F479934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 768 | 308 | 1536 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10030075|Ga0070709_100300753 |
| Length | 275 |
| Sequence | VHTDSSICSASASPWQPVPETVTTPLHAPAPSILSELRRLAIVPALNEERTVPLVIGELRSFDAGLDIVVVDDGSTDRTADVAAALGVYVLRLPFNLGIGGAVQTGFRFAHERDYDIVVRVDGDGQHDPSQLGLILEPVLVGRADIVVGSRFAAEEGGYRSSRSRRVGIRILAAVVSRVVGQRVTDTTSGFQALNRQGIALFAGDYPHDYPEVEATVMVFRHRLRLVEVPVTMRERGGGSSSITALRSIYYMVKVLLAIFVGLFRRNVLPHEDAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 1.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 9.51 |
| Rhizosphere | 89.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10030075 | 3300005434 | Bacteria | 3256 |
| 2 | Ga0070658_10004865 | 3300005327 | Bacteria | 10937 |
| 3 | Ga0070658_10016816 | 3300005327 | Bacteria | 5854 |
| 4 | Ga0070658_10124525 | 3300005327 | Bacteria | 2144 |
| 5 | Ga0070658_10333485 | 3300005327 | Bacteria | 1296 |
| 6 | Ga0070658_10384452 | 3300005327 | Unclassified | 1204 |
| 7 | Ga0070658_10472793 | 3300005327 | Bacteria | 1081 |
| 8 | Ga0070683_100000658 | 3300005329 | Bacteria | 24951 |
| 9 | Ga0070683_100014083 | 3300005329 | Bacteria | 6985 |
| 10 | Ga0070683_100016044 | 3300005329 | Bacteria | 6593 |
| 11 | Ga0070683_100056640 | 3300005329 | Bacteria | 3640 |
| 12 | Ga0070683_100325792 | 3300005329 | Bacteria | 1462 |
| 13 | Ga0068869_100033530 | 3300005334 | Bacteria | 3625 |
| 14 | Ga0070666_10238734 | 3300005335 | Unclassified | 1285 |
| 15 | Ga0070680_100029384 | 3300005336 | Bacteria | 4415 |
| 16 | Ga0070680_100055343 | 3300005336 | Bacteria | 3242 |
| 17 | Ga0070680_100307738 | 3300005336 | Bacteria | 1344 |
| 18 | Ga0070680_100316305 | 3300005336 | Bacteria | 1325 |
| 19 | Ga0070682_100085901 | 3300005337 | Bacteria | 2047 |
| 20 | Ga0068868_100132098 | 3300005338 | Unclassified | 2044 |
| 21 | Ga0068868_100316848 | 3300005338 | Bacteria | 1328 |
| 22 | Ga0070660_100001629 | 3300005339 | Bacteria | 15431 |
| 23 | Ga0070660_100007104 | 3300005339 | Bacteria | 7783 |
| 24 | Ga0070691_10001923 | 3300005341 | Bacteria | 9120 |
| 25 | Ga0070692_10052460 | 3300005345 | Bacteria | 2124 |
| 26 | Ga0070668_100162783 | 3300005347 | Unclassified | 1811 |
| 27 | Ga0070668_100526139 | 3300005347 | Bacteria | 1026 |
| 28 | Ga0070669_100481740 | 3300005353 | Unclassified | 1027 |
| 29 | Ga0070675_100025382 | 3300005354 | Bacteria | 4751 |
| 30 | Ga0070674_100050072 | 3300005356 | Bacteria | 2874 |
| 31 | Ga0070673_100010854 | 3300005364 | Bacteria | 6190 |
| 32 | Ga0070688_100057152 | 3300005365 | Bacteria | 2451 |
| 33 | Ga0070659_100020529 | 3300005366 | Bacteria | 5020 |
| 34 | Ga0070703_10008708 | 3300005406 | Bacteria | 2856 |
| 35 | Ga0070709_10101069 | 3300005434 | Bacteria | 1921 |
| 36 | Ga0070714_100024151 | 3300005435 | Bacteria | 5000 |
| 37 | Ga0070714_100025809 | 3300005435 | Bacteria | 4853 |
| 38 | Ga0070714_100055787 | 3300005435 | Bacteria | 3378 |
| 39 | Ga0070714_100322440 | 3300005435 | Bacteria | 1445 |
| 40 | Ga0070714_100444345 | 3300005435 | Bacteria | 1231 |
| 41 | Ga0070713_100249691 | 3300005436 | Bacteria | 1618 |
| 42 | Ga0070701_10047333 | 3300005438 | Bacteria | 2214 |
| 43 | Ga0070705_100002556 | 3300005440 | Bacteria | 9145 |
| 44 | Ga0070705_100094379 | 3300005440 | Bacteria | 1873 |
| 45 | Ga0070700_100157672 | 3300005441 | Bacteria | 1559 |
| 46 | Ga0070708_100070521 | 3300005445 | Bacteria | 3144 |
| 47 | Ga0070708_100207875 | 3300005445 | Bacteria | 1834 |
| 48 | Ga0070678_100048203 | 3300005456 | Bacteria | 3067 |
| 49 | Ga0070678_100133008 | 3300005456 | Bacteria | 1979 |
| 50 | Ga0070662_100320046 | 3300005457 | Bacteria | 1265 |
| 51 | Ga0070681_10079065 | 3300005458 | Bacteria | 3245 |
| 52 | Ga0070681_10098519 | 3300005458 | Bacteria | 2869 |
| 53 | Ga0070681_10211312 | 3300005458 | Bacteria | 1856 |
| 54 | Ga0068867_100293431 | 3300005459 | Bacteria | 1338 |
| 55 | Ga0070685_10007475 | 3300005466 | Bacteria | 5591 |
| 56 | Ga0070706_100307874 | 3300005467 | Bacteria | 1478 |
| 57 | Ga0070707_100051086 | 3300005468 | Bacteria | 3963 |
| 58 | Ga0070707_100403146 | 3300005468 | Bacteria | 1328 |
| 59 | Ga0070698_100046714 | 3300005471 | Bacteria | 4427 |
| 60 | Ga0070698_100120064 | 3300005471 | Bacteria | 2589 |
| 61 | Ga0070679_100017853 | 3300005530 | Bacteria | 6872 |
| 62 | Ga0070679_100044341 | 3300005530 | Bacteria | 4431 |
| 63 | Ga0070679_100240545 | 3300005530 | Bacteria | 1768 |
| 64 | Ga0070684_100031845 | 3300005535 | Bacteria | 4492 |
| 65 | Ga0070684_100121520 | 3300005535 | Bacteria | 2349 |
| 66 | Ga0070684_100205517 | 3300005535 | Bacteria | 1794 |
| 67 | Ga0070684_100223008 | 3300005535 | Bacteria | 1720 |
| 68 | Ga0070684_100286727 | 3300005535 | Bacteria | 1509 |
| 69 | Ga0070672_100061503 | 3300005543 | Bacteria | 2960 |
| 70 | Ga0070686_100486238 | 3300005544 | Unclassified | 955 |
| 71 | Ga0070695_100078253 | 3300005545 | Bacteria | 2180 |
| 72 | Ga0070696_100235797 | 3300005546 | Bacteria | 1378 |
| 73 | Ga0070665_100146443 | 3300005548 | Bacteria | 2365 |
| 74 | Ga0070704_100006528 | 3300005549 | Bacteria | 6878 |
| 75 | Ga0070704_100092249 | 3300005549 | Bacteria | 2260 |
| 76 | Ga0068855_100020903 | 3300005563 | Bacteria | 7848 |
| 77 | Ga0068855_100118534 | 3300005563 | Bacteria | 3031 |
| 78 | Ga0068855_100177590 | 3300005563 | Bacteria | 2408 |
| 79 | Ga0068855_100393141 | 3300005563 | Bacteria | 1520 |
| 80 | Ga0068855_100732610 | 3300005563 | Bacteria | 1055 |
| 81 | Ga0070664_100013025 | 3300005564 | Bacteria | 6767 |
| 82 | Ga0070664_100257526 | 3300005564 | Bacteria | 1569 |
| 83 | Ga0070664_100271058 | 3300005564 | Bacteria | 1529 |
| 84 | Ga0068857_100283002 | 3300005577 | Bacteria | 1526 |
| 85 | Ga0068854_100419615 | 3300005578 | Bacteria | 1111 |
| 86 | Ga0068856_100002274 | 3300005614 | Bacteria | 19813 |
| 87 | Ga0068856_100007496 | 3300005614 | Bacteria | 10652 |
| 88 | Ga0068856_100252498 | 3300005614 | Unclassified | 1779 |
| 89 | Ga0068856_101136085 | 3300005614 | Bacteria | 798 |
| 90 | Ga0070702_100089281 | 3300005615 | Bacteria | 1865 |
| 91 | Ga0070702_100180297 | 3300005615 | Bacteria | 1381 |
| 92 | Ga0068852_100028639 | 3300005616 | Bacteria | 4564 |
| 93 | Ga0068859_100056890 | 3300005617 | Bacteria | 3938 |
| 94 | Ga0068864_100129477 | 3300005618 | Bacteria | 2265 |
| 95 | Ga0068851_10077500 | 3300005834 | Bacteria | 1731 |
| 96 | Ga0068863_100074032 | 3300005841 | Bacteria | 3222 |
| 97 | Ga0068858_100047904 | 3300005842 | Bacteria | 3961 |
| 98 | Ga0068862_100224838 | 3300005844 | Bacteria | 1701 |
| 99 | Ga0081539_10001497 | 3300005985 | Bacteria | 39539 |
| 100 | Ga0070717_10024524 | 3300006028 | Bacteria | 4790 |
| 101 | Ga0070717_10226842 | 3300006028 | Bacteria | 1644 |
| 102 | Ga0070717_10393639 | 3300006028 | Bacteria | 1244 |
| 103 | Ga0075365_10041240 | 3300006038 | Bacteria | 3015 |
| 104 | Ga0075365_10219079 | 3300006038 | Bacteria | 1335 |
| 105 | Ga0070712_100018985 | 3300006175 | Bacteria | 4475 |
| 106 | Ga0097621_100773675 | 3300006237 | Bacteria | 888 |
| 107 | Ga0068871_100352751 | 3300006358 | Bacteria | 1301 |
| 108 | Ga0075428_100275586 | 3300006844 | Bacteria | 1810 |
| 109 | Ga0075430_100001695 | 3300006846 | Bacteria | 18006 |
| 110 | Ga0075431_100333658 | 3300006847 | Bacteria | 1527 |
| 111 | Ga0075434_100050200 | 3300006871 | Bacteria | 4144 |
| 112 | Ga0075429_100064471 | 3300006880 | Bacteria | 3191 |
| 113 | Ga0097620_100056894 | 3300006931 | Bacteria | 3938 |
| 114 | Ga0075435_100249505 | 3300007076 | Bacteria | 1511 |
| 115 | Ga0075435_100532982 | 3300007076 | Bacteria | 1016 |
| 116 | Ga0099794_10029821 | 3300007265 | Unclassified | 2544 |
| 117 | Ga0105240_10033924 | 3300009093 | Bacteria | 6590 |
| 118 | Ga0105240_10082655 | 3300009093 | Bacteria | 3943 |
| 119 | Ga0105240_10179571 | 3300009093 | Bacteria | 2499 |
| 120 | Ga0105240_10230791 | 3300009093 | Bacteria | 2151 |
| 121 | Ga0111539_10141967 | 3300009094 | Bacteria | 2811 |
| 122 | Ga0111539_10181000 | 3300009094 | Bacteria | 2461 |
| 123 | Ga0105245_10007462 | 3300009098 | Bacteria | 9576 |
| 124 | Ga0105245_10013746 | 3300009098 | Bacteria | 7049 |
| 125 | Ga0105245_10014092 | 3300009098 | Bacteria | 6966 |
| 126 | Ga0105245_10029568 | 3300009098 | Bacteria | 4843 |
| 127 | Ga0105245_10034860 | 3300009098 | Bacteria | 4465 |
| 128 | Ga0114129_10121280 | 3300009147 | Bacteria | 3598 |
| 129 | Ga0114129_10163747 | 3300009147 | Bacteria | 3036 |
| 130 | Ga0105243_10001890 | 3300009148 | Bacteria | 17857 |
| 131 | Ga0105243_10044849 | 3300009148 | Bacteria | 3472 |
| 132 | Ga0105242_10130431 | 3300009176 | Bacteria | 2169 |
| 133 | Ga0105248_10026380 | 3300009177 | Bacteria | 6462 |
| 134 | Ga0105248_10549408 | 3300009177 | Bacteria | 1303 |
| 135 | Ga0105238_10076755 | 3300009551 | Bacteria | 3333 |
| 136 | Ga0105238_10099306 | 3300009551 | Bacteria | 2894 |
| 137 | Ga0105249_10083706 | 3300009553 | Bacteria | 2970 |
| 138 | Ga0105249_10281707 | 3300009553 | Bacteria | 1660 |
| 139 | Ga0105249_10299856 | 3300009553 | Bacteria | 1611 |
| 140 | Ga0105239_10016522 | 3300010375 | Bacteria | 8160 |
| 141 | Ga0105239_10048768 | 3300010375 | Unclassified | 4643 |
| 142 | Ga0105239_10279393 | 3300010375 | Bacteria | 1879 |
