F479949
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 768 | 255 | 1536 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10001423|Ga0213876_100014238 |
| Length | 120 |
| Sequence | MTDPQPAASVAVVDVPQSSRYEARLAADPSTGRAVATYELRDGAIAFMHTLVPRTLQGHGVGSALARTALDDARRRGLAVIPICPFFASYIRRHAAYQDLVPEAMRAELLAAPAGETSHE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 192 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 193 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 194 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 195 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 196 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 197 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 235 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 241 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 245 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 246 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 3.65 |
| Rhizosphere | 95.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213876_10001423 | 3300021384 | Bacteria | 14913 |
| 2 | JGI24736J21556_1030298 | 3300001904 | Unclassified | 837 |
| 3 | JGI24741J21665_1008559 | 3300001915 | Bacteria | 1924 |
| 4 | JGI24741J21665_1021003 | 3300001915 | Bacteria | 1022 |
| 5 | JGI24752J21851_1007996 | 3300001976 | Bacteria | 1378 |
| 6 | JGI24740J21852_10001875 | 3300001979 | Bacteria | 9620 |
| 7 | JGI24740J21852_10002541 | 3300001979 | Bacteria | 8226 |
| 8 | JGI24740J21852_10016406 | 3300001979 | Bacteria | 2678 |
| 9 | JGI24739J22299_10000368 | 3300001989 | Bacteria | 15458 |
| 10 | JGI24739J22299_10066850 | 3300001989 | Unclassified | 1125 |
| 11 | JGI24737J22298_10000529 | 3300001990 | Bacteria | 13396 |
| 12 | JGI24737J22298_10000723 | 3300001990 | Bacteria | 11628 |
| 13 | JGI24737J22298_10011722 | 3300001990 | Bacteria | 2868 |
| 14 | JGI24737J22298_10018837 | 3300001990 | Bacteria | 2211 |
| 15 | JGI24743J22301_10000217 | 3300001991 | Bacteria | 6055 |
| 16 | JGI24735J21928_10009535 | 3300002067 | Bacteria | 3114 |
| 17 | JGI24735J21928_10032002 | 3300002067 | Unclassified | 1558 |
| 18 | JGI24735J21928_10050993 | 3300002067 | Bacteria | 1195 |
| 19 | JGI24735J21928_10056802 | 3300002067 | Bacteria | 1127 |
| 20 | JGI24735J21928_10092777 | 3300002067 | Unclassified | 866 |
| 21 | JGI24738J21930_10005571 | 3300002075 | Bacteria | 3004 |
| 22 | rootH2_10130912 | 3300003320 | Unclassified | 2697 |
| 23 | rootH1_10001288 | 3300003323 | Bacteria | 7574 |
| 24 | Ga0065712_10099318 | 3300005290 | Unclassified | 2094 |
| 25 | Ga0065712_10478642 | 3300005290 | Unclassified | 665 |
| 26 | Ga0065715_10535615 | 3300005293 | Unclassified | 752 |
| 27 | Ga0070658_10006977 | 3300005327 | Bacteria | 9124 |
| 28 | Ga0070658_10015670 | 3300005327 | Bacteria | 6062 |
| 29 | Ga0070658_10049131 | 3300005327 | Bacteria | 3417 |
| 30 | Ga0070658_10049902 | 3300005327 | Bacteria | 3391 |
| 31 | Ga0070658_10071696 | 3300005327 | Bacteria | 2837 |
| 32 | Ga0070658_10140484 | 3300005327 | Bacteria | 2017 |
| 33 | Ga0070658_10325955 | 3300005327 | Unclassified | 1312 |
| 34 | Ga0070658_11734371 | 3300005327 | Unclassified | 540 |
| 35 | Ga0070676_10317327 | 3300005328 | Bacteria | 1061 |
| 36 | Ga0070683_100004703 | 3300005329 | Bacteria | 11283 |
| 37 | Ga0070683_100015584 | 3300005329 | Bacteria | 6681 |
| 38 | Ga0070683_100109802 | 3300005329 | Bacteria | 2602 |
| 39 | Ga0070690_100551506 | 3300005330 | Unclassified | 869 |
| 40 | Ga0070670_100027668 | 3300005331 | Bacteria | 4877 |
| 41 | Ga0070670_100040725 | 3300005331 | Bacteria | 3993 |
| 42 | Ga0070670_100086741 | 3300005331 | Bacteria | 2690 |
| 43 | Ga0070670_100205569 | 3300005331 | Unclassified | 1711 |
| 44 | Ga0070677_10016684 | 3300005333 | Bacteria | 2618 |
| 45 | Ga0070677_10055228 | 3300005333 | Bacteria | 1620 |
| 46 | Ga0068869_100064659 | 3300005334 | Bacteria | 2691 |
| 47 | Ga0068869_100506831 | 3300005334 | Unclassified | 1008 |
| 48 | Ga0068869_100680076 | 3300005334 | Bacteria | 876 |
| 49 | Ga0068869_100997926 | 3300005334 | Bacteria | 729 |
| 50 | Ga0070666_10031902 | 3300005335 | Bacteria | 3479 |
| 51 | Ga0070666_10172973 | 3300005335 | Bacteria | 1513 |
| 52 | Ga0070680_100000845 | 3300005336 | Bacteria | 21681 |
| 53 | Ga0070680_100005107 | 3300005336 | Bacteria | 9908 |
| 54 | Ga0070680_100552122 | 3300005336 | Unclassified | 987 |
| 55 | Ga0070680_101755296 | 3300005336 | Bacteria | 538 |
| 56 | Ga0070682_100027232 | 3300005337 | Bacteria | 3429 |
| 57 | Ga0070682_100096458 | 3300005337 | Bacteria | 1944 |
| 58 | Ga0070682_100232669 | 3300005337 | Unclassified | 1318 |
| 59 | Ga0068868_100154342 | 3300005338 | Bacteria | 1893 |
| 60 | Ga0068868_100307729 | 3300005338 | Bacteria | 1347 |
| 61 | Ga0068868_102394998 | 3300005338 | Bacteria | 504 |
| 62 | Ga0070660_100000292 | 3300005339 | Bacteria | 33415 |
| 63 | Ga0070660_100005614 | 3300005339 | Bacteria | 8696 |
| 64 | Ga0070660_100023314 | 3300005339 | Bacteria | 4585 |
| 65 | Ga0070660_100044041 | 3300005339 | Bacteria | 3411 |
| 66 | Ga0070660_100080370 | 3300005339 | Bacteria | 2558 |
| 67 | Ga0070660_100136878 | 3300005339 | Bacteria | 1962 |
| 68 | Ga0070660_100279400 | 3300005339 | Bacteria | 1366 |
| 69 | Ga0070660_100279580 | 3300005339 | Bacteria | 1365 |
| 70 | Ga0070689_100175591 | 3300005340 | Unclassified | 1737 |
| 71 | Ga0070689_101608234 | 3300005340 | Unclassified | 590 |
| 72 | Ga0070691_10002168 | 3300005341 | Bacteria | 8687 |
| 73 | Ga0070687_100032815 | 3300005343 | Bacteria | 2558 |
| 74 | Ga0070661_100006185 | 3300005344 | Bacteria | 8254 |
| 75 | Ga0070661_100022295 | 3300005344 | Bacteria | 4533 |
| 76 | Ga0070661_100058516 | 3300005344 | Bacteria | 2824 |
| 77 | Ga0070661_100145705 | 3300005344 | Bacteria | 1788 |
| 78 | Ga0070661_100293259 | 3300005344 | Bacteria | 1264 |
| 79 | Ga0070661_100362001 | 3300005344 | Bacteria | 1140 |
| 80 | Ga0070661_100602476 | 3300005344 | Bacteria | 888 |
| 81 | Ga0070661_101327113 | 3300005344 | Bacteria | 604 |
| 82 | Ga0070692_10000390 | 3300005345 | Bacteria | 13062 |
| 83 | Ga0070692_10011350 | 3300005345 | Bacteria | 4087 |
| 84 | Ga0070668_100087639 | 3300005347 | Bacteria | 2449 |
| 85 | Ga0070668_101468068 | 3300005347 | Bacteria | 623 |
| 86 | Ga0070669_100254443 | 3300005353 | Unclassified | 1399 |
| 87 | Ga0070669_100367084 | 3300005353 | Bacteria | 1172 |
| 88 | Ga0070669_100507000 | 3300005353 | Unclassified | 1001 |
| 89 | Ga0070669_101815873 | 3300005353 | Bacteria | 532 |
| 90 | Ga0070675_100014309 | 3300005354 | Bacteria | 6255 |
| 91 | Ga0070675_100301056 | 3300005354 | Bacteria | 1413 |
| 92 | Ga0070675_100543867 | 3300005354 | Bacteria | 1050 |
| 93 | Ga0070671_100023911 | 3300005355 | Bacteria | 5000 |
| 94 | Ga0070671_100026744 | 3300005355 | Bacteria | 4745 |
| 95 | Ga0070671_100115117 | 3300005355 | Bacteria | 2260 |
| 96 | Ga0070671_100236787 | 3300005355 | Bacteria | 1549 |
| 97 | Ga0070671_100513708 | 3300005355 | Bacteria | 1031 |
| 98 | Ga0070671_101745171 | 3300005355 | Bacteria | 553 |
| 99 | Ga0070674_100088728 | 3300005356 | Unclassified | 2226 |
| 100 | Ga0070674_100147827 | 3300005356 | Bacteria | 1770 |
| 101 | Ga0070674_100202056 | 3300005356 | Unclassified | 1535 |
| 102 | Ga0070674_100220887 | 3300005356 | Bacteria | 1474 |
| 103 | Ga0070674_101161134 | 3300005356 | Unclassified | 684 |
| 104 | Ga0070673_100029978 | 3300005364 | Bacteria | 4064 |
| 105 | Ga0070673_100048207 | 3300005364 | Bacteria | 3320 |
| 106 | Ga0070673_100051485 | 3300005364 | Unclassified | 3225 |
| 107 | Ga0070659_100003770 | 3300005366 | Bacteria | 10815 |
| 108 | Ga0070659_100004716 | 3300005366 | Bacteria | 9732 |
| 109 | Ga0070659_100005750 | 3300005366 | Bacteria | 8923 |
| 110 | Ga0070659_100008695 | 3300005366 | Bacteria | 7427 |
| 111 | Ga0070659_100019161 | 3300005366 | Bacteria | 5178 |
| 112 | Ga0070659_100027038 | 3300005366 | Bacteria | 4417 |
| 113 | Ga0070659_100030696 | 3300005366 | Bacteria | 4160 |
| 114 | Ga0070659_100134317 | 3300005366 | Unclassified | 2012 |
| 115 | Ga0070659_100134582 | 3300005366 | Bacteria | 2009 |
| 116 | Ga0070659_100330501 | 3300005366 | Bacteria | 1276 |
| 117 | Ga0070659_100398256 | 3300005366 | Bacteria | 1162 |
| 118 | Ga0070659_100508943 | 3300005366 | Bacteria | 1027 |
| 119 | Ga0070659_100819745 | 3300005366 | Bacteria | 810 |
| 120 | Ga0070667_100056382 | 3300005367 | Bacteria | 3319 |
| 121 | Ga0070667_100932715 | 3300005367 | Bacteria | 809 |
| 122 | Ga0070667_101033606 | 3300005367 | Unclassified | 767 |
| 123 | Ga0070667_102038549 | 3300005367 | Unclassified | 540 |
| 124 | Ga0070714_100514322 | 3300005435 | Unclassified | 1143 |
| 125 | Ga0070713_100050509 | 3300005436 | Bacteria | 3436 |
| 126 | Ga0070694_100062800 | 3300005444 | Bacteria | 2538 |
| 127 | Ga0070663_100020500 | 3300005455 | Bacteria | 4379 |
| 128 | Ga0070663_100023487 | 3300005455 | Bacteria | 4134 |
| 129 | Ga0070663_100156971 | 3300005455 | Bacteria | 1749 |
| 130 | Ga0070663_100238667 | 3300005455 | Bacteria | 1434 |
| 131 | Ga0070663_100634431 | 3300005455 | Unclassified | 902 |
| 132 | Ga0070663_100651552 | 3300005455 | Bacteria | 891 |
| 133 | Ga0070663_101730106 | 3300005455 | Bacteria | 559 |
| 134 | Ga0070678_100092099 | 3300005456 | Unclassified | 2328 |
| 135 | Ga0070678_100722307 | 3300005456 | Bacteria | 899 |
| 136 | Ga0070662_100012232 | 3300005457 | Bacteria | 5683 |
| 137 | Ga0070662_100020845 | 3300005457 | Bacteria | 4470 |
