F479949

General Info

Members Datasets Scaffolds Average Seq Length
768 255 1536 106

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10001423|Ga0213876_100014238
Length 120
Sequence MTDPQPAASVAVVDVPQSSRYEARLAADPSTGRAVATYELRDGAIAFMHTLVPRTLQGHGVGSALARTALDDARRRGLAVIPICPFFASYIRRHAAYQDLVPEAMRAELLAAPAGETSHE

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
232 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
233 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
239 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
240 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
241 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
244 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
245 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
246 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.65
Rhizosphere 95.05
Stem 0
Stem Tuber 0
Unclassified 26.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10001423 3300021384 Bacteria 14913
2 JGI24736J21556_1030298 3300001904 Unclassified 837
3 JGI24741J21665_1008559 3300001915 Bacteria 1924
4 JGI24741J21665_1021003 3300001915 Bacteria 1022
5 JGI24752J21851_1007996 3300001976 Bacteria 1378
6 JGI24740J21852_10001875 3300001979 Bacteria 9620
7 JGI24740J21852_10002541 3300001979 Bacteria 8226
8 JGI24740J21852_10016406 3300001979 Bacteria 2678
9 JGI24739J22299_10000368 3300001989 Bacteria 15458
10 JGI24739J22299_10066850 3300001989 Unclassified 1125
11 JGI24737J22298_10000529 3300001990 Bacteria 13396
12 JGI24737J22298_10000723 3300001990 Bacteria 11628
13 JGI24737J22298_10011722 3300001990 Bacteria 2868
14 JGI24737J22298_10018837 3300001990 Bacteria 2211
15 JGI24743J22301_10000217 3300001991 Bacteria 6055
16 JGI24735J21928_10009535 3300002067 Bacteria 3114
17 JGI24735J21928_10032002 3300002067 Unclassified 1558
18 JGI24735J21928_10050993 3300002067 Bacteria 1195
19 JGI24735J21928_10056802 3300002067 Bacteria 1127
20 JGI24735J21928_10092777 3300002067 Unclassified 866
21 JGI24738J21930_10005571 3300002075 Bacteria 3004
22 rootH2_10130912 3300003320 Unclassified 2697
23 rootH1_10001288 3300003323 Bacteria 7574
24 Ga0065712_10099318 3300005290 Unclassified 2094
25 Ga0065712_10478642 3300005290 Unclassified 665
26 Ga0065715_10535615 3300005293 Unclassified 752
27 Ga0070658_10006977 3300005327 Bacteria 9124
28 Ga0070658_10015670 3300005327 Bacteria 6062
29 Ga0070658_10049131 3300005327 Bacteria 3417
30 Ga0070658_10049902 3300005327 Bacteria 3391
31 Ga0070658_10071696 3300005327 Bacteria 2837
32 Ga0070658_10140484 3300005327 Bacteria 2017
33 Ga0070658_10325955 3300005327 Unclassified 1312
34 Ga0070658_11734371 3300005327 Unclassified 540
35 Ga0070676_10317327 3300005328 Bacteria 1061
36 Ga0070683_100004703 3300005329 Bacteria 11283
37 Ga0070683_100015584 3300005329 Bacteria 6681
38 Ga0070683_100109802 3300005329 Bacteria 2602
39 Ga0070690_100551506 3300005330 Unclassified 869
40 Ga0070670_100027668 3300005331 Bacteria 4877
41 Ga0070670_100040725 3300005331 Bacteria 3993
42 Ga0070670_100086741 3300005331 Bacteria 2690
43 Ga0070670_100205569 3300005331 Unclassified 1711
44 Ga0070677_10016684 3300005333 Bacteria 2618
45 Ga0070677_10055228 3300005333 Bacteria 1620
46 Ga0068869_100064659 3300005334 Bacteria 2691
47 Ga0068869_100506831 3300005334 Unclassified 1008
48 Ga0068869_100680076 3300005334 Bacteria 876
49 Ga0068869_100997926 3300005334 Bacteria 729
50 Ga0070666_10031902 3300005335 Bacteria 3479
51 Ga0070666_10172973 3300005335 Bacteria 1513
52 Ga0070680_100000845 3300005336 Bacteria 21681
53 Ga0070680_100005107 3300005336 Bacteria 9908
54 Ga0070680_100552122 3300005336 Unclassified 987
55 Ga0070680_101755296 3300005336 Bacteria 538
56 Ga0070682_100027232 3300005337 Bacteria 3429
57 Ga0070682_100096458 3300005337 Bacteria 1944
58 Ga0070682_100232669 3300005337 Unclassified 1318
59 Ga0068868_100154342 3300005338 Bacteria 1893
60 Ga0068868_100307729 3300005338 Bacteria 1347
61 Ga0068868_102394998 3300005338 Bacteria 504
62 Ga0070660_100000292 3300005339 Bacteria 33415
63 Ga0070660_100005614 3300005339 Bacteria 8696
64 Ga0070660_100023314 3300005339 Bacteria 4585
65 Ga0070660_100044041 3300005339 Bacteria 3411
66 Ga0070660_100080370 3300005339 Bacteria 2558
67 Ga0070660_100136878 3300005339 Bacteria 1962
68 Ga0070660_100279400 3300005339 Bacteria 1366
69 Ga0070660_100279580 3300005339 Bacteria 1365
70 Ga0070689_100175591 3300005340 Unclassified 1737
71 Ga0070689_101608234 3300005340 Unclassified 590
72 Ga0070691_10002168 3300005341 Bacteria 8687
73 Ga0070687_100032815 3300005343 Bacteria 2558
74 Ga0070661_100006185 3300005344 Bacteria 8254
75 Ga0070661_100022295 3300005344 Bacteria 4533
76 Ga0070661_100058516 3300005344 Bacteria 2824
77 Ga0070661_100145705 3300005344 Bacteria 1788
78 Ga0070661_100293259 3300005344 Bacteria 1264
79 Ga0070661_100362001 3300005344 Bacteria 1140
80 Ga0070661_100602476 3300005344 Bacteria 888
81 Ga0070661_101327113 3300005344 Bacteria 604
82 Ga0070692_10000390 3300005345 Bacteria 13062
83 Ga0070692_10011350 3300005345 Bacteria 4087
84 Ga0070668_100087639 3300005347 Bacteria 2449
85 Ga0070668_101468068 3300005347 Bacteria 623
86 Ga0070669_100254443 3300005353 Unclassified 1399
87 Ga0070669_100367084 3300005353 Bacteria 1172
88 Ga0070669_100507000 3300005353 Unclassified 1001
89 Ga0070669_101815873 3300005353 Bacteria 532
90 Ga0070675_100014309 3300005354 Bacteria 6255
91 Ga0070675_100301056 3300005354 Bacteria 1413
92 Ga0070675_100543867 3300005354 Bacteria 1050
93 Ga0070671_100023911 3300005355 Bacteria 5000
94 Ga0070671_100026744 3300005355 Bacteria 4745
95 Ga0070671_100115117 3300005355 Bacteria 2260
96 Ga0070671_100236787 3300005355 Bacteria 1549
97 Ga0070671_100513708 3300005355 Bacteria 1031
98 Ga0070671_101745171 3300005355 Bacteria 553
99 Ga0070674_100088728 3300005356 Unclassified 2226
100 Ga0070674_100147827 3300005356 Bacteria 1770
101 Ga0070674_100202056 3300005356 Unclassified 1535
102 Ga0070674_100220887 3300005356 Bacteria 1474
103 Ga0070674_101161134 3300005356 Unclassified 684
104 Ga0070673_100029978 3300005364 Bacteria 4064
105 Ga0070673_100048207 3300005364 Bacteria 3320
106 Ga0070673_100051485 3300005364 Unclassified 3225
107 Ga0070659_100003770 3300005366 Bacteria 10815
108 Ga0070659_100004716 3300005366 Bacteria 9732
109 Ga0070659_100005750 3300005366 Bacteria 8923
110 Ga0070659_100008695 3300005366 Bacteria 7427
111 Ga0070659_100019161 3300005366 Bacteria 5178
112 Ga0070659_100027038 3300005366 Bacteria 4417
113 Ga0070659_100030696 3300005366 Bacteria 4160
114 Ga0070659_100134317 3300005366 Unclassified 2012
115 Ga0070659_100134582 3300005366 Bacteria 2009
116 Ga0070659_100330501 3300005366 Bacteria 1276
117 Ga0070659_100398256 3300005366 Bacteria 1162
118 Ga0070659_100508943 3300005366 Bacteria 1027
119 Ga0070659_100819745 3300005366 Bacteria 810
120 Ga0070667_100056382 3300005367 Bacteria 3319
121 Ga0070667_100932715 3300005367 Bacteria 809
122 Ga0070667_101033606 3300005367 Unclassified 767
123 Ga0070667_102038549 3300005367 Unclassified 540
124 Ga0070714_100514322 3300005435 Unclassified 1143
125 Ga0070713_100050509 3300005436 Bacteria 3436
126 Ga0070694_100062800 3300005444 Bacteria 2538
127 Ga0070663_100020500 3300005455 Bacteria 4379
128 Ga0070663_100023487 3300005455 Bacteria 4134
129 Ga0070663_100156971 3300005455 Bacteria 1749