| 143 | Ga0105239_10510060 | 3300010375 | Bacteria | 1368 |
| 144 | Ga0105239_10586818 | 3300010375 | Bacteria | 1271 |
| 145 | Ga0105246_10275409 | 3300011119 | Bacteria | 1347 |
| 146 | Ga0157373_10071748 | 3300013100 | Bacteria | 2445 |
| 147 | Ga0157373_10130725 | 3300013100 | Bacteria | 1766 |
| 148 | Ga0157371_10004876 | 3300013102 | Bacteria | 11535 |
| 149 | Ga0157371_10501469 | 3300013102 | Bacteria | 896 |
| 150 | Ga0157370_10006316 | 3300013104 | Bacteria | 13094 |
| 151 | Ga0157370_10069538 | 3300013104 | Bacteria | 3325 |
| 152 | Ga0157369_10005292 | 3300013105 | Bacteria | 15039 |
| 153 | Ga0157369_10005518 | 3300013105 | Bacteria | 14689 |
| 154 | Ga0157369_10054839 | 3300013105 | Bacteria | 4303 |
| 155 | Ga0157369_10276809 | 3300013105 | Bacteria | 1748 |
| 156 | Ga0157369_10345859 | 3300013105 | Bacteria | 1545 |
| 157 | Ga0157374_10469137 | 3300013296 | Bacteria | 1261 |
| 158 | Ga0157374_10796173 | 3300013296 | Bacteria | 961 |
| 159 | Ga0157372_10139058 | 3300013307 | Bacteria | 2797 |
| 160 | Ga0157372_10141518 | 3300013307 | Bacteria | 2772 |
| 161 | Ga0157372_10256994 | 3300013307 | Bacteria | 2028 |
| 162 | Ga0157372_10264577 | 3300013307 | Bacteria | 1997 |
| 163 | Ga0157375_10004328 | 3300013308 | Bacteria | 12327 |
| 164 | Ga0163163_10305149 | 3300014325 | Bacteria | 1644 |
| 165 | Ga0182008_10009394 | 3300014497 | Bacteria | 5279 |
| 166 | Ga0182008_10015932 | 3300014497 | Bacteria | 3914 |
| 167 | Ga0157377_10004210 | 3300014745 | Bacteria | 6584 |
| 168 | Ga0182006_1024237 | 3300015261 | Bacteria | 2504 |
| 169 | Ga0182007_10008455 | 3300015262 | Bacteria | 4229 |
| 170 | Ga0197907_11074073 | 3300020069 | Bacteria | 1699 |
| 171 | Ga0206356_10379076 | 3300020070 | Bacteria | 1374 |
| 172 | Ga0206354_11276381 | 3300020081 | Bacteria | 2991 |
| 173 | Ga0206354_11349107 | 3300020081 | Bacteria | 2077 |
| 174 | Ga0206353_10632157 | 3300020082 | Bacteria | 2507 |
| 175 | Ga0206353_10953117 | 3300020082 | Bacteria | 3431 |
| 176 | Ga0206353_11085992 | 3300020082 | Bacteria | 6550 |
| 177 | Ga0206353_11566952 | 3300020082 | Bacteria | 7367 |
| 178 | Ga0207653_10023898 | 3300025885 | Bacteria | 1949 |
| 179 | Ga0207710_10026558 | 3300025900 | Bacteria | 2503 |
| 180 | Ga0207688_10050816 | 3300025901 | Bacteria | 2322 |
| 181 | Ga0207680_10169968 | 3300025903 | Bacteria | 1468 |
| 182 | Ga0207699_10078771 | 3300025906 | Bacteria | 2036 |
| 183 | Ga0207699_10081012 | 3300025906 | Bacteria | 2013 |
| 184 | Ga0207699_10142491 | 3300025906 | Bacteria | 1577 |
| 185 | Ga0207705_10030806 | 3300025909 | Bacteria | 3829 |
| 186 | Ga0207705_10054350 | 3300025909 | Bacteria | 2886 |
| 187 | Ga0207705_10087859 | 3300025909 | Bacteria | 2273 |
| 188 | Ga0207705_10573935 | 3300025909 | Bacteria | 877 |
| 189 | Ga0207707_10130210 | 3300025912 | Bacteria | 2201 |
| 190 | Ga0207707_10147072 | 3300025912 | Bacteria | 2060 |
| 191 | Ga0207695_10021843 | 3300025913 | Bacteria | 7288 |
| 192 | Ga0207695_10110202 | 3300025913 | Bacteria | 2733 |
| 193 | Ga0207695_10272063 | 3300025913 | Bacteria | 1589 |
| 194 | Ga0207693_10402328 | 3300025915 | Bacteria | 1070 |
| 195 | Ga0207663_10187561 | 3300025916 | Bacteria | 1482 |
| 196 | Ga0207660_10239737 | 3300025917 | Bacteria | 1428 |
| 197 | Ga0207660_10493318 | 3300025917 | Bacteria | 993 |
| 198 | Ga0207662_10012921 | 3300025918 | Bacteria | 4660 |
| 199 | Ga0207657_10001298 | 3300025919 | Bacteria | 26543 |
| 200 | Ga0207657_10002818 | 3300025919 | Bacteria | 18694 |
| 201 | Ga0207657_10010757 | 3300025919 | Bacteria | 9108 |
| 202 | Ga0207657_10483909 | 3300025919 | Bacteria | 970 |
| 203 | Ga0207652_10149658 | 3300025921 | Bacteria | 2089 |
| 204 | Ga0207652_10309737 | 3300025921 | Unclassified | 1425 |
| 205 | Ga0207646_10332572 | 3300025922 | Bacteria | 1372 |
| 206 | Ga0207681_10250794 | 3300025923 | Bacteria | 1382 |
| 207 | Ga0207694_10062631 | 3300025924 | Bacteria | 2896 |
| 208 | Ga0207694_10157599 | 3300025924 | Bacteria | 1832 |
| 209 | Ga0207650_10264737 | 3300025925 | Bacteria | 1395 |
| 210 | Ga0207659_10075291 | 3300025926 | Bacteria | 2476 |
| 211 | Ga0207659_10321706 | 3300025926 | Unclassified | 1276 |
| 212 | Ga0207687_10008350 | 3300025927 | Bacteria | 6774 |
| 213 | Ga0207687_10015175 | 3300025927 | Bacteria | 5048 |
| 214 | Ga0207687_10052052 | 3300025927 | Bacteria | 2856 |
| 215 | Ga0207687_10060463 | 3300025927 | Bacteria | 2673 |
| 216 | Ga0207687_10075643 | 3300025927 | Unclassified | 2417 |
| 217 | Ga0207687_10100876 | 3300025927 | Bacteria | 2124 |
| 218 | Ga0207700_10143398 | 3300025928 | Bacteria | 1965 |
| 219 | Ga0207700_10184135 | 3300025928 | Bacteria | 1751 |
| 220 | Ga0207700_10372808 | 3300025928 | Unclassified | 1247 |
| 221 | Ga0207664_10025324 | 3300025929 | Bacteria | 4468 |
| 222 | Ga0207664_10106167 | 3300025929 | Bacteria | 2328 |
| 223 | Ga0207664_10247048 | 3300025929 | Bacteria | 1556 |
| 224 | Ga0207664_10264921 | 3300025929 | Bacteria | 1504 |
| 225 | Ga0207644_10139741 | 3300025931 | Unclassified | 1864 |
| 226 | Ga0207690_10028706 | 3300025932 | Bacteria | 3528 |
| 227 | Ga0207706_10004508 | 3300025933 | Bacteria | 13081 |
| 228 | Ga0207706_10056340 | 3300025933 | Bacteria | 3466 |
| 229 | Ga0207686_10083238 | 3300025934 | Unclassified | 2094 |
| 230 | Ga0207709_10128206 | 3300025935 | Bacteria | 1725 |
| 231 | Ga0207670_10054640 | 3300025936 | Bacteria | 2695 |
| 232 | Ga0207669_10018387 | 3300025937 | Bacteria | 3612 |
| 233 | Ga0207669_10123380 | 3300025937 | Bacteria | 1764 |
| 234 | Ga0207691_10008235 | 3300025940 | Bacteria | 10011 |
| 235 | Ga0207691_10016650 | 3300025940 | Bacteria | 6981 |
| 236 | Ga0207711_10239444 | 3300025941 | Unclassified | 1664 |
| 237 | Ga0207689_10069082 | 3300025942 | Bacteria | 2903 |
| 238 | Ga0207661_10167119 | 3300025944 | Bacteria | 1912 |
| 239 | Ga0207661_10192306 | 3300025944 | Bacteria | 1789 |
| 240 | Ga0207661_10605806 | 3300025944 | Bacteria | 1005 |
| 241 | Ga0207679_10170542 | 3300025945 | Bacteria | 1791 |
| 242 | Ga0207667_10028622 | 3300025949 | Bacteria | 6050 |
| 243 | Ga0207667_10115140 | 3300025949 | Bacteria | 2771 |
| 244 | Ga0207667_10596199 | 3300025949 | Bacteria | 1114 |
| 245 | Ga0207651_10171206 | 3300025960 | Bacteria | 1713 |
| 246 | Ga0207712_10111123 | 3300025961 | Bacteria | 2056 |
| 247 | Ga0207712_10192609 | 3300025961 | Bacteria | 1610 |
| 248 | Ga0207658_10094419 | 3300025986 | Bacteria | 2328 |
| 249 | Ga0207677_10031559 | 3300026023 | Bacteria | 3394 |
| 250 | Ga0207677_10390252 | 3300026023 | Bacteria | 1177 |
| 251 | Ga0207639_10750374 | 3300026041 | Bacteria | 907 |
| 252 | Ga0207678_10083624 | 3300026067 | Bacteria | 2730 |
| 253 | Ga0207708_10092396 | 3300026075 | Bacteria | 2335 |
| 254 | Ga0207708_10187155 | 3300026075 | Bacteria | 1646 |
| 255 | Ga0207708_10211756 | 3300026075 | Unclassified | 1550 |
| 256 | Ga0207702_10005369 | 3300026078 | Bacteria | 11228 |
| 257 | Ga0207702_10134105 | 3300026078 | Bacteria | 2232 |
| 258 | Ga0207702_10199417 | 3300026078 | Unclassified | 1854 |
| 259 | Ga0207702_10386931 | 3300026078 | Bacteria | 1346 |
| 260 | Ga0207641_10742692 | 3300026088 | Bacteria | 968 |
| 261 | Ga0207648_10043629 | 3300026089 | Bacteria | 3936 |
| 262 | Ga0207674_10909892 | 3300026116 | Bacteria | 848 |
| 263 | Ga0207675_100155163 | 3300026118 | Bacteria | 2181 |
| 264 | Ga0207683_10039573 | 3300026121 | Bacteria | 4114 |
| 265 | Ga0207698_10011395 | 3300026142 | Bacteria | 5764 |
| 266 | Ga0207698_10198913 | 3300026142 | Bacteria | 1793 |
| 267 | Ga0207428_10142260 | 3300027907 | Bacteria | 1830 |
| 268 | Ga0268266_10123855 | 3300028379 | Bacteria | 2304 |
| 269 | Ga0265319_1003017 | 3300028563 | Bacteria | 8937 |
| 270 | Ga0265334_10002725 | 3300028573 | Bacteria | 8165 |
| 271 | Ga0265318_10003644 | 3300028577 | Bacteria | 7688 |
| 272 | Ga0265318_10116689 | 3300028577 | Unclassified | 981 |
| 273 | Ga0265322_10021100 | 3300028654 | Bacteria | 1866 |
| 274 | Ga0265322_10054173 | 3300028654 | Bacteria | 1138 |
| 275 | Ga0265336_10058699 | 3300028666 | Bacteria | 1155 |
| 276 | Ga0265338_10003780 | 3300028800 | Bacteria | 21040 |
| 277 | Ga0265338_10026701 | 3300028800 | Bacteria | 5813 |
| 278 | Ga0265338_10058462 | 3300028800 | Bacteria | 3403 |
| 279 | Ga0265338_10097073 | 3300028800 | Bacteria | 2415 |
| 280 | Ga0265330_10008454 | 3300031235 | Bacteria | 4953 |
| 281 | Ga0265328_10005336 | 3300031239 | Bacteria | 5513 |
| 282 | Ga0265320_10015015 | 3300031240 | Bacteria | 4388 |
| 283 | Ga0265320_10103483 | 3300031240 | Bacteria | 1310 |
| 284 | Ga0265340_10011010 | 3300031247 | Bacteria | 4822 |
| 285 | Ga0265340_10074679 | 3300031247 | Unclassified | 1603 |
| 286 | Ga0265339_10114101 | 3300031249 | Bacteria | 1395 |
| 287 | Ga0265327_10015996 | 3300031251 | Bacteria | 4799 |
| 288 | Ga0265316_10029736 | 3300031344 | Bacteria | 4487 |
| 289 | Ga0265316_10074084 | 3300031344 | Bacteria | 2621 |
| 290 | Ga0265316_10090444 | 3300031344 | Bacteria | 2335 |
| 291 | Ga0265316_10423691 | 3300031344 | Bacteria | 957 |
| 292 | Ga0265313_10023198 | 3300031595 | Bacteria | 3347 |
| 293 | Ga0265313_10036924 | 3300031595 | Bacteria | 2449 |
| 294 | Ga0265313_10055180 | 3300031595 | Bacteria | 1883 |