| 138 | Ga0070662_100027900 | 3300005457 | Bacteria | 3925 |
| 139 | Ga0070662_100051542 | 3300005457 | Unclassified | 2972 |
| 140 | Ga0070662_100072217 | 3300005457 | Bacteria | 2547 |
| 141 | Ga0070662_100095149 | 3300005457 | Unclassified | 2244 |
| 142 | Ga0070662_100150231 | 3300005457 | Unclassified | 1813 |
| 143 | Ga0070662_100185786 | 3300005457 | Unclassified | 1641 |
| 144 | Ga0070681_10069863 | 3300005458 | Bacteria | 3478 |
| 145 | Ga0070681_10090488 | 3300005458 | Bacteria | 3010 |
| 146 | Ga0070681_10158006 | 3300005458 | Unclassified | 2191 |
| 147 | Ga0070681_10457878 | 3300005458 | Bacteria | 1188 |
| 148 | Ga0070681_10570212 | 3300005458 | Bacteria | 1046 |
| 149 | Ga0070681_11062188 | 3300005458 | Bacteria | 730 |
| 150 | Ga0068867_100347978 | 3300005459 | Unclassified | 1236 |
| 151 | Ga0068867_100499070 | 3300005459 | Unclassified | 1046 |
| 152 | Ga0068867_101806709 | 3300005459 | Bacteria | 575 |
| 153 | Ga0074259_10894309 | 3300005507 | Unclassified | 514 |
| 154 | Ga0070679_100023597 | 3300005530 | Bacteria | 6024 |
| 155 | Ga0070679_100094201 | 3300005530 | Bacteria | 2982 |
| 156 | Ga0070679_100250873 | 3300005530 | Bacteria | 1726 |
| 157 | Ga0070679_100641217 | 3300005530 | Unclassified | 1005 |
| 158 | Ga0070684_100014486 | 3300005535 | Bacteria | 6391 |
| 159 | Ga0070684_100070593 | 3300005535 | Bacteria | 3074 |
| 160 | Ga0068853_100009560 | 3300005539 | Bacteria | 7811 |
| 161 | Ga0068853_100031007 | 3300005539 | Bacteria | 4519 |
| 162 | Ga0068853_100085473 | 3300005539 | Bacteria | 2765 |
| 163 | Ga0068853_100238978 | 3300005539 | Unclassified | 1664 |
| 164 | Ga0068853_101106044 | 3300005539 | Unclassified | 764 |
| 165 | Ga0068853_101453305 | 3300005539 | Unclassified | 663 |
| 166 | Ga0070672_100038083 | 3300005543 | Bacteria | 3672 |
| 167 | Ga0070672_100053878 | 3300005543 | Bacteria | 3147 |
| 168 | Ga0070672_100085207 | 3300005543 | Unclassified | 2539 |
| 169 | Ga0070672_100521502 | 3300005543 | Unclassified | 1029 |
| 170 | Ga0070672_101337984 | 3300005543 | Unclassified | 640 |
| 171 | Ga0070695_100092459 | 3300005545 | Unclassified | 2022 |
| 172 | Ga0070693_100279253 | 3300005547 | Unclassified | 1118 |
| 173 | Ga0070693_100740673 | 3300005547 | Unclassified | 723 |
| 174 | Ga0070665_100029557 | 3300005548 | Bacteria | 5516 |
| 175 | Ga0070665_100106550 | 3300005548 | Bacteria | 2805 |
| 176 | Ga0068855_100039819 | 3300005563 | Bacteria | 5578 |
| 177 | Ga0068855_100159451 | 3300005563 | Unclassified | 2562 |
| 178 | Ga0068855_100238392 | 3300005563 | Bacteria | 2033 |
| 179 | Ga0068855_100396131 | 3300005563 | Unclassified | 1514 |
| 180 | Ga0068855_100541993 | 3300005563 | Unclassified | 1260 |
| 181 | Ga0068855_101921608 | 3300005563 | Bacteria | 599 |
| 182 | Ga0070664_100003107 | 3300005564 | Bacteria | 13428 |
| 183 | Ga0070664_100008604 | 3300005564 | Bacteria | 8257 |
| 184 | Ga0070664_100015317 | 3300005564 | Bacteria | 6270 |
| 185 | Ga0070664_100043360 | 3300005564 | Bacteria | 3796 |
| 186 | Ga0070664_100045426 | 3300005564 | Bacteria | 3709 |
| 187 | Ga0070664_100068067 | 3300005564 | Bacteria | 3044 |
| 188 | Ga0070664_100086955 | 3300005564 | Unclassified | 2701 |
| 189 | Ga0068857_100011886 | 3300005577 | Bacteria | 7573 |
| 190 | Ga0068857_100013634 | 3300005577 | Bacteria | 7082 |
| 191 | Ga0068857_100014309 | 3300005577 | Bacteria | 6914 |
| 192 | Ga0068857_100030380 | 3300005577 | Bacteria | 4771 |
| 193 | Ga0068857_100037809 | 3300005577 | Bacteria | 4276 |
| 194 | Ga0068857_100061266 | 3300005577 | Bacteria | 3343 |
| 195 | Ga0068857_100112427 | 3300005577 | Bacteria | 2448 |
| 196 | Ga0068857_100428261 | 3300005577 | Unclassified | 1234 |
| 197 | Ga0068854_100008247 | 3300005578 | Bacteria | 6689 |
| 198 | Ga0068854_100009638 | 3300005578 | Bacteria | 6236 |
| 199 | Ga0068854_100079478 | 3300005578 | Unclassified | 2418 |
| 200 | Ga0068854_100105987 | 3300005578 | Unclassified | 2114 |
| 201 | Ga0068854_100273088 | 3300005578 | Bacteria | 1358 |
| 202 | Ga0068854_100283110 | 3300005578 | Unclassified | 1336 |
| 203 | Ga0068854_100712687 | 3300005578 | Bacteria | 867 |
| 204 | Ga0068854_102189065 | 3300005578 | Unclassified | 511 |
| 205 | Ga0068856_100004427 | 3300005614 | Bacteria | 13984 |
| 206 | Ga0068856_100025985 | 3300005614 | Bacteria | 5710 |
| 207 | Ga0068856_100043250 | 3300005614 | Bacteria | 4432 |
| 208 | Ga0068856_100092683 | 3300005614 | Bacteria | 3006 |
| 209 | Ga0068852_100029333 | 3300005616 | Bacteria | 4519 |
| 210 | Ga0068852_100117525 | 3300005616 | Bacteria | 2428 |
| 211 | Ga0068852_100333684 | 3300005616 | Bacteria | 1476 |
| 212 | Ga0068852_100373439 | 3300005616 | Bacteria | 1397 |
| 213 | Ga0068852_100554466 | 3300005616 | Bacteria | 1150 |
| 214 | Ga0068852_101010770 | 3300005616 | Unclassified | 850 |
| 215 | Ga0068852_101071807 | 3300005616 | Unclassified | 826 |
| 216 | Ga0068859_100004235 | 3300005617 | Bacteria | 14649 |
| 217 | Ga0068859_100022494 | 3300005617 | Bacteria | 6321 |
| 218 | Ga0068859_100234904 | 3300005617 | Unclassified | 1922 |
| 219 | Ga0068859_100641182 | 3300005617 | Bacteria | 1154 |
| 220 | Ga0068864_100029956 | 3300005618 | Unclassified | 4612 |
| 221 | Ga0068864_100039708 | 3300005618 | Bacteria | 4022 |
| 222 | Ga0068864_100097372 | 3300005618 | Unclassified | 2604 |
| 223 | Ga0068864_101400354 | 3300005618 | Bacteria | 701 |
| 224 | Ga0068861_100261132 | 3300005719 | Bacteria | 1483 |
| 225 | Ga0068861_101690309 | 3300005719 | Bacteria | 626 |
| 226 | Ga0068861_102061703 | 3300005719 | Bacteria | 570 |
| 227 | Ga0068851_10026597 | 3300005834 | Bacteria | 2845 |
| 228 | Ga0068851_10061662 | 3300005834 | Bacteria | 1923 |
| 229 | Ga0068851_10308448 | 3300005834 | Bacteria | 911 |
| 230 | Ga0068870_10902086 | 3300005840 | Unclassified | 624 |
| 231 | Ga0068863_100006933 | 3300005841 | Bacteria | 11105 |
| 232 | Ga0068863_100010745 | 3300005841 | Bacteria | 8883 |
| 233 | Ga0068863_100079788 | 3300005841 | Bacteria | 3099 |
| 234 | Ga0068863_100437991 | 3300005841 | Bacteria | 1281 |
| 235 | Ga0068863_100468018 | 3300005841 | Bacteria | 1238 |
| 236 | Ga0068863_102110033 | 3300005841 | Unclassified | 574 |
| 237 | Ga0068858_100004012 | 3300005842 | Bacteria | 14518 |
| 238 | Ga0068858_100018632 | 3300005842 | Bacteria | 6499 |
| 239 | Ga0068858_100027015 | 3300005842 | Bacteria | 5331 |
| 240 | Ga0068858_100065423 | 3300005842 | Bacteria | 3364 |
| 241 | Ga0068860_100006310 | 3300005843 | Bacteria | 11910 |
| 242 | Ga0068860_100055159 | 3300005843 | Bacteria | 3777 |
| 243 | Ga0068860_100092572 | 3300005843 | Bacteria | 2881 |
| 244 | Ga0068860_100157255 | 3300005843 | Unclassified | 2191 |
| 245 | Ga0068862_100004972 | 3300005844 | Bacteria | 11191 |
| 246 | Ga0068862_100011357 | 3300005844 | Bacteria | 7354 |
| 247 | Ga0068862_100750340 | 3300005844 | Unclassified | 949 |
| 248 | Ga0081540_1304905 | 3300005983 | Unclassified | 547 |
| 249 | Ga0070717_10009496 | 3300006028 | Bacteria | 7314 |
| 250 | Ga0075369_10517425 | 3300006186 | Bacteria | 568 |
| 251 | Ga0075366_10512461 | 3300006195 | Bacteria | 742 |
| 252 | Ga0097621_100002260 | 3300006237 | Bacteria | 13171 |
| 253 | Ga0097621_100739833 | 3300006237 | Bacteria | 908 |
| 254 | Ga0068871_100194221 | 3300006358 | Unclassified | 1750 |
| 255 | Ga0068871_100653729 | 3300006358 | Unclassified | 960 |
| 256 | Ga0075428_100562324 | 3300006844 | Unclassified | 1219 |
| 257 | Ga0075431_101782286 | 3300006847 | Unclassified | 572 |
| 258 | Ga0075434_100330119 | 3300006871 | Unclassified | 1546 |
| 259 | Ga0075429_100880125 | 3300006880 | Unclassified | 784 |
| 260 | Ga0068865_100117195 | 3300006881 | Bacteria | 1974 |
| 261 | Ga0097620_100004235 | 3300006931 | Bacteria | 14649 |
| 262 | Ga0097620_100022494 | 3300006931 | Bacteria | 6321 |
| 263 | Ga0097620_100234878 | 3300006931 | Unclassified | 1922 |
| 264 | Ga0097620_100641185 | 3300006931 | Bacteria | 1154 |
| 265 | Ga0075435_100599049 | 3300007076 | Unclassified | 956 |
| 266 | Ga0105251_10015303 | 3300009011 | Unclassified | 4200 |
| 267 | Ga0105250_10502839 | 3300009092 | Unclassified | 550 |
| 268 | Ga0105240_10023904 | 3300009093 | Bacteria | 8071 |
| 269 | Ga0105245_10114876 | 3300009098 | Bacteria | 2508 |
| 270 | Ga0105245_10255736 | 3300009098 | Bacteria | 1703 |
| 271 | Ga0105247_11408556 | 3300009101 | Unclassified | 564 |
| 272 | Ga0105243_10308782 | 3300009148 | Bacteria | 1436 |
| 273 | Ga0105243_10377173 | 3300009148 | Unclassified | 1311 |
| 274 | Ga0105241_10244250 | 3300009174 | Unclassified | 1519 |
| 275 | Ga0105241_10334066 | 3300009174 | Bacteria | 1311 |
| 276 | Ga0105241_10985064 | 3300009174 | Unclassified | 788 |
| 277 | Ga0105241_11440378 | 3300009174 | Unclassified | 661 |
| 278 | Ga0105242_10011492 | 3300009176 | Bacteria | 6806 |
| 279 | Ga0105248_10012176 | 3300009177 | Bacteria | 9488 |
| 280 | Ga0105248_10044967 | 3300009177 | Unclassified | 4951 |
| 281 | Ga0105248_10110097 | 3300009177 | Unclassified | 3105 |
| 282 | Ga0105248_10207840 | 3300009177 | Bacteria | 2206 |
| 283 | Ga0105248_10845471 | 3300009177 | Unclassified | 1033 |
| 284 | Ga0105237_10016756 | 3300009545 | Bacteria | 7608 |
| 285 | Ga0105237_10066503 | 3300009545 | Unclassified | 3599 |
| 286 | Ga0105237_10116509 | 3300009545 | Bacteria | 2665 |
| 287 | Ga0105238_10007178 | 3300009551 | Bacteria | 11143 |
| 288 | Ga0105249_10024765 | 3300009553 | Bacteria | 5395 |
| 289 | Ga0105249_10034008 | 3300009553 | Bacteria | 4617 |