130 Ga0070663_100238667 3300005455 Bacteria 1434
131 Ga0070663_100634431 3300005455 Unclassified 902
132 Ga0070663_100651552 3300005455 Bacteria 891
133 Ga0070663_101730106 3300005455 Bacteria 559
134 Ga0070678_100092099 3300005456 Unclassified 2328
135 Ga0070678_100722307 3300005456 Bacteria 899
136 Ga0070662_100012232 3300005457 Bacteria 5683
137 Ga0070662_100020845 3300005457 Bacteria 4470
138 Ga0070662_100027900 3300005457 Bacteria 3925
139 Ga0070662_100051542 3300005457 Unclassified 2972
140 Ga0070662_100072217 3300005457 Bacteria 2547
141 Ga0070662_100095149 3300005457 Unclassified 2244
142 Ga0070662_100150231 3300005457 Unclassified 1813
143 Ga0070662_100185786 3300005457 Unclassified 1641
144 Ga0070681_10069863 3300005458 Bacteria 3478
145 Ga0070681_10090488 3300005458 Bacteria 3010
146 Ga0070681_10158006 3300005458 Unclassified 2191
147 Ga0070681_10457878 3300005458 Bacteria 1188
148 Ga0070681_10570212 3300005458 Bacteria 1046
149 Ga0070681_11062188 3300005458 Bacteria 730
150 Ga0068867_100347978 3300005459 Unclassified 1236
151 Ga0068867_100499070 3300005459 Unclassified 1046
152 Ga0068867_101806709 3300005459 Bacteria 575
153 Ga0074259_10894309 3300005507 Unclassified 514
154 Ga0070679_100023597 3300005530 Bacteria 6024
155 Ga0070679_100094201 3300005530 Bacteria 2982
156 Ga0070679_100250873 3300005530 Bacteria 1726
157 Ga0070679_100641217 3300005530 Unclassified 1005
158 Ga0070684_100014486 3300005535 Bacteria 6391
159 Ga0070684_100070593 3300005535 Bacteria 3074
160 Ga0068853_100009560 3300005539 Bacteria 7811
161 Ga0068853_100031007 3300005539 Bacteria 4519
162 Ga0068853_100085473 3300005539 Bacteria 2765
163 Ga0068853_100238978 3300005539 Unclassified 1664
164 Ga0068853_101106044 3300005539 Unclassified 764
165 Ga0068853_101453305 3300005539 Unclassified 663
166 Ga0070672_100038083 3300005543 Bacteria 3672
167 Ga0070672_100053878 3300005543 Bacteria 3147
168 Ga0070672_100085207 3300005543 Unclassified 2539
169 Ga0070672_100521502 3300005543 Unclassified 1029
170 Ga0070672_101337984 3300005543 Unclassified 640
171 Ga0070695_100092459 3300005545 Unclassified 2022
172 Ga0070693_100279253 3300005547 Unclassified 1118
173 Ga0070693_100740673 3300005547 Unclassified 723
174 Ga0070665_100029557 3300005548 Bacteria 5516
175 Ga0070665_100106550 3300005548 Bacteria 2805
176 Ga0068855_100039819 3300005563 Bacteria 5578
177 Ga0068855_100159451 3300005563 Unclassified 2562
178 Ga0068855_100238392 3300005563 Bacteria 2033
179 Ga0068855_100396131 3300005563 Unclassified 1514
180 Ga0068855_100541993 3300005563 Unclassified 1260
181 Ga0068855_101921608 3300005563 Bacteria 599
182 Ga0070664_100003107 3300005564 Bacteria 13428
183 Ga0070664_100008604 3300005564 Bacteria 8257
184 Ga0070664_100015317 3300005564 Bacteria 6270
185 Ga0070664_100043360 3300005564 Bacteria 3796
186 Ga0070664_100045426 3300005564 Bacteria 3709
187 Ga0070664_100068067 3300005564 Bacteria 3044
188 Ga0070664_100086955 3300005564 Unclassified 2701
189 Ga0068857_100011886 3300005577 Bacteria 7573
190 Ga0068857_100013634 3300005577 Bacteria 7082
191 Ga0068857_100014309 3300005577 Bacteria 6914
192 Ga0068857_100030380 3300005577 Bacteria 4771
193 Ga0068857_100037809 3300005577 Bacteria 4276
194 Ga0068857_100061266 3300005577 Bacteria 3343
195 Ga0068857_100112427 3300005577 Bacteria 2448
196 Ga0068857_100428261 3300005577 Unclassified 1234
197 Ga0068854_100008247 3300005578 Bacteria 6689
198 Ga0068854_100009638 3300005578 Bacteria 6236
199 Ga0068854_100079478 3300005578 Unclassified 2418
200 Ga0068854_100105987 3300005578 Unclassified 2114
201 Ga0068854_100273088 3300005578 Bacteria 1358
202 Ga0068854_100283110 3300005578 Unclassified 1336
203 Ga0068854_100712687 3300005578 Bacteria 867
204 Ga0068854_102189065 3300005578 Unclassified 511
205 Ga0068856_100004427 3300005614 Bacteria 13984
206 Ga0068856_100025985 3300005614 Bacteria 5710
207 Ga0068856_100043250 3300005614 Bacteria 4432
208 Ga0068856_100092683 3300005614 Bacteria 3006
209 Ga0068852_100029333 3300005616 Bacteria 4519
210 Ga0068852_100117525 3300005616 Bacteria 2428
211 Ga0068852_100333684 3300005616 Bacteria 1476
212 Ga0068852_100373439 3300005616 Bacteria 1397
213 Ga0068852_100554466 3300005616 Bacteria 1150
214 Ga0068852_101010770 3300005616 Unclassified 850
215 Ga0068852_101071807 3300005616 Unclassified 826
216 Ga0068859_100004235 3300005617 Bacteria 14649
217 Ga0068859_100022494 3300005617 Bacteria 6321
218 Ga0068859_100234904 3300005617 Unclassified 1922
219 Ga0068859_100641182 3300005617 Bacteria 1154
220 Ga0068864_100029956 3300005618 Unclassified 4612
221 Ga0068864_100039708 3300005618 Bacteria 4022
222 Ga0068864_100097372 3300005618 Unclassified 2604
223 Ga0068864_101400354 3300005618 Bacteria 701
224 Ga0068861_100261132 3300005719 Bacteria 1483
225 Ga0068861_101690309 3300005719 Bacteria 626
226 Ga0068861_102061703 3300005719 Bacteria 570
227 Ga0068851_10026597 3300005834 Bacteria 2845
228 Ga0068851_10061662 3300005834 Bacteria 1923
229 Ga0068851_10308448 3300005834 Bacteria 911
230 Ga0068870_10902086 3300005840 Unclassified 624
231 Ga0068863_100006933 3300005841 Bacteria 11105
232 Ga0068863_100010745 3300005841 Bacteria 8883
233 Ga0068863_100079788 3300005841 Bacteria 3099
234 Ga0068863_100437991 3300005841 Bacteria 1281
235 Ga0068863_100468018 3300005841 Bacteria 1238
236 Ga0068863_102110033 3300005841 Unclassified 574
237 Ga0068858_100004012 3300005842 Bacteria 14518
238 Ga0068858_100018632 3300005842 Bacteria 6499
239 Ga0068858_100027015 3300005842 Bacteria 5331
240 Ga0068858_100065423 3300005842 Bacteria 3364
241 Ga0068860_100006310 3300005843 Bacteria 11910
242 Ga0068860_100055159 3300005843 Bacteria 3777
243 Ga0068860_100092572 3300005843 Bacteria 2881
244 Ga0068860_100157255 3300005843 Unclassified 2191
245 Ga0068862_100004972 3300005844 Bacteria 11191
246 Ga0068862_100011357 3300005844 Bacteria 7354
247 Ga0068862_100750340 3300005844 Unclassified 949
248 Ga0081540_1304905 3300005983 Unclassified 547
249 Ga0070717_10009496 3300006028 Bacteria 7314
250 Ga0075369_10517425 3300006186 Bacteria 568
251 Ga0075366_10512461 3300006195 Bacteria 742
252 Ga0097621_100002260 3300006237 Bacteria 13171
253 Ga0097621_100739833 3300006237 Bacteria 908
254 Ga0068871_100194221 3300006358 Unclassified 1750
255 Ga0068871_100653729 3300006358 Unclassified 960
256 Ga0075428_100562324 3300006844 Unclassified 1219
257 Ga0075431_101782286 3300006847 Unclassified 572
258 Ga0075434_100330119 3300006871 Unclassified 1546
259 Ga0075429_100880125 3300006880 Unclassified 784
260 Ga0068865_100117195 3300006881 Bacteria 1974
261 Ga0097620_100004235 3300006931 Bacteria 14649
262 Ga0097620_100022494 3300006931 Bacteria 6321
263 Ga0097620_100234878 3300006931 Unclassified 1922
264 Ga0097620_100641185 3300006931 Bacteria 1154
265 Ga0075435_100599049 3300007076 Unclassified 956
266 Ga0105251_10015303 3300009011 Unclassified 4200
267 Ga0105250_10502839 3300009092 Unclassified 550
268 Ga0105240_10023904 3300009093 Bacteria 8071
269 Ga0105245_10114876 3300009098 Bacteria 2508
270 Ga0105245_10255736 3300009098 Bacteria 1703
271 Ga0105247_11408556 3300009101 Unclassified 564
272 Ga0105243_10308782 3300009148 Bacteria 1436
273 Ga0105243_10377173 3300009148 Unclassified 1311
274 Ga0105241_10244250 3300009174 Unclassified 1519
275 Ga0105241_10334066 3300009174 Bacteria 1311