| 295 | Ga0265314_10034318 | 3300031711 | Bacteria | 3709 |
| 296 | Ga0265314_10118918 | 3300031711 | Bacteria | 1666 |
| 297 | Ga0265314_10265160 | 3300031711 | Unclassified | 979 |
| 298 | Ga0265342_10181463 | 3300031712 | Bacteria | 1152 |
| 299 | Ga0307409_100010972 | 3300031995 | Bacteria | 5677 |
| 300 | Ga0307409_100246215 | 3300031995 | Bacteria | 1631 |
| 301 | Ga0307416_100171322 | 3300032002 | Bacteria | 2021 |
| 302 | Ga0373928_0062888 | 3300035084 | Bacteria | 902 |
| 303 | Ga0373944_0004058 | 3300035089 | Bacteria | 3795 |
| 304 | Ga0373951_0013350 | 3300035091 | Bacteria | 1848 |
| 305 | Ga0373951_0058596 | 3300035091 | Bacteria | 961 |
| 306 | Ga0373936_0017416 | 3300035113 | Bacteria | 2766 |
| 307 | Ga0373945_0002258 | 3300035116 | Bacteria | 6027 |
| 308 | Ga0373945_0046181 | 3300035116 | Bacteria | 1588 |
| 309 | Ga0373960_0015664 | 3300035121 | Bacteria | 1939 |
| 310 | Ga0373943_0004043 | 3300035170 | Bacteria | 6667 |
| 311 | Ga0373943_0018612 | 3300035170 | Bacteria | 3193 |
| 312 | Ga0373955_0043752 | 3300035172 | Bacteria | 2410 |
| 313 | Ga0373935_0051481 | 3300035692 | Bacteria | 2615 |
| 314 | Ga0373947_0004772 | 3300035725 | Bacteria | 7940 |
| 315 | Ga0373947_0020847 | 3300035725 | Bacteria | 3788 |
| 316 | Ga0373937_0133789 | 3300036401 | Bacteria | 2317 |
| 317 | Ga0373925_0002390 | 3300037068 | Bacteria | 15052 |
| 318 | Ga0373925_0271179 | 3300037068 | Bacteria | 1365 |
| 319 | Ga0395899_0024136 | 3300037312 | Bacteria | 4599 |
| 320 | Ga0395899_0043674 | 3300037312 | Bacteria | 3343 |
| 321 | Ga0395899_0052150 | 3300037312 | Bacteria | 3033 |
| 322 | Ga0395899_0061786 | 3300037312 | Bacteria | 2759 |
| 323 | Ga0395899_0191796 | 3300037312 | Bacteria | 1430 |
| 324 | Ga0395899_0203819 | 3300037312 | Bacteria | 1378 |
| 325 | Ga0395899_0334991 | 3300037312 | Bacteria | 1016 |
| 326 | Ga0395900_0006141 | 3300037418 | Bacteria | 12535 |
| 327 | Ga0395900_0063053 | 3300037418 | Bacteria | 3810 |
| 328 | Ga0395900_0109780 | 3300037418 | Bacteria | 2834 |
| 329 | Ga0395900_0136411 | 3300037418 | Bacteria | 2514 |
| 330 | Ga0395900_0142146 | 3300037418 | Bacteria | 2457 |
| 331 | Ga0395900_0267108 | 3300037418 | Bacteria | 1707 |
| 332 | Ga0395900_0371711 | 3300037418 | Bacteria | 1399 |
| 333 | Ga0395900_0419404 | 3300037418 | Bacteria | 1299 |
| 334 | Ga0395900_0615082 | 3300037418 | Bacteria | 1026 |
| 335 | Ga0395900_0640296 | 3300037418 | Bacteria | 1000 |
| 336 | Ga0395900_0645753 | 3300037418 | Bacteria | 995 |
| 337 | Ga0395900_0668244 | 3300037418 | Bacteria | 974 |
| 338 | Ga0395900_0904623 | 3300037418 | Unclassified | 806 |
| 339 | Ga0395898_0032242 | 3300037466 | Bacteria | 5229 |
| 340 | Ga0395898_0045002 | 3300037466 | Bacteria | 4339 |
| 341 | Ga0395898_0052326 | 3300037466 | Bacteria | 3989 |
| 342 | Ga0395898_0059520 | 3300037466 | Bacteria | 3715 |
| 343 | Ga0395898_0066545 | 3300037466 | Bacteria | 3490 |
| 344 | Ga0395898_0142328 | 3300037466 | Bacteria | 2296 |
| 345 | Ga0395898_0145215 | 3300037466 | Bacteria | 2271 |
| 346 | Ga0395898_0215544 | 3300037466 | Bacteria | 1831 |
| 347 | Ga0395898_0339516 | 3300037466 | Bacteria | 1432 |
| 348 | Ga0395898_0467846 | 3300037466 | Bacteria | 1200 |
| 349 | Ga0395898_0668631 | 3300037466 | Bacteria | 981 |
| 350 | Ga0395898_0668644 | 3300037466 | Bacteria | 981 |
| 351 | Ga0395905_0004396 | 3300037471 | Bacteria | 14666 |
| 352 | Ga0395905_0017526 | 3300037471 | Bacteria | 6799 |
| 353 | Ga0395905_0131888 | 3300037471 | Bacteria | 2350 |
| 354 | Ga0395905_0148104 | 3300037471 | Bacteria | 2209 |
| 355 | Ga0395905_0160856 | 3300037471 | Bacteria | 2110 |
| 356 | Ga0395905_0335044 | 3300037471 | Archaea | 1404 |
| 357 | Ga0395905_0902677 | 3300037471 | Bacteria | 786 |
| 358 | Ga0395901_0002959 | 3300038443 | Bacteria | 17130 |
| 359 | Ga0395901_0006058 | 3300038443 | Bacteria | 12252 |
| 360 | Ga0395901_0008716 | 3300038443 | Bacteria | 10251 |
| 361 | Ga0395901_0021184 | 3300038443 | Bacteria | 6658 |
| 362 | Ga0395901_0160523 | 3300038443 | Bacteria | 2361 |
| 363 | Ga0395901_0196895 | 3300038443 | Bacteria | 2113 |
| 364 | Ga0395901_0284708 | 3300038443 | Bacteria | 1717 |
| 365 | Ga0395901_0369726 | 3300038443 | Bacteria | 1477 |
| 366 | Ga0395901_0440903 | 3300038443 | Bacteria | 1333 |
| 367 | Ga0395901_0542450 | 3300038443 | Bacteria | 1179 |
| 368 | Ga0395901_0566120 | 3300038443 | Bacteria | 1150 |
| 369 | Ga0436360_0359980 | 3300039438 | Bacteria | 1466 |
| 370 | Ga0439439_0019593 | 3300041406 | Bacteria | 1680 |
| 371 | Ga0451853_1343990 | 3300041512 | Bacteria | 1496 |
| 372 | Ga0451853_3187853 | 3300041512 | Bacteria | 959 |
| 373 | Ga0450914_004742 | 3300042118 | Bacteria | 1120 |
| 374 | Ga0451577_0002511 | 3300042876 | Bacteria | 21731 |
| 375 | Ga0466969_0058417 | 3300044656 | Bacteria | 1877 |
| 376 | Ga0466966_0004480 | 3300044684 | Bacteria | 9214 |
| 377 | Ga0466966_0104432 | 3300044684 | Bacteria | 1750 |
| 378 | Ga0466966_0184637 | 3300044684 | Unclassified | 1265 |
| 379 | Ga0466961_0007230 | 3300044693 | Bacteria | 7065 |
| 380 | Ga0466961_0025684 | 3300044693 | Bacteria | 3786 |
| 381 | Ga0466961_0105739 | 3300044693 | Bacteria | 1772 |
| 382 | Ga0466963_0001801 | 3300044694 | Bacteria | 11660 |
| 383 | Ga0466963_0002737 | 3300044694 | Bacteria | 9951 |
| 384 | Ga0466963_0003027 | 3300044694 | Bacteria | 9513 |
| 385 | Ga0466963_0003699 | 3300044694 | Bacteria | 8800 |
| 386 | Ga0466963_0009585 | 3300044694 | Bacteria | 5836 |
| 387 | Ga0466963_0041816 | 3300044694 | Bacteria | 3007 |
| 388 | Ga0466963_0057615 | 3300044694 | Bacteria | 2588 |
| 389 | Ga0466963_0198558 | 3300044694 | Bacteria | 1403 |
| 390 | Ga0466964_0098590 | 3300044706 | Bacteria | 1284 |
| 391 | Ga0453684_0000107 | 3300044712 | Bacteria | 362864 |
| 392 | Ga0466971_0000286 | 3300044719 | Bacteria | 19348 |
| 393 | Ga0466968_0043116 | 3300044735 | Bacteria | 1909 |
| 394 | Ga0466970_0125546 | 3300044765 | Bacteria | 1407 |
| 395 | Ga0466970_0273043 | 3300044765 | Bacteria | 950 |
| 396 | Ga0466957_0000016 | 3300044842 | Bacteria | 66255 |
| 397 | Ga0466957_0011629 | 3300044842 | Bacteria | 5085 |
| 398 | Ga0466957_0179508 | 3300044842 | Bacteria | 1382 |
| 399 | Ga0466957_0213503 | 3300044842 | Bacteria | 1271 |
| 400 | Ga0466960_0032423 | 3300044901 | Bacteria | 2419 |
| 401 | Ga0466959_0001352 | 3300045049 | Bacteria | 14948 |
| 402 | Ga0466959_0008299 | 3300045049 | Bacteria | 7336 |
| 403 | Ga0466959_0046040 | 3300045049 | Bacteria | 3211 |
| 404 | Ga0466959_0060809 | 3300045049 | Bacteria | 2748 |
| 405 | Ga0466959_0113610 | 3300045049 | Unclassified | 1931 |
| 406 | Ga0451576_0592653 | 3300045051 | Bacteria | 1165 |
| 407 | Ga0466958_0003273 | 3300045836 | Bacteria | 8377 |
| 408 | Ga0466958_0005096 | 3300045836 | Bacteria | 7020 |
| 409 | Ga0466958_0035867 | 3300045836 | Bacteria | 2965 |
| 410 | Ga0466958_0046744 | 3300045836 | Bacteria | 2612 |
| 411 | Ga0466958_0099234 | 3300045836 | Bacteria | 1809 |
| 412 | Ga0466967_0002705 | 3300045976 | Bacteria | 11203 |
| 413 | Ga0466967_0006369 | 3300045976 | Bacteria | 8342 |
| 414 | Ga0466967_0019105 | 3300045976 | Bacteria | 5502 |
| 415 | Ga0466967_0019957 | 3300045976 | Bacteria | 5403 |
| 416 | Ga0466967_0020424 | 3300045976 | Bacteria | 5354 |
| 417 | Ga0466967_0024299 | 3300045976 | Bacteria | 4980 |
| 418 | Ga0466967_0026977 | 3300045976 | Bacteria | 4769 |
| 419 | Ga0466967_0033511 | 3300045976 | Bacteria | 4348 |
| 420 | Ga0466967_0035833 | 3300045976 | Bacteria | 4228 |
| 421 | Ga0466967_0037387 | 3300045976 | Bacteria | 4154 |
| 422 | Ga0466967_0071065 | 3300045976 | Bacteria | 3115 |
| 423 | Ga0466967_0075359 | 3300045976 | Unclassified | 3032 |
| 424 | Ga0466967_0082094 | 3300045976 | Bacteria | 2912 |
| 425 | Ga0466967_0103650 | 3300045976 | Bacteria | 2603 |
| 426 | Ga0466967_0651682 | 3300045976 | Bacteria | 1041 |
| 427 | Ga0466967_0761484 | 3300045976 | Bacteria | 960 |
| 428 | Ga0466967_0937895 | 3300045976 | Bacteria | 861 |
| 429 | Ga0495592_0114943 | 3300046454 | Bacteria | 1900 |
| 430 | Ga0495592_0198951 | 3300046454 | Bacteria | 1353 |
| 431 | Ga0495629_0000751 | 3300046459 | Bacteria | 26237 |
| 432 | Ga0495629_0072363 | 3300046459 | Bacteria | 2406 |
| 433 | Ga0495641_0025892 | 3300046461 | Bacteria | 2872 |
| 434 | Ga0495651_0056923 | 3300046462 | Bacteria | 3002 |
| 435 | Ga0495651_0075561 | 3300046462 | Bacteria | 2554 |
| 436 | Ga0495651_0106926 | 3300046462 | Bacteria | 2073 |
| 437 | Ga0495653_0103286 | 3300046463 | Bacteria | 2061 |
| 438 | Ga0495653_0135861 | 3300046463 | Unclassified | 1735 |
| 439 | Ga0495653_0181191 | 3300046463 | Bacteria | 1445 |
| 440 | Ga0495653_0182782 | 3300046463 | Bacteria | 1437 |
| 441 | Ga0495653_0215782 | 3300046463 | Bacteria | 1293 |
| 442 | Ga0495653_0263075 | 3300046463 | Bacteria | 1139 |
| 443 | Ga0495582_0004009 | 3300046473 | Bacteria | 8270 |
| 444 | Ga0495582_0233375 | 3300046473 | Bacteria | 1054 |
| 445 | Ga0495639_0004280 | 3300046475 | Bacteria | 6122 |
| 446 | Ga0495662_0002337 | 3300046476 | Bacteria | 9556 |
| 447 | Ga0495662_0112883 | 3300046476 | Bacteria | 1332 |
| 448 | Ga0495664_0066110 | 3300046477 | Bacteria | 2156 |
| 449 | Ga0495664_0088489 | 3300046477 | Bacteria | 1861 |