| 290 | Ga0105249_10505295 | 3300009553 | Unclassified | 1254 |
| 291 | Ga0105239_10050139 | 3300010375 | Bacteria | 4579 |
| 292 | Ga0105239_10806153 | 3300010375 | Bacteria | 1076 |
| 293 | Ga0105239_11886257 | 3300010375 | Bacteria | 693 |
| 294 | Ga0105239_12391736 | 3300010375 | Unclassified | 615 |
| 295 | Ga0105239_12414821 | 3300010375 | Unclassified | 612 |
| 296 | Ga0105246_10047957 | 3300011119 | Bacteria | 2919 |
| 297 | Ga0105246_10476446 | 3300011119 | Unclassified | 1055 |
| 298 | Ga0105246_10595553 | 3300011119 | Unclassified | 954 |
| 299 | Ga0157327_1047241 | 3300012512 | Bacteria | 600 |
| 300 | Ga0157373_10007336 | 3300013100 | Bacteria | 8212 |
| 301 | Ga0157373_10022668 | 3300013100 | Bacteria | 4555 |
| 302 | Ga0157373_10029131 | 3300013100 | Bacteria | 3980 |
| 303 | Ga0157373_10227284 | 3300013100 | Bacteria | 1317 |
| 304 | Ga0157373_10677867 | 3300013100 | Unclassified | 754 |
| 305 | Ga0157373_11114060 | 3300013100 | Bacteria | 593 |
| 306 | Ga0157371_10077341 | 3300013102 | Bacteria | 2356 |
| 307 | Ga0157371_10108652 | 3300013102 | Bacteria | 1968 |
| 308 | Ga0157371_10270757 | 3300013102 | Unclassified | 1226 |
| 309 | Ga0157371_10377051 | 3300013102 | Unclassified | 1035 |
| 310 | Ga0157370_10021821 | 3300013104 | Bacteria | 6378 |
| 311 | Ga0157370_10027504 | 3300013104 | Bacteria | 5608 |
| 312 | Ga0157370_10122073 | 3300013104 | Bacteria | 2433 |
| 313 | Ga0157370_10285642 | 3300013104 | Bacteria | 1524 |
| 314 | Ga0157369_10016388 | 3300013105 | Bacteria | 8337 |
| 315 | Ga0157369_10050844 | 3300013105 | Bacteria | 4486 |
| 316 | Ga0157369_10733591 | 3300013105 | Bacteria | 1017 |
| 317 | Ga0157374_10122784 | 3300013296 | Bacteria | 2508 |
| 318 | Ga0157374_11560643 | 3300013296 | Unclassified | 684 |
| 319 | Ga0163162_10164675 | 3300013306 | Bacteria | 2341 |
| 320 | Ga0163162_10458600 | 3300013306 | Bacteria | 1406 |
| 321 | Ga0163162_10782988 | 3300013306 | Unclassified | 1072 |
| 322 | Ga0163162_11934587 | 3300013306 | Bacteria | 675 |
| 323 | Ga0157372_10069372 | 3300013307 | Bacteria | 3964 |
| 324 | Ga0157372_10119577 | 3300013307 | Bacteria | 3024 |
| 325 | Ga0157372_10131797 | 3300013307 | Bacteria | 2876 |
| 326 | Ga0157372_10371368 | 3300013307 | Unclassified | 1667 |
| 327 | Ga0157372_11123754 | 3300013307 | Bacteria | 909 |
| 328 | Ga0157372_12535076 | 3300013307 | Bacteria | 589 |
| 329 | Ga0157372_13482479 | 3300013307 | Unclassified | 500 |
| 330 | Ga0157375_10049335 | 3300013308 | Bacteria | 4123 |
| 331 | Ga0157375_10401238 | 3300013308 | Bacteria | 1538 |
| 332 | Ga0157375_10620348 | 3300013308 | Bacteria | 1239 |
| 333 | Ga0157375_10640518 | 3300013308 | Bacteria | 1220 |
| 334 | Ga0163163_10009557 | 3300014325 | Bacteria | 8664 |
| 335 | Ga0163163_10065935 | 3300014325 | Unclassified | 3595 |
| 336 | Ga0163163_10273706 | 3300014325 | Bacteria | 1739 |
| 337 | Ga0157380_10543972 | 3300014326 | Bacteria | 1138 |
| 338 | Ga0182008_10015807 | 3300014497 | Unclassified | 3930 |
| 339 | Ga0182008_10427889 | 3300014497 | Unclassified | 716 |
| 340 | Ga0157377_10196732 | 3300014745 | Bacteria | 1277 |
| 341 | Ga0157379_10041754 | 3300014968 | Bacteria | 4094 |
| 342 | Ga0157379_10099770 | 3300014968 | Bacteria | 2607 |
| 343 | Ga0224712_10218980 | 3300022467 | Bacteria | 871 |
| 344 | Ga0207656_10253035 | 3300025321 | Unclassified | 863 |
| 345 | Ga0207656_10469276 | 3300025321 | Bacteria | 637 |
| 346 | Ga0207682_10032938 | 3300025893 | Bacteria | 2084 |
| 347 | Ga0207682_10107479 | 3300025893 | Bacteria | 1225 |
| 348 | Ga0207688_10021924 | 3300025901 | Bacteria | 3493 |
| 349 | Ga0207688_10048322 | 3300025901 | Unclassified | 2377 |
| 350 | Ga0207680_10003921 | 3300025903 | Bacteria | 7020 |
| 351 | Ga0207680_10127623 | 3300025903 | Bacteria | 1672 |
| 352 | Ga0207647_10000910 | 3300025904 | Bacteria | 22876 |
| 353 | Ga0207647_10001423 | 3300025904 | Bacteria | 18343 |
| 354 | Ga0207647_10005982 | 3300025904 | Bacteria | 8862 |
| 355 | Ga0207647_10056077 | 3300025904 | Bacteria | 2418 |
| 356 | Ga0207647_10235766 | 3300025904 | Unclassified | 1052 |
| 357 | Ga0207647_10435397 | 3300025904 | Bacteria | 736 |
| 358 | Ga0207705_10000853 | 3300025909 | Bacteria | 24997 |
| 359 | Ga0207705_10005390 | 3300025909 | Bacteria | 9567 |
| 360 | Ga0207705_10021877 | 3300025909 | Bacteria | 4562 |
| 361 | Ga0207705_10036885 | 3300025909 | Bacteria | 3498 |
| 362 | Ga0207705_10100650 | 3300025909 | Bacteria | 2126 |
| 363 | Ga0207705_10601415 | 3300025909 | Unclassified | 855 |
| 364 | Ga0207654_10606115 | 3300025911 | Bacteria | 782 |
| 365 | Ga0207654_10991711 | 3300025911 | Unclassified | 611 |
| 366 | Ga0207707_10148938 | 3300025912 | Bacteria | 2046 |
| 367 | Ga0207707_10219855 | 3300025912 | Bacteria | 1653 |
| 368 | Ga0207707_10472336 | 3300025912 | Bacteria | 1072 |
| 369 | Ga0207695_10008918 | 3300025913 | Bacteria | 12486 |
| 370 | Ga0207671_10014919 | 3300025914 | Bacteria | 6110 |
| 371 | Ga0207671_10147375 | 3300025914 | Bacteria | 1816 |
| 372 | Ga0207671_11253253 | 3300025914 | Unclassified | 579 |
| 373 | Ga0207660_10005166 | 3300025917 | Bacteria | 8484 |
| 374 | Ga0207660_10008617 | 3300025917 | Bacteria | 6596 |
| 375 | Ga0207660_10606836 | 3300025917 | Unclassified | 891 |
| 376 | Ga0207662_10023904 | 3300025918 | Bacteria | 3514 |
| 377 | Ga0207657_10000962 | 3300025919 | Bacteria | 30503 |
| 378 | Ga0207657_10005030 | 3300025919 | Bacteria | 13871 |
| 379 | Ga0207657_10008887 | 3300025919 | Bacteria | 10163 |
| 380 | Ga0207657_10017773 | 3300025919 | Bacteria | 6808 |
| 381 | Ga0207657_10025608 | 3300025919 | Bacteria | 5435 |
| 382 | Ga0207657_10082361 | 3300025919 | Bacteria | 2701 |
| 383 | Ga0207657_10103321 | 3300025919 | Bacteria | 2362 |
| 384 | Ga0207657_10282627 | 3300025919 | Unclassified | 1317 |
| 385 | Ga0207657_10364155 | 3300025919 | Bacteria | 1139 |
| 386 | Ga0207657_10490350 | 3300025919 | Bacteria | 963 |
| 387 | Ga0207657_10955238 | 3300025919 | Bacteria | 659 |
| 388 | Ga0207649_10001843 | 3300025920 | Bacteria | 12115 |
| 389 | Ga0207649_10047888 | 3300025920 | Bacteria | 2634 |
| 390 | Ga0207649_10071095 | 3300025920 | Bacteria | 2221 |
| 391 | Ga0207649_10177284 | 3300025920 | Bacteria | 1489 |
| 392 | Ga0207649_10203031 | 3300025920 | Bacteria | 1401 |
| 393 | Ga0207649_10243771 | 3300025920 | Bacteria | 1291 |
| 394 | Ga0207649_10288567 | 3300025920 | Bacteria | 1196 |
| 395 | Ga0207649_10655660 | 3300025920 | Unclassified | 811 |
| 396 | Ga0207649_10874786 | 3300025920 | Bacteria | 704 |
| 397 | Ga0207652_10001100 | 3300025921 | Bacteria | 24430 |
| 398 | Ga0207652_10068224 | 3300025921 | Bacteria | 3085 |
| 399 | Ga0207652_10191918 | 3300025921 | Bacteria | 1837 |
| 400 | Ga0207652_11122857 | 3300025921 | Unclassified | 687 |
| 401 | Ga0207681_10352460 | 3300025923 | Unclassified | 1178 |
| 402 | Ga0207681_10540932 | 3300025923 | Bacteria | 958 |
| 403 | Ga0207681_11097026 | 3300025923 | Unclassified | 668 |
| 404 | Ga0207694_10005672 | 3300025924 | Bacteria | 9577 |
| 405 | Ga0207650_10208074 | 3300025925 | Bacteria | 1570 |
| 406 | Ga0207650_10236767 | 3300025925 | Bacteria | 1474 |
| 407 | Ga0207650_10302049 | 3300025925 | Bacteria | 1307 |
| 408 | Ga0207659_10079422 | 3300025926 | Bacteria | 2421 |
| 409 | Ga0207659_10762900 | 3300025926 | Bacteria | 830 |
| 410 | Ga0207659_10825668 | 3300025926 | Bacteria | 796 |
| 411 | Ga0207687_10077207 | 3300025927 | Unclassified | 2395 |
| 412 | Ga0207664_10624136 | 3300025929 | Unclassified | 968 |
| 413 | Ga0207644_10035225 | 3300025931 | Bacteria | 3505 |
| 414 | Ga0207644_10035438 | 3300025931 | Unclassified | 3496 |
| 415 | Ga0207644_10040022 | 3300025931 | Bacteria | 3311 |
| 416 | Ga0207644_10267414 | 3300025931 | Bacteria | 1369 |
| 417 | Ga0207644_10304955 | 3300025931 | Bacteria | 1284 |
| 418 | Ga0207644_10579374 | 3300025931 | Unclassified | 930 |
| 419 | Ga0207644_10621336 | 3300025931 | Bacteria | 898 |
| 420 | Ga0207644_10899196 | 3300025931 | Bacteria | 742 |
| 421 | Ga0207690_10002177 | 3300025932 | Bacteria | 11948 |
| 422 | Ga0207690_10009048 | 3300025932 | Bacteria | 5911 |
| 423 | Ga0207690_10010356 | 3300025932 | Bacteria | 5537 |
| 424 | Ga0207690_10023439 | 3300025932 | Bacteria | 3851 |
| 425 | Ga0207690_10046744 | 3300025932 | Bacteria | 2868 |
| 426 | Ga0207690_10110327 | 3300025932 | Bacteria | 1980 |
| 427 | Ga0207690_10122837 | 3300025932 | Unclassified | 1889 |
| 428 | Ga0207690_10180910 | 3300025932 | Bacteria | 1587 |
| 429 | Ga0207690_10236175 | 3300025932 | Bacteria | 1406 |
| 430 | Ga0207690_10514499 | 3300025932 | Bacteria | 969 |
| 431 | Ga0207690_10585582 | 3300025932 | Bacteria | 910 |
| 432 | Ga0207690_10890930 | 3300025932 | Bacteria | 738 |
| 433 | Ga0207706_10001681 | 3300025933 | Bacteria | 21822 |
| 434 | Ga0207706_10016868 | 3300025933 | Bacteria | 6588 |
| 435 | Ga0207706_10035222 | 3300025933 | Bacteria | 4452 |
| 436 | Ga0207706_10035849 | 3300025933 | Bacteria | 4408 |
| 437 | Ga0207706_10036821 | 3300025933 | Bacteria | 4346 |
| 438 | Ga0207706_10206695 | 3300025933 | Unclassified | 1721 |
| 439 | Ga0207706_10730880 | 3300025933 | Bacteria | 844 |
| 440 | Ga0207706_10734883 | 3300025933 | Bacteria | 842 |
| 441 | Ga0207706_10921953 | 3300025933 | Unclassified | 737 |
| 442 | Ga0207686_10024015 | 3300025934 | Unclassified | 3526 |
| 443 | Ga0207709_10175537 | 3300025935 | Unclassified | 1508 |
| 444 | Ga0207670_10136030 | 3300025936 | Bacteria | 1806 |
| 445 | Ga0207670_11711529 | 3300025936 | Unclassified | 535 |