276 Ga0105241_10985064 3300009174 Unclassified 788
277 Ga0105241_11440378 3300009174 Unclassified 661
278 Ga0105242_10011492 3300009176 Bacteria 6806
279 Ga0105248_10012176 3300009177 Bacteria 9488
280 Ga0105248_10044967 3300009177 Unclassified 4951
281 Ga0105248_10110097 3300009177 Unclassified 3105
282 Ga0105248_10207840 3300009177 Bacteria 2206
283 Ga0105248_10845471 3300009177 Unclassified 1033
284 Ga0105237_10016756 3300009545 Bacteria 7608
285 Ga0105237_10066503 3300009545 Unclassified 3599
286 Ga0105237_10116509 3300009545 Bacteria 2665
287 Ga0105238_10007178 3300009551 Bacteria 11143
288 Ga0105249_10024765 3300009553 Bacteria 5395
289 Ga0105249_10034008 3300009553 Bacteria 4617
290 Ga0105249_10505295 3300009553 Unclassified 1254
291 Ga0105239_10050139 3300010375 Bacteria 4579
292 Ga0105239_10806153 3300010375 Bacteria 1076
293 Ga0105239_11886257 3300010375 Bacteria 693
294 Ga0105239_12391736 3300010375 Unclassified 615
295 Ga0105239_12414821 3300010375 Unclassified 612
296 Ga0105246_10047957 3300011119 Bacteria 2919
297 Ga0105246_10476446 3300011119 Unclassified 1055
298 Ga0105246_10595553 3300011119 Unclassified 954
299 Ga0157327_1047241 3300012512 Bacteria 600
300 Ga0157373_10007336 3300013100 Bacteria 8212
301 Ga0157373_10022668 3300013100 Bacteria 4555
302 Ga0157373_10029131 3300013100 Bacteria 3980
303 Ga0157373_10227284 3300013100 Bacteria 1317
304 Ga0157373_10677867 3300013100 Unclassified 754
305 Ga0157373_11114060 3300013100 Bacteria 593
306 Ga0157371_10077341 3300013102 Bacteria 2356
307 Ga0157371_10108652 3300013102 Bacteria 1968
308 Ga0157371_10270757 3300013102 Unclassified 1226
309 Ga0157371_10377051 3300013102 Unclassified 1035
310 Ga0157370_10021821 3300013104 Bacteria 6378
311 Ga0157370_10027504 3300013104 Bacteria 5608
312 Ga0157370_10122073 3300013104 Bacteria 2433
313 Ga0157370_10285642 3300013104 Bacteria 1524
314 Ga0157369_10016388 3300013105 Bacteria 8337
315 Ga0157369_10050844 3300013105 Bacteria 4486
316 Ga0157369_10733591 3300013105 Bacteria 1017
317 Ga0157374_10122784 3300013296 Bacteria 2508
318 Ga0157374_11560643 3300013296 Unclassified 684
319 Ga0163162_10164675 3300013306 Bacteria 2341
320 Ga0163162_10458600 3300013306 Bacteria 1406
321 Ga0163162_10782988 3300013306 Unclassified 1072
322 Ga0163162_11934587 3300013306 Bacteria 675
323 Ga0157372_10069372 3300013307 Bacteria 3964
324 Ga0157372_10119577 3300013307 Bacteria 3024
325 Ga0157372_10131797 3300013307 Bacteria 2876
326 Ga0157372_10371368 3300013307 Unclassified 1667
327 Ga0157372_11123754 3300013307 Bacteria 909
328 Ga0157372_12535076 3300013307 Bacteria 589
329 Ga0157372_13482479 3300013307 Unclassified 500
330 Ga0157375_10049335 3300013308 Bacteria 4123
331 Ga0157375_10401238 3300013308 Bacteria 1538
332 Ga0157375_10620348 3300013308 Bacteria 1239
333 Ga0157375_10640518 3300013308 Bacteria 1220
334 Ga0163163_10009557 3300014325 Bacteria 8664
335 Ga0163163_10065935 3300014325 Unclassified 3595
336 Ga0163163_10273706 3300014325 Bacteria 1739
337 Ga0157380_10543972 3300014326 Bacteria 1138
338 Ga0182008_10015807 3300014497 Unclassified 3930
339 Ga0182008_10427889 3300014497 Unclassified 716
340 Ga0157377_10196732 3300014745 Bacteria 1277
341 Ga0157379_10041754 3300014968 Bacteria 4094
342 Ga0157379_10099770 3300014968 Bacteria 2607
343 Ga0224712_10218980 3300022467 Bacteria 871
344 Ga0207656_10253035 3300025321 Unclassified 863
345 Ga0207656_10469276 3300025321 Bacteria 637
346 Ga0207682_10032938 3300025893 Bacteria 2084
347 Ga0207682_10107479 3300025893 Bacteria 1225
348 Ga0207688_10021924 3300025901 Bacteria 3493
349 Ga0207688_10048322 3300025901 Unclassified 2377
350 Ga0207680_10003921 3300025903 Bacteria 7020
351 Ga0207680_10127623 3300025903 Bacteria 1672
352 Ga0207647_10000910 3300025904 Bacteria 22876
353 Ga0207647_10001423 3300025904 Bacteria 18343
354 Ga0207647_10005982 3300025904 Bacteria 8862
355 Ga0207647_10056077 3300025904 Bacteria 2418
356 Ga0207647_10235766 3300025904 Unclassified 1052
357 Ga0207647_10435397 3300025904 Bacteria 736
358 Ga0207705_10000853 3300025909 Bacteria 24997
359 Ga0207705_10005390 3300025909 Bacteria 9567
360 Ga0207705_10021877 3300025909 Bacteria 4562
361 Ga0207705_10036885 3300025909 Bacteria 3498
362 Ga0207705_10100650 3300025909 Bacteria 2126
363 Ga0207705_10601415 3300025909 Unclassified 855
364 Ga0207654_10606115 3300025911 Bacteria 782
365 Ga0207654_10991711 3300025911 Unclassified 611
366 Ga0207707_10148938 3300025912 Bacteria 2046
367 Ga0207707_10219855 3300025912 Bacteria 1653
368 Ga0207707_10472336 3300025912 Bacteria 1072
369 Ga0207695_10008918 3300025913 Bacteria 12486
370 Ga0207671_10014919 3300025914 Bacteria 6110
371 Ga0207671_10147375 3300025914 Bacteria 1816
372 Ga0207671_11253253 3300025914 Unclassified 579
373 Ga0207660_10005166 3300025917 Bacteria 8484
374 Ga0207660_10008617 3300025917 Bacteria 6596
375 Ga0207660_10606836 3300025917 Unclassified 891
376 Ga0207662_10023904 3300025918 Bacteria 3514
377 Ga0207657_10000962 3300025919 Bacteria 30503
378 Ga0207657_10005030 3300025919 Bacteria 13871
379 Ga0207657_10008887 3300025919 Bacteria 10163
380 Ga0207657_10017773 3300025919 Bacteria 6808
381 Ga0207657_10025608 3300025919 Bacteria 5435
382 Ga0207657_10082361 3300025919 Bacteria 2701
383 Ga0207657_10103321 3300025919 Bacteria 2362
384 Ga0207657_10282627 3300025919 Unclassified 1317
385 Ga0207657_10364155 3300025919 Bacteria 1139
386 Ga0207657_10490350 3300025919 Bacteria 963
387 Ga0207657_10955238 3300025919 Bacteria 659
388 Ga0207649_10001843 3300025920 Bacteria 12115
389 Ga0207649_10047888 3300025920 Bacteria 2634
390 Ga0207649_10071095 3300025920 Bacteria 2221
391 Ga0207649_10177284 3300025920 Bacteria 1489
392 Ga0207649_10203031 3300025920 Bacteria 1401
393 Ga0207649_10243771 3300025920 Bacteria 1291
394 Ga0207649_10288567 3300025920 Bacteria 1196
395 Ga0207649_10655660 3300025920 Unclassified 811
396 Ga0207649_10874786 3300025920 Bacteria 704
397 Ga0207652_10001100 3300025921 Bacteria 24430
398 Ga0207652_10068224 3300025921 Bacteria 3085
399 Ga0207652_10191918 3300025921 Bacteria 1837
400 Ga0207652_11122857 3300025921 Unclassified 687
401 Ga0207681_10352460 3300025923 Unclassified 1178
402 Ga0207681_10540932 3300025923 Bacteria 958
403 Ga0207681_11097026 3300025923 Unclassified 668
404 Ga0207694_10005672 3300025924 Bacteria 9577
405 Ga0207650_10208074 3300025925 Bacteria 1570
406 Ga0207650_10236767 3300025925 Bacteria 1474
407 Ga0207650_10302049 3300025925 Bacteria 1307
408 Ga0207659_10079422 3300025926 Bacteria 2421
409 Ga0207659_10762900 3300025926 Bacteria 830
410 Ga0207659_10825668 3300025926 Bacteria 796
411 Ga0207687_10077207 3300025927 Unclassified 2395
412 Ga0207664_10624136 3300025929 Unclassified 968
413 Ga0207644_10035225 3300025931 Bacteria 3505
414 Ga0207644_10035438 3300025931 Unclassified 3496
415 Ga0207644_10040022 3300025931 Bacteria 3311
416 Ga0207644_10267414 3300025931 Bacteria 1369
417 Ga0207644_10304955 3300025931 Bacteria 1284
418 Ga0207644_10579374 3300025931 Unclassified 930
419 Ga0207644_10621336 3300025931 Bacteria 898
420 Ga0207644_10899196 3300025931 Bacteria 742
421 Ga0207690_10002177 3300025932 Bacteria 11948
422 Ga0207690_10009048 3300025932 Bacteria 5911
423 Ga0207690_10010356 3300025932 Bacteria 5537
424 Ga0207690_10023439 3300025932 Bacteria 3851