| 450 | Ga0495664_0297523 | 3300046477 | Bacteria | 974 |
| 451 | Ga0495594_0016495 | 3300046499 | Bacteria | 3892 |
| 452 | Ga0495608_0028413 | 3300046511 | Bacteria | 3801 |
| 453 | Ga0495608_0066826 | 3300046511 | Bacteria | 2353 |
| 454 | Ga0495608_0122122 | 3300046511 | Bacteria | 1670 |
| 455 | Ga0495618_0380749 | 3300046514 | Bacteria | 866 |
| 456 | Ga0495628_0066377 | 3300046516 | Bacteria | 2821 |
| 457 | Ga0495628_0073645 | 3300046516 | Bacteria | 2661 |
| 458 | Ga0495628_0132695 | 3300046516 | Bacteria | 1904 |
| 459 | Ga0495628_0540827 | 3300046516 | Bacteria | 837 |
| 460 | Ga0495630_0012132 | 3300046517 | Bacteria | 6248 |
| 461 | Ga0495630_0029133 | 3300046517 | Bacteria | 4103 |
| 462 | Ga0495630_0087067 | 3300046517 | Bacteria | 2359 |
| 463 | Ga0495630_0130200 | 3300046517 | Bacteria | 1911 |
| 464 | Ga0495666_0073918 | 3300046526 | Bacteria | 1617 |
| 465 | Ga0495652_0016921 | 3300046529 | Bacteria | 6515 |
| 466 | Ga0495652_0030670 | 3300046529 | Bacteria | 4713 |
| 467 | Ga0495652_0095571 | 3300046529 | Bacteria | 2421 |
| 468 | Ga0495652_0261440 | 3300046529 | Unclassified | 1277 |
| 469 | Ga0495665_0002583 | 3300046531 | Bacteria | 9781 |
| 470 | Ga0495640_0022230 | 3300046533 | Bacteria | 4640 |
| 471 | Ga0495640_0064950 | 3300046533 | Bacteria | 2466 |
| 472 | Ga0495640_0123295 | 3300046533 | Bacteria | 1682 |
| 473 | Ga0495640_0202305 | 3300046533 | Bacteria | 1258 |
| 474 | Ga0495586_0204184 | 3300046535 | Bacteria | 1121 |
| 475 | Ga0495586_0321923 | 3300046535 | Bacteria | 887 |
| 476 | Ga0495587_0100812 | 3300046536 | Bacteria | 1664 |
| 477 | Ga0495587_0130428 | 3300046536 | Bacteria | 1437 |
| 478 | Ga0495645_0114779 | 3300046543 | Bacteria | 1903 |
| 479 | Ga0495645_0152989 | 3300046543 | Bacteria | 1601 |
| 480 | Ga0495645_0260255 | 3300046543 | Bacteria | 1149 |
| 481 | Ga0495667_0000109 | 3300046559 | Bacteria | 59985 |
| 482 | Ga0495667_0013180 | 3300046559 | Bacteria | 5599 |
| 483 | Ga0495667_0020497 | 3300046559 | Bacteria | 4461 |
| 484 | Ga0495667_0048163 | 3300046559 | Bacteria | 2814 |
| 485 | Ga0495667_0057783 | 3300046559 | Bacteria | 2549 |
| 486 | Ga0495667_0074030 | 3300046559 | Bacteria | 2218 |
| 487 | Ga0495656_0028573 | 3300046615 | Bacteria | 2238 |
| 488 | Ga0495635_0019899 | 3300046663 | Bacteria | 4678 |
| 489 | Ga0495635_0037924 | 3300046663 | Bacteria | 3336 |
| 490 | Ga0495635_0062328 | 3300046663 | Bacteria | 2561 |
| 491 | Ga0495635_0101367 | 3300046663 | Bacteria | 1968 |
| 492 | Ga0495635_0139260 | 3300046663 | Bacteria | 1653 |
| 493 | Ga0495635_0413153 | 3300046663 | Bacteria | 895 |
| 494 | Ga0495588_0226015 | 3300046674 | Bacteria | 988 |
| 495 | Ga0495657_0040339 | 3300046675 | Bacteria | 3203 |
| 496 | Ga0495657_0072767 | 3300046675 | Bacteria | 2241 |
| 497 | Ga0495657_0115125 | 3300046675 | Bacteria | 1699 |
| 498 | Ga0495599_0070768 | 3300046678 | Bacteria | 2177 |
| 499 | Ga0495599_0072799 | 3300046678 | Bacteria | 2145 |
| 500 | Ga0495599_0169215 | 3300046678 | Bacteria | 1349 |
| 501 | Ga0495623_0072986 | 3300046679 | Bacteria | 2133 |
| 502 | Ga0495646_0128884 | 3300046680 | Bacteria | 1426 |
| 503 | Ga0495646_0132014 | 3300046680 | Bacteria | 1405 |
| 504 | Ga0495658_0005121 | 3300046683 | Bacteria | 6445 |
| 505 | Ga0495658_0018848 | 3300046683 | Bacteria | 3595 |
| 506 | Ga0495658_0104585 | 3300046683 | Bacteria | 1695 |
| 507 | Ga0495658_0491887 | 3300046683 | Archaea | 784 |
| 508 | Ga0495613_0002178 | 3300046689 | Bacteria | 14831 |
| 509 | Ga0495613_0129090 | 3300046689 | Bacteria | 1811 |
| 510 | Ga0495613_0153318 | 3300046689 | Bacteria | 1642 |
| 511 | Ga0495624_0054028 | 3300046690 | Bacteria | 2534 |
| 512 | Ga0495624_0069454 | 3300046690 | Bacteria | 2194 |
| 513 | Ga0495670_0151634 | 3300046691 | Bacteria | 1216 |
| 514 | Ga0495589_0154033 | 3300046794 | Bacteria | 1097 |
| 515 | Ga0495600_0037399 | 3300046809 | Bacteria | 3155 |
| 516 | Ga0495600_0043868 | 3300046809 | Bacteria | 2917 |
| 517 | Ga0495600_0418298 | 3300046809 | Bacteria | 832 |
| 518 | Ga0495581_0008850 | 3300047315 | Bacteria | 5827 |
| 519 | Ga0495604_0059232 | 3300047317 | Bacteria | 2936 |
| 520 | Ga0495604_0156830 | 3300047317 | Bacteria | 1612 |
| 521 | Ga0495604_0172428 | 3300047317 | Bacteria | 1520 |
| 522 | Ga0495604_0314440 | 3300047317 | Unclassified | 1048 |
| 523 | Ga0495604_0453268 | 3300047317 | Bacteria | 838 |
| 524 | Ga0495674_0001348 | 3300047319 | Bacteria | 23938 |
| 525 | Ga0495674_0055887 | 3300047319 | Bacteria | 3460 |
| 526 | Ga0495674_0116444 | 3300047319 | Bacteria | 2261 |
| 527 | Ga0495674_0198237 | 3300047319 | Bacteria | 1666 |
| 528 | Ga0495674_0208793 | 3300047319 | Bacteria | 1618 |
| 529 | Ga0495674_0265636 | 3300047319 | Bacteria | 1409 |
| 530 | Ga0495676_0009529 | 3300047321 | Bacteria | 8841 |
| 531 | Ga0495680_0001999 | 3300047322 | Bacteria | 21403 |
| 532 | Ga0495680_0022618 | 3300047322 | Bacteria | 5236 |
| 533 | Ga0495680_0025403 | 3300047322 | Bacteria | 4903 |
| 534 | Ga0495680_0029516 | 3300047322 | Bacteria | 4490 |
| 535 | Ga0495680_0070304 | 3300047322 | Bacteria | 2669 |
| 536 | Ga0495680_0149056 | 3300047322 | Bacteria | 1707 |
| 537 | Ga0495680_0251680 | 3300047322 | Bacteria | 1252 |
| 538 | Ga0495675_0012447 | 3300047444 | Bacteria | 5355 |
| 539 | Ga0495675_0075941 | 3300047444 | Bacteria | 2118 |
| 540 | Ga0495684_0004159 | 3300047471 | Bacteria | 11303 |
| 541 | Ga0495684_0005557 | 3300047471 | Bacteria | 9822 |
| 542 | Ga0495684_0020794 | 3300047471 | Bacteria | 5057 |
| 543 | Ga0495684_0025711 | 3300047471 | Bacteria | 4523 |
| 544 | Ga0495684_0113042 | 3300047471 | Bacteria | 2047 |
| 545 | Ga0495684_0300991 | 3300047471 | Unclassified | 1152 |
| 546 | Ga0495593_0054808 | 3300047673 | Bacteria | 2100 |
| 547 | Ga0495593_0260513 | 3300047673 | Bacteria | 868 |
| 548 | Ga0495602_0072444 | 3300048088 | Bacteria | 2937 |
| 549 | Ga0495602_0092290 | 3300048088 | Unclassified | 2509 |
| 550 | Ga0495602_0122576 | 3300048088 | Bacteria | 2089 |
| 551 | Ga0495602_0168084 | 3300048088 | Bacteria | 1705 |
| 552 | Ga0495602_0216796 | 3300048088 | Bacteria | 1448 |
| 553 | Ga0495602_0454185 | 3300048088 | Bacteria | 904 |
| 554 | Ga0495614_0002115 | 3300048089 | Bacteria | 8783 |
| 555 | Ga0496100_0113226 | 3300048903 | Bacteria | 1888 |
| 556 | Ga0496100_0150205 | 3300048903 | Bacteria | 1661 |
| 557 | Ga0496101_0003998 | 3300048904 | Bacteria | 9224 |
| 558 | Ga0496101_0253300 | 3300048904 | Bacteria | 1372 |
| 559 | Ga0496101_0340415 | 3300048904 | Bacteria | 1178 |
| 560 | Ga0496102_0162685 | 3300048905 | Bacteria | 2100 |
| 561 | Ga0496102_0284372 | 3300048905 | Bacteria | 1559 |
| 562 | Ga0496102_0773301 | 3300048905 | Bacteria | 883 |
| 563 | Ga0496104_0001866 | 3300048907 | Bacteria | 18242 |
| 564 | Ga0496104_0012594 | 3300048907 | Bacteria | 7610 |
| 565 | Ga0496104_0056272 | 3300048907 | Bacteria | 3719 |
| 566 | Ga0496104_0083370 | 3300048907 | Bacteria | 3049 |
| 567 | Ga0496104_0111804 | 3300048907 | Bacteria | 2619 |
| 568 | Ga0496104_0116084 | 3300048907 | Bacteria | 2569 |
| 569 | Ga0496104_0223952 | 3300048907 | Bacteria | 1793 |
| 570 | Ga0496104_0226962 | 3300048907 | Unclassified | 1780 |
| 571 | Ga0496104_0314143 | 3300048907 | Bacteria | 1480 |
| 572 | Ga0496105_0000814 | 3300048908 | Bacteria | 21144 |
| 573 | Ga0496105_0012703 | 3300048908 | Bacteria | 6670 |
| 574 | Ga0496105_0047413 | 3300048908 | Bacteria | 3546 |
| 575 | Ga0496105_0078036 | 3300048908 | Bacteria | 2735 |
| 576 | Ga0496105_0081884 | 3300048908 | Bacteria | 2666 |
| 577 | Ga0496106_0143056 | 3300048909 | Unclassified | 1882 |
| 578 | Ga0496106_0175265 | 3300048909 | Bacteria | 1701 |
| 579 | Ga0496106_0206698 | 3300048909 | Bacteria | 1563 |
| 580 | Ga0496107_0018923 | 3300048910 | Bacteria | 4855 |
| 581 | Ga0496107_0048680 | 3300048910 | Bacteria | 3054 |
| 582 | Ga0496107_0082734 | 3300048910 | Bacteria | 2341 |
| 583 | Ga0496107_0255133 | 3300048910 | Bacteria | 1305 |
| 584 | Ga0496107_0353804 | 3300048910 | Bacteria | 1093 |
| 585 | Ga0496108_0000913 | 3300048911 | Bacteria | 22979 |
| 586 | Ga0496108_0198968 | 3300048911 | Bacteria | 1738 |
| 587 | Ga0496108_0205128 | 3300048911 | Bacteria | 1711 |
| 588 | Ga0496109_0000515 | 3300048912 | Bacteria | 32878 |
| 589 | Ga0496109_0025069 | 3300048912 | Bacteria | 5310 |
| 590 | Ga0496109_0038167 | 3300048912 | Bacteria | 4341 |
| 591 | Ga0496109_0112748 | 3300048912 | Bacteria | 2529 |
| 592 | Ga0496109_0214156 | 3300048912 | Bacteria | 1812 |
| 593 | Ga0496109_0303928 | 3300048912 | Bacteria | 1505 |
| 594 | Ga0496109_0793989 | 3300048912 | Bacteria | 885 |
| 595 | Ga0496110_0011572 | 3300048913 | Bacteria | 7231 |
| 596 | Ga0496110_0154677 | 3300048913 | Bacteria | 2077 |
| 597 | Ga0496110_0205508 | 3300048913 | Bacteria | 1790 |
| 598 | Ga0496110_0280668 | 3300048913 | Unclassified | 1517 |
| 599 | Ga0496110_0519931 | 3300048913 | Bacteria | 1083 |
| 600 | Ga0496110_0554066 | 3300048913 | Bacteria | 1045 |
| 601 | Ga0496111_0002620 | 3300048914 | Bacteria | 10905 |
| 602 | Ga0496111_0003042 | 3300048914 | Bacteria | 10287 |
| 603 | Ga0496111_0044690 | 3300048914 | Bacteria | 3184 |
| 604 | Ga0496111_0215631 | 3300048914 | Bacteria | 1426 |
