bacteria 1682
108 Ga0075368_10016335 3300006042 Bacteria 2766
109 Ga0075363_100039245 3300006048 Bacteria 2491
110 Ga0075363_100088566 3300006048 Bacteria 1701
111 Ga0075364_10109353 3300006051 Bacteria 1844
112 Ga0070716_100339500 3300006173 Bacteria 1059
113 Ga0075362_10028019 3300006177 Bacteria 2416
114 Ga0075367_10078633 3300006178 Bacteria 1992
115 Ga0075369_10036984 3300006186 Bacteria 2078
116 Ga0075369_10091018 3300006186 Bacteria 1361
117 Ga0075370_10015574 3300006353 Bacteria 4073
118 Ga0075370_10038284 3300006353 Bacteria 2698
119 Ga0075428_100189480 3300006844 Bacteria 2225
120 Ga0075428_100233901 3300006844 Bacteria 1983
121 Ga0075434_100029717 3300006871 Bacteria 5379
122 Ga0097620_100147070 3300006931 Bacteria 2431
123 Ga0097620_100272137 3300006931 Bacteria 1786
124 Ga0097620_100447757 3300006931 Bacteria 1387
125 Ga0075435_100033251 3300007076 Bacteria 4076
126 Ga0105240_10014081 3300009093 Bacteria 10929
127 Ga0105240_10017926 3300009093 Bacteria 9521
128 Ga0105240_10066543 3300009093 Bacteria 4469
129 Ga0105245_10060890 3300009098 Bacteria 3401
130 Ga0105245_10079445 3300009098 Bacteria 2995
131 Ga0105245_10326086 3300009098 Bacteria 1514
132 Ga0105247_10026556 3300009101 Bacteria 3498
133 Ga0105247_10040296 3300009101 Bacteria 2855
134 Ga0114129_10215714 3300009147 Bacteria 2592
135 Ga0105241_10000538 3300009174 Bacteria 28546
136 Ga0105241_10013912 3300009174 Bacteria 5896
137 Ga0105241_10027359 3300009174 Bacteria 4247
138 Ga0105242_10102824 3300009176 Bacteria 2423
139 Ga0105237_10003299 3300009545 Bacteria 19261
140 Ga0105237_10057131 3300009545 Bacteria 3905
141 Ga0105237_10085768 3300009545 Bacteria 3139
142 Ga0105237_10355032 3300009545 Bacteria 1470
143 Ga0105238_10192764 3300009551 Bacteria 2014
144 Ga0105238_10356667 3300009551 Bacteria 1451
145 Ga0105249_10141132 3300009553 Bacteria 2310
146 Ga0105249_10141379 3300009553 Bacteria 2308
147 Ga0105239_10025796 3300010375 Bacteria 6472
148 Ga0105239_10029629 3300010375 Bacteria 6017
149 Ga0105239_10055849 3300010375 Bacteria 4331
150 Ga0105239_10132077 3300010375 Bacteria 2778
151 Ga0105239_10198624 3300010375 Bacteria 2246
152 Ga0105239_10321208 3300010375 Bacteria 1746
153 Ga0105239_10368337 3300010375 Bacteria 1623
154 Ga0105246_10023303 3300011119 Bacteria 4005
155 Ga0105246_10030133 3300011119 Bacteria 3580
156 Ga0105246_10142139 3300011119 Bacteria 1806
157 Ga0157369_10247291 3300013105 Bacteria 1862
158 Ga0157374_10016924 3300013296 Bacteria 6417
159 Ga0157374_10143749 3300013296 Bacteria 2316
160 Ga0157378_10214028 3300013297 Bacteria 1829
161 Ga0157375_10024625 3300013308 Bacteria 5574
162 Ga0157375_10075210 3300013308 Bacteria 3401
163 Ga0157375_10220850 3300013308 Bacteria 2053
164 Ga0163163_10052887 3300014325 Bacteria 4008
165 Ga0163163_10111642 3300014325 Bacteria 2763
166 Ga0157380_10695195 3300014326 Bacteria 1021
167 Ga0157379_10220995 3300014968 Bacteria 1716
168 Ga0157376_10025066 3300014969 Bacteria 4693
169 Ga0157376_10050771 3300014969 Bacteria 3443
170 Ga0157376_10126673 3300014969 Bacteria 2273
171 Ga0163161_10012946 3300017792 Bacteria 5795
172 Ga0214544_1000026 3300021320 Bacteria 161530
173 Ga0214542_1000025 3300021321 Bacteria 183588
174 Ga0214545_1000014 3300021324 Bacteria 183588
175 Ga0214543_1000034 3300021327 Bacteria 183712
176 Ga0213873_10041192 3300021358 Bacteria 1190
177 Ga0213871_10000403 3300021441 Bacteria 5753
178 Ga0207425_1010937 3300025245 Bacteria 2189
179 Ga0209677_100778 3300025253 Bacteria 16092
180 Ga0209148_1000516 3300025254 Bacteria 38539
181 Ga0209233_1001322 3300025261 Bacteria 9892
182 Ga0209233_1001630 3300025261 Bacteria 8734
183 Ga0209233_1007518 3300025261 Bacteria 3447
184 Ga0209233_1018286 3300025261 Bacteria 1889
185 Ga0209455_1004171 3300025272 Bacteria 4834
186 Ga0209564_1002228 3300025295 Bacteria 16027
187 Ga0209758_1000141 3300025297 Bacteria 172481
188 Ga0209758_1002551 3300025297 Bacteria 18365
189 Ga0209758_1002574 3300025297 Bacteria 18214
190 Ga0209758_1004224 3300025297 Bacteria 12159
191 Ga0209758_1005011 3300025297 Bacteria 10567
192 Ga0209758_1007584 3300025297 Bacteria 7331
193 Ga0209758_1018699 3300025297 Bacteria 3382
194 Ga0209256_1004845 3300025299 Bacteria 8140
195 Ga0207426_1001022 3300025302 Bacteria 26892
196 Ga0207426_1001111 3300025302 Bacteria 24708
197 Ga0207426_1018923 3300025302 Bacteria 2417
198 Ga0207426_1055556 3300025302 Bacteria 1159
199 Ga0209257_1000426 3300025304 Bacteria 81095
200 Ga0209257_1022503 3300025304 Bacteria 2246
201 Ga0207697_10011495 3300025315 Bacteria 3742
202 Ga0207642_10080033 3300025899 Bacteria 1583
203 Ga0207680_10120805 3300025903 Bacteria 1713
204 Ga0207647_10006134 3300025904 Bacteria 8759
205 Ga0207647_10016511 3300025904 Bacteria 5037
206 Ga0207647_10093436 3300025904 Bacteria 1792
207 Ga0207645_10028276 3300025907 Bacteria 3620
208 Ga0207645_10034762 3300025907 Bacteria 3238
209 Ga0207705_10292584 3300025909 Bacteria 1248
210 Ga0207684_10169130 3300025910 Bacteria 1884
211 Ga0207654_10000673 3300025911 Bacteria 19202
212 Ga0207654_10019170 3300025911 Bacteria 3605
213 Ga0207654_10131110 3300025911 Bacteria 1587
214 Ga0207707_10007094 3300025912 Bacteria 9764
215 Ga0207707_10072110 3300025912 Bacteria 3011
216 Ga0207695_10000062 3300025913 Bacteria 351979
217 Ga0207695_10000497 3300025913 Bacteria 83894
218 Ga0207671_10003655 3300025914 Bacteria 15185
219 Ga0207671_10029616 3300025914 Bacteria 4087
220 Ga0207671_10092301 3300025914 Bacteria 2283
221 Ga0207660_10030654 3300025917 Bacteria 3698
222 Ga0207660_10070575 3300025917 Bacteria 2540
223 Ga0207657_10065189 3300025919 Bacteria 3106
224 Ga0207649_10180952 3300025920 Bacteria 1476
225 Ga0207681_10097095 3300025923 Bacteria 2117
226 Ga0207694_10000571 3300025924 Bacteria 33435
227 Ga0207650_10244968 3300025925 Bacteria 1449
228 Ga0207687_10064332 3300025927 Bacteria 2600
229 Ga0207664_10264301 3300025929 Bacteria 1506
230 Ga0207644_10141506 3300025931 Bacteria 1853
231 Ga0207690_10167870 3300025932 Bacteria 1642
232 Ga0207690_10212573 3300025932 Bacteria 1475
233 Ga0207706_10035078 3300025933 Bacteria 4462
234 Ga0207706_10140591 3300025933 Bacteria 2124
235 Ga0207709_10025270 3300025935 Bacteria 3400
236 Ga0207670_10161508 3300025936 Bacteria 1673
237 Ga0207665_10380714 3300025939 Bacteria 1071
238 Ga0207691_10181665 3300025940 Bacteria 1838
239 Ga0207711_10097010 3300025941 Bacteria 2602
240 Ga0207711_10270668 3300025941 Bacteria 1563
241 Ga0207689_10014554 3300025942 Bacteria 6690
242 Ga0207689_10156934 3300025942 Bacteria 1876
243 Ga0207661_10000591 3300025944 Bacteria 23205
244 Ga0207661_10077762 3300025944 Bacteria 2730
245 Ga0207679_10170886 3300025945 Bacteria 1789
246 Ga0207667_10270762 3300025949 Bacteria 1736