| 446 | Ga0207669_10032702 | 3300025937 | Bacteria | 2925 |
| 447 | Ga0207669_10202498 | 3300025937 | Unclassified | 1442 |
| 448 | Ga0207669_11045954 | 3300025937 | Unclassified | 687 |
| 449 | Ga0207704_10782533 | 3300025938 | Unclassified | 796 |
| 450 | Ga0207665_10261566 | 3300025939 | Unclassified | 1282 |
| 451 | Ga0207691_10028017 | 3300025940 | Bacteria | 5278 |
| 452 | Ga0207691_10054881 | 3300025940 | Bacteria | 3634 |
| 453 | Ga0207691_10057901 | 3300025940 | Bacteria | 3526 |
| 454 | Ga0207691_11403634 | 3300025940 | Unclassified | 574 |
| 455 | Ga0207711_10008511 | 3300025941 | Bacteria | 8582 |
| 456 | Ga0207711_10184390 | 3300025941 | Bacteria | 1899 |
| 457 | Ga0207711_10250351 | 3300025941 | Bacteria | 1627 |
| 458 | Ga0207689_10003104 | 3300025942 | Bacteria | 15265 |
| 459 | Ga0207689_10258486 | 3300025942 | Bacteria | 1441 |
| 460 | Ga0207689_10410381 | 3300025942 | Bacteria | 1129 |
| 461 | Ga0207689_11123487 | 3300025942 | Bacteria | 662 |
| 462 | Ga0207661_10023786 | 3300025944 | Bacteria | 4634 |
| 463 | Ga0207679_10006355 | 3300025945 | Bacteria | 7468 |
| 464 | Ga0207679_10010430 | 3300025945 | Bacteria | 5982 |
| 465 | Ga0207679_10018949 | 3300025945 | Bacteria | 4618 |
| 466 | Ga0207679_10029504 | 3300025945 | Bacteria | 3820 |
| 467 | Ga0207679_10091656 | 3300025945 | Bacteria | 2352 |
| 468 | Ga0207679_10139243 | 3300025945 | Unclassified | 1959 |
| 469 | Ga0207667_10004508 | 3300025949 | Bacteria | 17062 |
| 470 | Ga0207667_10007822 | 3300025949 | Bacteria | 12775 |
| 471 | Ga0207667_10020852 | 3300025949 | Bacteria | 7277 |
| 472 | Ga0207667_10097564 | 3300025949 | Bacteria | 3033 |
| 473 | Ga0207667_11815955 | 3300025949 | Bacteria | 573 |
| 474 | Ga0207651_10110575 | 3300025960 | Bacteria | 2062 |
| 475 | Ga0207651_10325327 | 3300025960 | Bacteria | 1286 |
| 476 | Ga0207651_10339234 | 3300025960 | Bacteria | 1262 |
| 477 | Ga0207651_10984731 | 3300025960 | Unclassified | 753 |
| 478 | Ga0207712_10001181 | 3300025961 | Bacteria | 18076 |
| 479 | Ga0207712_11413752 | 3300025961 | Bacteria | 623 |
| 480 | Ga0207668_10073861 | 3300025972 | Bacteria | 2445 |
| 481 | Ga0207640_10002781 | 3300025981 | Bacteria | 9378 |
| 482 | Ga0207640_10014468 | 3300025981 | Bacteria | 4545 |
| 483 | Ga0207640_10134994 | 3300025981 | Bacteria | 1790 |
| 484 | Ga0207640_10493061 | 3300025981 | Bacteria | 1018 |
| 485 | Ga0207640_10790105 | 3300025981 | Unclassified | 821 |
| 486 | Ga0207640_10848610 | 3300025981 | Unclassified | 795 |
| 487 | Ga0207640_11562658 | 3300025981 | Unclassified | 594 |
| 488 | Ga0207658_10049889 | 3300025986 | Bacteria | 3077 |
| 489 | Ga0207658_10065477 | 3300025986 | Bacteria | 2729 |
| 490 | Ga0207658_10153755 | 3300025986 | Unclassified | 1877 |
| 491 | Ga0207658_10436121 | 3300025986 | Unclassified | 1158 |
| 492 | Ga0207658_11422049 | 3300025986 | Unclassified | 634 |
| 493 | Ga0207677_10096497 | 3300026023 | Bacteria | 2163 |
| 494 | Ga0207677_10709019 | 3300026023 | Bacteria | 893 |
| 495 | Ga0207677_11627085 | 3300026023 | Unclassified | 598 |
| 496 | Ga0207703_10011955 | 3300026035 | Bacteria | 6762 |
| 497 | Ga0207703_10028182 | 3300026035 | Bacteria | 4425 |
| 498 | Ga0207639_10019533 | 3300026041 | Bacteria | 4835 |
| 499 | Ga0207639_10026995 | 3300026041 | Bacteria | 4177 |
| 500 | Ga0207639_10206250 | 3300026041 | Bacteria | 1689 |
| 501 | Ga0207639_10582942 | 3300026041 | Bacteria | 1030 |
| 502 | Ga0207678_10002042 | 3300026067 | Bacteria | 18312 |
| 503 | Ga0207678_10002194 | 3300026067 | Bacteria | 17632 |
| 504 | Ga0207678_10003505 | 3300026067 | Bacteria | 14109 |
| 505 | Ga0207678_10040809 | 3300026067 | Bacteria | 4023 |
| 506 | Ga0207678_10179021 | 3300026067 | Bacteria | 1810 |
| 507 | Ga0207678_10205233 | 3300026067 | Bacteria | 1686 |
| 508 | Ga0207678_10242683 | 3300026067 | Bacteria | 1543 |
| 509 | Ga0207678_10248894 | 3300026067 | Bacteria | 1522 |
| 510 | Ga0207702_10018149 | 3300026078 | Bacteria | 5821 |
| 511 | Ga0207641_10031504 | 3300026088 | Bacteria | 4398 |
| 512 | Ga0207641_10031686 | 3300026088 | Bacteria | 4385 |
| 513 | Ga0207641_10054196 | 3300026088 | Bacteria | 3402 |
| 514 | Ga0207641_10133802 | 3300026088 | Bacteria | 2229 |
| 515 | Ga0207641_10463989 | 3300026088 | Bacteria | 1225 |
| 516 | Ga0207641_10547504 | 3300026088 | Unclassified | 1128 |
| 517 | Ga0207648_10202586 | 3300026089 | Bacteria | 1760 |
| 518 | Ga0207648_11048889 | 3300026089 | Bacteria | 764 |
| 519 | Ga0207676_10021105 | 3300026095 | Bacteria | 4775 |
| 520 | Ga0207676_10189029 | 3300026095 | Bacteria | 1810 |
| 521 | Ga0207676_10289594 | 3300026095 | Bacteria | 1490 |
| 522 | Ga0207676_10912135 | 3300026095 | Bacteria | 862 |
| 523 | Ga0207676_11070284 | 3300026095 | Unclassified | 796 |
| 524 | Ga0207674_10000151 | 3300026116 | Bacteria | 81529 |
| 525 | Ga0207674_10000410 | 3300026116 | Bacteria | 55768 |
| 526 | Ga0207674_10003707 | 3300026116 | Bacteria | 18662 |
| 527 | Ga0207674_10017187 | 3300026116 | Bacteria | 7893 |
| 528 | Ga0207674_10028333 | 3300026116 | Bacteria | 5913 |
| 529 | Ga0207674_10137143 | 3300026116 | Bacteria | 2408 |
| 530 | Ga0207674_10314836 | 3300026116 | Bacteria | 1514 |
| 531 | Ga0207674_10551206 | 3300026116 | Bacteria | 1114 |
| 532 | Ga0207675_100277227 | 3300026118 | Bacteria | 1628 |
| 533 | Ga0207675_101206675 | 3300026118 | Bacteria | 777 |
| 534 | Ga0207683_10197429 | 3300026121 | Bacteria | 1828 |
| 535 | Ga0207683_10952870 | 3300026121 | Unclassified | 797 |
| 536 | Ga0207698_10004072 | 3300026142 | Bacteria | 8873 |
| 537 | Ga0207698_10023373 | 3300026142 | Unclassified | 4317 |
| 538 | Ga0207698_10048265 | 3300026142 | Bacteria | 3231 |
| 539 | Ga0207698_10234064 | 3300026142 | Bacteria | 1669 |
| 540 | Ga0207698_10508412 | 3300026142 | Bacteria | 1174 |
| 541 | Ga0207698_10966677 | 3300026142 | Bacteria | 861 |
| 542 | Ga0207698_11685858 | 3300026142 | Bacteria | 649 |
| 543 | Ga0268266_10030954 | 3300028379 | Bacteria | 4544 |
| 544 | Ga0268266_10038372 | 3300028379 | Bacteria | 4078 |
| 545 | Ga0268265_10057807 | 3300028380 | Bacteria | 2958 |
| 546 | Ga0268265_10253782 | 3300028380 | Bacteria | 1559 |
| 547 | Ga0268265_10301237 | 3300028380 | Bacteria | 1443 |
| 548 | Ga0268265_10998793 | 3300028380 | Unclassified | 826 |
| 549 | Ga0268264_10049087 | 3300028381 | Bacteria | 3510 |
| 550 | Ga0268264_10273068 | 3300028381 | Unclassified | 1580 |
| 551 | Ga0268264_10649741 | 3300028381 | Bacteria | 1044 |
| 552 | Ga0307513_10353201 | 3300031456 | Bacteria | 1217 |
| 553 | Ga0307408_100326265 | 3300031548 | Bacteria | 1295 |
| 554 | Ga0307408_100840450 | 3300031548 | Bacteria | 836 |
| 555 | Ga0307408_102415430 | 3300031548 | Unclassified | 510 |
| 556 | Ga0307405_10040033 | 3300031731 | Bacteria | 2836 |
| 557 | Ga0307413_10121324 | 3300031824 | Bacteria | 1771 |
| 558 | Ga0307413_10128200 | 3300031824 | Bacteria | 1731 |
| 559 | Ga0307410_10290792 | 3300031852 | Bacteria | 1286 |
| 560 | Ga0307410_11417799 | 3300031852 | Unclassified | 610 |
| 561 | Ga0307406_10079831 | 3300031901 | Bacteria | 2171 |
| 562 | Ga0307406_10199142 | 3300031901 | Bacteria | 1472 |
| 563 | Ga0307406_10388123 | 3300031901 | Bacteria | 1103 |
| 564 | Ga0307412_10093856 | 3300031911 | Bacteria | 2106 |
| 565 | Ga0307409_100018161 | 3300031995 | Bacteria | 4715 |
| 566 | Ga0307409_100840066 | 3300031995 | Bacteria | 928 |
| 567 | Ga0307409_100964229 | 3300031995 | Unclassified | 869 |
| 568 | Ga0307416_100054970 | 3300032002 | Bacteria | 3203 |
| 569 | Ga0307416_100710272 | 3300032002 | Bacteria | 1095 |
| 570 | Ga0307416_100886603 | 3300032002 | Bacteria | 991 |
| 571 | Ga0307414_10165794 | 3300032004 | Bacteria | 1760 |
| 572 | Ga0307411_10123468 | 3300032005 | Bacteria | 1878 |
| 573 | Ga0307411_10443911 | 3300032005 | Bacteria | 1083 |
| 574 | Ga0307411_10883957 | 3300032005 | Bacteria | 793 |
| 575 | Ga0307415_100007613 | 3300032126 | Bacteria | 5937 |
| 576 | Ga0307415_100589868 | 3300032126 | Unclassified | 987 |
| 577 | Ga0373941_0334621 | 3300035115 | Unclassified | 612 |
| 578 | Ga0373931_0304457 | 3300035691 | Bacteria | 985 |
| 579 | Ga0395899_0001165 | 3300037312 | Bacteria | 23226 |
| 580 | Ga0395899_0002476 | 3300037312 | Bacteria | 14982 |
| 581 | Ga0395899_0010292 | 3300037312 | Bacteria | 7170 |
| 582 | Ga0395899_0010948 | 3300037312 | Bacteria | 6949 |
| 583 | Ga0395899_0061872 | 3300037312 | Bacteria | 2757 |
| 584 | Ga0395899_0069989 | 3300037312 | Bacteria | 2568 |
| 585 | Ga0395899_0139182 | 3300037312 | Bacteria | 1728 |
| 586 | Ga0395899_0289756 | 3300037312 | Unclassified | 1111 |
| 587 | Ga0395899_0295507 | 3300037312 | Unclassified | 1098 |
| 588 | Ga0395899_0342913 | 3300037312 | Unclassified | 1001 |
| 589 | Ga0395899_0454743 | 3300037312 | Unclassified | 838 |
| 590 | Ga0395900_0002233 | 3300037418 | Bacteria | 21590 |
| 591 | Ga0395900_0003176 | 3300037418 | Bacteria | 17816 |
| 592 | Ga0395900_0018282 | 3300037418 | Bacteria | 7151 |
| 593 | Ga0395900_0031690 | 3300037418 | Bacteria | 5434 |
| 594 | Ga0395900_0038945 | 3300037418 | Bacteria | 4900 |
| 595 | Ga0395900_0039272 | 3300037418 | Bacteria | 4876 |
| 596 | Ga0395900_0046747 | 3300037418 | Bacteria | 4456 |
| 597 | Ga0395900_0088446 | 3300037418 | Bacteria | 3184 |
| 598 | Ga0395900_0102203 | 3300037418 | Bacteria | 2945 |
| 599 | Ga0395900_0126713 | 3300037418 | Bacteria | 2619 |
| 600 | Ga0395900_0129338 | 3300037418 | Bacteria | 2588 |