| 605 | Ga0496112_0008408 | 3300048915 | Bacteria | 9243 |
| 606 | Ga0496112_0014988 | 3300048915 | Bacteria | 7214 |
| 607 | Ga0496112_0029234 | 3300048915 | Bacteria | 5328 |
| 608 | Ga0496112_0068511 | 3300048915 | Bacteria | 3504 |
| 609 | Ga0496112_0070790 | 3300048915 | Bacteria | 3447 |
| 610 | Ga0496112_0084912 | 3300048915 | Bacteria | 3132 |
| 611 | Ga0496112_0085287 | 3300048915 | Bacteria | 3125 |
| 612 | Ga0496112_0118792 | 3300048915 | Bacteria | 2614 |
| 613 | Ga0496112_0155430 | 3300048915 | Bacteria | 2254 |
| 614 | Ga0496112_0720273 | 3300048915 | Bacteria | 925 |
| 615 | Ga0496113_0075668 | 3300048916 | Bacteria | 2570 |
| 616 | Ga0496113_0174437 | 3300048916 | Bacteria | 1703 |
| 617 | Ga0496113_0276879 | 3300048916 | Bacteria | 1341 |
| 618 | Ga0496114_0000623 | 3300048917 | Bacteria | 26186 |
| 619 | Ga0496114_0019075 | 3300048917 | Bacteria | 5557 |
| 620 | Ga0496114_0027511 | 3300048917 | Bacteria | 4659 |
| 621 | Ga0496114_0033848 | 3300048917 | Bacteria | 4213 |
| 622 | Ga0496114_0039467 | 3300048917 | Bacteria | 3907 |
| 623 | Ga0496114_0045402 | 3300048917 | Bacteria | 3650 |
| 624 | Ga0496114_0069405 | 3300048917 | Bacteria | 2959 |
| 625 | Ga0496114_0241837 | 3300048917 | Bacteria | 1587 |
| 626 | Ga0496115_0000516 | 3300048918 | Bacteria | 30049 |
| 627 | Ga0496115_0223480 | 3300048918 | Bacteria | 1554 |
| 628 | Ga0501031_0000846 | 3300049568 | Bacteria | 18372 |
| 629 | Ga0501031_0003266 | 3300049568 | Bacteria | 10420 |
| 630 | Ga0501031_0038460 | 3300049568 | Bacteria | 3123 |
| 631 | Ga0501031_0072902 | 3300049568 | Bacteria | 2235 |
| 632 | Ga0501032_0041930 | 3300049569 | Bacteria | 3106 |
| 633 | Ga0501032_0059918 | 3300049569 | Bacteria | 2553 |
| 634 | Ga0501033_0007070 | 3300049570 | Bacteria | 8764 |
| 635 | Ga0501033_0062239 | 3300049570 | Bacteria | 2748 |
| 636 | Ga0501033_0108535 | 3300049570 | Bacteria | 2021 |
| 637 | Ga0501034_0040919 | 3300049571 | Bacteria | 4689 |
| 638 | Ga0501034_0285678 | 3300049571 | Bacteria | 1589 |
| 639 | Ga0501036_0001804 | 3300049572 | Bacteria | 16596 |
| 640 | Ga0501036_0030229 | 3300049572 | Bacteria | 4577 |
| 641 | Ga0501036_0103983 | 3300049572 | Bacteria | 2401 |
| 642 | Ga0501036_0359551 | 3300049572 | Bacteria | 1216 |
| 643 | Ga0501037_0033364 | 3300049573 | Bacteria | 3802 |
| 644 | Ga0501037_0040796 | 3300049573 | Bacteria | 3415 |
| 645 | Ga0501037_0082614 | 3300049573 | Bacteria | 2328 |
| 646 | Ga0501038_0001069 | 3300049574 | Bacteria | 24728 |
| 647 | Ga0501038_0011884 | 3300049574 | Bacteria | 7946 |
| 648 | Ga0501038_0046049 | 3300049574 | Bacteria | 3783 |
| 649 | Ga0501039_0007554 | 3300049575 | Bacteria | 8303 |
| 650 | Ga0501039_0009025 | 3300049575 | Bacteria | 7596 |
| 651 | Ga0501039_0084584 | 3300049575 | Bacteria | 2471 |
| 652 | Ga0501039_0343198 | 3300049575 | Bacteria | 1173 |
| 653 | Ga0501040_0014689 | 3300049576 | Bacteria | 5165 |
| 654 | Ga0501040_0024820 | 3300049576 | Bacteria | 4026 |
| 655 | Ga0501041_0000917 | 3300049577 | Bacteria | 15968 |
| 656 | Ga0501041_0002324 | 3300049577 | Bacteria | 10750 |
| 657 | Ga0501042_0015806 | 3300049578 | Bacteria | 5173 |
| 658 | Ga0501042_0029897 | 3300049578 | Bacteria | 3843 |
| 659 | Ga0501042_0222711 | 3300049578 | Bacteria | 1361 |
| 660 | Ga0501043_0035726 | 3300049579 | Bacteria | 3909 |
| 661 | Ga0501046_0011675 | 3300049580 | Bacteria | 7507 |
| 662 | Ga0501046_0045385 | 3300049580 | Bacteria | 3492 |
| 663 | Ga0501046_0109562 | 3300049580 | Bacteria | 2111 |
| 664 | Ga0501047_0168510 | 3300049581 | Bacteria | 2060 |
| 665 | Ga0501047_0442240 | 3300049581 | Bacteria | 1130 |
| 666 | Ga0501047_0571904 | 3300049581 | Bacteria | 953 |
| 667 | Ga0501048_0001298 | 3300049582 | Bacteria | 18965 |
| 668 | Ga0501048_0005524 | 3300049582 | Bacteria | 9619 |
| 669 | Ga0501067_0016102 | 3300049583 | Bacteria | 4134 |
| 670 | Ga0501067_0050603 | 3300049583 | Unclassified | 2302 |
| 671 | Ga0501068_0004009 | 3300049584 | Bacteria | 8010 |
| 672 | Ga0501068_0019365 | 3300049584 | Bacteria | 3951 |
| 673 | Ga0501068_0047639 | 3300049584 | Bacteria | 2586 |
| 674 | Ga0501068_0195505 | 3300049584 | Bacteria | 1282 |
| 675 | Ga0501068_0452697 | 3300049584 | Bacteria | 830 |
| 676 | Ga0501069_0001576 | 3300049585 | Bacteria | 11266 |
| 677 | Ga0501069_0016325 | 3300049585 | Bacteria | 3986 |
| 678 | Ga0501069_0120836 | 3300049585 | Unclassified | 1496 |
| 679 | Ga0501069_0137709 | 3300049585 | Bacteria | 1399 |
| 680 | Ga0501070_0002493 | 3300049586 | Bacteria | 16126 |
| 681 | Ga0501070_0041521 | 3300049586 | Bacteria | 3832 |
| 682 | Ga0501070_0091402 | 3300049586 | Bacteria | 2519 |
| 683 | Ga0501070_0125946 | 3300049586 | Bacteria | 2117 |
| 684 | Ga0501070_0188595 | 3300049586 | Bacteria | 1695 |
| 685 | Ga0501070_0217732 | 3300049586 | Bacteria | 1566 |
| 686 | Ga0501070_0226458 | 3300049586 | Bacteria | 1532 |
| 687 | Ga0501071_0005243 | 3300049587 | Bacteria | 8308 |
| 688 | Ga0501071_0008999 | 3300049587 | Bacteria | 6627 |
| 689 | Ga0501071_0009735 | 3300049587 | Bacteria | 6412 |
| 690 | Ga0501071_0207595 | 3300049587 | Bacteria | 1472 |
| 691 | Ga0501072_0005526 | 3300049588 | Bacteria | 9620 |
| 692 | Ga0501072_0117282 | 3300049588 | Bacteria | 2120 |
| 693 | Ga0501072_0314058 | 3300049588 | Bacteria | 1245 |
| 694 | Ga0501073_0009347 | 3300049589 | Bacteria | 7234 |
| 695 | Ga0501073_0010225 | 3300049589 | Bacteria | 6893 |
| 696 | Ga0501074_0005547 | 3300049590 | Bacteria | 9075 |
| 697 | Ga0501074_0021237 | 3300049590 | Bacteria | 4714 |
| 698 | Ga0501074_0034002 | 3300049590 | Bacteria | 3695 |
| 699 | Ga0501074_0070043 | 3300049590 | Bacteria | 2522 |
| 700 | Ga0501074_0105379 | 3300049590 | Bacteria | 2018 |
| 701 | Ga0501075_0035350 | 3300049591 | Bacteria | 3726 |
| 702 | Ga0501075_0114894 | 3300049591 | Bacteria | 2047 |
| 703 | Ga0501075_0128538 | 3300049591 | Bacteria | 1929 |
| 704 | Ga0501076_0003885 | 3300049592 | Bacteria | 10525 |
| 705 | Ga0501076_0077576 | 3300049592 | Bacteria | 2665 |
| 706 | Ga0501076_0079411 | 3300049592 | Bacteria | 2633 |
| 707 | Ga0501076_0601760 | 3300049592 | Bacteria | 907 |
| 708 | Ga0501077_0018115 | 3300049593 | Bacteria | 4452 |
| 709 | Ga0501077_0327133 | 3300049593 | Bacteria | 977 |
| 710 | Ga0501077_0439058 | 3300049593 | Bacteria | 835 |
| 711 | Ga0501079_0010609 | 3300049741 | Bacteria | 7010 |
| 712 | Ga0501079_0021547 | 3300049741 | Bacteria | 4929 |
| 713 | Ga0501079_0191241 | 3300049741 | Bacteria | 1597 |
| 714 | Ga0501080_0004694 | 3300049742 | Bacteria | 12188 |
| 715 | Ga0501080_0012605 | 3300049742 | Bacteria | 7751 |
| 716 | Ga0501080_0018866 | 3300049742 | Bacteria | 6387 |
| 717 | Ga0501080_0019556 | 3300049742 | Bacteria | 6274 |
| 718 | Ga0501081_0005562 | 3300049743 | Bacteria | 8137 |
| 719 | Ga0501081_0072919 | 3300049743 | Bacteria | 2394 |
| 720 | Ga0501081_0266426 | 3300049743 | Bacteria | 1252 |
| 721 | Ga0501083_0006527 | 3300049744 | Bacteria | 8272 |
| 722 | Ga0501083_0070425 | 3300049744 | Bacteria | 2326 |
| 723 | Ga0501035_0007364 | 3300049822 | Bacteria | 10284 |
| 724 | Ga0501035_0011641 | 3300049822 | Bacteria | 8155 |
| 725 | Ga0501035_0157310 | 3300049822 | Bacteria | 1969 |
| 726 | Ga0501044_0338376 | 3300049823 | Bacteria | 1426 |
| 727 | Ga0501044_0343458 | 3300049823 | Bacteria | 1413 |
| 728 | Ga0501044_0567926 | 3300049823 | Bacteria | 1030 |
| 729 | Ga0501044_0783348 | 3300049823 | Bacteria | 834 |
| 730 | Ga0501045_0000260 | 3300049824 | Bacteria | 30596 |
| 731 | Ga0501045_0000874 | 3300049824 | Bacteria | 19549 |
| 732 | Ga0501045_0280422 | 3300049824 | Bacteria | 1240 |
| 733 | nmdc:mga05p37_148086_c1 | 3300050507 | Bacteria | 2873 |
| 734 | nmdc:mga05p37_160700_c1 | 3300050507 | Bacteria | 2744 |
| 735 | nmdc:mga09592_40028_c1 | 3300050508 | Bacteria | 3937 |
| 736 | nmdc:mga09592_635250_c1 | 3300050508 | Bacteria | 912 |
| 737 | nmdc:mga0qj67_1196_c1 | 3300050509 | Bacteria | 18023 |
| 738 | nmdc:mga0qj67_223845_c1 | 3300050509 | Bacteria | 1527 |
| 739 | nmdc:mga0qj67_361218_c1 | 3300050509 | Bacteria | 1173 |
| 740 | nmdc:mga06r32_424454_c1 | 3300050510 | Unclassified | 1311 |
| 741 | nmdc:mga08y16_231547_c1 | 3300050511 | Bacteria | 1911 |
| 742 | nmdc:mga0rr50_176455_c1 | 3300050513 | Bacteria | 1744 |
| 743 | nmdc:mga0a205_51796_c1 | 3300050515 | Bacteria | 3963 |
| 744 | Ga0495601_0066873 | 3300053077 | Bacteria | 2288 |
| 745 | Ga0495595_0005495 | 3300053084 | Bacteria | 5135 |
| 746 | Ga0495595_0021383 | 3300053084 | Bacteria | 2826 |
| 747 | Ga0495595_0063090 | 3300053084 | Bacteria | 1739 |
| 748 | Ga0495595_0070835 | 3300053084 | Bacteria | 1648 |
| 749 | Ga0495595_0075051 | 3300053084 | Unclassified | 1603 |
| 750 | Ga0495595_0118614 | 3300053084 | Bacteria | 1288 |
| 751 | Ga0495595_0178446 | 3300053084 | Bacteria | 1053 |
| 752 | Ga0495619_0001761 | 3300053085 | Bacteria | 14402 |
| 753 | Ga0495619_0149198 | 3300053085 | Bacteria | 1612 |
| 754 | Ga0495619_0297505 | 3300053085 | Bacteria | 1118 |
| 755 | Ga0501084_0030073 | 3300054114 | Bacteria | 4543 |
| 756 | Ga0501084_0035680 | 3300054114 | Bacteria | 4157 |
| 757 | Ga0501084_0048179 | 3300054114 | Bacteria | 3568 |
| 758 | Ga0501084_0053226 | 3300054114 | Bacteria | 3385 |