247 Ga0207651_10111212 3300025960 Bacteria 2057
248 Ga0207651_10256836 3300025960 Bacteria 1433
249 Ga0207651_10432609 3300025960 Bacteria 1126
250 Ga0207668_10041779 3300025972 Bacteria 3101
251 Ga0207668_10047403 3300025972 Bacteria 2942
252 Ga0207668_10089524 3300025972 Bacteria 2256
253 Ga0207640_10176483 3300025981 Bacteria 1597
254 Ga0207640_10235602 3300025981 Bacteria 1411
255 Ga0207658_10034683 3300025986 Bacteria 3608
256 Ga0207658_10291199 3300025986 Bacteria 1403
257 Ga0207677_10053779 3300026023 Bacteria 2743
258 Ga0207703_10044332 3300026035 Bacteria 3574
259 Ga0207703_10099761 3300026035 Bacteria 2459
260 Ga0207703_10205718 3300026035 Bacteria 1752
261 Ga0207639_10134793 3300026041 Bacteria 2049
262 Ga0207639_10575763 3300026041 Bacteria 1036
263 Ga0207678_10018655 3300026067 Bacteria 6090
264 Ga0207678_10053461 3300026067 Bacteria 3480
265 Ga0207678_10057216 3300026067 Bacteria 3355
266 Ga0207678_10092409 3300026067 Bacteria 2586
267 Ga0207678_10110584 3300026067 Bacteria 2344
268 Ga0207678_10170279 3300026067 Bacteria 1859
269 Ga0207702_10000003 3300026078 Bacteria 434196
270 Ga0207641_10266441 3300026088 Bacteria 1606
271 Ga0207648_10078408 3300026089 Bacteria 2881
272 Ga0207648_10239013 3300026089 Bacteria 1617
273 Ga0207676_10019965 3300026095 Bacteria 4895
274 Ga0207676_10232739 3300026095 Bacteria 1648
275 Ga0207674_10074144 3300026116 Bacteria 3416
276 Ga0207675_100043075 3300026118 Bacteria 4215
277 Ga0207675_100109787 3300026118 Bacteria 2603
278 Ga0207683_10013758 3300026121 Bacteria 6899
279 Ga0207683_10084186 3300026121 Bacteria 2827
280 Ga0207698_10047031 3300026142 Bacteria 3264
281 Ga0207698_10387328 3300026142 Bacteria 1332
282 Ga0207698_10453744 3300026142 Bacteria 1238
283 Ga0209489_100295 3300027361 Bacteria 87273
284 Ga0209700_100013 3300027363 Bacteria 341906
285 Ga0268266_10011469 3300028379 Bacteria 7699
286 Ga0268266_10045982 3300028379 Bacteria 3736
287 Ga0268266_10077392 3300028379 Bacteria 2892
288 Ga0268266_10119247 3300028379 Bacteria 2346
289 Ga0268266_10331891 3300028379 Bacteria 1425
290 Ga0307515_10020920 3300028794 Bacteria 11631
291 Ga0265339_10018346 3300031249 Bacteria 4125
292 Ga0307415_100044162 3300032126 Bacteria 2978
293 Ga0307510_10028510 3300033180 Bacteria 6375
294 Ga0307510_10316444 3300033180 Bacteria 1019
295 Ga0315911_1000010 3300033442 Bacteria 322197
296 Ga0373936_0020822 3300035113 Bacteria 2550
297 Ga0373939_0069487 3300035114 Bacteria 1143
298 Ga0373954_0021520 3300035118 Bacteria 2921
299 Ga0373956_0045870 3300035119 Bacteria 1951
300 Ga0373957_0177613 3300035120 Bacteria 882
301 Ga0373960_0042418 3300035121 Bacteria 1321
302 Ga0373943_0035056 3300035170 Bacteria 2396
303 Ga0373931_0249007 3300035691 Bacteria 1080
304 Ga0373927_0248810 3300035695 Bacteria 1168
305 Ga0373933_0023599 3300035724 Bacteria 3516
306 Ga0373947_0304900 3300035725 Bacteria 1062
307 Ga0373937_0061401 3300036401 Bacteria 3455
308 Ga0395899_0150974 3300037312 Bacteria 1647
309 Ga0395900_0026074 3300037418 Bacteria 5984
310 Ga0395898_0017784 3300037466 Bacteria 7254
311 Ga0395905_0027045 3300037471 Bacteria 5410
312 Ga0395905_0138285 3300037471 Bacteria 2292
313 Ga0395905_0247773 3300037471 Bacteria 1664
314 Ga0436364_1440034 3300037853 Bacteria 1533
315 Ga0395901_0010481 3300038443 Bacteria 9390
316 Ga0436360_1267380 3300039438 Bacteria 5977
317 Ga0436362_1130210 3300039453 Bacteria 3553
318 Ga0451793_0392809 3300041452 Bacteria 2326
319 Ga0451795_1676707 3300041456 Bacteria 1237
320 Ga0451800_1360595 3300041459 Bacteria 1489
321 Ga0451853_0151450 3300041512 Bacteria 1361
322 Ga0439459_0006929 3300042438 Bacteria 1903
323 Ga0466969_0153796 3300044656 Bacteria 1059
324 Ga0466972_0021527 3300044658 Bacteria 3213
325 Ga0466966_0002704 3300044684 Bacteria 11629
326 Ga0466961_0000149 3300044693 Bacteria 47561
327 Ga0466964_0140251 3300044706 Bacteria 1110
328 Ga0466968_0005932 3300044735 Bacteria 4583
329 Ga0466959_0001944 3300045049 Bacteria 13011
330 Ga0466967_0165255 3300045976 Bacteria 2079
331 Ga0495592_0158257 3300046454 Bacteria 1561
332 Ga0495592_0259725 3300046454 Bacteria 1145
333 Ga0495603_0129498 3300046455 Bacteria 1470
334 Ga0495629_0374975 3300046459 Bacteria 969
335 Ga0495651_0005291 3300046462 Bacteria 9838
336 Ga0495651_0259461 3300046462 Bacteria 1183
337 Ga0495580_0120043 3300046472 Bacteria 1825
338 Ga0495580_0254473 3300046472 Bacteria 1202
339 Ga0495582_0032490 3300046473 Bacteria 2869
340 Ga0495582_0061803 3300046473 Bacteria 2069
341 Ga0495605_0025935 3300046474 Bacteria 3049
342 Ga0495605_0057622 3300046474 Bacteria 1869
343 Ga0495605_0071321 3300046474 Bacteria 1641
344 Ga0495639_0100750 3300046475 Bacteria 1363
345 Ga0495664_0009276 3300046477 Bacteria 5503
346 Ga0495664_0055550 3300046477 Bacteria 2356
347 Ga0495664_0085256 3300046477 Bacteria 1896
348 Ga0495664_0122357 3300046477 Bacteria 1573
349 Ga0495585_0141877 3300046492 Bacteria 1258
350 Ga0495606_0063885 3300046507 Bacteria 2345
351 Ga0495610_0038756 3300046512 Bacteria 2417
352 Ga0495618_0082557 3300046514 Bacteria 2052
353 Ga0495618_0103063 3300046514 Bacteria 1827
354 Ga0495630_0068762 3300046517 Bacteria 2664
355 Ga0495630_0096898 3300046517 Bacteria 2230
356 Ga0495632_0042001 3300046519 Bacteria 2294
357 Ga0495643_0068410 3300046522 Bacteria 1868
358 Ga0495643_0105636 3300046522 Bacteria 1438
359 Ga0495643_0166422 3300046522 Bacteria 1081
360 Ga0495648_0020924 3300046524 Bacteria 4549
361 Ga0495648_0184270 3300046524 Bacteria 1058
362 Ga0495652_0061731 3300046529 Bacteria 3162
363 Ga0495665_0146832 3300046531 Bacteria 1232
364 Ga0495640_0015659 3300046533 Bacteria 5696
365 Ga0495640_0041370 3300046533 Bacteria 3221
366 Ga0495640_0062301 3300046533 Bacteria 2530
367 Ga0495586_0048243 3300046535 Bacteria 2301
368 Ga0495587_0061449 3300046536 Bacteria 2201
369 Ga0495645_0066458 3300046543 Bacteria 2606
370 Ga0495622_0009702 3300046557 Bacteria 4451
371 Ga0495667_0005990 3300046559 Bacteria 8220
372 Ga0495668_0082531 3300046616 Bacteria 1763
373 Ga0495668_0102942 3300046616 Bacteria 1562
374 Ga0495668_0143638 3300046616 Bacteria 1306
375 Ga0495668_0149908 3300046616 Bacteria 1277
376 Ga0495634_0067476 3300046642 Bacteria 2366
377 Ga0495625_0055046 3300046660 Bacteria 2839
378 Ga0495625_0094677 3300046660 Bacteria 2060
379 Ga0495625_0149975 3300046660 Bacteria 1568
380 Ga0495635_0017204 3300046663 Bacteria 5048
381 Ga0495588_0008023 3300046674 Bacteria 4827
382 Ga0495599_0024720 3300046678 Bacteria 3756
383 Ga0495623_0009425 3300046679 Bacteria 6337
384 Ga0495646_0021211 3300046680 Bacteria 4107
385 Ga0495624_0039999 3300046690 Bacteria 3004
386 Ga0495670_0042931 3300046691 Bacteria 2256
387 Ga0495671_0053998 3300046692 Bacteria 1993