| 601 | Ga0395900_0142048 | 3300037418 | Unclassified | 2458 |
| 602 | Ga0395900_0164404 | 3300037418 | Bacteria | 2262 |
| 603 | Ga0395900_0219630 | 3300037418 | Bacteria | 1916 |
| 604 | Ga0395900_0375719 | 3300037418 | Unclassified | 1390 |
| 605 | Ga0395900_0387219 | 3300037418 | Bacteria | 1365 |
| 606 | Ga0395900_0512787 | 3300037418 | Unclassified | 1148 |
| 607 | Ga0395900_0620871 | 3300037418 | Bacteria | 1020 |
| 608 | Ga0395900_0683220 | 3300037418 | Unclassified | 961 |
| 609 | Ga0395900_0759567 | 3300037418 | Bacteria | 899 |
| 610 | Ga0395900_1229477 | 3300037418 | Bacteria | 664 |
| 611 | Ga0395900_1425491 | 3300037418 | Bacteria | 605 |
| 612 | Ga0395900_1577484 | 3300037418 | Unclassified | 568 |
| 613 | Ga0395898_0004873 | 3300037466 | Bacteria | 14574 |
| 614 | Ga0395898_0010099 | 3300037466 | Bacteria | 9879 |
| 615 | Ga0395898_0027301 | 3300037466 | Bacteria | 5733 |
| 616 | Ga0395898_0049776 | 3300037466 | Bacteria | 4105 |
| 617 | Ga0395898_0264466 | 3300037466 | Bacteria | 1640 |
| 618 | Ga0395898_0282755 | 3300037466 | Bacteria | 1582 |
| 619 | Ga0395898_0314351 | 3300037466 | Bacteria | 1494 |
| 620 | Ga0395898_0496903 | 3300037466 | Bacteria | 1160 |
| 621 | Ga0395898_0609267 | 3300037466 | Bacteria | 1035 |
| 622 | Ga0395898_1356200 | 3300037466 | Bacteria | 640 |
| 623 | Ga0395898_1765788 | 3300037466 | Unclassified | 540 |
| 624 | Ga0395905_0001302 | 3300037471 | Bacteria | 30624 |
| 625 | Ga0395905_0003014 | 3300037471 | Bacteria | 18246 |
| 626 | Ga0395905_0007273 | 3300037471 | Bacteria | 11034 |
| 627 | Ga0395905_0013236 | 3300037471 | Bacteria | 7915 |
| 628 | Ga0395905_0014464 | 3300037471 | Bacteria | 7533 |
| 629 | Ga0395905_0015273 | 3300037471 | Bacteria | 7301 |
| 630 | Ga0395905_0023506 | 3300037471 | Bacteria | 5823 |
| 631 | Ga0395905_0025264 | 3300037471 | Bacteria | 5602 |
| 632 | Ga0395905_0029822 | 3300037471 | Bacteria | 5142 |
| 633 | Ga0395905_0034865 | 3300037471 | Bacteria | 4724 |
| 634 | Ga0395905_0035249 | 3300037471 | Bacteria | 4698 |
| 635 | Ga0395905_0035324 | 3300037471 | Bacteria | 4693 |
| 636 | Ga0395905_0046811 | 3300037471 | Bacteria | 4055 |
| 637 | Ga0395905_0048894 | 3300037471 | Bacteria | 3962 |
| 638 | Ga0395905_0053046 | 3300037471 | Bacteria | 3796 |
| 639 | Ga0395905_0058065 | 3300037471 | Unclassified | 3619 |
| 640 | Ga0395905_0071538 | 3300037471 | Bacteria | 3251 |
| 641 | Ga0395905_0107941 | 3300037471 | Bacteria | 2613 |
| 642 | Ga0395905_0112597 | 3300037471 | Bacteria | 2556 |
| 643 | Ga0395905_0132355 | 3300037471 | Bacteria | 2346 |
| 644 | Ga0395905_0168113 | 3300037471 | Bacteria | 2060 |
| 645 | Ga0395905_0238235 | 3300037471 | Bacteria | 1701 |
| 646 | Ga0395905_0292331 | 3300037471 | Bacteria | 1516 |
| 647 | Ga0395905_0293832 | 3300037471 | Bacteria | 1512 |
| 648 | Ga0395905_0449700 | 3300037471 | Unclassified | 1186 |
| 649 | Ga0395905_0775400 | 3300037471 | Bacteria | 862 |
| 650 | Ga0395905_0997467 | 3300037471 | Unclassified | 740 |
| 651 | Ga0395905_1055491 | 3300037471 | Bacteria | 715 |
| 652 | Ga0395905_1076743 | 3300037471 | Unclassified | 707 |
| 653 | Ga0395905_1543476 | 3300037471 | Unclassified | 569 |
| 654 | Ga0395905_1788106 | 3300037471 | Unclassified | 520 |
| 655 | Ga0395901_0010449 | 3300038443 | Bacteria | 9403 |
| 656 | Ga0395901_0019891 | 3300038443 | Bacteria | 6869 |
| 657 | Ga0395901_0025745 | 3300038443 | Bacteria | 6040 |
| 658 | Ga0395901_0029136 | 3300038443 | Bacteria | 5681 |
| 659 | Ga0395901_0035592 | 3300038443 | Bacteria | 5144 |
| 660 | Ga0395901_0038033 | 3300038443 | Bacteria | 4977 |
| 661 | Ga0395901_0119354 | 3300038443 | Bacteria | 2771 |
| 662 | Ga0395901_0133372 | 3300038443 | Bacteria | 2610 |
| 663 | Ga0395901_0139054 | 3300038443 | Bacteria | 2552 |
| 664 | Ga0395901_0151256 | 3300038443 | Bacteria | 2439 |
| 665 | Ga0395901_0175417 | 3300038443 | Bacteria | 2248 |
| 666 | Ga0395901_0187948 | 3300038443 | Bacteria | 2166 |
| 667 | Ga0395901_0381138 | 3300038443 | Bacteria | 1451 |
| 668 | Ga0395901_0542401 | 3300038443 | Unclassified | 1179 |
| 669 | Ga0395901_0997827 | 3300038443 | Unclassified | 813 |
| 670 | Ga0395901_1147400 | 3300038443 | Bacteria | 745 |
| 671 | Ga0395901_1268186 | 3300038443 | Bacteria | 700 |
| 672 | Ga0395901_1356926 | 3300038443 | Bacteria | 671 |
| 673 | Ga0395901_1535380 | 3300038443 | Bacteria | 621 |
| 674 | Ga0395901_1775458 | 3300038443 | Unclassified | 566 |
| 675 | Ga0436365_0986541 | 3300039437 | Bacteria | 20562 |
| 676 | Ga0436363_1629466 | 3300039450 | Unclassified | 846 |
| 677 | Ga0439447_118632 | 3300041407 | Bacteria | 607 |
| 678 | Ga0439465_0083785 | 3300041413 | Bacteria | 1084 |
| 679 | Ga0439432_045879 | 3300042006 | Bacteria | 1374 |
| 680 | Ga0439449_0036781 | 3300042007 | Bacteria | 1821 |
| 681 | Ga0439455_0040748 | 3300042012 | Unclassified | 1188 |
| 682 | Ga0439458_0000044 | 3300042157 | Bacteria | 20076 |
| 683 | Ga0439458_0001191 | 3300042157 | Bacteria | 6615 |
| 684 | Ga0439459_0219257 | 3300042438 | Bacteria | 526 |
| 685 | Ga0439464_0000895 | 3300042439 | Bacteria | 6655 |
| 686 | Ga0466969_0004255 | 3300044656 | Bacteria | 7609 |
| 687 | Ga0466965_0438785 | 3300044683 | Bacteria | 726 |
| 688 | Ga0466966_0046173 | 3300044684 | Bacteria | 2782 |
| 689 | Ga0466961_0037700 | 3300044693 | Bacteria | 3101 |
| 690 | Ga0466963_0133998 | 3300044694 | Unclassified | 1713 |
| 691 | Ga0466963_1132299 | 3300044694 | Unclassified | 550 |
| 692 | Ga0466971_0047123 | 3300044719 | Unclassified | 1937 |
| 693 | Ga0466970_0147751 | 3300044765 | Bacteria | 1297 |
| 694 | Ga0466957_0040787 | 3300044842 | Bacteria | 2805 |
| 695 | Ga0466957_0145544 | 3300044842 | Bacteria | 1529 |
| 696 | Ga0466957_0271221 | 3300044842 | Bacteria | 1133 |
| 697 | Ga0466959_0365286 | 3300045049 | Unclassified | 983 |
| 698 | Ga0466958_0521928 | 3300045836 | Bacteria | 771 |
| 699 | Ga0466967_0011818 | 3300045976 | Bacteria | 6639 |
| 700 | Ga0466967_0094538 | 3300045976 | Plasmid | 2722 |
| 701 | Ga0466967_0403564 | 3300045976 | Unclassified | 1330 |
| 702 | Ga0466967_0620856 | 3300045976 | Unclassified | 1068 |
| 703 | Ga0466967_1512886 | 3300045976 | Bacteria | 668 |
| 704 | Ga0495584_0656414 | 3300046491 | Unclassified | 535 |
| 705 | Ga0495633_0149962 | 3300046558 | Unclassified | 1077 |
| 706 | Ga0495669_0161656 | 3300046684 | Bacteria | 1063 |
| 707 | Ga0495669_0224553 | 3300046684 | Bacteria | 900 |
| 708 | Ga0495669_0340980 | 3300046684 | Unclassified | 724 |
| 709 | Ga0495670_0630852 | 3300046691 | Unclassified | 584 |
| 710 | Ga0495677_0304378 | 3300047445 | Bacteria | 627 |
| 711 | Ga0496100_1123886 | 3300048903 | Unclassified | 619 |
| 712 | Ga0496101_0223388 | 3300048904 | Unclassified | 1462 |
| 713 | Ga0496101_0848583 | 3300048904 | Unclassified | 720 |
| 714 | Ga0496102_0078330 | 3300048905 | Unclassified | 3042 |
| 715 | Ga0496102_0663104 | 3300048905 | Unclassified | 966 |
| 716 | Ga0496102_1826272 | 3300048905 | Unclassified | 525 |
| 717 | Ga0496103_0239014 | 3300048906 | Bacteria | 1168 |
| 718 | Ga0496104_0180909 | 3300048907 | Unclassified | 2019 |
| 719 | Ga0496104_1460378 | 3300048907 | Unclassified | 587 |
| 720 | Ga0496105_0087574 | 3300048908 | Unclassified | 2573 |
| 721 | Ga0496106_0083251 | 3300048909 | Unclassified | 2460 |
| 722 | Ga0496106_0828848 | 3300048909 | Unclassified | 733 |
| 723 | Ga0496107_0020104 | 3300048910 | Bacteria | 4715 |
| 724 | Ga0496107_0908296 | 3300048910 | Unclassified | 642 |
| 725 | Ga0496108_0006067 | 3300048911 | Bacteria | 9772 |
| 726 | Ga0496109_0015360 | 3300048912 | Bacteria | 6670 |
| 727 | Ga0496109_0369814 | 3300048912 | Bacteria | 1354 |
| 728 | Ga0496110_0015740 | 3300048913 | Bacteria | 6302 |
| 729 | Ga0496110_0347880 | 3300048913 | Unclassified | 1350 |
| 730 | Ga0496110_0371396 | 3300048913 | Bacteria | 1303 |
| 731 | Ga0496110_0400112 | 3300048913 | Unclassified | 1252 |
| 732 | Ga0496110_1371982 | 3300048913 | Unclassified | 616 |
| 733 | Ga0496111_0002395 | 3300048914 | Bacteria | 11304 |
| 734 | Ga0496112_0111779 | 3300048915 | Unclassified | 2701 |
| 735 | Ga0496112_0226194 | 3300048915 | Bacteria | 1826 |
| 736 | Ga0496112_1148888 | 3300048915 | Unclassified | 694 |
| 737 | Ga0496113_0000705 | 3300048916 | Bacteria | 17089 |
| 738 | Ga0496113_0090326 | 3300048916 | Bacteria | 2359 |
| 739 | Ga0501067_0011658 | 3300049583 | Bacteria | 4869 |
| 740 | Ga0501067_0052413 | 3300049583 | Bacteria | 2261 |
| 741 | Ga0501068_0436233 | 3300049584 | Unclassified | 847 |
| 742 | Ga0501071_0075239 | 3300049587 | Unclassified | 2465 |
| 743 | Ga0501201_038254 | 3300049651 | Bacteria | 569 |
| 744 | Ga0501202_176554 | 3300049652 | Unclassified | 574 |
| 745 | Ga0501216_061818 | 3300049660 | Bacteria | 757 |
| 746 | Ga0501217_037859 | 3300049661 | Bacteria | 1216 |
| 747 | Ga0501223_023733 | 3300049663 | Bacteria | 1195 |
| 748 | Ga0501233_038509 | 3300049668 | Bacteria | 1114 |
| 749 | Ga0501235_171441 | 3300049669 | Bacteria | 573 |
| 750 | Ga0501240_021790 | 3300049673 | Bacteria | 971 |
| 751 | Ga0501242_008440 | 3300049674 | Bacteria | 1205 |
| 752 | Ga0501243_051401 | 3300049675 | Unclassified | 745 |
| 753 | Ga0501248_037463 | 3300049678 | Bacteria | 580 |
| 754 | Ga0501249_084455 | 3300049679 | Bacteria | 749 |
| 755 | Ga0501234_006733 | 3300049707 | Bacteria | 1797 |
| 756 | Ga0501245_036012 | 3300049708 | Bacteria | 835 |
| 757 | Ga0501268_001972 | 3300049765 | Bacteria | 2637 |
| 758 | Ga0501273_000968 | 3300049770 | Bacteria | 2567 |