| 759 | Ga0501084_0157879 | 3300054114 | Bacteria | 1913 |
| 760 | Ga0501082_0006823 | 3300060353 | Bacteria | 9869 |
| 761 | Ga0501082_0014407 | 3300060353 | Bacteria | 6804 |
| 762 | Ga0501082_0048650 | 3300060353 | Bacteria | 3655 |
| 763 | Ga0501082_0117335 | 3300060353 | Bacteria | 2305 |
| 764 | Ga0466962_0000594 | 3300061719 | Bacteria | 15979 |
| 765 | Ga0530510_0053810 | 3300061734 | Bacteria | 2908 |
| 766 | Ga0530510_0087480 | 3300061734 | Bacteria | 2270 |
| 767 | Ga0530510_0336413 | 3300061734 | Bacteria | 1133 |
| 768 | Ga0530510_0502204 | 3300061734 | Bacteria | 919 |
| 769 | Ga0070709_10030075 | |||
| 770 | Ga0070658_10004865 | |||
| 771 | Ga0070658_10016816 | |||
| 772 | Ga0070658_10124525 | |||
| 773 | Ga0070658_10333485 | |||
| 774 | Ga0070658_10384452 | |||
| 775 | Ga0070658_10472793 | |||
| 776 | Ga0070683_100000658 | |||
| 777 | Ga0070683_100014083 | |||
| 778 | Ga0070683_100016044 | |||
| 779 | Ga0070683_100056640 | |||
| 780 | Ga0070683_100325792 | |||
| 781 | Ga0068869_100033530 | |||
| 782 | Ga0070666_10238734 | |||
| 783 | Ga0070680_100029384 | |||
| 784 | Ga0070680_100055343 | |||
| 785 | Ga0070680_100307738 | |||
| 786 | Ga0070680_100316305 | |||
| 787 | Ga0070682_100085901 | |||
| 788 | Ga0068868_100132098 | |||
| 789 | Ga0068868_100316848 | |||
| 790 | Ga0070660_100001629 | |||
| 791 | Ga0070660_100007104 | |||
| 792 | Ga0070691_10001923 | |||
| 793 | Ga0070692_10052460 | |||
| 794 | Ga0070668_100162783 | |||
| 795 | Ga0070668_100526139 | |||
| 796 | Ga0070669_100481740 | |||
| 797 | Ga0070675_100025382 | |||
| 798 | Ga0070674_100050072 | |||
| 799 | Ga0070673_100010854 | |||
| 800 | Ga0070688_100057152 | |||
| 801 | Ga0070659_100020529 | |||
| 802 | Ga0070703_10008708 | |||
| 803 | Ga0070709_10101069 | |||
| 804 | Ga0070714_100024151 | |||
| 805 | Ga0070714_100025809 | |||
| 806 | Ga0070714_100055787 | |||
| 807 | Ga0070714_100322440 | |||
| 808 | Ga0070714_100444345 | |||
| 809 | Ga0070713_100249691 | |||
| 810 | Ga0070701_10047333 | |||
| 811 | Ga0070705_100002556 | |||
| 812 | Ga0070705_100094379 | |||
| 813 | Ga0070700_100157672 | |||
| 814 | Ga0070708_100070521 | |||
| 815 | Ga0070708_100207875 | |||
| 816 | Ga0070678_100048203 | |||
| 817 | Ga0070678_100133008 | |||
| 818 | Ga0070662_100320046 | |||
| 819 | Ga0070681_10079065 | |||
| 820 | Ga0070681_10098519 | |||
| 821 | Ga0070681_10211312 | |||
| 822 | Ga0068867_100293431 | |||
| 823 | Ga0070685_10007475 | |||
| 824 | Ga0070706_100307874 | |||
| 825 | Ga0070707_100051086 | |||
| 826 | Ga0070707_100403146 | |||
| 827 | Ga0070698_100046714 | |||
| 828 | Ga0070698_100120064 | |||
| 829 | Ga0070679_100017853 | |||
| 830 | Ga0070679_100044341 | |||
| 831 | Ga0070679_100240545 | |||
| 832 | Ga0070684_100031845 | |||
| 833 | Ga0070684_100121520 | |||
| 834 | Ga0070684_100205517 | |||
| 835 | Ga0070684_100223008 | |||
| 836 | Ga0070684_100286727 | |||
| 837 | Ga0070672_100061503 | |||
| 838 | Ga0070686_100486238 | |||
| 839 | Ga0070695_100078253 | |||
| 840 | Ga0070696_100235797 | |||
| 841 | Ga0070665_100146443 | |||
| 842 | Ga0070704_100006528 | |||
| 843 | Ga0070704_100092249 | |||
| 844 | Ga0068855_100020903 | |||
| 845 | Ga0068855_100118534 | |||
| 846 | Ga0068855_100177590 | |||
| 847 | Ga0068855_100393141 | |||
| 848 | Ga0068855_100732610 | |||
| 849 | Ga0070664_100013025 | |||
| 850 | Ga0070664_100257526 | |||
| 851 | Ga0070664_100271058 | |||
| 852 | Ga0068857_100283002 | |||
| 853 | Ga0068854_100419615 | |||
| 854 | Ga0068856_100002274 | |||
| 855 | Ga0068856_100007496 | |||
| 856 | Ga0068856_100252498 | |||
| 857 | Ga0068856_101136085 | |||
| 858 | Ga0070702_100089281 | |||
| 859 | Ga0070702_100180297 | |||
| 860 | Ga0068852_100028639 | |||
| 861 | Ga0068859_100056890 | |||
| 862 | Ga0068864_100129477 | |||
| 863 | Ga0068851_10077500 | |||
| 864 | Ga0068863_100074032 | |||
| 865 | Ga0068858_100047904 | |||
| 866 | Ga0068862_100224838 | |||
| 867 | Ga0081539_10001497 | |||
| 868 | Ga0070717_10024524 | |||
| 869 | Ga0070717_10226842 | |||
| 870 | Ga0070717_10393639 | |||
| 871 | Ga0075365_10041240 | |||
| 872 | Ga0075365_10219079 | |||
| 873 | Ga0070712_100018985 | |||
| 874 | Ga0097621_100773675 | |||
| 875 | Ga0068871_100352751 | |||
| 876 | Ga0075428_100275586 | |||
| 877 | Ga0075430_100001695 | |||
| 878 | Ga0075431_100333658 | |||
| 879 | Ga0075434_100050200 | |||
| 880 | Ga0075429_100064471 | |||
| 881 | Ga0097620_100056894 | |||
| 882 | Ga0075435_100249505 | |||
| 883 | Ga0075435_100532982 | |||
| 884 | Ga0099794_10029821 | |||
| 885 | Ga0105240_10033924 | |||
| 886 | Ga0105240_10082655 | |||
| 887 | Ga0105240_10179571 | |||
| 888 | Ga0105240_10230791 | |||
| 889 | Ga0111539_10141967 | |||
| 890 | Ga0111539_10181000 | |||
| 891 | Ga0105245_10007462 | |||
| 892 | Ga0105245_10013746 | |||
| 893 | Ga0105245_10014092 | |||
| 894 | Ga0105245_10029568 | |||
| 895 | Ga0105245_10034860 | |||
| 896 | Ga0114129_10121280 | |||
| 897 | Ga0114129_10163747 | |||
| 898 | Ga0105243_10001890 | |||
| 899 | Ga0105243_10044849 | |||
| 900 | Ga0105242_10130431 | |||
| 901 | Ga0105248_10026380 | |||
| 902 | Ga0105248_10549408 | |||
| 903 | Ga0105238_10076755 | |||
| 904 | Ga0105238_10099306 | |||
| 905 | Ga0105249_10083706 | |||
| 906 | Ga0105249_10281707 | |||
| 907 | Ga0105249_10299856 | |||
| 908 | Ga0105239_10016522 | |||
| 909 | Ga0105239_10048768 | |||
| 910 | Ga0105239_10279393 | |||
| 911 | Ga0105239_10510060 | |||
| 912 | Ga0105239_10586818 | |||
| 913 | Ga0105246_10275409 | |||
| 914 | Ga0157373_10071748 | |||
| 915 | Ga0157373_10130725 | |||
| 916 | Ga0157371_10004876 | |||
| 917 | Ga0157371_10501469 | |||
| 918 | Ga0157370_10006316 | |||
| 919 | Ga0157370_10069538 | |||
| 920 | Ga0157369_10005292 | |||
| 921 | Ga0157369_10005518 | |||
| 922 | Ga0157369_10054839 | |||
| 923 | Ga0157369_10276809 | |||
| 924 | Ga0157369_10345859 | |||
| 925 | Ga0157374_10469137 | |||
| 926 | Ga0157374_10796173 | |||
| 927 | Ga0157372_10139058 | |||
| 928 | Ga0157372_10141518 | |||
| 929 | Ga0157372_10256994 | |||
| 930 | Ga0157372_10264577 | |||
| 931 | Ga0157375_10004328 | |||
| 932 | Ga0163163_10305149 | |||
| 933 | Ga0182008_10009394 | |||
| 934 | Ga0182008_10015932 | |||
| 935 | Ga0157377_10004210 | |||
| 936 | Ga0182006_1024237 | |||
| 937 | Ga0182007_10008455 | |||
| 938 | Ga0197907_11074073 | |||
| 939 | Ga0206356_10379076 | |||
| 940 | Ga0206354_11276381 | |||
| 941 | Ga0206354_11349107 | |||
| 942 | Ga0206353_10632157 | |||
| 943 | Ga0206353_10953117 | |||
| 944 | Ga0206353_11085992 | |||
| 945 | Ga0206353_11566952 | |||
| 946 | Ga0207653_10023898 | |||
| 947 | Ga0207710_10026558 | |||
| 948 | Ga0207688_10050816 | |||
| 949 | Ga0207680_10169968 | |||
| 950 | Ga0207699_10078771 | |||
| 951 | Ga0207699_10081012 | |||
| 952 | Ga0207699_10142491 | |||
| 953 | Ga0207705_10030806 | |||
| 954 | Ga0207705_10054350 | |||
| 955 | Ga0207705_10087859 | |||
| 956 | Ga0207705_10573935 | |||
| 957 | Ga0207707_10130210 | |||
| 958 | Ga0207707_10147072 | |||
| 959 | Ga0207695_10021843 | |||
| 960 | Ga0207695_10110202 | |||
| 961 | Ga0207695_10272063 | |||
| 962 | Ga0207693_10402328 | |||
| 963 | Ga0207663_10187561 | |||
| 964 | Ga0207660_10239737 | |||
| 965 | Ga0207660_10493318 | |||
| 966 | Ga0207662_10012921 | |||
| 967 | Ga0207657_10001298 | |||
| 968 | Ga0207657_10002818 | |||
| 969 | Ga0207657_10010757 | |||
| 970 | Ga0207657_10483909 | |||
| 971 | Ga0207652_10149658 | |||
| 972 | Ga0207652_10309737 | |||
| 973 | Ga0207646_10332572 | |||
| 974 | Ga0207681_10250794 | |||
| 975 | Ga0207694_10062631 | |||
| 976 | Ga0207694_10157599 | |||
| 977 | Ga0207650_10264737 | |||
| 978 | Ga0207659_10075291 | |||
| 979 | Ga0207659_10321706 | |||
| 980 | Ga0207687_10008350 | |||
| 981 | Ga0207687_10015175 | |||
| 982 | Ga0207687_10052052 | |||
| 983 | Ga0207687_10060463 | |||
| 984 | Ga0207687_10075643 | |||
| 985 | Ga0207687_10100876 | |||
| 986 | Ga0207700_10143398 | |||
| 987 | Ga0207700_10184135 | |||
| 988 | Ga0207700_10372808 | |||
| 989 | Ga0207664_10025324 | |||
| 990 | Ga0207664_10106167 | |||
| 991 | Ga0207664_10247048 | |||
| 992 | Ga0207664_10264921 | |||
| 993 | Ga0207644_10139741 | |||
| 994 | Ga0207690_10028706 | |||
| 995 | Ga0207706_10004508 | |||
| 996 | Ga0207706_10056340 | |||
| 997 | Ga0207686_10083238 | |||
| 998 | Ga0207709_10128206 | |||
| 999 | Ga0207670_10054640 | |||
| 1000 | Ga0207669_10018387 | |||
| 1001 | Ga0207669_10123380 | |||
| 1002 | Ga0207691_10008235 | |||
| 1003 | Ga0207691_10016650 | |||
| 1004 | Ga0207711_10239444 | |||
| 1005 | Ga0207689_10069082 | |||
| 1006 | Ga0207661_10167119 | |||
| 1007 | Ga0207661_10192306 | |||
| 1008 | Ga0207661_10605806 | |||
| 1009 | Ga0207679_10170542 | |||
| 1010 | Ga0207667_10028622 | |||
| 1011 | Ga0207667_10115140 | |||
| 1012 | Ga0207667_10596199 | |||
| 1013 | Ga0207651_10171206 | |||
| 1014 | Ga0207712_10111123 | |||
| 1015 | Ga0207712_10192609 | |||
| 1016 | Ga0207658_10094419 | |||
| 1017 | Ga0207677_10031559 | |||
| 1018 | Ga0207677_10390252 | |||
| 1019 | Ga0207639_10750374 | |||
| 1020 | Ga0207678_10083624 | |||
| 1021 | Ga0207708_10092396 | |||
| 1022 | Ga0207708_10187155 | |||
| 1023 | Ga0207708_10211756 | |||
| 1024 | Ga0207702_10005369 | |||
| 1025 | Ga0207702_10134105 | |||