388 Ga0495649_0004374 3300046694 Bacteria 9243
389 Ga0495649_0186976 3300046694 Bacteria 1079
390 Ga0495589_0064033 3300046794 Bacteria 1803
391 Ga0495581_0110724 3300047315 Bacteria 1597
392 Ga0495604_0000905 3300047317 Bacteria 24653
393 Ga0495604_0006433 3300047317 Bacteria 9321
394 Ga0495674_0009424 3300047319 Bacteria 9280
395 Ga0495674_0085183 3300047319 Bacteria 2707
396 Ga0495680_0002632 3300047322 Bacteria 18223
397 Ga0495683_0086306 3300047323 Bacteria 1525
398 Ga0495687_033544 3300047443 Bacteria 2327
399 Ga0495675_0007188 3300047444 Bacteria 6856
400 Ga0495685_063779 3300047447 Bacteria 1240
401 Ga0495673_0056271 3300047469 Bacteria 1703
402 Ga0495684_0004812 3300047471 Bacteria 10541
403 Ga0495686_0058551 3300047472 Bacteria 2401
404 Ga0495686_0083520 3300047472 Bacteria 1948
405 Ga0495593_0055710 3300047673 Bacteria 2080
406 Ga0495602_0016516 3300048088 Bacteria 7422
407 Ga0495614_0031984 3300048089 Bacteria 2265
408 Ga0496100_0013300 3300048903 Bacteria 4742
409 Ga0496100_0147327 3300048903 Bacteria 1675
410 Ga0496101_0022109 3300048904 Bacteria 4375
411 Ga0496101_0103077 3300048904 Bacteria 2138
412 Ga0496101_0129178 3300048904 Bacteria 1917
413 Ga0496101_0390479 3300048904 Bacteria 1095
414 Ga0496102_0002007 3300048905 Bacteria 17583
415 Ga0496102_0022027 3300048905 Bacteria 5644
416 Ga0496102_0139837 3300048905 Bacteria 2270
417 Ga0496102_0190924 3300048905 Bacteria 1930
418 Ga0496102_0556208 3300048905 Bacteria 1070
419 Ga0496102_0671250 3300048905 Bacteria 959
420 Ga0496103_0012305 3300048906 Bacteria 5078
421 Ga0496103_0098892 3300048906 Bacteria 1845
422 Ga0496104_0006350 3300048907 Bacteria 10395
423 Ga0496104_0047462 3300048907 Bacteria 4047
424 Ga0496104_0094854 3300048907 Bacteria 2854
425 Ga0496104_0097134 3300048907 Bacteria 2819
426 Ga0496104_0214519 3300048907 Bacteria 1836
427 Ga0496105_0001222 3300048908 Bacteria 17908
428 Ga0496105_0013030 3300048908 Bacteria 6589
429 Ga0496105_0036723 3300048908 Bacteria 4037
430 Ga0496105_0076210 3300048908 Bacteria 2769
431 Ga0496105_0123918 3300048908 Bacteria 2130
432 Ga0496105_0433551 3300048908 Bacteria 1039
433 Ga0496106_0020464 3300048909 Bacteria 4910
434 Ga0496106_0021340 3300048909 Bacteria 4808
435 Ga0496106_0024892 3300048909 Bacteria 4451
436 Ga0496106_0051714 3300048909 Bacteria 3098
437 Ga0496107_0006630 3300048910 Bacteria 7970
438 Ga0496107_0007234 3300048910 Bacteria 7647
439 Ga0496107_0079823 3300048910 Bacteria 2385
440 Ga0496107_0290531 3300048910 Bacteria 1217
441 Ga0496108_0008204 3300048911 Bacteria 8476
442 Ga0496108_0009009 3300048911 Bacteria 8084
443 Ga0496108_0013475 3300048911 Bacteria 6671
444 Ga0496108_0142228 3300048911 Bacteria 2067
445 Ga0496108_0558039 3300048911 Bacteria 999
446 Ga0496109_0000361 3300048912 Bacteria 42221
447 Ga0496109_0005319 3300048912 Bacteria 10761
448 Ga0496110_0017010 3300048913 Bacteria 6079
449 Ga0496110_0066446 3300048913 Bacteria 3189
450 Ga0496110_0093109 3300048913 Bacteria 2697
451 Ga0496110_0108871 3300048913 Bacteria 2488
452 Ga0496110_0139615 3300048913 Bacteria 2190
453 Ga0496110_0366875 3300048913 Bacteria 1312
454 Ga0496111_0197333 3300048914 Bacteria 1496
455 Ga0496111_0222218 3300048914 Bacteria 1403
456 Ga0496111_0382878 3300048914 Bacteria 1040
457 Ga0496112_0003390 3300048915 Bacteria 13162
458 Ga0496112_0008969 3300048915 Bacteria 8978
459 Ga0496112_0022055 3300048915 Bacteria 6064
460 Ga0496113_0463272 3300048916 Bacteria 1018
461 Ga0496114_0021956 3300048917 Bacteria 5196
462 Ga0496114_0051898 3300048917 Bacteria 3415
463 Ga0496114_0077688 3300048917 Bacteria 2799
464 Ga0496114_0271868 3300048917 Bacteria 1493
465 Ga0496116_0036239 3300048919 Bacteria 3455
466 Ga0496116_0100538 3300048919 Bacteria 1729
467 Ga0496117_0181330 3300048920 Bacteria 1210
468 Ga0496118_0014787 3300048921 Bacteria 7280
469 Ga0496118_0063384 3300048921 Bacteria 2720
470 Ga0496118_0133326 3300048921 Bacteria 1590
471 Ga0496118_0171840 3300048921 Bacteria 1323
472 Ga0496119_0008125 3300048922 Bacteria 9292
473 Ga0496119_0053978 3300048922 Bacteria 2450
474 Ga0496119_0058321 3300048922 Bacteria 2327
475 Ga0496119_0092138 3300048922 Bacteria 1720
476 Ga0496121_0005990 3300048924 Bacteria 15358
477 Ga0496121_0102595 3300048924 Bacteria 2203
478 Ga0496121_0123295 3300048924 Bacteria 1953
479 Ga0496121_0139712 3300048924 Bacteria 1799
480 Ga0496122_0096145 3300048925 Bacteria 1999
481 Ga0496124_0079063 3300048927 Bacteria 2709
482 Ga0496125_0035738 3300048928 Bacteria 4352
483 Ga0496125_0094033 3300048928 Bacteria 2235
484 Ga0496125_0255683 3300048928 Bacteria 1101
485 Ga0496126_0004519 3300048929 Bacteria 16558
486 Ga0496126_0008775 3300048929 Bacteria 10850
487 Ga0496126_0171004 3300048929 Bacteria 1851
488 Ga0496126_0189177 3300048929 Bacteria 1744
489 Ga0495682_0006553 3300049460 Bacteria 4704
490 Ga0501033_0347497 3300049570 Bacteria 1039
491 Ga0501034_0105114 3300049571 Bacteria 2816
492 Ga0501041_0193110 3300049577 Bacteria 1276
493 Ga0501046_0109786 3300049580 Bacteria 2108
494 Ga0501047_0126274 3300049581 Bacteria 2438
495 Ga0501069_0100619 3300049585 Bacteria 1641
496 Ga0501070_0033191 3300049586 Bacteria 4319
497 Ga0501076_0407561 3300049592 Bacteria 1118
498 Ga0501080_0316804 3300049742 Bacteria 1413
499 Ga0501044_0246707 3300049823 Bacteria 1728
500 nmdc:mga03683_40690_c1 3300050489 Bacteria 1907
501 nmdc:mga03n38_108332_c1 3300050490 Bacteria 1349
502 nmdc:mga03n38_24576_c1 3300050490 Bacteria 2465
503 nmdc:mga0yw44_10880_c1 3300050492 Bacteria 4665
504 nmdc:mga0yw44_310544_c1 3300050492 Bacteria 1058
505 nmdc:mga0yw44_43120_c1 3300050492 Bacteria 2692
506 nmdc:mga0yw44_45043_c1 3300050492 Bacteria 2643
507 nmdc:mga0yw44_69757_c1 3300050492 Bacteria 2178
508 nmdc:mga0k408_44968_c2 3300050493 Bacteria 1514
509 nmdc:mga06z11_26524_c1 3300050494 Bacteria 2758
510 nmdc:mga07m45_64668_c1 3300050496 Bacteria 2076
511 nmdc:mga07m45_96800_c1 3300050496 Bacteria 1694
512 nmdc:mga05p37_80427_c1 3300050507 Bacteria 4014
513 nmdc:mga0n895_27395_c1 3300050512 Bacteria 5414
514 nmdc:mga0sz30_8355_c1 3300050516 Bacteria 3907
515 Ga0495601_0136049 3300053077 Bacteria 1602
516 Ga0495601_0182984 3300053077 Bacteria 1370
517 Ga0500610_0155127 3300053079 Bacteria 1144
518 Ga0495655_0010054 3300053083 Bacteria 1855
519 Ga0495655_0011063 3300053083 Bacteria 1802
520 Ga0495595_0025940 3300053084 Bacteria 2600
521 Ga0495619_0056934 3300053085 Bacteria 2593
522 Ga0495619_0096956 3300053085 Bacteria 2003
523 Ga0500578_0039537 3300053086 Bacteria 3031
524 Ga0500643_000435 3300053087 Bacteria 31475
525 Ga0500651_0066913 3300053093 Bacteria 2237
526 Ga0500566_0000185 3300053094 Bacteria 32171
527 Ga0500566_0000993 3300053094 Bacteria 16325
528 Ga0500641_0009130 3300053096 Bacteria 3556