425 Ga0207690_10046744 3300025932 Bacteria 2868
426 Ga0207690_10110327 3300025932 Bacteria 1980
427 Ga0207690_10122837 3300025932 Unclassified 1889
428 Ga0207690_10180910 3300025932 Bacteria 1587
429 Ga0207690_10236175 3300025932 Bacteria 1406
430 Ga0207690_10514499 3300025932 Bacteria 969
431 Ga0207690_10585582 3300025932 Bacteria 910
432 Ga0207690_10890930 3300025932 Bacteria 738
433 Ga0207706_10001681 3300025933 Bacteria 21822
434 Ga0207706_10016868 3300025933 Bacteria 6588
435 Ga0207706_10035222 3300025933 Bacteria 4452
436 Ga0207706_10035849 3300025933 Bacteria 4408
437 Ga0207706_10036821 3300025933 Bacteria 4346
438 Ga0207706_10206695 3300025933 Unclassified 1721
439 Ga0207706_10730880 3300025933 Bacteria 844
440 Ga0207706_10734883 3300025933 Bacteria 842
441 Ga0207706_10921953 3300025933 Unclassified 737
442 Ga0207686_10024015 3300025934 Unclassified 3526
443 Ga0207709_10175537 3300025935 Unclassified 1508
444 Ga0207670_10136030 3300025936 Bacteria 1806
445 Ga0207670_11711529 3300025936 Unclassified 535
446 Ga0207669_10032702 3300025937 Bacteria 2925
447 Ga0207669_10202498 3300025937 Unclassified 1442
448 Ga0207669_11045954 3300025937 Unclassified 687
449 Ga0207704_10782533 3300025938 Unclassified 796
450 Ga0207665_10261566 3300025939 Unclassified 1282
451 Ga0207691_10028017 3300025940 Bacteria 5278
452 Ga0207691_10054881 3300025940 Bacteria 3634
453 Ga0207691_10057901 3300025940 Bacteria 3526
454 Ga0207691_11403634 3300025940 Unclassified 574
455 Ga0207711_10008511 3300025941 Bacteria 8582
456 Ga0207711_10184390 3300025941 Bacteria 1899
457 Ga0207711_10250351 3300025941 Bacteria 1627
458 Ga0207689_10003104 3300025942 Bacteria 15265
459 Ga0207689_10258486 3300025942 Bacteria 1441
460 Ga0207689_10410381 3300025942 Bacteria 1129
461 Ga0207689_11123487 3300025942 Bacteria 662
462 Ga0207661_10023786 3300025944 Bacteria 4634
463 Ga0207679_10006355 3300025945 Bacteria 7468
464 Ga0207679_10010430 3300025945 Bacteria 5982
465 Ga0207679_10018949 3300025945 Bacteria 4618
466 Ga0207679_10029504 3300025945 Bacteria 3820
467 Ga0207679_10091656 3300025945 Bacteria 2352
468 Ga0207679_10139243 3300025945 Unclassified 1959
469 Ga0207667_10004508 3300025949 Bacteria 17062
470 Ga0207667_10007822 3300025949 Bacteria 12775
471 Ga0207667_10020852 3300025949 Bacteria 7277
472 Ga0207667_10097564 3300025949 Bacteria 3033
473 Ga0207667_11815955 3300025949 Bacteria 573
474 Ga0207651_10110575 3300025960 Bacteria 2062
475 Ga0207651_10325327 3300025960 Bacteria 1286
476 Ga0207651_10339234 3300025960 Bacteria 1262
477 Ga0207651_10984731 3300025960 Unclassified 753
478 Ga0207712_10001181 3300025961 Bacteria 18076
479 Ga0207712_11413752 3300025961 Bacteria 623
480 Ga0207668_10073861 3300025972 Bacteria 2445
481 Ga0207640_10002781 3300025981 Bacteria 9378
482 Ga0207640_10014468 3300025981 Bacteria 4545
483 Ga0207640_10134994 3300025981 Bacteria 1790
484 Ga0207640_10493061 3300025981 Bacteria 1018
485 Ga0207640_10790105 3300025981 Unclassified 821
486 Ga0207640_10848610 3300025981 Unclassified 795
487 Ga0207640_11562658 3300025981 Unclassified 594
488 Ga0207658_10049889 3300025986 Bacteria 3077
489 Ga0207658_10065477 3300025986 Bacteria 2729
490 Ga0207658_10153755 3300025986 Unclassified 1877
491 Ga0207658_10436121 3300025986 Unclassified 1158
492 Ga0207658_11422049 3300025986 Unclassified 634
493 Ga0207677_10096497 3300026023 Bacteria 2163
494 Ga0207677_10709019 3300026023 Bacteria 893
495 Ga0207677_11627085 3300026023 Unclassified 598
496 Ga0207703_10011955 3300026035 Bacteria 6762
497 Ga0207703_10028182 3300026035 Bacteria 4425
498 Ga0207639_10019533 3300026041 Bacteria 4835
499 Ga0207639_10026995 3300026041 Bacteria 4177
500 Ga0207639_10206250 3300026041 Bacteria 1689
501 Ga0207639_10582942 3300026041 Bacteria 1030
502 Ga0207678_10002042 3300026067 Bacteria 18312
503 Ga0207678_10002194 3300026067 Bacteria 17632
504 Ga0207678_10003505 3300026067 Bacteria 14109
505 Ga0207678_10040809 3300026067 Bacteria 4023
506 Ga0207678_10179021 3300026067 Bacteria 1810
507 Ga0207678_10205233 3300026067 Bacteria 1686
508 Ga0207678_10242683 3300026067 Bacteria 1543
509 Ga0207678_10248894 3300026067 Bacteria 1522
510 Ga0207702_10018149 3300026078 Bacteria 5821
511 Ga0207641_10031504 3300026088 Bacteria 4398
512 Ga0207641_10031686 3300026088 Bacteria 4385
513 Ga0207641_10054196 3300026088 Bacteria 3402
514 Ga0207641_10133802 3300026088 Bacteria 2229
515 Ga0207641_10463989 3300026088 Bacteria 1225
516 Ga0207641_10547504 3300026088 Unclassified 1128
517 Ga0207648_10202586 3300026089 Bacteria 1760
518 Ga0207648_11048889 3300026089 Bacteria 764
519 Ga0207676_10021105 3300026095 Bacteria 4775
520 Ga0207676_10189029 3300026095 Bacteria 1810
521 Ga0207676_10289594 3300026095 Bacteria 1490
522 Ga0207676_10912135 3300026095 Bacteria 862
523 Ga0207676_11070284 3300026095 Unclassified 796
524 Ga0207674_10000151 3300026116 Bacteria 81529
525 Ga0207674_10000410 3300026116 Bacteria 55768
526 Ga0207674_10003707 3300026116 Bacteria 18662
527 Ga0207674_10017187 3300026116 Bacteria 7893
528 Ga0207674_10028333 3300026116 Bacteria 5913
529 Ga0207674_10137143 3300026116 Bacteria 2408
530 Ga0207674_10314836 3300026116 Bacteria 1514
531 Ga0207674_10551206 3300026116 Bacteria 1114
532 Ga0207675_100277227 3300026118 Bacteria 1628
533 Ga0207675_101206675 3300026118 Bacteria 777
534 Ga0207683_10197429 3300026121 Bacteria 1828
535 Ga0207683_10952870 3300026121 Unclassified 797
536 Ga0207698_10004072 3300026142 Bacteria 8873
537 Ga0207698_10023373 3300026142 Unclassified 4317
538 Ga0207698_10048265 3300026142 Bacteria 3231
539 Ga0207698_10234064 3300026142 Bacteria 1669
540 Ga0207698_10508412 3300026142 Bacteria 1174
541 Ga0207698_10966677 3300026142 Bacteria 861
542 Ga0207698_11685858 3300026142 Bacteria 649
543 Ga0268266_10030954 3300028379 Bacteria 4544
544 Ga0268266_10038372 3300028379 Bacteria 4078
545 Ga0268265_10057807 3300028380 Bacteria 2958
546 Ga0268265_10253782 3300028380 Bacteria 1559
547 Ga0268265_10301237 3300028380 Bacteria 1443
548 Ga0268265_10998793 3300028380 Unclassified 826
549 Ga0268264_10049087 3300028381 Bacteria 3510
550 Ga0268264_10273068 3300028381 Unclassified 1580
551 Ga0268264_10649741 3300028381 Bacteria 1044
552 Ga0307513_10353201 3300031456 Bacteria 1217
553 Ga0307408_100326265 3300031548 Bacteria 1295
554 Ga0307408_100840450 3300031548 Bacteria 836
555 Ga0307408_102415430 3300031548 Unclassified 510
556 Ga0307405_10040033 3300031731 Bacteria 2836
557 Ga0307413_10121324 3300031824 Bacteria 1771
558 Ga0307413_10128200 3300031824 Bacteria 1731
559 Ga0307410_10290792 3300031852 Bacteria 1286
560 Ga0307410_11417799 3300031852 Unclassified 610
561 Ga0307406_10079831 3300031901 Bacteria 2171
562 Ga0307406_10199142 3300031901 Bacteria 1472
563 Ga0307406_10388123 3300031901 Bacteria 1103
564 Ga0307412_10093856 3300031911 Bacteria 2106
565 Ga0307409_100018161 3300031995 Bacteria 4715
566 Ga0307409_100840066 3300031995 Bacteria 928
567 Ga0307409_100964229 3300031995 Unclassified 869
568 Ga0307416_100054970 3300032002 Bacteria 3203
569 Ga0307416_100710272 3300032002 Bacteria 1095
570 Ga0307416_100886603 3300032002 Bacteria 991
571 Ga0307414_10165794 3300032004 Bacteria 1760
572 Ga0307411_10123468 3300032005 Bacteria 1878
573 Ga0307411_10443911 3300032005 Bacteria 1083
574 Ga0307411_10883957 3300032005 Bacteria 793