| 1026 | Ga0207702_10199417 | |||
| 1027 | Ga0207702_10386931 | |||
| 1028 | Ga0207641_10742692 | |||
| 1029 | Ga0207648_10043629 | |||
| 1030 | Ga0207674_10909892 | |||
| 1031 | Ga0207675_100155163 | |||
| 1032 | Ga0207683_10039573 | |||
| 1033 | Ga0207698_10011395 | |||
| 1034 | Ga0207698_10198913 | |||
| 1035 | Ga0207428_10142260 | |||
| 1036 | Ga0268266_10123855 | |||
| 1037 | Ga0265319_1003017 | |||
| 1038 | Ga0265334_10002725 | |||
| 1039 | Ga0265318_10003644 | |||
| 1040 | Ga0265318_10116689 | |||
| 1041 | Ga0265322_10021100 | |||
| 1042 | Ga0265322_10054173 | |||
| 1043 | Ga0265336_10058699 | |||
| 1044 | Ga0265338_10003780 | |||
| 1045 | Ga0265338_10026701 | |||
| 1046 | Ga0265338_10058462 | |||
| 1047 | Ga0265338_10097073 | |||
| 1048 | Ga0265330_10008454 | |||
| 1049 | Ga0265328_10005336 | |||
| 1050 | Ga0265320_10015015 | |||
| 1051 | Ga0265320_10103483 | |||
| 1052 | Ga0265340_10011010 | |||
| 1053 | Ga0265340_10074679 | |||
| 1054 | Ga0265339_10114101 | |||
| 1055 | Ga0265327_10015996 | |||
| 1056 | Ga0265316_10029736 | |||
| 1057 | Ga0265316_10074084 | |||
| 1058 | Ga0265316_10090444 | |||
| 1059 | Ga0265316_10423691 | |||
| 1060 | Ga0265313_10023198 | |||
| 1061 | Ga0265313_10036924 | |||
| 1062 | Ga0265313_10055180 | |||
| 1063 | Ga0265314_10034318 | |||
| 1064 | Ga0265314_10118918 | |||
| 1065 | Ga0265314_10265160 | |||
| 1066 | Ga0265342_10181463 | |||
| 1067 | Ga0307409_100010972 | |||
| 1068 | Ga0307409_100246215 | |||
| 1069 | Ga0307416_100171322 | |||
| 1070 | Ga0373928_0062888 | |||
| 1071 | Ga0373944_0004058 | |||
| 1072 | Ga0373951_0013350 | |||
| 1073 | Ga0373951_0058596 | |||
| 1074 | Ga0373936_0017416 | |||
| 1075 | Ga0373945_0002258 | |||
| 1076 | Ga0373945_0046181 | |||
| 1077 | Ga0373960_0015664 | |||
| 1078 | Ga0373943_0004043 | |||
| 1079 | Ga0373943_0018612 | |||
| 1080 | Ga0373955_0043752 | |||
| 1081 | Ga0373935_0051481 | |||
| 1082 | Ga0373947_0004772 | |||
| 1083 | Ga0373947_0020847 | |||
| 1084 | Ga0373937_0133789 | |||
| 1085 | Ga0373925_0002390 | |||
| 1086 | Ga0373925_0271179 | |||
| 1087 | Ga0395899_0024136 | |||
| 1088 | Ga0395899_0043674 | |||
| 1089 | Ga0395899_0052150 | |||
| 1090 | Ga0395899_0061786 | |||
| 1091 | Ga0395899_0191796 | |||
| 1092 | Ga0395899_0203819 | |||
| 1093 | Ga0395899_0334991 | |||
| 1094 | Ga0395900_0006141 | |||
| 1095 | Ga0395900_0063053 | |||
| 1096 | Ga0395900_0109780 | |||
| 1097 | Ga0395900_0136411 | |||
| 1098 | Ga0395900_0142146 | |||
| 1099 | Ga0395900_0267108 | |||
| 1100 | Ga0395900_0371711 | |||
| 1101 | Ga0395900_0419404 | |||
| 1102 | Ga0395900_0615082 | |||
| 1103 | Ga0395900_0640296 | |||
| 1104 | Ga0395900_0645753 | |||
| 1105 | Ga0395900_0668244 | |||
| 1106 | Ga0395900_0904623 | |||
| 1107 | Ga0395898_0032242 | |||
| 1108 | Ga0395898_0045002 | |||
| 1109 | Ga0395898_0052326 | |||
| 1110 | Ga0395898_0059520 | |||
| 1111 | Ga0395898_0066545 | |||
| 1112 | Ga0395898_0142328 | |||
| 1113 | Ga0395898_0145215 | |||
| 1114 | Ga0395898_0215544 | |||
| 1115 | Ga0395898_0339516 | |||
| 1116 | Ga0395898_0467846 | |||
| 1117 | Ga0395898_0668631 | |||
| 1118 | Ga0395898_0668644 | |||
| 1119 | Ga0395905_0004396 | |||
| 1120 | Ga0395905_0017526 | |||
| 1121 | Ga0395905_0131888 | |||
| 1122 | Ga0395905_0148104 | |||
| 1123 | Ga0395905_0160856 | |||
| 1124 | Ga0395905_0335044 | |||
| 1125 | Ga0395905_0902677 | |||
| 1126 | Ga0395901_0002959 | |||
| 1127 | Ga0395901_0006058 | |||
| 1128 | Ga0395901_0008716 | |||
| 1129 | Ga0395901_0021184 | |||
| 1130 | Ga0395901_0160523 | |||
| 1131 | Ga0395901_0196895 | |||
| 1132 | Ga0395901_0284708 | |||
| 1133 | Ga0395901_0369726 | |||
| 1134 | Ga0395901_0440903 | |||
| 1135 | Ga0395901_0542450 | |||
| 1136 | Ga0395901_0566120 | |||
| 1137 | Ga0436360_0359980 | |||
| 1138 | Ga0439439_0019593 | |||
| 1139 | Ga0451853_1343990 | |||
| 1140 | Ga0451853_3187853 | |||
| 1141 | Ga0450914_004742 | |||
| 1142 | Ga0451577_0002511 | |||
| 1143 | Ga0466969_0058417 | |||
| 1144 | Ga0466966_0004480 | |||
| 1145 | Ga0466966_0104432 | |||
| 1146 | Ga0466966_0184637 | |||
| 1147 | Ga0466961_0007230 | |||
| 1148 | Ga0466961_0025684 | |||
| 1149 | Ga0466961_0105739 | |||
| 1150 | Ga0466963_0001801 | |||
| 1151 | Ga0466963_0002737 | |||
| 1152 | Ga0466963_0003027 | |||
| 1153 | Ga0466963_0003699 | |||
| 1154 | Ga0466963_0009585 | |||
| 1155 | Ga0466963_0041816 | |||
| 1156 | Ga0466963_0057615 | |||
| 1157 | Ga0466963_0198558 | |||
| 1158 | Ga0466964_0098590 | |||
| 1159 | Ga0453684_0000107 | |||
| 1160 | Ga0466971_0000286 | |||
| 1161 | Ga0466968_0043116 | |||
| 1162 | Ga0466970_0125546 | |||
| 1163 | Ga0466970_0273043 | |||
| 1164 | Ga0466957_0000016 | |||
| 1165 | Ga0466957_0011629 | |||
| 1166 | Ga0466957_0179508 | |||
| 1167 | Ga0466957_0213503 | |||
| 1168 | Ga0466960_0032423 | |||
| 1169 | Ga0466959_0001352 | |||
| 1170 | Ga0466959_0008299 | |||
| 1171 | Ga0466959_0046040 | |||
| 1172 | Ga0466959_0060809 | |||
| 1173 | Ga0466959_0113610 | |||
| 1174 | Ga0451576_0592653 | |||
| 1175 | Ga0466958_0003273 | |||
| 1176 | Ga0466958_0005096 | |||
| 1177 | Ga0466958_0035867 | |||
| 1178 | Ga0466958_0046744 | |||
| 1179 | Ga0466958_0099234 | |||
| 1180 | Ga0466967_0002705 | |||
| 1181 | Ga0466967_0006369 | |||
| 1182 | Ga0466967_0019105 | |||
| 1183 | Ga0466967_0019957 | |||
| 1184 | Ga0466967_0020424 | |||
| 1185 | Ga0466967_0024299 | |||
| 1186 | Ga0466967_0026977 | |||
| 1187 | Ga0466967_0033511 | |||
| 1188 | Ga0466967_0035833 | |||
| 1189 | Ga0466967_0037387 | |||
| 1190 | Ga0466967_0071065 | |||
| 1191 | Ga0466967_0075359 | |||
| 1192 | Ga0466967_0082094 | |||
| 1193 | Ga0466967_0103650 | |||
| 1194 | Ga0466967_0651682 | |||
| 1195 | Ga0466967_0761484 | |||
| 1196 | Ga0466967_0937895 | |||
| 1197 | Ga0495592_0114943 | |||
| 1198 | Ga0495592_0198951 | |||
| 1199 | Ga0495629_0000751 | |||
| 1200 | Ga0495629_0072363 | |||
| 1201 | Ga0495641_0025892 | |||
| 1202 | Ga0495651_0056923 | |||
| 1203 | Ga0495651_0075561 | |||
| 1204 | Ga0495651_0106926 | |||
| 1205 | Ga0495653_0103286 | |||
| 1206 | Ga0495653_0135861 | |||
| 1207 | Ga0495653_0181191 | |||
| 1208 | Ga0495653_0182782 | |||
| 1209 | Ga0495653_0215782 | |||
| 1210 | Ga0495653_0263075 | |||
| 1211 | Ga0495582_0004009 | |||
| 1212 | Ga0495582_0233375 | |||
| 1213 | Ga0495639_0004280 | |||
| 1214 | Ga0495662_0002337 | |||
| 1215 | Ga0495662_0112883 | |||
| 1216 | Ga0495664_0066110 | |||
| 1217 | Ga0495664_0088489 | |||
| 1218 | Ga0495664_0297523 | |||
| 1219 | Ga0495594_0016495 | |||
| 1220 | Ga0495608_0028413 | |||
| 1221 | Ga0495608_0066826 | |||
| 1222 | Ga0495608_0122122 | |||
| 1223 | Ga0495618_0380749 | |||
| 1224 | Ga0495628_0066377 | |||
| 1225 | Ga0495628_0073645 | |||
| 1226 | Ga0495628_0132695 | |||
| 1227 | Ga0495628_0540827 | |||
| 1228 | Ga0495630_0012132 | |||
| 1229 | Ga0495630_0029133 | |||
| 1230 | Ga0495630_0087067 | |||
| 1231 | Ga0495630_0130200 | |||
| 1232 | Ga0495666_0073918 | |||
| 1233 | Ga0495652_0016921 | |||
| 1234 | Ga0495652_0030670 | |||
| 1235 | Ga0495652_0095571 | |||
| 1236 | Ga0495652_0261440 | |||
| 1237 | Ga0495665_0002583 | |||
| 1238 | Ga0495640_0022230 | |||
| 1239 | Ga0495640_0064950 | |||
| 1240 | Ga0495640_0123295 | |||
| 1241 | Ga0495640_0202305 | |||
| 1242 | Ga0495586_0204184 | |||
| 1243 | Ga0495586_0321923 | |||
| 1244 | Ga0495587_0100812 | |||
| 1245 | Ga0495587_0130428 | |||
| 1246 | Ga0495645_0114779 | |||
| 1247 | Ga0495645_0152989 | |||
| 1248 | Ga0495645_0260255 | |||
| 1249 | Ga0495667_0000109 | |||
| 1250 | Ga0495667_0013180 | |||
| 1251 | Ga0495667_0020497 | |||
| 1252 | Ga0495667_0048163 | |||
| 1253 | Ga0495667_0057783 | |||
| 1254 | Ga0495667_0074030 | |||
| 1255 | Ga0495656_0028573 | |||
| 1256 | Ga0495635_0019899 | |||
| 1257 | Ga0495635_0037924 | |||
| 1258 | Ga0495635_0062328 | |||
| 1259 | Ga0495635_0101367 | |||
| 1260 | Ga0495635_0139260 | |||
| 1261 | Ga0495635_0413153 | |||
| 1262 | Ga0495588_0226015 | |||
| 1263 | Ga0495657_0040339 | |||
| 1264 | Ga0495657_0072767 | |||
| 1265 | Ga0495657_0115125 | |||
| 1266 | Ga0495599_0070768 | |||
| 1267 | Ga0495599_0072799 | |||
| 1268 | Ga0495599_0169215 | |||
| 1269 | Ga0495623_0072986 | |||
| 1270 | Ga0495646_0128884 | |||
| 1271 | Ga0495646_0132014 | |||
| 1272 | Ga0495658_0005121 | |||
| 1273 | Ga0495658_0018848 | |||
| 1274 | Ga0495658_0104585 | |||
| 1275 | Ga0495658_0491887 | |||
| 1276 | Ga0495613_0002178 | |||
| 1277 | Ga0495613_0129090 | |||
| 1278 | Ga0495613_0153318 | |||
| 1279 | Ga0495624_0054028 | |||
| 1280 | Ga0495624_0069454 | |||
| 1281 | Ga0495670_0151634 | |||
| 1282 | Ga0495589_0154033 | |||
| 1283 | Ga0495600_0037399 | |||
| 1284 | Ga0495600_0043868 | |||
| 1285 | Ga0495600_0418298 | |||
| 1286 | Ga0495581_0008850 | |||
| 1287 | Ga0495604_0059232 | |||
| 1288 | Ga0495604_0156830 | |||
| 1289 | Ga0495604_0172428 | |||
| 1290 | Ga0495604_0314440 | |||
| 1291 | Ga0495604_0453268 | |||
| 1292 | Ga0495674_0001348 | |||
| 1293 | Ga0495674_0055887 | |||
| 1294 | Ga0495674_0116444 | |||
| 1295 | Ga0495674_0198237 | |||
| 1296 | Ga0495674_0208793 | |||
| 1297 | Ga0495674_0265636 | |||
| 1298 | Ga0495676_0009529 | |||
| 1299 | Ga0495680_0001999 | |||
| 1300 | Ga0495680_0022618 | |||
| 1301 | Ga0495680_0025403 | |||