529 Ga0500641_0010473 3300053096 Bacteria 3352
530 Ga0500554_003324 3300053102 Bacteria 3279
531 Ga0500555_030878 3300053103 Bacteria 1519
532 Ga0500556_0005535 3300053104 Bacteria 3566
533 Ga0500557_000041 3300053105 Bacteria 64885
534 Ga0500562_011778 3300053108 Bacteria 2220
535 Ga0500595_005823 3300053119 Bacteria 5316
536 Ga0500595_006324 3300053119 Bacteria 5038
537 Ga0500595_009254 3300053119 Bacteria 3982
538 Ga0500607_144307 3300053121 Bacteria 1114
539 Ga0500608_021482 3300053122 Bacteria 2983
540 Ga0500621_085604 3300053126 Bacteria 1259
541 Ga0500642_0000140 3300053130 Bacteria 32282
542 Ga0500655_014686 3300053133 Bacteria 1434
543 Ga0500658_0131070 3300053134 Bacteria 1118
544 Ga0500559_0105965 3300053136 Bacteria 1299
545 Ga0500589_096404 3300053147 Bacteria 1292
546 Ga0500620_003064 3300053155 Bacteria 3507
547 Ga0500622_0014718 3300053156 Bacteria 4194
548 Ga0500634_0145092 3300053161 Bacteria 1117
549 Ga0500638_006319 3300053162 Bacteria 4835
550 Ga0500638_023787 3300053162 Bacteria 2915
551 Ga0500636_0000112 3300053177 Bacteria 42041
552 Ga0500636_0046530 3300053177 Bacteria 2558
553 Ga0500637_0001154 3300053178 Bacteria 10952
554 Ga0500637_0071056 3300053178 Bacteria 2002
555 Ga0500625_007721 3300053729 Bacteria 4697
556 Ga0500609_001591 3300053731 Bacteria 3312
557 Ga0500601_000165 3300053737 Bacteria 13854
558 Ga0500661_000795 3300055283 Bacteria 5891
559 Ga0500661_003733 3300055283 Bacteria 2858
560 Ga0500661_020620 3300055283 Bacteria 1171
561 Ga0466962_0052723 3300061719 Bacteria 1944
562 2507510997 2507262055 Bacteria 8048963
563 2508544817 2508501009 Bacteria 7784016
564 2508696957 2508501042 Bacteria 8719808
565 2511394093 2511231028 Bacteria 8046582
566 2513623471 2513237092 Bacteria 8341956
567 2513637483 2513237094 Bacteria 8789602
568 2513649668 2513237095 Bacteria 8976980
569 2513655010 2513237096 Bacteria 8722461
570 2513697417 2513237101 Bacteria 7952346
571 2513701421 2513237102 Bacteria 7703324
572 2513861025 2513237137 Bacteria 9558895
573 2513874637 2513237139 Bacteria 8737671
574 2513915967 2513237145 Bacteria 8979722
575 2514017577 2513237161 Bacteria 8871253
576 2515625451 2515154112 Bacteria 8294334
577 2517100576 2517093001 Bacteria 9002274
578 2517894727 2517572143 Bacteria 9484767
579 2524438200 2524023205 Bacteria 8918781
580 2524534476 2524023228 Bacteria 10118060
581 2528849834 2528768022 Bacteria 10457665
582 2617350762 2617270735 Bacteria 9163226
583 2617377850 2617270741 Bacteria 8201522
584 2671119142 2667528175 Bacteria 7532676
585 2723843092 2721755755 Bacteria 8322773
586 2728747617 2728368998 Bacteria 8720350
587 2745076918 2744054633 Bacteria 8678936
588 2793064648 2791355196 Bacteria 7323613
589 2793071203 2791355197 Bacteria 8420563
590 2805916634 2802429603 Bacteria 8777136
591 2818238139 2816332527 Bacteria 8933356
592 2824607975 2824600985 Bacteria 8488197
593 2824616530 2824609381 Bacteria 8672835
594 2824624669 2824617872 Bacteria 8814715
595 2824633296 2824626560 Bacteria 8813858
596 2824640648 2824635225 Bacteria 8785348
597 2824650599 2824644064 Bacteria 8743947
598 2824657814 2824653114 Bacteria 8493680
599 2824670073 2824661429 Bacteria 9877870
600 2824677245 2824671348 Bacteria 8369588
601 2824683851 2824679649 Bacteria 8248951
602 2824693697 2824687955 Bacteria 8360029
603 2824702232 2824696289 Bacteria 8335049
604 2824710914 2824704595 Bacteria 9667483
605 2824721948 2824714736 Bacteria 8717648
606 2824728500 2824723954 Bacteria 8758240
607 2824737061 2824732956 Bacteria 7810675
608 2824750511 2824746037 Bacteria 7911610
609 2824761822 2824753945 Bacteria 9787441
610 2824772296 2824763712 Bacteria 9792355
611 2824780820 2824773399 Bacteria 8360218
612 2838127881 2838122688 Bacteria 8803140
613 2841943174 2841941048 Bacteria 8688029
614 2841956195 2841949485 Bacteria 8680857
615 2841960234 2841957949 Bacteria 8652217
616 2841968185 2841966195 Bacteria 8673214
617 2841976605 2841974524 Bacteria 8931498
618 2841987978 2841983080 Bacteria 8395090
619 2842042719 2842038055 Bacteria 8002051
620 2842050762 2842045827 Bacteria 8006841
621 2844316930 2844315083 Bacteria 8138177
622 2847938549 2847930680 Bacteria 9342022
623 2847944252 2847939898 Bacteria 8606328
624 2849081515 2849076700 Bacteria 7039503
625 2857512175 2857509624 Bacteria 7472071
626 2874597734 2874590934 Bacteria 8299676
627 2874615801 2874612657 Bacteria 8252029
628 2874623450 2874620515 Bacteria 8290088
629 2874630640 2874628541 Bacteria 8630250
630 2874651264 2874645413 Bacteria 8214782
631 2876762417 2876761206 Bacteria 10111113
632 2876776334 2876771140 Bacteria 8287509
633 2876820902 2876818435 Bacteria 8274608
634 2879081803 2879074833 Bacteria 8279565
635 2879086207 2879083081 Bacteria 8587928
636 2879101691 2879099564 Bacteria 10442239
637 2879130518 2879127579 Bacteria 8294491
638 2879146404 2879142872 Bacteria 8267021
639 2881370665 2881364244 Bacteria 7710352
640 2881672699 2881665667 Bacteria 8175609
641 2885366951 2885366525 Bacteria 8326213
642 2885376515 2885374607 Bacteria 8927485
643 2885389111 2885383462 Bacteria 9473874
644 2885413447 2885409591 Bacteria 9235467
645 2888381539 2888378607 Bacteria 9652610
646 2888389101 2888388044 Bacteria 7304136
647 2888421941 2888419890 Bacteria 7857137
648 2889033607 2889033259 Bacteria 9099371
649 2903733979 2903727486 Bacteria 8281579
650 2904667319 2904666416 Bacteria 8226587
651 2904697712 2904690495 Bacteria 9412302
652 2904705772
653 2904719212 2904711408 Bacteria 9771557
654 2906604596 2906602504 Bacteria 8295279
655 2906611448
656 2906629286 2906626472 Bacteria 8826946
657 2906640984 2906635258 Bacteria 8601019
658 2906651063 2906643746 Bacteria 8722424
659 2906660817 2906660503 Bacteria 8595048
660 2908745040 2908739725 Bacteria 8628932
661 2908757192 2908756301 Bacteria 8864324
662 2908782095 2908775508 Bacteria 8092255
663 2922371206
664 2922390247 2922386360 Bacteria 7017218
665 2922393859 2922393267 Bacteria 8285685
666 2922427909
667 2929619592 2929615660 Bacteria 9193770
668 2929627938 2929624759 Bacteria 9339455
669 2932785921 2932784394 Bacteria 9704911
670 2932798299 2932794094 Bacteria 7915132
671 2932804095 2932801729 Bacteria 7987968
672 2932817292 2932809354 Bacteria 9135765
673 2932826889 2932818245 Bacteria 9955613
674 2932830965 2932828146 Bacteria 9745859
675 2933581512 2933577622 Bacteria 9116884
676 2935612765 2935608549 Bacteria 8203142
677 2935621030 2935616580 Bacteria 9032984
678 2935632162 2935630451 Bacteria 8169952
679 2935640106 2935638405 Bacteria 10015038
680 2935655439 2935648319 Bacteria 8801166
681 2935664260 2935656913 Bacteria 8965014
682 2935667055 2935665750 Bacteria 9571747
683 2935680301 2935675223 Bacteria 9928132
684 2935690188 2935684952 Bacteria 9590419