| 759 | nmdc:mga0k408_761468_c1 | 3300050493 | Unclassified | 565 |
| 760 | nmdc:mga09592_742486_c1 | 3300050508 | Unclassified | 833 |
| 761 | nmdc:mga0qj67_172027_c1 | 3300050509 | Bacteria | 1759 |
| 762 | nmdc:mga06r32_232233_c1 | 3300050510 | Bacteria | 1832 |
| 763 | nmdc:mga0rr50_556457_c1 | 3300050513 | Unclassified | 977 |
| 764 | nmdc:mga0rr50_801870_c1 | 3300050513 | Unclassified | 803 |
| 765 | nmdc:mga0a205_1007_c1 | 3300050515 | Bacteria | 23371 |
| 766 | nmdc:mga0sz30_465739_c1 | 3300050516 | Bacteria | 568 |
| 767 | Ga0587073_0310087 | 3300059492 | Unclassified | 517 |
| 768 | Ga0466962_0014061 | 3300061719 | Bacteria | 3855 |
| 769 | Ga0213876_10001423 | |||
| 770 | JGI24736J21556_1030298 | |||
| 771 | JGI24741J21665_1008559 | |||
| 772 | JGI24741J21665_1021003 | |||
| 773 | JGI24752J21851_1007996 | |||
| 774 | JGI24740J21852_10001875 | |||
| 775 | JGI24740J21852_10002541 | |||
| 776 | JGI24740J21852_10016406 | |||
| 777 | JGI24739J22299_10000368 | |||
| 778 | JGI24739J22299_10066850 | |||
| 779 | JGI24737J22298_10000529 | |||
| 780 | JGI24737J22298_10000723 | |||
| 781 | JGI24737J22298_10011722 | |||
| 782 | JGI24737J22298_10018837 | |||
| 783 | JGI24743J22301_10000217 | |||
| 784 | JGI24735J21928_10009535 | |||
| 785 | JGI24735J21928_10032002 | |||
| 786 | JGI24735J21928_10050993 | |||
| 787 | JGI24735J21928_10056802 | |||
| 788 | JGI24735J21928_10092777 | |||
| 789 | JGI24738J21930_10005571 | |||
| 790 | rootH2_10130912 | |||
| 791 | rootH1_10001288 | |||
| 792 | Ga0065712_10099318 | |||
| 793 | Ga0065712_10478642 | |||
| 794 | Ga0065715_10535615 | |||
| 795 | Ga0070658_10006977 | |||
| 796 | Ga0070658_10015670 | |||
| 797 | Ga0070658_10049131 | |||
| 798 | Ga0070658_10049902 | |||
| 799 | Ga0070658_10071696 | |||
| 800 | Ga0070658_10140484 | |||
| 801 | Ga0070658_10325955 | |||
| 802 | Ga0070658_11734371 | |||
| 803 | Ga0070676_10317327 | |||
| 804 | Ga0070683_100004703 | |||
| 805 | Ga0070683_100015584 | |||
| 806 | Ga0070683_100109802 | |||
| 807 | Ga0070690_100551506 | |||
| 808 | Ga0070670_100027668 | |||
| 809 | Ga0070670_100040725 | |||
| 810 | Ga0070670_100086741 | |||
| 811 | Ga0070670_100205569 | |||
| 812 | Ga0070677_10016684 | |||
| 813 | Ga0070677_10055228 | |||
| 814 | Ga0068869_100064659 | |||
| 815 | Ga0068869_100506831 | |||
| 816 | Ga0068869_100680076 | |||
| 817 | Ga0068869_100997926 | |||
| 818 | Ga0070666_10031902 | |||
| 819 | Ga0070666_10172973 | |||
| 820 | Ga0070680_100000845 | |||
| 821 | Ga0070680_100005107 | |||
| 822 | Ga0070680_100552122 | |||
| 823 | Ga0070680_101755296 | |||
| 824 | Ga0070682_100027232 | |||
| 825 | Ga0070682_100096458 | |||
| 826 | Ga0070682_100232669 | |||
| 827 | Ga0068868_100154342 | |||
| 828 | Ga0068868_100307729 | |||
| 829 | Ga0068868_102394998 | |||
| 830 | Ga0070660_100000292 | |||
| 831 | Ga0070660_100005614 | |||
| 832 | Ga0070660_100023314 | |||
| 833 | Ga0070660_100044041 | |||
| 834 | Ga0070660_100080370 | |||
| 835 | Ga0070660_100136878 | |||
| 836 | Ga0070660_100279400 | |||
| 837 | Ga0070660_100279580 | |||
| 838 | Ga0070689_100175591 | |||
| 839 | Ga0070689_101608234 | |||
| 840 | Ga0070691_10002168 | |||
| 841 | Ga0070687_100032815 | |||
| 842 | Ga0070661_100006185 | |||
| 843 | Ga0070661_100022295 | |||
| 844 | Ga0070661_100058516 | |||
| 845 | Ga0070661_100145705 | |||
| 846 | Ga0070661_100293259 | |||
| 847 | Ga0070661_100362001 | |||
| 848 | Ga0070661_100602476 | |||
| 849 | Ga0070661_101327113 | |||
| 850 | Ga0070692_10000390 | |||
| 851 | Ga0070692_10011350 | |||
| 852 | Ga0070668_100087639 | |||
| 853 | Ga0070668_101468068 | |||
| 854 | Ga0070669_100254443 | |||
| 855 | Ga0070669_100367084 | |||
| 856 | Ga0070669_100507000 | |||
| 857 | Ga0070669_101815873 | |||
| 858 | Ga0070675_100014309 | |||
| 859 | Ga0070675_100301056 | |||
| 860 | Ga0070675_100543867 | |||
| 861 | Ga0070671_100023911 | |||
| 862 | Ga0070671_100026744 | |||
| 863 | Ga0070671_100115117 | |||
| 864 | Ga0070671_100236787 | |||
| 865 | Ga0070671_100513708 | |||
| 866 | Ga0070671_101745171 | |||
| 867 | Ga0070674_100088728 | |||
| 868 | Ga0070674_100147827 | |||
| 869 | Ga0070674_100202056 | |||
| 870 | Ga0070674_100220887 | |||
| 871 | Ga0070674_101161134 | |||
| 872 | Ga0070673_100029978 | |||
| 873 | Ga0070673_100048207 | |||
| 874 | Ga0070673_100051485 | |||
| 875 | Ga0070659_100003770 | |||
| 876 | Ga0070659_100004716 | |||
| 877 | Ga0070659_100005750 | |||
| 878 | Ga0070659_100008695 | |||
| 879 | Ga0070659_100019161 | |||
| 880 | Ga0070659_100027038 | |||
| 881 | Ga0070659_100030696 | |||
| 882 | Ga0070659_100134317 | |||
| 883 | Ga0070659_100134582 | |||
| 884 | Ga0070659_100330501 | |||
| 885 | Ga0070659_100398256 | |||
| 886 | Ga0070659_100508943 | |||
| 887 | Ga0070659_100819745 | |||
| 888 | Ga0070667_100056382 | |||
| 889 | Ga0070667_100932715 | |||
| 890 | Ga0070667_101033606 | |||
| 891 | Ga0070667_102038549 | |||
| 892 | Ga0070714_100514322 | |||
| 893 | Ga0070713_100050509 | |||
| 894 | Ga0070694_100062800 | |||
| 895 | Ga0070663_100020500 | |||
| 896 | Ga0070663_100023487 | |||
| 897 | Ga0070663_100156971 | |||
| 898 | Ga0070663_100238667 | |||
| 899 | Ga0070663_100634431 | |||
| 900 | Ga0070663_100651552 | |||
| 901 | Ga0070663_101730106 | |||
| 902 | Ga0070678_100092099 | |||
| 903 | Ga0070678_100722307 | |||
| 904 | Ga0070662_100012232 | |||
| 905 | Ga0070662_100020845 | |||
| 906 | Ga0070662_100027900 | |||
| 907 | Ga0070662_100051542 | |||
| 908 | Ga0070662_100072217 | |||
| 909 | Ga0070662_100095149 | |||
| 910 | Ga0070662_100150231 | |||
| 911 | Ga0070662_100185786 | |||
| 912 | Ga0070681_10069863 | |||
| 913 | Ga0070681_10090488 | |||
| 914 | Ga0070681_10158006 | |||
| 915 | Ga0070681_10457878 | |||
| 916 | Ga0070681_10570212 | |||
| 917 | Ga0070681_11062188 | |||
| 918 | Ga0068867_100347978 | |||
| 919 | Ga0068867_100499070 | |||
| 920 | Ga0068867_101806709 | |||
| 921 | Ga0074259_10894309 | |||
| 922 | Ga0070679_100023597 | |||
| 923 | Ga0070679_100094201 | |||
| 924 | Ga0070679_100250873 | |||
| 925 | Ga0070679_100641217 | |||
| 926 | Ga0070684_100014486 | |||
| 927 | Ga0070684_100070593 | |||
| 928 | Ga0068853_100009560 | |||
| 929 | Ga0068853_100031007 | |||
| 930 | Ga0068853_100085473 | |||
| 931 | Ga0068853_100238978 | |||
| 932 | Ga0068853_101106044 | |||
| 933 | Ga0068853_101453305 | |||
| 934 | Ga0070672_100038083 | |||
| 935 | Ga0070672_100053878 | |||
| 936 | Ga0070672_100085207 | |||
| 937 | Ga0070672_100521502 | |||
| 938 | Ga0070672_101337984 | |||
| 939 | Ga0070695_100092459 | |||
| 940 | Ga0070693_100279253 | |||
| 941 | Ga0070693_100740673 | |||
| 942 | Ga0070665_100029557 | |||
| 943 | Ga0070665_100106550 | |||
| 944 | Ga0068855_100039819 | |||
| 945 | Ga0068855_100159451 | |||
| 946 | Ga0068855_100238392 | |||
| 947 | Ga0068855_100396131 | |||
| 948 | Ga0068855_100541993 | |||
| 949 | Ga0068855_101921608 | |||
| 950 | Ga0070664_100003107 | |||
| 951 | Ga0070664_100008604 | |||
| 952 | Ga0070664_100015317 | |||
| 953 | Ga0070664_100043360 | |||
| 954 | Ga0070664_100045426 | |||
| 955 | Ga0070664_100068067 | |||
| 956 | Ga0070664_100086955 | |||
| 957 | Ga0068857_100011886 | |||
| 958 | Ga0068857_100013634 | |||
| 959 | Ga0068857_100014309 | |||
| 960 | Ga0068857_100030380 | |||
| 961 | Ga0068857_100037809 | |||
| 962 | Ga0068857_100061266 | |||
| 963 | Ga0068857_100112427 | |||
| 964 | Ga0068857_100428261 | |||
| 965 | Ga0068854_100008247 | |||
| 966 | Ga0068854_100009638 | |||
| 967 | Ga0068854_100079478 | |||
| 968 | Ga0068854_100105987 | |||
| 969 | Ga0068854_100273088 | |||
| 970 | Ga0068854_100283110 | |||
| 971 | Ga0068854_100712687 | |||
| 972 | Ga0068854_102189065 | |||
| 973 | Ga0068856_100004427 | |||
| 974 | Ga0068856_100025985 | |||
| 975 | Ga0068856_100043250 | |||
| 976 | Ga0068856_100092683 | |||
| 977 | Ga0068852_100029333 | |||
| 978 | Ga0068852_100117525 | |||
| 979 | Ga0068852_100333684 | |||
| 980 | Ga0068852_100373439 | |||
| 981 | Ga0068852_100554466 | |||
| 982 | Ga0068852_101010770 | |||
| 983 | Ga0068852_101071807 | |||
| 984 | Ga0068859_100004235 | |||
| 985 | Ga0068859_100022494 | |||
| 986 | Ga0068859_100234904 | |||
| 987 | Ga0068859_100641182 | |||
| 988 | Ga0068864_100029956 | |||
| 989 | Ga0068864_100039708 | |||
| 990 | Ga0068864_100097372 | |||
| 991 | Ga0068864_101400354 | |||
| 992 | Ga0068861_100261132 | |||
| 993 | Ga0068861_101690309 | |||
| 994 | Ga0068861_102061703 | |||
| 995 | Ga0068851_10026597 | |||
| 996 | Ga0068851_10061662 | |||
| 997 | Ga0068851_10308448 | |||
| 998 | Ga0068870_10902086 | |||
| 999 | Ga0068863_100006933 | |||
| 1000 | Ga0068863_100010745 | |||
| 1001 | Ga0068863_100079788 | |||
| 1002 | Ga0068863_100437991 | |||
| 1003 | Ga0068863_100468018 | |||
| 1004 | Ga0068863_102110033 | |||
| 1005 | Ga0068858_100004012 | |||
| 1006 | Ga0068858_100018632 | |||
| 1007 | Ga0068858_100027015 | |||
| 1008 | Ga0068858_100065423 | |||
| 1009 | Ga0068860_100006310 | |||
| 1010 | Ga0068860_100055159 | |||
| 1011 | Ga0068860_100092572 | |||
| 1012 | Ga0068860_100157255 | |||
| 1013 | Ga0068862_100004972 | |||
| 1014 | Ga0068862_100011357 | |||
| 1015 | Ga0068862_100750340 | |||
| 1016 | Ga0081540_1304905 | |||
| 1017 | Ga0070717_10009496 | |||
| 1018 | Ga0075369_10517425 | |||
| 1019 | Ga0075366_10512461 | |||
| 1020 | Ga0097621_100002260 | |||
| 1021 | Ga0097621_100739833 | |||
| 1022 | Ga0068871_100194221 | |||
| 1023 | Ga0068871_100653729 | |||
| 1024 | Ga0075428_100562324 | |||
| 1025 | Ga0075431_101782286 | |||