575 Ga0307415_100007613 3300032126 Bacteria 5937
576 Ga0307415_100589868 3300032126 Unclassified 987
577 Ga0373941_0334621 3300035115 Unclassified 612
578 Ga0373931_0304457 3300035691 Bacteria 985
579 Ga0395899_0001165 3300037312 Bacteria 23226
580 Ga0395899_0002476 3300037312 Bacteria 14982
581 Ga0395899_0010292 3300037312 Bacteria 7170
582 Ga0395899_0010948 3300037312 Bacteria 6949
583 Ga0395899_0061872 3300037312 Bacteria 2757
584 Ga0395899_0069989 3300037312 Bacteria 2568
585 Ga0395899_0139182 3300037312 Bacteria 1728
586 Ga0395899_0289756 3300037312 Unclassified 1111
587 Ga0395899_0295507 3300037312 Unclassified 1098
588 Ga0395899_0342913 3300037312 Unclassified 1001
589 Ga0395899_0454743 3300037312 Unclassified 838
590 Ga0395900_0002233 3300037418 Bacteria 21590
591 Ga0395900_0003176 3300037418 Bacteria 17816
592 Ga0395900_0018282 3300037418 Bacteria 7151
593 Ga0395900_0031690 3300037418 Bacteria 5434
594 Ga0395900_0038945 3300037418 Bacteria 4900
595 Ga0395900_0039272 3300037418 Bacteria 4876
596 Ga0395900_0046747 3300037418 Bacteria 4456
597 Ga0395900_0088446 3300037418 Bacteria 3184
598 Ga0395900_0102203 3300037418 Bacteria 2945
599 Ga0395900_0126713 3300037418 Bacteria 2619
600 Ga0395900_0129338 3300037418 Bacteria 2588
601 Ga0395900_0142048 3300037418 Unclassified 2458
602 Ga0395900_0164404 3300037418 Bacteria 2262
603 Ga0395900_0219630 3300037418 Bacteria 1916
604 Ga0395900_0375719 3300037418 Unclassified 1390
605 Ga0395900_0387219 3300037418 Bacteria 1365
606 Ga0395900_0512787 3300037418 Unclassified 1148
607 Ga0395900_0620871 3300037418 Bacteria 1020
608 Ga0395900_0683220 3300037418 Unclassified 961
609 Ga0395900_0759567 3300037418 Bacteria 899
610 Ga0395900_1229477 3300037418 Bacteria 664
611 Ga0395900_1425491 3300037418 Bacteria 605
612 Ga0395900_1577484 3300037418 Unclassified 568
613 Ga0395898_0004873 3300037466 Bacteria 14574
614 Ga0395898_0010099 3300037466 Bacteria 9879
615 Ga0395898_0027301 3300037466 Bacteria 5733
616 Ga0395898_0049776 3300037466 Bacteria 4105
617 Ga0395898_0264466 3300037466 Bacteria 1640
618 Ga0395898_0282755 3300037466 Bacteria 1582
619 Ga0395898_0314351 3300037466 Bacteria 1494
620 Ga0395898_0496903 3300037466 Bacteria 1160
621 Ga0395898_0609267 3300037466 Bacteria 1035
622 Ga0395898_1356200 3300037466 Bacteria 640
623 Ga0395898_1765788 3300037466 Unclassified 540
624 Ga0395905_0001302 3300037471 Bacteria 30624
625 Ga0395905_0003014 3300037471 Bacteria 18246
626 Ga0395905_0007273 3300037471 Bacteria 11034
627 Ga0395905_0013236 3300037471 Bacteria 7915
628 Ga0395905_0014464 3300037471 Bacteria 7533
629 Ga0395905_0015273 3300037471 Bacteria 7301
630 Ga0395905_0023506 3300037471 Bacteria 5823
631 Ga0395905_0025264 3300037471 Bacteria 5602
632 Ga0395905_0029822 3300037471 Bacteria 5142
633 Ga0395905_0034865 3300037471 Bacteria 4724
634 Ga0395905_0035249 3300037471 Bacteria 4698
635 Ga0395905_0035324 3300037471 Bacteria 4693
636 Ga0395905_0046811 3300037471 Bacteria 4055
637 Ga0395905_0048894 3300037471 Bacteria 3962
638 Ga0395905_0053046 3300037471 Bacteria 3796
639 Ga0395905_0058065 3300037471 Unclassified 3619
640 Ga0395905_0071538 3300037471 Bacteria 3251
641 Ga0395905_0107941 3300037471 Bacteria 2613
642 Ga0395905_0112597 3300037471 Bacteria 2556
643 Ga0395905_0132355 3300037471 Bacteria 2346
644 Ga0395905_0168113 3300037471 Bacteria 2060
645 Ga0395905_0238235 3300037471 Bacteria 1701
646 Ga0395905_0292331 3300037471 Bacteria 1516
647 Ga0395905_0293832 3300037471 Bacteria 1512
648 Ga0395905_0449700 3300037471 Unclassified 1186
649 Ga0395905_0775400 3300037471 Bacteria 862
650 Ga0395905_0997467 3300037471 Unclassified 740
651 Ga0395905_1055491 3300037471 Bacteria 715
652 Ga0395905_1076743 3300037471 Unclassified 707
653 Ga0395905_1543476 3300037471 Unclassified 569
654 Ga0395905_1788106 3300037471 Unclassified 520
655 Ga0395901_0010449 3300038443 Bacteria 9403
656 Ga0395901_0019891 3300038443 Bacteria 6869
657 Ga0395901_0025745 3300038443 Bacteria 6040
658 Ga0395901_0029136 3300038443 Bacteria 5681
659 Ga0395901_0035592 3300038443 Bacteria 5144
660 Ga0395901_0038033 3300038443 Bacteria 4977
661 Ga0395901_0119354 3300038443 Bacteria 2771
662 Ga0395901_0133372 3300038443 Bacteria 2610
663 Ga0395901_0139054 3300038443 Bacteria 2552
664 Ga0395901_0151256 3300038443 Bacteria 2439
665 Ga0395901_0175417 3300038443 Bacteria 2248
666 Ga0395901_0187948 3300038443 Bacteria 2166
667 Ga0395901_0381138 3300038443 Bacteria 1451
668 Ga0395901_0542401 3300038443 Unclassified 1179
669 Ga0395901_0997827 3300038443 Unclassified 813
670 Ga0395901_1147400 3300038443 Bacteria 745
671 Ga0395901_1268186 3300038443 Bacteria 700
672 Ga0395901_1356926 3300038443 Bacteria 671
673 Ga0395901_1535380 3300038443 Bacteria 621
674 Ga0395901_1775458 3300038443 Unclassified 566
675 Ga0436365_0986541 3300039437 Bacteria 20562
676 Ga0436363_1629466 3300039450 Unclassified 846
677 Ga0439447_118632 3300041407 Bacteria 607
678 Ga0439465_0083785 3300041413 Bacteria 1084
679 Ga0439432_045879 3300042006 Bacteria 1374
680 Ga0439449_0036781 3300042007 Bacteria 1821
681 Ga0439455_0040748 3300042012 Unclassified 1188
682 Ga0439458_0000044 3300042157 Bacteria 20076
683 Ga0439458_0001191 3300042157 Bacteria 6615
684 Ga0439459_0219257 3300042438 Bacteria 526
685 Ga0439464_0000895 3300042439 Bacteria 6655
686 Ga0466969_0004255 3300044656 Bacteria 7609
687 Ga0466965_0438785 3300044683 Bacteria 726
688 Ga0466966_0046173 3300044684 Bacteria 2782
689 Ga0466961_0037700 3300044693 Bacteria 3101
690 Ga0466963_0133998 3300044694 Unclassified 1713
691 Ga0466963_1132299 3300044694 Unclassified 550
692 Ga0466971_0047123 3300044719 Unclassified 1937
693 Ga0466970_0147751 3300044765 Bacteria 1297
694 Ga0466957_0040787 3300044842 Bacteria 2805
695 Ga0466957_0145544 3300044842 Bacteria 1529
696 Ga0466957_0271221 3300044842 Bacteria 1133
697 Ga0466959_0365286 3300045049 Unclassified 983
698 Ga0466958_0521928 3300045836 Bacteria 771
699 Ga0466967_0011818 3300045976 Bacteria 6639
700 Ga0466967_0094538 3300045976 Plasmid 2722
701 Ga0466967_0403564 3300045976 Unclassified 1330
702 Ga0466967_0620856 3300045976 Unclassified 1068
703 Ga0466967_1512886 3300045976 Bacteria 668
704 Ga0495584_0656414 3300046491 Unclassified 535
705 Ga0495633_0149962 3300046558 Unclassified 1077
706 Ga0495669_0161656 3300046684 Bacteria 1063
707 Ga0495669_0224553 3300046684 Bacteria 900
708 Ga0495669_0340980 3300046684 Unclassified 724
709 Ga0495670_0630852 3300046691 Unclassified 584
710 Ga0495677_0304378 3300047445 Bacteria 627
711 Ga0496100_1123886 3300048903 Unclassified 619
712 Ga0496101_0223388 3300048904 Unclassified 1462
713 Ga0496101_0848583 3300048904 Unclassified 720
714 Ga0496102_0078330 3300048905 Unclassified 3042
715 Ga0496102_0663104 3300048905 Unclassified 966
716 Ga0496102_1826272 3300048905 Unclassified 525
717 Ga0496103_0239014 3300048906 Bacteria 1168
718 Ga0496104_0180909 3300048907 Unclassified 2019
719 Ga0496104_1460378 3300048907 Unclassified 587
720 Ga0496105_0087574 3300048908 Unclassified 2573
721 Ga0496106_0083251 3300048909 Unclassified 2460
722 Ga0496106_0828848 3300048909 Unclassified 733
723 Ga0496107_0020104 3300048910 Bacteria 4715
724 Ga0496107_0908296 3300048910 Unclassified 642
725 Ga0496108_0006067 3300048911 Bacteria 9772
726 Ga0496109_0015360 3300048912 Bacteria 6670