685 2935699727 2935694250 Bacteria 9291695
686 2935704811 2935703347 Bacteria 10242284
687 2935718116 2935713505 Bacteria 9608509
688 2935726734 2935722832 Bacteria 9608746
689 2935735503 2935732158 Bacteria 9706831
690 2935745226 2935741537 Bacteria 9707219
691 2935755199 2935750917 Bacteria 9590372
692 2935762285 2935760218 Bacteria 9817913
693 2935788421 2935785616 Bacteria 7962367
694 2935796578 2935793552 Bacteria 8012592
695 2935803787 2935801545 Bacteria 9301974
696 2935811703 2935810662 Bacteria 9401221
697 2935824255 2935819856 Bacteria 8261050
698 2935829589 2935827899 Bacteria 10038562
699 2935843077 2935837841 Bacteria 9454360
700 2935852599 2935847175 Bacteria 8228321
701 2935858837 2935855204 Bacteria 9035059
702 2935866765 2935864058 Bacteria 9784707
703 2935876896 2935873716 Bacteria 9632195
704 2935884099 2935883170 Bacteria 7964738
705 2935912255 2935908558 Bacteria 8568796
706 2935924071 2935916978 Bacteria 9113783
707 2935929284 2935926038 Bacteria 8601059
708 2935935915 2935934488 Bacteria 8602579
709 2935950423 2935942939 Bacteria 8599779
710 2935957419 2935951376 Bacteria 8602333
711 2935962058 2935959822 Bacteria 7869783
712 2935968450 2935967501 Bacteria 8603075
713 2935976638 2935975950 Bacteria 8347125
714 2935987918 2935984226 Bacteria 8302647
715 2935993467 2935992306 Bacteria 9802711
716 2936004362 2936002035 Bacteria 9362176
717 2936018330 2936011229 Bacteria 8801034
718 2936026907 2936019824 Bacteria 8804134
719 2936035729 2936028420 Bacteria 8965941
720 2936038285 2936037263 Bacteria 9446081
721 2936053808 2936046547 Bacteria 8903709
722 2936058622 2936055302 Bacteria 8785755
723 2940561521 2940556831 Bacteria 9590747
724 2941508110 2941507105 Bacteria 8166816
725 2941515385 2941515067 Bacteria 8166720
726 2941524040 2941523033 Bacteria 8169134
727 2941533711 2941531003 Bacteria 7653939
728 2941544301 2941538514 Bacteria 9402094
729 3005477619 3005474847 Bacteria 9259049
730 3005485685 3005483717 Bacteria 7877331
731 3005507139 3005506211 Bacteria 6943378
732 3005594507 3005587118 Bacteria 7794411
733 3005596563 3005594810 Bacteria 8716512
734 3005712632 3005710791 Bacteria 7622528
735 3005719692 3005718088 Bacteria 8283608
736 8006930988 8006926726 Bacteria 6749210
737 8006933596 8006933436 Bacteria 10410654
738 8006966513 8006964411 Bacteria 8966052
739 8006983269 8006973647 Bacteria 10679141
740 8006997823 8006994254 Bacteria 8309700
741 8016516420 8016511872 Bacteria 9921665
742 8016523817 8016522445 Bacteria 8156687
743 8016541619 8016539877 Bacteria 8155419
744 8016551648 8016548790 Bacteria 8155074
745 8016560037 8016557553 Bacteria 8154380
746 8016567005 8016566248 Bacteria 8158151
747 8016579725 8016575299 Bacteria 8154085
748 8016589148 8016583857 Bacteria 10421953
749 8016597959 8016595262 Bacteria 8149947
750 8016604098 8016603502 Bacteria 8731218
751 8016620680 8016613128 Bacteria 8794220
752 8016633833 8016630954 Bacteria 9217207
753 8017060117 8017057580 Bacteria 10023680
754 8019537033 8019530166 Bacteria 8155624
755 8019548248 8019547302 Bacteria 7996444
756 8019559532 8019555841 Bacteria 9642137
757 8019569636 8019565922 Bacteria 9639779
758 8019579629 8019576017 Bacteria 10049540
759 8019587338 8019586578 Bacteria 10212056
760 8019604003 8019597564 Bacteria 10041141
761 8019614527 8019608314 Bacteria 10042931
762 8019674427 8019668869 Bacteria 8791617
763 8019681676 8019678201 Bacteria 8863603
764 8019694099 8019687851 Bacteria 8712826
765 8055749151 8055742211 Bacteria 9226248
766 8056674856 8056673599 Bacteria 7871253
767 8056695157 8056689827 Bacteria 6712655
768 8056970000 8056967851 Bacteria 9038162
769 Ga0209389_1000004
770 JGI24737J22298_10009803
771 JGI25406J46586_10000789
772 JGI25165J46597_1004357
773 JGI25153J46596_10001899
774 JGI25153J46596_10001991
775 JGI25153J46596_10003569
776 JGI25153J46596_10018363
777 JGI25153J46596_10024393
778 JGI25160J50197_1000916
779 JGI25160J50197_1001939
780 JGI25404J52841_10037078
781 Ga0055539_1005368
782 Ga0055531_10005121
783 Ga0055543_1002598
784 Ga0065165_1001630
785 Ga0065165_1001784
786 Ga0065165_1024054
787 Ga0070658_10071339
788 Ga0070676_10057578
789 Ga0070683_100060604
790 Ga0070670_100103237
791 Ga0070680_100059827
792 Ga0068868_100019643
793 Ga0068868_100044721
794 Ga0068868_100589364
795 Ga0070661_100014272
796 Ga0070661_100075405
797 Ga0070668_100054638
798 Ga0070668_100062303
799 Ga0070671_100011785
800 Ga0070671_100132386
801 Ga0070674_100060517
802 Ga0070659_100355787
803 Ga0070714_100041846
804 Ga0070663_100030983
805 Ga0070663_100057313
806 Ga0070663_100067313
807 Ga0070663_100074653
808 Ga0070663_100194164
809 Ga0070678_100596663
810 Ga0070662_100136128
811 Ga0070681_10008669
812 Ga0070681_10032246
813 Ga0070681_10184737
814 Ga0068867_100195679
815 Ga0070685_10135025
816 Ga0070699_100113835
817 Ga0070679_100124252
818 Ga0070679_100132784
819 Ga0070684_100004058
820 Ga0070684_100201256
821 Ga0068853_100053427
822 Ga0068853_100175380
823 Ga0068853_100287618
824 Ga0068853_100295122
825 Ga0070686_100112778
826 Ga0070665_100042560
827 Ga0070665_100063876
828 Ga0070665_100076670
829 Ga0070665_100109514
830 Ga0070665_100131256
831 Ga0070665_100187099
832 Ga0068855_100074350
833 Ga0068855_100090633
834 Ga0068855_100186078
835 Ga0068855_100189915
836 Ga0068855_100215132
837 Ga0070664_100107626
838 Ga0068857_100015211
839 Ga0068854_100051650
840 Ga0068854_100118298
841 Ga0068856_100039332
842 Ga0068856_100082555
843 Ga0068852_100011393
844 Ga0068852_100084678
845 Ga0068852_100480214
846 Ga0068852_100534920
847 Ga0068859_100147073
848 Ga0068859_100272128
849 Ga0068859_100447760
850 Ga0068864_100008536
851 Ga0068861_100008090
852 Ga0068861_100131165
853 Ga0068851_10009624
854 Ga0068870_10135865
855 Ga0068858_100017551
856 Ga0068858_100173599
857 Ga0068862_100072594
858 Ga0068862_100203175
859 Ga0081455_10008108
860 Ga0081455_10042864
861 Ga0081455_10046021
862 Ga0081540_1001402
863 Ga0081540_1001927
864 Ga0081540_1002927
865 Ga0081540_1006969
866 Ga0081540_1009737
867 Ga0081540_1021051
868 Ga0081540_1024046
869 Ga0081540_1030582
870 Ga0081540_1040874
871 Ga0081539_10002973
872 Ga0081539_10010397
873 Ga0075365_10009233
874 Ga0075365_10052610
875 Ga0075365_10139503
876 Ga0075368_10016335
877 Ga0075363_100039245
878 Ga0075363_100088566
879 Ga0075364_10109353
880 Ga0070716_100339500
881 Ga0075362_10028019
882 Ga0075367_10078633
883 Ga0075369_10036984
884 Ga0075369_10091018
885 Ga0075370_10015574
886 Ga0075370_10038284
887 Ga0075428_100189480
888 Ga0075428_100233901
889 Ga0075434_100029717
890 Ga0097620_100147070
891 Ga0097620_100272137
892 Ga0097620_100447757
893 Ga0075435_100033251
894 Ga0105240_10014081
895 Ga0105240_10017926
896 Ga0105240_10066543
897 Ga0105245_10060890