| 1026 | Ga0075434_100330119 | |||
| 1027 | Ga0075429_100880125 | |||
| 1028 | Ga0068865_100117195 | |||
| 1029 | Ga0097620_100004235 | |||
| 1030 | Ga0097620_100022494 | |||
| 1031 | Ga0097620_100234878 | |||
| 1032 | Ga0097620_100641185 | |||
| 1033 | Ga0075435_100599049 | |||
| 1034 | Ga0105251_10015303 | |||
| 1035 | Ga0105250_10502839 | |||
| 1036 | Ga0105240_10023904 | |||
| 1037 | Ga0105245_10114876 | |||
| 1038 | Ga0105245_10255736 | |||
| 1039 | Ga0105247_11408556 | |||
| 1040 | Ga0105243_10308782 | |||
| 1041 | Ga0105243_10377173 | |||
| 1042 | Ga0105241_10244250 | |||
| 1043 | Ga0105241_10334066 | |||
| 1044 | Ga0105241_10985064 | |||
| 1045 | Ga0105241_11440378 | |||
| 1046 | Ga0105242_10011492 | |||
| 1047 | Ga0105248_10012176 | |||
| 1048 | Ga0105248_10044967 | |||
| 1049 | Ga0105248_10110097 | |||
| 1050 | Ga0105248_10207840 | |||
| 1051 | Ga0105248_10845471 | |||
| 1052 | Ga0105237_10016756 | |||
| 1053 | Ga0105237_10066503 | |||
| 1054 | Ga0105237_10116509 | |||
| 1055 | Ga0105238_10007178 | |||
| 1056 | Ga0105249_10024765 | |||
| 1057 | Ga0105249_10034008 | |||
| 1058 | Ga0105249_10505295 | |||
| 1059 | Ga0105239_10050139 | |||
| 1060 | Ga0105239_10806153 | |||
| 1061 | Ga0105239_11886257 | |||
| 1062 | Ga0105239_12391736 | |||
| 1063 | Ga0105239_12414821 | |||
| 1064 | Ga0105246_10047957 | |||
| 1065 | Ga0105246_10476446 | |||
| 1066 | Ga0105246_10595553 | |||
| 1067 | Ga0157327_1047241 | |||
| 1068 | Ga0157373_10007336 | |||
| 1069 | Ga0157373_10022668 | |||
| 1070 | Ga0157373_10029131 | |||
| 1071 | Ga0157373_10227284 | |||
| 1072 | Ga0157373_10677867 | |||
| 1073 | Ga0157373_11114060 | |||
| 1074 | Ga0157371_10077341 | |||
| 1075 | Ga0157371_10108652 | |||
| 1076 | Ga0157371_10270757 | |||
| 1077 | Ga0157371_10377051 | |||
| 1078 | Ga0157370_10021821 | |||
| 1079 | Ga0157370_10027504 | |||
| 1080 | Ga0157370_10122073 | |||
| 1081 | Ga0157370_10285642 | |||
| 1082 | Ga0157369_10016388 | |||
| 1083 | Ga0157369_10050844 | |||
| 1084 | Ga0157369_10733591 | |||
| 1085 | Ga0157374_10122784 | |||
| 1086 | Ga0157374_11560643 | |||
| 1087 | Ga0163162_10164675 | |||
| 1088 | Ga0163162_10458600 | |||
| 1089 | Ga0163162_10782988 | |||
| 1090 | Ga0163162_11934587 | |||
| 1091 | Ga0157372_10069372 | |||
| 1092 | Ga0157372_10119577 | |||
| 1093 | Ga0157372_10131797 | |||
| 1094 | Ga0157372_10371368 | |||
| 1095 | Ga0157372_11123754 | |||
| 1096 | Ga0157372_12535076 | |||
| 1097 | Ga0157372_13482479 | |||
| 1098 | Ga0157375_10049335 | |||
| 1099 | Ga0157375_10401238 | |||
| 1100 | Ga0157375_10620348 | |||
| 1101 | Ga0157375_10640518 | |||
| 1102 | Ga0163163_10009557 | |||
| 1103 | Ga0163163_10065935 | |||
| 1104 | Ga0163163_10273706 | |||
| 1105 | Ga0157380_10543972 | |||
| 1106 | Ga0182008_10015807 | |||
| 1107 | Ga0182008_10427889 | |||
| 1108 | Ga0157377_10196732 | |||
| 1109 | Ga0157379_10041754 | |||
| 1110 | Ga0157379_10099770 | |||
| 1111 | Ga0224712_10218980 | |||
| 1112 | Ga0207656_10253035 | |||
| 1113 | Ga0207656_10469276 | |||
| 1114 | Ga0207682_10032938 | |||
| 1115 | Ga0207682_10107479 | |||
| 1116 | Ga0207688_10021924 | |||
| 1117 | Ga0207688_10048322 | |||
| 1118 | Ga0207680_10003921 | |||
| 1119 | Ga0207680_10127623 | |||
| 1120 | Ga0207647_10000910 | |||
| 1121 | Ga0207647_10001423 | |||
| 1122 | Ga0207647_10005982 | |||
| 1123 | Ga0207647_10056077 | |||
| 1124 | Ga0207647_10235766 | |||
| 1125 | Ga0207647_10435397 | |||
| 1126 | Ga0207705_10000853 | |||
| 1127 | Ga0207705_10005390 | |||
| 1128 | Ga0207705_10021877 | |||
| 1129 | Ga0207705_10036885 | |||
| 1130 | Ga0207705_10100650 | |||
| 1131 | Ga0207705_10601415 | |||
| 1132 | Ga0207654_10606115 | |||
| 1133 | Ga0207654_10991711 | |||
| 1134 | Ga0207707_10148938 | |||
| 1135 | Ga0207707_10219855 | |||
| 1136 | Ga0207707_10472336 | |||
| 1137 | Ga0207695_10008918 | |||
| 1138 | Ga0207671_10014919 | |||
| 1139 | Ga0207671_10147375 | |||
| 1140 | Ga0207671_11253253 | |||
| 1141 | Ga0207660_10005166 | |||
| 1142 | Ga0207660_10008617 | |||
| 1143 | Ga0207660_10606836 | |||
| 1144 | Ga0207662_10023904 | |||
| 1145 | Ga0207657_10000962 | |||
| 1146 | Ga0207657_10005030 | |||
| 1147 | Ga0207657_10008887 | |||
| 1148 | Ga0207657_10017773 | |||
| 1149 | Ga0207657_10025608 | |||
| 1150 | Ga0207657_10082361 | |||
| 1151 | Ga0207657_10103321 | |||
| 1152 | Ga0207657_10282627 | |||
| 1153 | Ga0207657_10364155 | |||
| 1154 | Ga0207657_10490350 | |||
| 1155 | Ga0207657_10955238 | |||
| 1156 | Ga0207649_10001843 | |||
| 1157 | Ga0207649_10047888 | |||
| 1158 | Ga0207649_10071095 | |||
| 1159 | Ga0207649_10177284 | |||
| 1160 | Ga0207649_10203031 | |||
| 1161 | Ga0207649_10243771 | |||
| 1162 | Ga0207649_10288567 | |||
| 1163 | Ga0207649_10655660 | |||
| 1164 | Ga0207649_10874786 | |||
| 1165 | Ga0207652_10001100 | |||
| 1166 | Ga0207652_10068224 | |||
| 1167 | Ga0207652_10191918 | |||
| 1168 | Ga0207652_11122857 | |||
| 1169 | Ga0207681_10352460 | |||
| 1170 | Ga0207681_10540932 | |||
| 1171 | Ga0207681_11097026 | |||
| 1172 | Ga0207694_10005672 | |||
| 1173 | Ga0207650_10208074 | |||
| 1174 | Ga0207650_10236767 | |||
| 1175 | Ga0207650_10302049 | |||
| 1176 | Ga0207659_10079422 | |||
| 1177 | Ga0207659_10762900 | |||
| 1178 | Ga0207659_10825668 | |||
| 1179 | Ga0207687_10077207 | |||
| 1180 | Ga0207664_10624136 | |||
| 1181 | Ga0207644_10035225 | |||
| 1182 | Ga0207644_10035438 | |||
| 1183 | Ga0207644_10040022 | |||
| 1184 | Ga0207644_10267414 | |||
| 1185 | Ga0207644_10304955 | |||
| 1186 | Ga0207644_10579374 | |||
| 1187 | Ga0207644_10621336 | |||
| 1188 | Ga0207644_10899196 | |||
| 1189 | Ga0207690_10002177 | |||
| 1190 | Ga0207690_10009048 | |||
| 1191 | Ga0207690_10010356 | |||
| 1192 | Ga0207690_10023439 | |||
| 1193 | Ga0207690_10046744 | |||
| 1194 | Ga0207690_10110327 | |||
| 1195 | Ga0207690_10122837 | |||
| 1196 | Ga0207690_10180910 | |||
| 1197 | Ga0207690_10236175 | |||
| 1198 | Ga0207690_10514499 | |||
| 1199 | Ga0207690_10585582 | |||
| 1200 | Ga0207690_10890930 | |||
| 1201 | Ga0207706_10001681 | |||
| 1202 | Ga0207706_10016868 | |||
| 1203 | Ga0207706_10035222 | |||
| 1204 | Ga0207706_10035849 | |||
| 1205 | Ga0207706_10036821 | |||
| 1206 | Ga0207706_10206695 | |||
| 1207 | Ga0207706_10730880 | |||
| 1208 | Ga0207706_10734883 | |||
| 1209 | Ga0207706_10921953 | |||
| 1210 | Ga0207686_10024015 | |||
| 1211 | Ga0207709_10175537 | |||
| 1212 | Ga0207670_10136030 | |||
| 1213 | Ga0207670_11711529 | |||
| 1214 | Ga0207669_10032702 | |||
| 1215 | Ga0207669_10202498 | |||
| 1216 | Ga0207669_11045954 | |||
| 1217 | Ga0207704_10782533 | |||
| 1218 | Ga0207665_10261566 | |||
| 1219 | Ga0207691_10028017 | |||
| 1220 | Ga0207691_10054881 | |||
| 1221 | Ga0207691_10057901 | |||
| 1222 | Ga0207691_11403634 | |||
| 1223 | Ga0207711_10008511 | |||
| 1224 | Ga0207711_10184390 | |||
| 1225 | Ga0207711_10250351 | |||
| 1226 | Ga0207689_10003104 | |||
| 1227 | Ga0207689_10258486 | |||
| 1228 | Ga0207689_10410381 | |||
| 1229 | Ga0207689_11123487 | |||
| 1230 | Ga0207661_10023786 | |||
| 1231 | Ga0207679_10006355 | |||
| 1232 | Ga0207679_10010430 | |||
| 1233 | Ga0207679_10018949 | |||
| 1234 | Ga0207679_10029504 | |||
| 1235 | Ga0207679_10091656 | |||
| 1236 | Ga0207679_10139243 | |||
| 1237 | Ga0207667_10004508 | |||
| 1238 | Ga0207667_10007822 | |||
| 1239 | Ga0207667_10020852 | |||
| 1240 | Ga0207667_10097564 | |||
| 1241 | Ga0207667_11815955 | |||
| 1242 | Ga0207651_10110575 | |||
| 1243 | Ga0207651_10325327 | |||
| 1244 | Ga0207651_10339234 | |||
| 1245 | Ga0207651_10984731 | |||
| 1246 | Ga0207712_10001181 | |||
| 1247 | Ga0207712_11413752 | |||
| 1248 | Ga0207668_10073861 | |||
| 1249 | Ga0207640_10002781 | |||
| 1250 | Ga0207640_10014468 | |||
| 1251 | Ga0207640_10134994 | |||
| 1252 | Ga0207640_10493061 | |||
| 1253 | Ga0207640_10790105 | |||
| 1254 | Ga0207640_10848610 | |||
| 1255 | Ga0207640_11562658 | |||
| 1256 | Ga0207658_10049889 | |||
| 1257 | Ga0207658_10065477 | |||
| 1258 | Ga0207658_10153755 | |||
| 1259 | Ga0207658_10436121 | |||
| 1260 | Ga0207658_11422049 | |||
| 1261 | Ga0207677_10096497 | |||
| 1262 | Ga0207677_10709019 | |||
| 1263 | Ga0207677_11627085 | |||
| 1264 | Ga0207703_10011955 | |||
| 1265 | Ga0207703_10028182 | |||
| 1266 | Ga0207639_10019533 | |||
| 1267 | Ga0207639_10026995 | |||
| 1268 | Ga0207639_10206250 | |||
| 1269 | Ga0207639_10582942 | |||
| 1270 | Ga0207678_10002042 | |||
| 1271 | Ga0207678_10002194 | |||
| 1272 | Ga0207678_10003505 | |||
| 1273 | Ga0207678_10040809 | |||
| 1274 | Ga0207678_10179021 | |||
| 1275 | Ga0207678_10205233 | |||
| 1276 | Ga0207678_10242683 | |||
| 1277 | Ga0207678_10248894 | |||
| 1278 | Ga0207702_10018149 | |||
| 1279 | Ga0207641_10031504 | |||
| 1280 | Ga0207641_10031686 | |||
| 1281 | Ga0207641_10054196 | |||
| 1282 | Ga0207641_10133802 | |||
| 1283 | Ga0207641_10463989 | |||
| 1284 | Ga0207641_10547504 | |||
| 1285 | Ga0207648_10202586 | |||
| 1286 | Ga0207648_11048889 | |||
| 1287 | Ga0207676_10021105 | |||
| 1288 | Ga0207676_10189029 | |||
| 1289 | Ga0207676_10289594 | |||
| 1290 | Ga0207676_10912135 | |||
| 1291 | Ga0207676_11070284 | |||
| 1292 | Ga0207674_10000151 | |||
| 1293 | Ga0207674_10000410 | |||
| 1294 | Ga0207674_10003707 | |||
| 1295 | Ga0207674_10017187 | |||
| 1296 | Ga0207674_10028333 | |||
| 1297 | Ga0207674_10137143 | |||
| 1298 | Ga0207674_10314836 | |||
| 1299 | Ga0207674_10551206 | |||
| 1300 | Ga0207675_100277227 | |||
| 1301 | Ga0207675_101206675 | |||
| 1302 | Ga0207683_10197429 | |||