727 Ga0496109_0369814 3300048912 Bacteria 1354
728 Ga0496110_0015740 3300048913 Bacteria 6302
729 Ga0496110_0347880 3300048913 Unclassified 1350
730 Ga0496110_0371396 3300048913 Bacteria 1303
731 Ga0496110_0400112 3300048913 Unclassified 1252
732 Ga0496110_1371982 3300048913 Unclassified 616
733 Ga0496111_0002395 3300048914 Bacteria 11304
734 Ga0496112_0111779 3300048915 Unclassified 2701
735 Ga0496112_0226194 3300048915 Bacteria 1826
736 Ga0496112_1148888 3300048915 Unclassified 694
737 Ga0496113_0000705 3300048916 Bacteria 17089
738 Ga0496113_0090326 3300048916 Bacteria 2359
739 Ga0501067_0011658 3300049583 Bacteria 4869
740 Ga0501067_0052413 3300049583 Bacteria 2261
741 Ga0501068_0436233 3300049584 Unclassified 847
742 Ga0501071_0075239 3300049587 Unclassified 2465
743 Ga0501201_038254 3300049651 Bacteria 569
744 Ga0501202_176554 3300049652 Unclassified 574
745 Ga0501216_061818 3300049660 Bacteria 757
746 Ga0501217_037859 3300049661 Bacteria 1216
747 Ga0501223_023733 3300049663 Bacteria 1195
748 Ga0501233_038509 3300049668 Bacteria 1114
749 Ga0501235_171441 3300049669 Bacteria 573
750 Ga0501240_021790 3300049673 Bacteria 971
751 Ga0501242_008440 3300049674 Bacteria 1205
752 Ga0501243_051401 3300049675 Unclassified 745
753 Ga0501248_037463 3300049678 Bacteria 580
754 Ga0501249_084455 3300049679 Bacteria 749
755 Ga0501234_006733 3300049707 Bacteria 1797
756 Ga0501245_036012 3300049708 Bacteria 835
757 Ga0501268_001972 3300049765 Bacteria 2637
758 Ga0501273_000968 3300049770 Bacteria 2567
759 nmdc:mga0k408_761468_c1 3300050493 Unclassified 565
760 nmdc:mga09592_742486_c1 3300050508 Unclassified 833
761 nmdc:mga0qj67_172027_c1 3300050509 Bacteria 1759
762 nmdc:mga06r32_232233_c1 3300050510 Bacteria 1832
763 nmdc:mga0rr50_556457_c1 3300050513 Unclassified 977
764 nmdc:mga0rr50_801870_c1 3300050513 Unclassified 803
765 nmdc:mga0a205_1007_c1 3300050515 Bacteria 23371
766 nmdc:mga0sz30_465739_c1 3300050516 Bacteria 568
767 Ga0587073_0310087 3300059492 Unclassified 517
768 Ga0466962_0014061 3300061719 Bacteria 3855
769 Ga0213876_10001423
770 JGI24736J21556_1030298
771 JGI24741J21665_1008559
772 JGI24741J21665_1021003
773 JGI24752J21851_1007996
774 JGI24740J21852_10001875
775 JGI24740J21852_10002541
776 JGI24740J21852_10016406
777 JGI24739J22299_10000368
778 JGI24739J22299_10066850
779 JGI24737J22298_10000529
780 JGI24737J22298_10000723
781 JGI24737J22298_10011722
782 JGI24737J22298_10018837
783 JGI24743J22301_10000217
784 JGI24735J21928_10009535
785 JGI24735J21928_10032002
786 JGI24735J21928_10050993
787 JGI24735J21928_10056802
788 JGI24735J21928_10092777
789 JGI24738J21930_10005571
790 rootH2_10130912
791 rootH1_10001288
792 Ga0065712_10099318
793 Ga0065712_10478642
794 Ga0065715_10535615
795 Ga0070658_10006977
796 Ga0070658_10015670
797 Ga0070658_10049131
798 Ga0070658_10049902
799 Ga0070658_10071696
800 Ga0070658_10140484
801 Ga0070658_10325955
802 Ga0070658_11734371
803 Ga0070676_10317327
804 Ga0070683_100004703
805 Ga0070683_100015584
806 Ga0070683_100109802
807 Ga0070690_100551506
808 Ga0070670_100027668
809 Ga0070670_100040725
810 Ga0070670_100086741
811 Ga0070670_100205569
812 Ga0070677_10016684
813 Ga0070677_10055228
814 Ga0068869_100064659
815 Ga0068869_100506831
816 Ga0068869_100680076
817 Ga0068869_100997926
818 Ga0070666_10031902
819 Ga0070666_10172973
820 Ga0070680_100000845
821 Ga0070680_100005107
822 Ga0070680_100552122
823 Ga0070680_101755296
824 Ga0070682_100027232
825 Ga0070682_100096458
826 Ga0070682_100232669
827 Ga0068868_100154342
828 Ga0068868_100307729
829 Ga0068868_102394998
830 Ga0070660_100000292
831 Ga0070660_100005614
832 Ga0070660_100023314
833 Ga0070660_100044041
834 Ga0070660_100080370
835 Ga0070660_100136878
836 Ga0070660_100279400
837 Ga0070660_100279580
838 Ga0070689_100175591
839 Ga0070689_101608234
840 Ga0070691_10002168
841 Ga0070687_100032815
842 Ga0070661_100006185
843 Ga0070661_100022295
844 Ga0070661_100058516
845 Ga0070661_100145705
846 Ga0070661_100293259
847 Ga0070661_100362001
848 Ga0070661_100602476
849 Ga0070661_101327113
850 Ga0070692_10000390
851 Ga0070692_10011350
852 Ga0070668_100087639
853 Ga0070668_101468068
854 Ga0070669_100254443
855 Ga0070669_100367084
856 Ga0070669_100507000
857 Ga0070669_101815873
858 Ga0070675_100014309
859 Ga0070675_100301056
860 Ga0070675_100543867
861 Ga0070671_100023911
862 Ga0070671_100026744
863 Ga0070671_100115117
864 Ga0070671_100236787
865 Ga0070671_100513708
866 Ga0070671_101745171
867 Ga0070674_100088728
868 Ga0070674_100147827
869 Ga0070674_100202056
870 Ga0070674_100220887
871 Ga0070674_101161134
872 Ga0070673_100029978
873 Ga0070673_100048207
874 Ga0070673_100051485
875 Ga0070659_100003770
876 Ga0070659_100004716
877 Ga0070659_100005750
878 Ga0070659_100008695
879 Ga0070659_100019161
880 Ga0070659_100027038
881 Ga0070659_100030696
882 Ga0070659_100134317
883 Ga0070659_100134582
884 Ga0070659_100330501
885 Ga0070659_100398256
886 Ga0070659_100508943
887 Ga0070659_100819745
888 Ga0070667_100056382
889 Ga0070667_100932715
890 Ga0070667_101033606
891 Ga0070667_102038549
892 Ga0070714_100514322
893 Ga0070713_100050509
894 Ga0070694_100062800
895 Ga0070663_100020500
896 Ga0070663_100023487
897 Ga0070663_100156971
898 Ga0070663_100238667
899 Ga0070663_100634431
900 Ga0070663_100651552
901 Ga0070663_101730106
902 Ga0070678_100092099
903 Ga0070678_100722307
904 Ga0070662_100012232
905 Ga0070662_100020845
906 Ga0070662_100027900
907 Ga0070662_100051542
908 Ga0070662_100072217
909 Ga0070662_100095149
910 Ga0070662_100150231
911 Ga0070662_100185786
912 Ga0070681_10069863
913 Ga0070681_10090488
914 Ga0070681_10158006
915 Ga0070681_10457878
916 Ga0070681_10570212
917 Ga0070681_11062188
918 Ga0068867_100347978
919 Ga0068867_100499070
920 Ga0068867_101806709
921 Ga0074259_10894309
922 Ga0070679_100023597
923 Ga0070679_100094201
924 Ga0070679_100250873
925 Ga0070679_100641217
926 Ga0070684_100014486
927 Ga0070684_100070593
928 Ga0068853_100009560
929 Ga0068853_100031007
930 Ga0068853_100085473
931 Ga0068853_100238978
932 Ga0068853_101106044
933 Ga0068853_101453305
934 Ga0070672_100038083
935 Ga0070672_100053878
936 Ga0070672_100085207
937 Ga0070672_100521502
938 Ga0070672_101337984
939 Ga0070695_100092459
940 Ga0070693_100279253
941 Ga0070693_100740673
942 Ga0070665_100029557
943 Ga0070665_100106550
944 Ga0068855_100039819
945 Ga0068855_100159451
946 Ga0068855_100238392
947 Ga0068855_100396131
948 Ga0068855_100541993
949 Ga0068855_101921608
950 Ga0070664_100003107
951 Ga0070664_100008604
952 Ga0070664_100015317
953 Ga0070664_100043360
954 Ga0070664_100045426
955 Ga0070664_100068067
956 Ga0070664_100086955
957 Ga0068857_100011886
958 Ga0068857_100013634
959 Ga0068857_100014309
960 Ga0068857_100030380
961 Ga0068857_100037809
962 Ga0068857_100061266
963 Ga0068857_100112427
964 Ga0068857_100428261
965 Ga0068854_100008247
966 Ga0068854_100009638
967 Ga0068854_100079478
968 Ga0068854_100105987
969 Ga0068854_100273088
970 Ga0068854_100283110
971 Ga0068854_100712687
972 Ga0068854_102189065
973 Ga0068856_100004427
974 Ga0068856_100025985
975 Ga0068856_100043250
976 Ga0068856_100092683
977 Ga0068852_100029333
978 Ga0068852_100117525
979 Ga0068852_100333684
980 Ga0068852_100373439
981 Ga0068852_100554466
982 Ga0068852_101010770
983 Ga0068852_101071807
984 Ga0068859_100004235
985 Ga0068859_100022494
986 Ga0068859_100234904