898 Ga0105245_10079445
899 Ga0105245_10326086
900 Ga0105247_10026556
901 Ga0105247_10040296
902 Ga0114129_10215714
903 Ga0105241_10000538
904 Ga0105241_10013912
905 Ga0105241_10027359
906 Ga0105242_10102824
907 Ga0105237_10003299
908 Ga0105237_10057131
909 Ga0105237_10085768
910 Ga0105237_10355032
911 Ga0105238_10192764
912 Ga0105238_10356667
913 Ga0105249_10141132
914 Ga0105249_10141379
915 Ga0105239_10025796
916 Ga0105239_10029629
917 Ga0105239_10055849
918 Ga0105239_10132077
919 Ga0105239_10198624
920 Ga0105239_10321208
921 Ga0105239_10368337
922 Ga0105246_10023303
923 Ga0105246_10030133
924 Ga0105246_10142139
925 Ga0157369_10247291
926 Ga0157374_10016924
927 Ga0157374_10143749
928 Ga0157378_10214028
929 Ga0157375_10024625
930 Ga0157375_10075210
931 Ga0157375_10220850
932 Ga0163163_10052887
933 Ga0163163_10111642
934 Ga0157380_10695195
935 Ga0157379_10220995
936 Ga0157376_10025066
937 Ga0157376_10050771
938 Ga0157376_10126673
939 Ga0163161_10012946
940 Ga0214544_1000026
941 Ga0214542_1000025
942 Ga0214545_1000014
943 Ga0214543_1000034
944 Ga0213873_10041192
945 Ga0213871_10000403
946 Ga0207425_1010937
947 Ga0209677_100778
948 Ga0209148_1000516
949 Ga0209233_1001322
950 Ga0209233_1001630
951 Ga0209233_1007518
952 Ga0209233_1018286
953 Ga0209455_1004171
954 Ga0209564_1002228
955 Ga0209758_1000141
956 Ga0209758_1002551
957 Ga0209758_1002574
958 Ga0209758_1004224
959 Ga0209758_1005011
960 Ga0209758_1007584
961 Ga0209758_1018699
962 Ga0209256_1004845
963 Ga0207426_1001022
964 Ga0207426_1001111
965 Ga0207426_1018923
966 Ga0207426_1055556
967 Ga0209257_1000426
968 Ga0209257_1022503
969 Ga0207697_10011495
970 Ga0207642_10080033
971 Ga0207680_10120805
972 Ga0207647_10006134
973 Ga0207647_10016511
974 Ga0207647_10093436
975 Ga0207645_10028276
976 Ga0207645_10034762
977 Ga0207705_10292584
978 Ga0207684_10169130
979 Ga0207654_10000673
980 Ga0207654_10019170
981 Ga0207654_10131110
982 Ga0207707_10007094
983 Ga0207707_10072110
984 Ga0207695_10000062
985 Ga0207695_10000497
986 Ga0207671_10003655
987 Ga0207671_10029616
988 Ga0207671_10092301
989 Ga0207660_10030654
990 Ga0207660_10070575
991 Ga0207657_10065189
992 Ga0207649_10180952
993 Ga0207681_10097095
994 Ga0207694_10000571
995 Ga0207650_10244968
996 Ga0207687_10064332
997 Ga0207664_10264301
998 Ga0207644_10141506
999 Ga0207690_10167870
1000 Ga0207690_10212573
1001 Ga0207706_10035078
1002 Ga0207706_10140591
1003 Ga0207709_10025270
1004 Ga0207670_10161508
1005 Ga0207665_10380714
1006 Ga0207691_10181665
1007 Ga0207711_10097010
1008 Ga0207711_10270668
1009 Ga0207689_10014554
1010 Ga0207689_10156934
1011 Ga0207661_10000591
1012 Ga0207661_10077762
1013 Ga0207679_10170886
1014 Ga0207667_10270762
1015 Ga0207651_10111212
1016 Ga0207651_10256836
1017 Ga0207651_10432609
1018 Ga0207668_10041779
1019 Ga0207668_10047403
1020 Ga0207668_10089524
1021 Ga0207640_10176483
1022 Ga0207640_10235602
1023 Ga0207658_10034683
1024 Ga0207658_10291199
1025 Ga0207677_10053779
1026 Ga0207703_10044332
1027 Ga0207703_10099761
1028 Ga0207703_10205718
1029 Ga0207639_10134793
1030 Ga0207639_10575763
1031 Ga0207678_10018655
1032 Ga0207678_10053461
1033 Ga0207678_10057216
1034 Ga0207678_10092409
1035 Ga0207678_10110584
1036 Ga0207678_10170279
1037 Ga0207702_10000003
1038 Ga0207641_10266441
1039 Ga0207648_10078408
1040 Ga0207648_10239013
1041 Ga0207676_10019965
1042 Ga0207676_10232739
1043 Ga0207674_10074144
1044 Ga0207675_100043075
1045 Ga0207675_100109787
1046 Ga0207683_10013758
1047 Ga0207683_10084186
1048 Ga0207698_10047031
1049 Ga0207698_10387328
1050 Ga0207698_10453744
1051 Ga0209489_100295
1052 Ga0209700_100013
1053 Ga0268266_10011469
1054 Ga0268266_10045982
1055 Ga0268266_10077392
1056 Ga0268266_10119247
1057 Ga0268266_10331891
1058 Ga0307515_10020920
1059 Ga0265339_10018346
1060 Ga0307415_100044162
1061 Ga0307510_10028510
1062 Ga0307510_10316444
1063 Ga0315911_1000010
1064 Ga0373936_0020822
1065 Ga0373939_0069487
1066 Ga0373954_0021520
1067 Ga0373956_0045870
1068 Ga0373957_0177613
1069 Ga0373960_0042418
1070 Ga0373943_0035056
1071 Ga0373931_0249007
1072 Ga0373927_0248810
1073 Ga0373933_0023599
1074 Ga0373947_0304900
1075 Ga0373937_0061401
1076 Ga0395899_0150974
1077 Ga0395900_0026074
1078 Ga0395898_0017784
1079 Ga0395905_0027045
1080 Ga0395905_0138285
1081 Ga0395905_0247773
1082 Ga0436364_1440034
1083 Ga0395901_0010481
1084 Ga0436360_1267380
1085 Ga0436362_1130210
1086 Ga0451793_0392809
1087 Ga0451795_1676707
1088 Ga0451800_1360595
1089 Ga0451853_0151450
1090 Ga0439459_0006929
1091 Ga0466969_0153796
1092 Ga0466972_0021527
1093 Ga0466966_0002704
1094 Ga0466961_0000149
1095 Ga0466964_0140251
1096 Ga0466968_0005932
1097 Ga0466959_0001944
1098 Ga0466967_0165255
1099 Ga0495592_0158257
1100 Ga0495592_0259725
1101 Ga0495603_0129498
1102 Ga0495629_0374975
1103 Ga0495651_0005291
1104 Ga0495651_0259461
1105 Ga0495580_0120043
1106 Ga0495580_0254473
1107 Ga0495582_0032490
1108 Ga0495582_0061803
1109 Ga0495605_0025935
1110 Ga0495605_0057622
1111 Ga0495605_0071321
1112 Ga0495639_0100750
1113 Ga0495664_0009276
1114 Ga0495664_0055550
1115 Ga0495664_0085256
1116 Ga0495664_0122357
1117 Ga0495585_0141877
1118 Ga0495606_0063885
1119 Ga0495610_0038756
1120 Ga0495618_0082557
1121 Ga0495618_0103063
1122 Ga0495630_0068762
1123 Ga0495630_0096898
1124 Ga0495632_0042001
1125 Ga0495643_0068410
1126 Ga0495643_0105636
1127 Ga0495643_0166422
1128 Ga0495648_0020924
1129 Ga0495648_0184270
1130 Ga0495652_0061731
1131 Ga0495665_0146832
1132 Ga0495640_0015659
1133 Ga0495640_0041370
1134 Ga0495640_0062301
1135 Ga0495586_0048243
1136 Ga0495587_0061449
1137 Ga0495645_0066458
1138 Ga0495622_0009702
1139 Ga0495667_0005990
1140 Ga0495668_0082531
1141 Ga0495668_0102942
1142 Ga0495668_0143638
1143 Ga0495668_0149908
1144 Ga0495634_0067476
1145 Ga0495625_0055046
1146 Ga0495625_0094677
1147 Ga0495625_0149975
1148 Ga0495635_0017204
1149 Ga0495588_0008023
1150 Ga0495599_0024720
1151 Ga0495623_0009425
1152 Ga0495646_0021211
1153 Ga0495624_0039999
1154 Ga0495670_0042931
1155 Ga0495671_0053998
1156 Ga0495649_0004374
1157 Ga0495649_0186976
1158 Ga0495589_0064033
1159 Ga0495581_0110724
1160 Ga0495604_0000905
1161 Ga0495604_0006433
1162 Ga0495674_0009424
1163 Ga0495674_0085183
1164 Ga0495680_0002632
1165 Ga0495683_0086306
1166 Ga0495687_033544
1167 Ga0495675_0007188
1168 Ga0495685_063779
1169 Ga0495673_0056271
1170 Ga0495684_0004812
1171 Ga0495686_0058551
1172 Ga0495686_0083520
1173 Ga0495593_0055710
1174 Ga0495602_0016516
1175 Ga0495614_0031984
1176 Ga0496100_0013300
1177 Ga0496100_0147327
1178 Ga0496101_0022109
1179 Ga0496101_0103077
1180 Ga0496101_0129178
1181 Ga0496101_0390479
1182 Ga0496102_0002007
1183 Ga0496102_0022027
1184 Ga0496102_0139837
1185 Ga0496102_0190924
1186 Ga0496102_0556208
1187 Ga0496102_0671250