| 1303 | Ga0207683_10952870 | |||
| 1304 | Ga0207698_10004072 | |||
| 1305 | Ga0207698_10023373 | |||
| 1306 | Ga0207698_10048265 | |||
| 1307 | Ga0207698_10234064 | |||
| 1308 | Ga0207698_10508412 | |||
| 1309 | Ga0207698_10966677 | |||
| 1310 | Ga0207698_11685858 | |||
| 1311 | Ga0268266_10030954 | |||
| 1312 | Ga0268266_10038372 | |||
| 1313 | Ga0268265_10057807 | |||
| 1314 | Ga0268265_10253782 | |||
| 1315 | Ga0268265_10301237 | |||
| 1316 | Ga0268265_10998793 | |||
| 1317 | Ga0268264_10049087 | |||
| 1318 | Ga0268264_10273068 | |||
| 1319 | Ga0268264_10649741 | |||
| 1320 | Ga0307513_10353201 | |||
| 1321 | Ga0307408_100326265 | |||
| 1322 | Ga0307408_100840450 | |||
| 1323 | Ga0307408_102415430 | |||
| 1324 | Ga0307405_10040033 | |||
| 1325 | Ga0307413_10121324 | |||
| 1326 | Ga0307413_10128200 | |||
| 1327 | Ga0307410_10290792 | |||
| 1328 | Ga0307410_11417799 | |||
| 1329 | Ga0307406_10079831 | |||
| 1330 | Ga0307406_10199142 | |||
| 1331 | Ga0307406_10388123 | |||
| 1332 | Ga0307412_10093856 | |||
| 1333 | Ga0307409_100018161 | |||
| 1334 | Ga0307409_100840066 | |||
| 1335 | Ga0307409_100964229 | |||
| 1336 | Ga0307416_100054970 | |||
| 1337 | Ga0307416_100710272 | |||
| 1338 | Ga0307416_100886603 | |||
| 1339 | Ga0307414_10165794 | |||
| 1340 | Ga0307411_10123468 | |||
| 1341 | Ga0307411_10443911 | |||
| 1342 | Ga0307411_10883957 | |||
| 1343 | Ga0307415_100007613 | |||
| 1344 | Ga0307415_100589868 | |||
| 1345 | Ga0373941_0334621 | |||
| 1346 | Ga0373931_0304457 | |||
| 1347 | Ga0395899_0001165 | |||
| 1348 | Ga0395899_0002476 | |||
| 1349 | Ga0395899_0010292 | |||
| 1350 | Ga0395899_0010948 | |||
| 1351 | Ga0395899_0061872 | |||
| 1352 | Ga0395899_0069989 | |||
| 1353 | Ga0395899_0139182 | |||
| 1354 | Ga0395899_0289756 | |||
| 1355 | Ga0395899_0295507 | |||
| 1356 | Ga0395899_0342913 | |||
| 1357 | Ga0395899_0454743 | |||
| 1358 | Ga0395900_0002233 | |||
| 1359 | Ga0395900_0003176 | |||
| 1360 | Ga0395900_0018282 | |||
| 1361 | Ga0395900_0031690 | |||
| 1362 | Ga0395900_0038945 | |||
| 1363 | Ga0395900_0039272 | |||
| 1364 | Ga0395900_0046747 | |||
| 1365 | Ga0395900_0088446 | |||
| 1366 | Ga0395900_0102203 | |||
| 1367 | Ga0395900_0126713 | |||
| 1368 | Ga0395900_0129338 | |||
| 1369 | Ga0395900_0142048 | |||
| 1370 | Ga0395900_0164404 | |||
| 1371 | Ga0395900_0219630 | |||
| 1372 | Ga0395900_0375719 | |||
| 1373 | Ga0395900_0387219 | |||
| 1374 | Ga0395900_0512787 | |||
| 1375 | Ga0395900_0620871 | |||
| 1376 | Ga0395900_0683220 | |||
| 1377 | Ga0395900_0759567 | |||
| 1378 | Ga0395900_1229477 | |||
| 1379 | Ga0395900_1425491 | |||
| 1380 | Ga0395900_1577484 | |||
| 1381 | Ga0395898_0004873 | |||
| 1382 | Ga0395898_0010099 | |||
| 1383 | Ga0395898_0027301 | |||
| 1384 | Ga0395898_0049776 | |||
| 1385 | Ga0395898_0264466 | |||
| 1386 | Ga0395898_0282755 | |||
| 1387 | Ga0395898_0314351 | |||
| 1388 | Ga0395898_0496903 | |||
| 1389 | Ga0395898_0609267 | |||
| 1390 | Ga0395898_1356200 | |||
| 1391 | Ga0395898_1765788 | |||
| 1392 | Ga0395905_0001302 | |||
| 1393 | Ga0395905_0003014 | |||
| 1394 | Ga0395905_0007273 | |||
| 1395 | Ga0395905_0013236 | |||
| 1396 | Ga0395905_0014464 | |||
| 1397 | Ga0395905_0015273 | |||
| 1398 | Ga0395905_0023506 | |||
| 1399 | Ga0395905_0025264 | |||
| 1400 | Ga0395905_0029822 | |||
| 1401 | Ga0395905_0034865 | |||
| 1402 | Ga0395905_0035249 | |||
| 1403 | Ga0395905_0035324 | |||
| 1404 | Ga0395905_0046811 | |||
| 1405 | Ga0395905_0048894 | |||
| 1406 | Ga0395905_0053046 | |||
| 1407 | Ga0395905_0058065 | |||
| 1408 | Ga0395905_0071538 | |||
| 1409 | Ga0395905_0107941 | |||
| 1410 | Ga0395905_0112597 | |||
| 1411 | Ga0395905_0132355 | |||
| 1412 | Ga0395905_0168113 | |||
| 1413 | Ga0395905_0238235 | |||
| 1414 | Ga0395905_0292331 | |||
| 1415 | Ga0395905_0293832 | |||
| 1416 | Ga0395905_0449700 | |||
| 1417 | Ga0395905_0775400 | |||
| 1418 | Ga0395905_0997467 | |||
| 1419 | Ga0395905_1055491 | |||
| 1420 | Ga0395905_1076743 | |||
| 1421 | Ga0395905_1543476 | |||
| 1422 | Ga0395905_1788106 | |||
| 1423 | Ga0395901_0010449 | |||
| 1424 | Ga0395901_0019891 | |||
| 1425 | Ga0395901_0025745 | |||
| 1426 | Ga0395901_0029136 | |||
| 1427 | Ga0395901_0035592 | |||
| 1428 | Ga0395901_0038033 | |||
| 1429 | Ga0395901_0119354 | |||
| 1430 | Ga0395901_0133372 | |||
| 1431 | Ga0395901_0139054 | |||
| 1432 | Ga0395901_0151256 | |||
| 1433 | Ga0395901_0175417 | |||
| 1434 | Ga0395901_0187948 | |||
| 1435 | Ga0395901_0381138 | |||
| 1436 | Ga0395901_0542401 | |||
| 1437 | Ga0395901_0997827 | |||
| 1438 | Ga0395901_1147400 | |||
| 1439 | Ga0395901_1268186 | |||
| 1440 | Ga0395901_1356926 | |||
| 1441 | Ga0395901_1535380 | |||
| 1442 | Ga0395901_1775458 | |||
| 1443 | Ga0436365_0986541 | |||
| 1444 | Ga0436363_1629466 | |||
| 1445 | Ga0439447_118632 | |||
| 1446 | Ga0439465_0083785 | |||
| 1447 | Ga0439432_045879 | |||
| 1448 | Ga0439449_0036781 | |||
| 1449 | Ga0439455_0040748 | |||
| 1450 | Ga0439458_0000044 | |||
| 1451 | Ga0439458_0001191 | |||
| 1452 | Ga0439459_0219257 | |||
| 1453 | Ga0439464_0000895 | |||
| 1454 | Ga0466969_0004255 | |||
| 1455 | Ga0466965_0438785 | |||
| 1456 | Ga0466966_0046173 | |||
| 1457 | Ga0466961_0037700 | |||
| 1458 | Ga0466963_0133998 | |||
| 1459 | Ga0466963_1132299 | |||
| 1460 | Ga0466971_0047123 | |||
| 1461 | Ga0466970_0147751 | |||
| 1462 | Ga0466957_0040787 | |||
| 1463 | Ga0466957_0145544 | |||
| 1464 | Ga0466957_0271221 | |||
| 1465 | Ga0466959_0365286 | |||
| 1466 | Ga0466958_0521928 | |||
| 1467 | Ga0466967_0011818 | |||
| 1468 | Ga0466967_0094538 | |||
| 1469 | Ga0466967_0403564 | |||
| 1470 | Ga0466967_0620856 | |||
| 1471 | Ga0466967_1512886 | |||
| 1472 | Ga0495584_0656414 | |||
| 1473 | Ga0495633_0149962 | |||
| 1474 | Ga0495669_0161656 | |||
| 1475 | Ga0495669_0224553 | |||
| 1476 | Ga0495669_0340980 | |||
| 1477 | Ga0495670_0630852 | |||
| 1478 | Ga0495677_0304378 | |||
| 1479 | Ga0496100_1123886 | |||
| 1480 | Ga0496101_0223388 | |||
| 1481 | Ga0496101_0848583 | |||
| 1482 | Ga0496102_0078330 | |||
| 1483 | Ga0496102_0663104 | |||
| 1484 | Ga0496102_1826272 | |||
| 1485 | Ga0496103_0239014 | |||
| 1486 | Ga0496104_0180909 | |||
| 1487 | Ga0496104_1460378 | |||
| 1488 | Ga0496105_0087574 | |||
| 1489 | Ga0496106_0083251 | |||
| 1490 | Ga0496106_0828848 | |||
| 1491 | Ga0496107_0020104 | |||
| 1492 | Ga0496107_0908296 | |||
| 1493 | Ga0496108_0006067 | |||
| 1494 | Ga0496109_0015360 | |||
| 1495 | Ga0496109_0369814 | |||
| 1496 | Ga0496110_0015740 | |||
| 1497 | Ga0496110_0347880 | |||
| 1498 | Ga0496110_0371396 | |||
| 1499 | Ga0496110_0400112 | |||
| 1500 | Ga0496110_1371982 | |||
| 1501 | Ga0496111_0002395 | |||
| 1502 | Ga0496112_0111779 | |||
| 1503 | Ga0496112_0226194 | |||
| 1504 | Ga0496112_1148888 | |||
| 1505 | Ga0496113_0000705 | |||
| 1506 | Ga0496113_0090326 | |||
| 1507 | Ga0501067_0011658 | |||
| 1508 | Ga0501067_0052413 | |||
| 1509 | Ga0501068_0436233 | |||
| 1510 | Ga0501071_0075239 | |||
| 1511 | Ga0501201_038254 | |||
| 1512 | Ga0501202_176554 | |||
| 1513 | Ga0501216_061818 | |||
| 1514 | Ga0501217_037859 | |||
| 1515 | Ga0501223_023733 | |||
| 1516 | Ga0501233_038509 | |||
| 1517 | Ga0501235_171441 | |||
| 1518 | Ga0501240_021790 | |||
| 1519 | Ga0501242_008440 | |||
| 1520 | Ga0501243_051401 | |||
| 1521 | Ga0501248_037463 | |||
| 1522 | Ga0501249_084455 | |||
| 1523 | Ga0501234_006733 | |||
| 1524 | Ga0501245_036012 | |||
| 1525 | Ga0501268_001972 | |||
| 1526 | Ga0501273_000968 | |||
| 1527 | nmdc:mga0k408_761468_c1 | |||
| 1528 | nmdc:mga09592_742486_c1 | |||
| 1529 | nmdc:mga0qj67_172027_c1 | |||
| 1530 | nmdc:mga06r32_232233_c1 | |||
| 1531 | nmdc:mga0rr50_556457_c1 | |||
| 1532 | nmdc:mga0rr50_801870_c1 | |||
| 1533 | nmdc:mga0a205_1007_c1 | |||
| 1534 | nmdc:mga0sz30_465739_c1 | |||
| 1535 | Ga0587073_0310087 | |||
| 1536 | Ga0466962_0014061 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q4y-assembly1.cif.gz_A | ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex | 0.9041 | 9 | 97 |
| 5i0c-assembly1.cif.gz_A | crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 | 0.9011 | 9 | 97 |
| 6wqc-assembly1.cif.gz_A | crystal structure of vipf from legionella hackeliae in complex with coa | 0.8854 | 18 | 77 |
| 5i0c-assembly1.cif.gz_A | crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 | 0.8824 | 9 | 97 |
| 6wqb-assembly1.cif.gz_A | crystal structure of vipf from legionella hackeliae in complex with acetyl-coa | 0.879 | 18 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D4A230_16_108_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9487 | 9 | 96 | 3.40.630.30 |
| af_G5EE42_2_95_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9475 | 8 | 95 | 3.40.630.30 |
| af_Q54CC0_2_81_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9418 | 9 | 80 | 3.40.630.30 |
| af_A0A2R8QAE8_34_133_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9301 | 9 | 97 | 3.40.630.30 |
| af_O62324_1_224_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9087 | 39 | 77 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5RCZ9-F1-model_v4 | N-acetyltransferase | 0.9917 | 9 | 97 |
GO:0016747
|
| AF-A0A2D9N4C0-F1-model_v4 | GNAT family N-acetyltransferase | 0.9886 | 9 | 98 |
GO:0016740
|
| AF-A0A535DSH6-F1-model_v4 | N-acetyltransferase | 0.9864 | 9 | 99 |
GO:0016740
|
| AF-A0A2V8TB28-F1-model_v4 | GNAT family N-acetyltransferase | 0.9858 | 8 | 98 |
GO:0016740
|
| AF-A0A2V9H2G3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9855 | 13 | 104 |
GO:0016740
|