987 Ga0068859_100641182
988 Ga0068864_100029956
989 Ga0068864_100039708
990 Ga0068864_100097372
991 Ga0068864_101400354
992 Ga0068861_100261132
993 Ga0068861_101690309
994 Ga0068861_102061703
995 Ga0068851_10026597
996 Ga0068851_10061662
997 Ga0068851_10308448
998 Ga0068870_10902086
999 Ga0068863_100006933
1000 Ga0068863_100010745
1001 Ga0068863_100079788
1002 Ga0068863_100437991
1003 Ga0068863_100468018
1004 Ga0068863_102110033
1005 Ga0068858_100004012
1006 Ga0068858_100018632
1007 Ga0068858_100027015
1008 Ga0068858_100065423
1009 Ga0068860_100006310
1010 Ga0068860_100055159
1011 Ga0068860_100092572
1012 Ga0068860_100157255
1013 Ga0068862_100004972
1014 Ga0068862_100011357
1015 Ga0068862_100750340
1016 Ga0081540_1304905
1017 Ga0070717_10009496
1018 Ga0075369_10517425
1019 Ga0075366_10512461
1020 Ga0097621_100002260
1021 Ga0097621_100739833
1022 Ga0068871_100194221
1023 Ga0068871_100653729
1024 Ga0075428_100562324
1025 Ga0075431_101782286
1026 Ga0075434_100330119
1027 Ga0075429_100880125
1028 Ga0068865_100117195
1029 Ga0097620_100004235
1030 Ga0097620_100022494
1031 Ga0097620_100234878
1032 Ga0097620_100641185
1033 Ga0075435_100599049
1034 Ga0105251_10015303
1035 Ga0105250_10502839
1036 Ga0105240_10023904
1037 Ga0105245_10114876
1038 Ga0105245_10255736
1039 Ga0105247_11408556
1040 Ga0105243_10308782
1041 Ga0105243_10377173
1042 Ga0105241_10244250
1043 Ga0105241_10334066
1044 Ga0105241_10985064
1045 Ga0105241_11440378
1046 Ga0105242_10011492
1047 Ga0105248_10012176
1048 Ga0105248_10044967
1049 Ga0105248_10110097
1050 Ga0105248_10207840
1051 Ga0105248_10845471
1052 Ga0105237_10016756
1053 Ga0105237_10066503
1054 Ga0105237_10116509
1055 Ga0105238_10007178
1056 Ga0105249_10024765
1057 Ga0105249_10034008
1058 Ga0105249_10505295
1059 Ga0105239_10050139
1060 Ga0105239_10806153
1061 Ga0105239_11886257
1062 Ga0105239_12391736
1063 Ga0105239_12414821
1064 Ga0105246_10047957
1065 Ga0105246_10476446
1066 Ga0105246_10595553
1067 Ga0157327_1047241
1068 Ga0157373_10007336
1069 Ga0157373_10022668
1070 Ga0157373_10029131
1071 Ga0157373_10227284
1072 Ga0157373_10677867
1073 Ga0157373_11114060
1074 Ga0157371_10077341
1075 Ga0157371_10108652
1076 Ga0157371_10270757
1077 Ga0157371_10377051
1078 Ga0157370_10021821
1079 Ga0157370_10027504
1080 Ga0157370_10122073
1081 Ga0157370_10285642
1082 Ga0157369_10016388
1083 Ga0157369_10050844
1084 Ga0157369_10733591
1085 Ga0157374_10122784
1086 Ga0157374_11560643
1087 Ga0163162_10164675
1088 Ga0163162_10458600
1089 Ga0163162_10782988
1090 Ga0163162_11934587
1091 Ga0157372_10069372
1092 Ga0157372_10119577
1093 Ga0157372_10131797
1094 Ga0157372_10371368
1095 Ga0157372_11123754
1096 Ga0157372_12535076
1097 Ga0157372_13482479
1098 Ga0157375_10049335
1099 Ga0157375_10401238
1100 Ga0157375_10620348
1101 Ga0157375_10640518
1102 Ga0163163_10009557
1103 Ga0163163_10065935
1104 Ga0163163_10273706
1105 Ga0157380_10543972
1106 Ga0182008_10015807
1107 Ga0182008_10427889
1108 Ga0157377_10196732
1109 Ga0157379_10041754
1110 Ga0157379_10099770
1111 Ga0224712_10218980
1112 Ga0207656_10253035
1113 Ga0207656_10469276
1114 Ga0207682_10032938
1115 Ga0207682_10107479
1116 Ga0207688_10021924
1117 Ga0207688_10048322
1118 Ga0207680_10003921
1119 Ga0207680_10127623
1120 Ga0207647_10000910
1121 Ga0207647_10001423
1122 Ga0207647_10005982
1123 Ga0207647_10056077
1124 Ga0207647_10235766
1125 Ga0207647_10435397
1126 Ga0207705_10000853
1127 Ga0207705_10005390
1128 Ga0207705_10021877
1129 Ga0207705_10036885
1130 Ga0207705_10100650
1131 Ga0207705_10601415
1132 Ga0207654_10606115
1133 Ga0207654_10991711
1134 Ga0207707_10148938
1135 Ga0207707_10219855
1136 Ga0207707_10472336
1137 Ga0207695_10008918
1138 Ga0207671_10014919
1139 Ga0207671_10147375
1140 Ga0207671_11253253
1141 Ga0207660_10005166
1142 Ga0207660_10008617
1143 Ga0207660_10606836
1144 Ga0207662_10023904
1145 Ga0207657_10000962
1146 Ga0207657_10005030
1147 Ga0207657_10008887
1148 Ga0207657_10017773
1149 Ga0207657_10025608
1150 Ga0207657_10082361
1151 Ga0207657_10103321
1152 Ga0207657_10282627
1153 Ga0207657_10364155
1154 Ga0207657_10490350
1155 Ga0207657_10955238
1156 Ga0207649_10001843
1157 Ga0207649_10047888
1158 Ga0207649_10071095
1159 Ga0207649_10177284
1160 Ga0207649_10203031
1161 Ga0207649_10243771
1162 Ga0207649_10288567
1163 Ga0207649_10655660
1164 Ga0207649_10874786
1165 Ga0207652_10001100
1166 Ga0207652_10068224
1167 Ga0207652_10191918
1168 Ga0207652_11122857
1169 Ga0207681_10352460
1170 Ga0207681_10540932
1171 Ga0207681_11097026
1172 Ga0207694_10005672
1173 Ga0207650_10208074
1174 Ga0207650_10236767
1175 Ga0207650_10302049
1176 Ga0207659_10079422
1177 Ga0207659_10762900
1178 Ga0207659_10825668
1179 Ga0207687_10077207
1180 Ga0207664_10624136
1181 Ga0207644_10035225
1182 Ga0207644_10035438
1183 Ga0207644_10040022
1184 Ga0207644_10267414
1185 Ga0207644_10304955
1186 Ga0207644_10579374
1187 Ga0207644_10621336
1188 Ga0207644_10899196
1189 Ga0207690_10002177
1190 Ga0207690_10009048
1191 Ga0207690_10010356
1192 Ga0207690_10023439
1193 Ga0207690_10046744
1194 Ga0207690_10110327
1195 Ga0207690_10122837
1196 Ga0207690_10180910
1197 Ga0207690_10236175
1198 Ga0207690_10514499
1199 Ga0207690_10585582
1200 Ga0207690_10890930
1201 Ga0207706_10001681
1202 Ga0207706_10016868
1203 Ga0207706_10035222
1204 Ga0207706_10035849
1205 Ga0207706_10036821
1206 Ga0207706_10206695
1207 Ga0207706_10730880
1208 Ga0207706_10734883
1209 Ga0207706_10921953
1210 Ga0207686_10024015
1211 Ga0207709_10175537
1212 Ga0207670_10136030
1213 Ga0207670_11711529
1214 Ga0207669_10032702
1215 Ga0207669_10202498
1216 Ga0207669_11045954
1217 Ga0207704_10782533
1218 Ga0207665_10261566
1219 Ga0207691_10028017
1220 Ga0207691_10054881
1221 Ga0207691_10057901
1222 Ga0207691_11403634
1223 Ga0207711_10008511
1224 Ga0207711_10184390
1225 Ga0207711_10250351
1226 Ga0207689_10003104
1227 Ga0207689_10258486
1228 Ga0207689_10410381
1229 Ga0207689_11123487
1230 Ga0207661_10023786
1231 Ga0207679_10006355
1232 Ga0207679_10010430
1233 Ga0207679_10018949
1234 Ga0207679_10029504
1235 Ga0207679_10091656
1236 Ga0207679_10139243
1237 Ga0207667_10004508
1238 Ga0207667_10007822
1239 Ga0207667_10020852
1240 Ga0207667_10097564
1241 Ga0207667_11815955
1242 Ga0207651_10110575
1243 Ga0207651_10325327
1244 Ga0207651_10339234
1245 Ga0207651_10984731
1246 Ga0207712_10001181
1247 Ga0207712_11413752
1248 Ga0207668_10073861
1249 Ga0207640_10002781
1250 Ga0207640_10014468
1251 Ga0207640_10134994
1252 Ga0207640_10493061
1253 Ga0207640_10790105
1254 Ga0207640_10848610
1255 Ga0207640_11562658
1256 Ga0207658_10049889
1257 Ga0207658_10065477
1258 Ga0207658_10153755
1259 Ga0207658_10436121
1260 Ga0207658_11422049
1261 Ga0207677_10096497
1262 Ga0207677_10709019
1263 Ga0207677_11627085
1264 Ga0207703_10011955
1265 Ga0207703_10028182
1266 Ga0207639_10019533
1267 Ga0207639_10026995
1268 Ga0207639_10206250
1269 Ga0207639_10582942
1270 Ga0207678_10002042
1271 Ga0207678_10002194
1272 Ga0207678_10003505
1273 Ga0207678_10040809
1274 Ga0207678_10179021
1275 Ga0207678_10205233
1276 Ga0207678_10242683
1277 Ga0207678_10248894
1278 Ga0207702_10018149
1279 Ga0207641_10031504
1280 Ga0207641_10031686
1281 Ga0207641_10054196
1282 Ga0207641_10133802
1283 Ga0207641_10463989
1284 Ga0207641_10547504
1285 Ga0207648_10202586
1286 Ga0207648_11048889
1287 Ga0207676_10021105
1288 Ga0207676_10189029
1289 Ga0207676_10289594