1188 Ga0496103_0012305
1189 Ga0496103_0098892
1190 Ga0496104_0006350
1191 Ga0496104_0047462
1192 Ga0496104_0094854
1193 Ga0496104_0097134
1194 Ga0496104_0214519
1195 Ga0496105_0001222
1196 Ga0496105_0013030
1197 Ga0496105_0036723
1198 Ga0496105_0076210
1199 Ga0496105_0123918
1200 Ga0496105_0433551
1201 Ga0496106_0020464
1202 Ga0496106_0021340
1203 Ga0496106_0024892
1204 Ga0496106_0051714
1205 Ga0496107_0006630
1206 Ga0496107_0007234
1207 Ga0496107_0079823
1208 Ga0496107_0290531
1209 Ga0496108_0008204
1210 Ga0496108_0009009
1211 Ga0496108_0013475
1212 Ga0496108_0142228
1213 Ga0496108_0558039
1214 Ga0496109_0000361
1215 Ga0496109_0005319
1216 Ga0496110_0017010
1217 Ga0496110_0066446
1218 Ga0496110_0093109
1219 Ga0496110_0108871
1220 Ga0496110_0139615
1221 Ga0496110_0366875
1222 Ga0496111_0197333
1223 Ga0496111_0222218
1224 Ga0496111_0382878
1225 Ga0496112_0003390
1226 Ga0496112_0008969
1227 Ga0496112_0022055
1228 Ga0496113_0463272
1229 Ga0496114_0021956
1230 Ga0496114_0051898
1231 Ga0496114_0077688
1232 Ga0496114_0271868
1233 Ga0496116_0036239
1234 Ga0496116_0100538
1235 Ga0496117_0181330
1236 Ga0496118_0014787
1237 Ga0496118_0063384
1238 Ga0496118_0133326
1239 Ga0496118_0171840
1240 Ga0496119_0008125
1241 Ga0496119_0053978
1242 Ga0496119_0058321
1243 Ga0496119_0092138
1244 Ga0496121_0005990
1245 Ga0496121_0102595
1246 Ga0496121_0123295
1247 Ga0496121_0139712
1248 Ga0496122_0096145
1249 Ga0496124_0079063
1250 Ga0496125_0035738
1251 Ga0496125_0094033
1252 Ga0496125_0255683
1253 Ga0496126_0004519
1254 Ga0496126_0008775
1255 Ga0496126_0171004
1256 Ga0496126_0189177
1257 Ga0495682_0006553
1258 Ga0501033_0347497
1259 Ga0501034_0105114
1260 Ga0501041_0193110
1261 Ga0501046_0109786
1262 Ga0501047_0126274
1263 Ga0501069_0100619
1264 Ga0501070_0033191
1265 Ga0501076_0407561
1266 Ga0501080_0316804
1267 Ga0501044_0246707
1268 nmdc:mga03683_40690_c1
1269 nmdc:mga03n38_108332_c1
1270 nmdc:mga03n38_24576_c1
1271 nmdc:mga0yw44_10880_c1
1272 nmdc:mga0yw44_310544_c1
1273 nmdc:mga0yw44_43120_c1
1274 nmdc:mga0yw44_45043_c1
1275 nmdc:mga0yw44_69757_c1
1276 nmdc:mga0k408_44968_c2
1277 nmdc:mga06z11_26524_c1
1278 nmdc:mga07m45_64668_c1
1279 nmdc:mga07m45_96800_c1
1280 nmdc:mga05p37_80427_c1
1281 nmdc:mga0n895_27395_c1
1282 nmdc:mga0sz30_8355_c1
1283 Ga0495601_0136049
1284 Ga0495601_0182984
1285 Ga0500610_0155127
1286 Ga0495655_0010054
1287 Ga0495655_0011063
1288 Ga0495595_0025940
1289 Ga0495619_0056934
1290 Ga0495619_0096956
1291 Ga0500578_0039537
1292 Ga0500643_000435
1293 Ga0500651_0066913
1294 Ga0500566_0000185
1295 Ga0500566_0000993
1296 Ga0500641_0009130
1297 Ga0500641_0010473
1298 Ga0500554_003324
1299 Ga0500555_030878
1300 Ga0500556_0005535
1301 Ga0500557_000041
1302 Ga0500562_011778
1303 Ga0500595_005823
1304 Ga0500595_006324
1305 Ga0500595_009254
1306 Ga0500607_144307
1307 Ga0500608_021482
1308 Ga0500621_085604
1309 Ga0500642_0000140
1310 Ga0500655_014686
1311 Ga0500658_0131070
1312 Ga0500559_0105965
1313 Ga0500589_096404
1314 Ga0500620_003064
1315 Ga0500622_0014718
1316 Ga0500634_0145092
1317 Ga0500638_006319
1318 Ga0500638_023787
1319 Ga0500636_0000112
1320 Ga0500636_0046530
1321 Ga0500637_0001154
1322 Ga0500637_0071056
1323 Ga0500625_007721
1324 Ga0500609_001591
1325 Ga0500601_000165
1326 Ga0500661_000795
1327 Ga0500661_003733
1328 Ga0500661_020620
1329 Ga0466962_0052723
1330 2507510997
1331 2508544817
1332 2508696957
1333 2511394093
1334 2513623471
1335 2513637483
1336 2513649668
1337 2513655010
1338 2513697417
1339 2513701421
1340 2513861025
1341 2513874637
1342 2513915967
1343 2514017577
1344 2515625451
1345 2517100576
1346 2517894727
1347 2524438200
1348 2524534476
1349 2528849834
1350 2617350762
1351 2617377850
1352 2671119142
1353 2723843092
1354 2728747617
1355 2745076918
1356 2793064648
1357 2793071203
1358 2805916634
1359 2818238139
1360 2824607975
1361 2824616530
1362 2824624669
1363 2824633296
1364 2824640648
1365 2824650599
1366 2824657814
1367 2824670073
1368 2824677245
1369 2824683851
1370 2824693697
1371 2824702232
1372 2824710914
1373 2824721948
1374 2824728500
1375 2824737061
1376 2824750511
1377 2824761822
1378 2824772296
1379 2824780820
1380 2838127881
1381 2841943174
1382 2841956195
1383 2841960234
1384 2841968185
1385 2841976605
1386 2841987978
1387 2842042719
1388 2842050762
1389 2844316930
1390 2847938549
1391 2847944252
1392 2849081515
1393 2857512175
1394 2874597734
1395 2874615801
1396 2874623450
1397 2874630640
1398 2874651264
1399 2876762417
1400 2876776334
1401 2876820902
1402 2879081803
1403 2879086207
1404 2879101691
1405 2879130518
1406 2879146404
1407 2881370665
1408 2881672699
1409 2885366951
1410 2885376515
1411 2885389111
1412 2885413447
1413 2888381539
1414 2888389101
1415 2888421941
1416 2889033607
1417 2903733979
1418 2904667319
1419 2904697712
1420 2904705772
1421 2904719212
1422 2906604596
1423 2906611448
1424 2906629286
1425 2906640984
1426 2906651063
1427 2906660817
1428 2908745040
1429 2908757192
1430 2908782095
1431 2922371206
1432 2922390247
1433 2922393859
1434 2922427909
1435 2929619592
1436 2929627938
1437 2932785921
1438 2932798299
1439 2932804095
1440 2932817292
1441 2932826889
1442 2932830965
1443 2933581512
1444 2935612765
1445 2935621030
1446 2935632162
1447 2935640106
1448 2935655439
1449 2935664260
1450 2935667055
1451 2935680301
1452 2935690188
1453 2935699727
1454 2935704811
1455 2935718116
1456 2935726734
1457 2935735503
1458 2935745226
1459 2935755199
1460 2935762285
1461 2935788421
1462 2935796578
1463 2935803787
1464 2935811703
1465 2935824255
1466 2935829589
1467 2935843077
1468 2935852599
1469 2935858837
1470 2935866765
1471 2935876896
1472 2935884099
1473 2935912255
1474 2935924071
1475 2935929284
1476 2935935915
1477 2935950423
1478 2935957419
1479 2935962058
1480 2935968450
1481 2935976638
1482 2935987918
1483 2935993467
1484 2936004362
1485 2936018330
1486 2936026907
1487 2936035729
1488 2936038285
1489 2936053808
1490 2936058622
1491 2940561521
1492 2941508110
1493 2941515385
1494 2941524040
1495 2941533711
1496 2941544301
1497 3005477619
1498 3005485685
1499 3005507139
1500 3005594507
1501 3005596563
1502 3005712632
1503 3005719692
1504 8006930988
1505 8006933596
1506 8006966513
1507 8006983269
1508 8006997823
1509 8016516420
1510 8016523817
1511 8016541619
1512 8016551648
1513 8016560037
1514 8016567005
1515 8016579725
1516 8016589148
1517 8016597959
1518 8016604098
1519 8016620680
1520 8016633833
1521 8017060117
1522 8019537033
1523 8019548248
1524 8019559532
1525 8019569636
1526 8019579629
1527 8019587338
1528 8019604003
1529 8019614527
1530 8019674427
1531 8019681676
1532 8019694099
1533 8055749151
1534 8056674856
1535 8056695157
1536 8056970000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02475