| 1302 | Ga0495680_0029516 | |||
| 1303 | Ga0495680_0070304 | |||
| 1304 | Ga0495680_0149056 | |||
| 1305 | Ga0495680_0251680 | |||
| 1306 | Ga0495675_0012447 | |||
| 1307 | Ga0495675_0075941 | |||
| 1308 | Ga0495684_0004159 | |||
| 1309 | Ga0495684_0005557 | |||
| 1310 | Ga0495684_0020794 | |||
| 1311 | Ga0495684_0025711 | |||
| 1312 | Ga0495684_0113042 | |||
| 1313 | Ga0495684_0300991 | |||
| 1314 | Ga0495593_0054808 | |||
| 1315 | Ga0495593_0260513 | |||
| 1316 | Ga0495602_0072444 | |||
| 1317 | Ga0495602_0092290 | |||
| 1318 | Ga0495602_0122576 | |||
| 1319 | Ga0495602_0168084 | |||
| 1320 | Ga0495602_0216796 | |||
| 1321 | Ga0495602_0454185 | |||
| 1322 | Ga0495614_0002115 | |||
| 1323 | Ga0496100_0113226 | |||
| 1324 | Ga0496100_0150205 | |||
| 1325 | Ga0496101_0003998 | |||
| 1326 | Ga0496101_0253300 | |||
| 1327 | Ga0496101_0340415 | |||
| 1328 | Ga0496102_0162685 | |||
| 1329 | Ga0496102_0284372 | |||
| 1330 | Ga0496102_0773301 | |||
| 1331 | Ga0496104_0001866 | |||
| 1332 | Ga0496104_0012594 | |||
| 1333 | Ga0496104_0056272 | |||
| 1334 | Ga0496104_0083370 | |||
| 1335 | Ga0496104_0111804 | |||
| 1336 | Ga0496104_0116084 | |||
| 1337 | Ga0496104_0223952 | |||
| 1338 | Ga0496104_0226962 | |||
| 1339 | Ga0496104_0314143 | |||
| 1340 | Ga0496105_0000814 | |||
| 1341 | Ga0496105_0012703 | |||
| 1342 | Ga0496105_0047413 | |||
| 1343 | Ga0496105_0078036 | |||
| 1344 | Ga0496105_0081884 | |||
| 1345 | Ga0496106_0143056 | |||
| 1346 | Ga0496106_0175265 | |||
| 1347 | Ga0496106_0206698 | |||
| 1348 | Ga0496107_0018923 | |||
| 1349 | Ga0496107_0048680 | |||
| 1350 | Ga0496107_0082734 | |||
| 1351 | Ga0496107_0255133 | |||
| 1352 | Ga0496107_0353804 | |||
| 1353 | Ga0496108_0000913 | |||
| 1354 | Ga0496108_0198968 | |||
| 1355 | Ga0496108_0205128 | |||
| 1356 | Ga0496109_0000515 | |||
| 1357 | Ga0496109_0025069 | |||
| 1358 | Ga0496109_0038167 | |||
| 1359 | Ga0496109_0112748 | |||
| 1360 | Ga0496109_0214156 | |||
| 1361 | Ga0496109_0303928 | |||
| 1362 | Ga0496109_0793989 | |||
| 1363 | Ga0496110_0011572 | |||
| 1364 | Ga0496110_0154677 | |||
| 1365 | Ga0496110_0205508 | |||
| 1366 | Ga0496110_0280668 | |||
| 1367 | Ga0496110_0519931 | |||
| 1368 | Ga0496110_0554066 | |||
| 1369 | Ga0496111_0002620 | |||
| 1370 | Ga0496111_0003042 | |||
| 1371 | Ga0496111_0044690 | |||
| 1372 | Ga0496111_0215631 | |||
| 1373 | Ga0496112_0008408 | |||
| 1374 | Ga0496112_0014988 | |||
| 1375 | Ga0496112_0029234 | |||
| 1376 | Ga0496112_0068511 | |||
| 1377 | Ga0496112_0070790 | |||
| 1378 | Ga0496112_0084912 | |||
| 1379 | Ga0496112_0085287 | |||
| 1380 | Ga0496112_0118792 | |||
| 1381 | Ga0496112_0155430 | |||
| 1382 | Ga0496112_0720273 | |||
| 1383 | Ga0496113_0075668 | |||
| 1384 | Ga0496113_0174437 | |||
| 1385 | Ga0496113_0276879 | |||
| 1386 | Ga0496114_0000623 | |||
| 1387 | Ga0496114_0019075 | |||
| 1388 | Ga0496114_0027511 | |||
| 1389 | Ga0496114_0033848 | |||
| 1390 | Ga0496114_0039467 | |||
| 1391 | Ga0496114_0045402 | |||
| 1392 | Ga0496114_0069405 | |||
| 1393 | Ga0496114_0241837 | |||
| 1394 | Ga0496115_0000516 | |||
| 1395 | Ga0496115_0223480 | |||
| 1396 | Ga0501031_0000846 | |||
| 1397 | Ga0501031_0003266 | |||
| 1398 | Ga0501031_0038460 | |||
| 1399 | Ga0501031_0072902 | |||
| 1400 | Ga0501032_0041930 | |||
| 1401 | Ga0501032_0059918 | |||
| 1402 | Ga0501033_0007070 | |||
| 1403 | Ga0501033_0062239 | |||
| 1404 | Ga0501033_0108535 | |||
| 1405 | Ga0501034_0040919 | |||
| 1406 | Ga0501034_0285678 | |||
| 1407 | Ga0501036_0001804 | |||
| 1408 | Ga0501036_0030229 | |||
| 1409 | Ga0501036_0103983 | |||
| 1410 | Ga0501036_0359551 | |||
| 1411 | Ga0501037_0033364 | |||
| 1412 | Ga0501037_0040796 | |||
| 1413 | Ga0501037_0082614 | |||
| 1414 | Ga0501038_0001069 | |||
| 1415 | Ga0501038_0011884 | |||
| 1416 | Ga0501038_0046049 | |||
| 1417 | Ga0501039_0007554 | |||
| 1418 | Ga0501039_0009025 | |||
| 1419 | Ga0501039_0084584 | |||
| 1420 | Ga0501039_0343198 | |||
| 1421 | Ga0501040_0014689 | |||
| 1422 | Ga0501040_0024820 | |||
| 1423 | Ga0501041_0000917 | |||
| 1424 | Ga0501041_0002324 | |||
| 1425 | Ga0501042_0015806 | |||
| 1426 | Ga0501042_0029897 | |||
| 1427 | Ga0501042_0222711 | |||
| 1428 | Ga0501043_0035726 | |||
| 1429 | Ga0501046_0011675 | |||
| 1430 | Ga0501046_0045385 | |||
| 1431 | Ga0501046_0109562 | |||
| 1432 | Ga0501047_0168510 | |||
| 1433 | Ga0501047_0442240 | |||
| 1434 | Ga0501047_0571904 | |||
| 1435 | Ga0501048_0001298 | |||
| 1436 | Ga0501048_0005524 | |||
| 1437 | Ga0501067_0016102 | |||
| 1438 | Ga0501067_0050603 | |||
| 1439 | Ga0501068_0004009 | |||
| 1440 | Ga0501068_0019365 | |||
| 1441 | Ga0501068_0047639 | |||
| 1442 | Ga0501068_0195505 | |||
| 1443 | Ga0501068_0452697 | |||
| 1444 | Ga0501069_0001576 | |||
| 1445 | Ga0501069_0016325 | |||
| 1446 | Ga0501069_0120836 | |||
| 1447 | Ga0501069_0137709 | |||
| 1448 | Ga0501070_0002493 | |||
| 1449 | Ga0501070_0041521 | |||
| 1450 | Ga0501070_0091402 | |||
| 1451 | Ga0501070_0125946 | |||
| 1452 | Ga0501070_0188595 | |||
| 1453 | Ga0501070_0217732 | |||
| 1454 | Ga0501070_0226458 | |||
| 1455 | Ga0501071_0005243 | |||
| 1456 | Ga0501071_0008999 | |||
| 1457 | Ga0501071_0009735 | |||
| 1458 | Ga0501071_0207595 | |||
| 1459 | Ga0501072_0005526 | |||
| 1460 | Ga0501072_0117282 | |||
| 1461 | Ga0501072_0314058 | |||
| 1462 | Ga0501073_0009347 | |||
| 1463 | Ga0501073_0010225 | |||
| 1464 | Ga0501074_0005547 | |||
| 1465 | Ga0501074_0021237 | |||
| 1466 | Ga0501074_0034002 | |||
| 1467 | Ga0501074_0070043 | |||
| 1468 | Ga0501074_0105379 | |||
| 1469 | Ga0501075_0035350 | |||
| 1470 | Ga0501075_0114894 | |||
| 1471 | Ga0501075_0128538 | |||
| 1472 | Ga0501076_0003885 | |||
| 1473 | Ga0501076_0077576 | |||
| 1474 | Ga0501076_0079411 | |||
| 1475 | Ga0501076_0601760 | |||
| 1476 | Ga0501077_0018115 | |||
| 1477 | Ga0501077_0327133 | |||
| 1478 | Ga0501077_0439058 | |||
| 1479 | Ga0501079_0010609 | |||
| 1480 | Ga0501079_0021547 | |||
| 1481 | Ga0501079_0191241 | |||
| 1482 | Ga0501080_0004694 | |||
| 1483 | Ga0501080_0012605 | |||
| 1484 | Ga0501080_0018866 | |||
| 1485 | Ga0501080_0019556 | |||
| 1486 | Ga0501081_0005562 | |||
| 1487 | Ga0501081_0072919 | |||
| 1488 | Ga0501081_0266426 | |||
| 1489 | Ga0501083_0006527 | |||
| 1490 | Ga0501083_0070425 | |||
| 1491 | Ga0501035_0007364 | |||
| 1492 | Ga0501035_0011641 | |||
| 1493 | Ga0501035_0157310 | |||
| 1494 | Ga0501044_0338376 | |||
| 1495 | Ga0501044_0343458 | |||
| 1496 | Ga0501044_0567926 | |||
| 1497 | Ga0501044_0783348 | |||
| 1498 | Ga0501045_0000260 | |||
| 1499 | Ga0501045_0000874 | |||
| 1500 | Ga0501045_0280422 | |||
| 1501 | nmdc:mga05p37_148086_c1 | |||
| 1502 | nmdc:mga05p37_160700_c1 | |||
| 1503 | nmdc:mga09592_40028_c1 | |||
| 1504 | nmdc:mga09592_635250_c1 | |||
| 1505 | nmdc:mga0qj67_1196_c1 | |||
| 1506 | nmdc:mga0qj67_223845_c1 | |||
| 1507 | nmdc:mga0qj67_361218_c1 | |||
| 1508 | nmdc:mga06r32_424454_c1 | |||
| 1509 | nmdc:mga08y16_231547_c1 | |||
| 1510 | nmdc:mga0rr50_176455_c1 | |||
| 1511 | nmdc:mga0a205_51796_c1 | |||
| 1512 | Ga0495601_0066873 | |||
| 1513 | Ga0495595_0005495 | |||
| 1514 | Ga0495595_0021383 | |||
| 1515 | Ga0495595_0063090 | |||
| 1516 | Ga0495595_0070835 | |||
| 1517 | Ga0495595_0075051 | |||
| 1518 | Ga0495595_0118614 | |||
| 1519 | Ga0495595_0178446 | |||
| 1520 | Ga0495619_0001761 | |||
| 1521 | Ga0495619_0149198 | |||
| 1522 | Ga0495619_0297505 | |||
| 1523 | Ga0501084_0030073 | |||
| 1524 | Ga0501084_0035680 | |||
| 1525 | Ga0501084_0048179 | |||
| 1526 | Ga0501084_0053226 | |||
| 1527 | Ga0501084_0157879 | |||
| 1528 | Ga0501082_0006823 | |||
| 1529 | Ga0501082_0014407 | |||
| 1530 | Ga0501082_0048650 | |||
| 1531 | Ga0501082_0117335 | |||
| 1532 | Ga0466962_0000594 | |||
| 1533 | Ga0530510_0053810 | |||
| 1534 | Ga0530510_0087480 | |||
| 1535 | Ga0530510_0336413 | |||
| 1536 | Ga0530510_0502204 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.7542 | 2 | 224 |
| 3ckj-assembly1.cif.gz_A | crystal structure of a mycobacterial protein | 0.7508 | 2 | 237 |
| 4dec-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) | 0.7392 | 2 | 237 |
| 5jqx-assembly1.cif.gz_A | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga | 0.7326 | 2 | 237 |
| 4y9x-assembly1.cif.gz_A | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-3 | 0.7292 | 2 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8571 | 3 | 216 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8405 | 3 | 223 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8289 | 5 | 225 | 3.90.550.10 |
| af_K7MVE2_46_307_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8283 | 1 | 207 | 3.90.550.10 |
| af_P40350_49_327_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8263 | 1 | 227 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9DBT3-F1-model_v4 | Glycosyl transferase family 2 | 0.9736 | 1 | 204 |
GO:0016740
|
| AF-A0A1F9DBT3-F1-model_v4 | Glycosyl transferase family 2 | 0.9689 | 1 | 204 |
GO:0016740
|
| AF-A0A359CAS1-F1-model_v4 | Glycosyl transferase family 2 | 0.9578 | 2 | 93 |
GO:0016757
|
| AF-A0A7Y6PKB2-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9553 | 1 | 229 |
GO:0016757
|
| AF-A0A522UJC5-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9533 | 3 | 229 |
GO:0016740
|