1290 Ga0207676_10912135
1291 Ga0207676_11070284
1292 Ga0207674_10000151
1293 Ga0207674_10000410
1294 Ga0207674_10003707
1295 Ga0207674_10017187
1296 Ga0207674_10028333
1297 Ga0207674_10137143
1298 Ga0207674_10314836
1299 Ga0207674_10551206
1300 Ga0207675_100277227
1301 Ga0207675_101206675
1302 Ga0207683_10197429
1303 Ga0207683_10952870
1304 Ga0207698_10004072
1305 Ga0207698_10023373
1306 Ga0207698_10048265
1307 Ga0207698_10234064
1308 Ga0207698_10508412
1309 Ga0207698_10966677
1310 Ga0207698_11685858
1311 Ga0268266_10030954
1312 Ga0268266_10038372
1313 Ga0268265_10057807
1314 Ga0268265_10253782
1315 Ga0268265_10301237
1316 Ga0268265_10998793
1317 Ga0268264_10049087
1318 Ga0268264_10273068
1319 Ga0268264_10649741
1320 Ga0307513_10353201
1321 Ga0307408_100326265
1322 Ga0307408_100840450
1323 Ga0307408_102415430
1324 Ga0307405_10040033
1325 Ga0307413_10121324
1326 Ga0307413_10128200
1327 Ga0307410_10290792
1328 Ga0307410_11417799
1329 Ga0307406_10079831
1330 Ga0307406_10199142
1331 Ga0307406_10388123
1332 Ga0307412_10093856
1333 Ga0307409_100018161
1334 Ga0307409_100840066
1335 Ga0307409_100964229
1336 Ga0307416_100054970
1337 Ga0307416_100710272
1338 Ga0307416_100886603
1339 Ga0307414_10165794
1340 Ga0307411_10123468
1341 Ga0307411_10443911
1342 Ga0307411_10883957
1343 Ga0307415_100007613
1344 Ga0307415_100589868
1345 Ga0373941_0334621
1346 Ga0373931_0304457
1347 Ga0395899_0001165
1348 Ga0395899_0002476
1349 Ga0395899_0010292
1350 Ga0395899_0010948
1351 Ga0395899_0061872
1352 Ga0395899_0069989
1353 Ga0395899_0139182
1354 Ga0395899_0289756
1355 Ga0395899_0295507
1356 Ga0395899_0342913
1357 Ga0395899_0454743
1358 Ga0395900_0002233
1359 Ga0395900_0003176
1360 Ga0395900_0018282
1361 Ga0395900_0031690
1362 Ga0395900_0038945
1363 Ga0395900_0039272
1364 Ga0395900_0046747
1365 Ga0395900_0088446
1366 Ga0395900_0102203
1367 Ga0395900_0126713
1368 Ga0395900_0129338
1369 Ga0395900_0142048
1370 Ga0395900_0164404
1371 Ga0395900_0219630
1372 Ga0395900_0375719
1373 Ga0395900_0387219
1374 Ga0395900_0512787
1375 Ga0395900_0620871
1376 Ga0395900_0683220
1377 Ga0395900_0759567
1378 Ga0395900_1229477
1379 Ga0395900_1425491
1380 Ga0395900_1577484
1381 Ga0395898_0004873
1382 Ga0395898_0010099
1383 Ga0395898_0027301
1384 Ga0395898_0049776
1385 Ga0395898_0264466
1386 Ga0395898_0282755
1387 Ga0395898_0314351
1388 Ga0395898_0496903
1389 Ga0395898_0609267
1390 Ga0395898_1356200
1391 Ga0395898_1765788
1392 Ga0395905_0001302
1393 Ga0395905_0003014
1394 Ga0395905_0007273
1395 Ga0395905_0013236
1396 Ga0395905_0014464
1397 Ga0395905_0015273
1398 Ga0395905_0023506
1399 Ga0395905_0025264
1400 Ga0395905_0029822
1401 Ga0395905_0034865
1402 Ga0395905_0035249
1403 Ga0395905_0035324
1404 Ga0395905_0046811
1405 Ga0395905_0048894
1406 Ga0395905_0053046
1407 Ga0395905_0058065
1408 Ga0395905_0071538
1409 Ga0395905_0107941
1410 Ga0395905_0112597
1411 Ga0395905_0132355
1412 Ga0395905_0168113
1413 Ga0395905_0238235
1414 Ga0395905_0292331
1415 Ga0395905_0293832
1416 Ga0395905_0449700
1417 Ga0395905_0775400
1418 Ga0395905_0997467
1419 Ga0395905_1055491
1420 Ga0395905_1076743
1421 Ga0395905_1543476
1422 Ga0395905_1788106
1423 Ga0395901_0010449
1424 Ga0395901_0019891
1425 Ga0395901_0025745
1426 Ga0395901_0029136
1427 Ga0395901_0035592
1428 Ga0395901_0038033
1429 Ga0395901_0119354
1430 Ga0395901_0133372
1431 Ga0395901_0139054
1432 Ga0395901_0151256
1433 Ga0395901_0175417
1434 Ga0395901_0187948
1435 Ga0395901_0381138
1436 Ga0395901_0542401
1437 Ga0395901_0997827
1438 Ga0395901_1147400
1439 Ga0395901_1268186
1440 Ga0395901_1356926
1441 Ga0395901_1535380
1442 Ga0395901_1775458
1443 Ga0436365_0986541
1444 Ga0436363_1629466
1445 Ga0439447_118632
1446 Ga0439465_0083785
1447 Ga0439432_045879
1448 Ga0439449_0036781
1449 Ga0439455_0040748
1450 Ga0439458_0000044
1451 Ga0439458_0001191
1452 Ga0439459_0219257
1453 Ga0439464_0000895
1454 Ga0466969_0004255
1455 Ga0466965_0438785
1456 Ga0466966_0046173
1457 Ga0466961_0037700
1458 Ga0466963_0133998
1459 Ga0466963_1132299
1460 Ga0466971_0047123
1461 Ga0466970_0147751
1462 Ga0466957_0040787
1463 Ga0466957_0145544
1464 Ga0466957_0271221
1465 Ga0466959_0365286
1466 Ga0466958_0521928
1467 Ga0466967_0011818
1468 Ga0466967_0094538
1469 Ga0466967_0403564
1470 Ga0466967_0620856
1471 Ga0466967_1512886
1472 Ga0495584_0656414
1473 Ga0495633_0149962
1474 Ga0495669_0161656
1475 Ga0495669_0224553
1476 Ga0495669_0340980
1477 Ga0495670_0630852
1478 Ga0495677_0304378
1479 Ga0496100_1123886
1480 Ga0496101_0223388
1481 Ga0496101_0848583
1482 Ga0496102_0078330
1483 Ga0496102_0663104
1484 Ga0496102_1826272
1485 Ga0496103_0239014
1486 Ga0496104_0180909
1487 Ga0496104_1460378
1488 Ga0496105_0087574
1489 Ga0496106_0083251
1490 Ga0496106_0828848
1491 Ga0496107_0020104
1492 Ga0496107_0908296
1493 Ga0496108_0006067
1494 Ga0496109_0015360
1495 Ga0496109_0369814
1496 Ga0496110_0015740
1497 Ga0496110_0347880
1498 Ga0496110_0371396
1499 Ga0496110_0400112
1500 Ga0496110_1371982
1501 Ga0496111_0002395
1502 Ga0496112_0111779
1503 Ga0496112_0226194
1504 Ga0496112_1148888
1505 Ga0496113_0000705
1506 Ga0496113_0090326
1507 Ga0501067_0011658
1508 Ga0501067_0052413
1509 Ga0501068_0436233
1510 Ga0501071_0075239
1511 Ga0501201_038254
1512 Ga0501202_176554
1513 Ga0501216_061818
1514 Ga0501217_037859
1515 Ga0501223_023733
1516 Ga0501233_038509
1517 Ga0501235_171441
1518 Ga0501240_021790
1519 Ga0501242_008440
1520 Ga0501243_051401
1521 Ga0501248_037463
1522 Ga0501249_084455
1523 Ga0501234_006733
1524 Ga0501245_036012
1525 Ga0501268_001972
1526 Ga0501273_000968
1527 nmdc:mga0k408_761468_c1
1528 nmdc:mga09592_742486_c1
1529 nmdc:mga0qj67_172027_c1
1530 nmdc:mga06r32_232233_c1
1531 nmdc:mga0rr50_556457_c1
1532 nmdc:mga0rr50_801870_c1
1533 nmdc:mga0a205_1007_c1
1534 nmdc:mga0sz30_465739_c1
1535 Ga0587073_0310087
1536 Ga0466962_0014061

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14542

Acetyltransf_CG

GCN5-related N-acetyl-transferase

20

100

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q4y-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex 0.9041 9 97
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.9011 9 97
6wqc-assembly1.cif.gz_A crystal structure of vipf from legionella hackeliae in complex with coa 0.8854 18 77
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8824 9 97
6wqb-assembly1.cif.gz_A crystal structure of vipf from legionella hackeliae in complex with acetyl-coa 0.879 18 72
ID Description Score Start End Superfamily
af_D4A230_16_108_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9487 9 96 3.40.630.30
af_G5EE42_2_95_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9475 8 95 3.40.630.30
af_Q54CC0_2_81_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9418 9 80 3.40.630.30
af_A0A2R8QAE8_34_133_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9301 9 97 3.40.630.30
af_O62324_1_224_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9087 39 77 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3N5RCZ9-F1-model_v4 N-acetyltransferase 0.9917 9 97 GO:0016747
AF-A0A2D9N4C0-F1-model_v4 GNAT family N-acetyltransferase 0.9886 9 98 GO:0016740
AF-A0A535DSH6-F1-model_v4 N-acetyltransferase 0.9864 9 99 GO:0016740
AF-A0A2V8TB28-F1-model_v4 GNAT family N-acetyltransferase 0.9858 8 98 GO:0016740
AF-A0A2V9H2G3-F1-model_v4 GNAT family N-acetyltransferase 0.9855 13 104 GO:0016740

Map