Met_10

Met-10+ like-protein

148

230

0.92

PF08241

Methyltransf_11

Methyltransferase domain

158

255

0.91

PF13649

Methyltransf_25

Methyltransferase domain

157

251

0.89

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

16

294

0.87

PF05175

MTS

Methyltransferase small domain

133

257

0.83

PF13847

Methyltransf_31

Methyltransferase domain

153

268

0.82

PF08242

Methyltransf_12

Methyltransferase domain

158

253

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9432 136 298
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8673 146 275
6aw8-assembly1.cif.gz_A 2.25a resolution domain swapped dimer structure of sah bound catechol o-methyltransferase (comt) from nannospalax galili 0.8654 146 275
5lr6-assembly1.cif.gz_A crystal structure of comt in complex with [3-(2,4-dimethyl-1,3-thiazol-5-yl)-1h-pyrazol-5-yl]-(4-phenylpiperazin-1-yl)methanone 0.8576 146 296
4pyq-assembly1.cif.gz_A humanized rat apo-comt in complex with a ureido-benzamidine 0.8569 146 296
ID Description Score Start End Superfamily
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9399 135 298 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9342 135 298 3.40.50.150
af_Q2FXZ4_114_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9084 133 298 3.40.50.150
2nxjB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8988 140 295 3.40.50.150
3cjtC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8946 134 295 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A349QEK2-F1-model_v4 deleted 0.9858 202 296
AF-A0A1V5L5H4-F1-model_v4 Ribosomal protein L11 methyltransferase (EC 2.1.1.-) 0.9812 184 296 GO:0005840
GO:0008276
GO:0032259
AF-A0A381WA52-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9777 227 296
AF-A0A435GRB1-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9776 132 295 GO:0005840
GO:0008276
GO:0032259
AF-A0A3M1A1I0-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.976 205 296

Map