F479928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 767 | 364 | 757 | 322 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2922386360|2922390553 |
| Length | 393 |
| Sequence | HLQSWFTSLGAWHRHSEPIGTFKGAHPDRPGDSLSAPSPPWDRLQSRGFGGKLPSRNGGSHKSAADSWGARMGIIHLLIPALALLSSHQALAQAGYPDRPIKMIVPLAAASAVDVAARIVTQKMADNMGQQIVILNQPGASGLIGAEAVARAEPDGYTIGGFNDSIMTMVPNLQSKIRWDILKDFEPVSLVATVEWGLVASNRASFRSAADLIAAAKAAPGKIDYGSGGPGSPQHLAMAMFASAAGISLTHVPYKGATQAATDIAAGQIPVGFQGLGTVATLVRGGQLKLIGVTTEKRLPQFADVPTVSESGLPGFFFNSWFAILAPAGTPKEILARLNSEVQKAVGDPDVRRKLEELGFAVRGSSAEELRAMTRDQLAKYERVIREMEIAKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2791355199 | |||
| 3 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 4 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 5 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 6 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 7 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 8 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 339 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 340 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 345 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 347 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 349 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 353 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 354 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 357 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 361 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 364 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 0.52 |
| Rhizoplane | 5.48 |
| Rhizosphere | 78.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000025 | 3300003203 | Bacteria | 74627 |
| 2 | JGI25406J46586_10002937 | 3300003203 | Bacteria | 8039 |
| 3 | rootH1_10005602 | 3300003323 | Bacteria | 5836 |
| 4 | Ga0065715_10126910 | 3300005293 | Bacteria | 2098 |
| 5 | Ga0070658_10026861 | 3300005327 | Bacteria | 4622 |
| 6 | Ga0070683_100001891 | 3300005329 | Bacteria | 16357 |
| 7 | Ga0070683_100018017 | 3300005329 | Bacteria | 6245 |
| 8 | Ga0070683_100128202 | 3300005329 | Bacteria | 2400 |
| 9 | Ga0070690_100196253 | 3300005330 | Bacteria | 1402 |
| 10 | Ga0070670_100105760 | 3300005331 | Bacteria | 2425 |
| 11 | Ga0068869_100006651 | 3300005334 | Bacteria | 7341 |
| 12 | Ga0068869_100074198 | 3300005334 | Bacteria | 2524 |
| 13 | Ga0070666_10212896 | 3300005335 | Bacteria | 1361 |
| 14 | Ga0070680_100014185 | 3300005336 | Bacteria | 6224 |
| 15 | Ga0070680_100034100 | 3300005336 | Bacteria | 4105 |
| 16 | Ga0070680_100227749 | 3300005336 | Bacteria | 1574 |
| 17 | Ga0070682_100175701 | 3300005337 | Bacteria | 1492 |
| 18 | Ga0068868_100013029 | 3300005338 | Bacteria | 6087 |
| 19 | Ga0068868_100024575 | 3300005338 | Bacteria | 4573 |
| 20 | Ga0068868_100051929 | 3300005338 | Bacteria | 3227 |
| 21 | Ga0070660_100082352 | 3300005339 | Bacteria | 2527 |
| 22 | Ga0070660_100085895 | 3300005339 | Bacteria | 2475 |
| 23 | Ga0070660_100225539 | 3300005339 | Bacteria | 1524 |
| 24 | Ga0070689_100160442 | 3300005340 | Bacteria | 1817 |
| 25 | Ga0070687_100109838 | 3300005343 | Bacteria | 1559 |
| 26 | Ga0070661_100141580 | 3300005344 | Bacteria | 1813 |
| 27 | Ga0070661_100171920 | 3300005344 | Bacteria | 1645 |
| 28 | Ga0070668_100040629 | 3300005347 | Bacteria | 3559 |
| 29 | Ga0070668_100066608 | 3300005347 | Bacteria | 2795 |
| 30 | Ga0070668_100094097 | 3300005347 | Bacteria | 2365 |
| 31 | Ga0070671_100112865 | 3300005355 | Bacteria | 2283 |
| 32 | Ga0070674_100276203 | 3300005356 | Bacteria | 1330 |
| 33 | Ga0070673_100181004 | 3300005364 | Bacteria | 1804 |
| 34 | Ga0070673_100183414 | 3300005364 | Bacteria | 1793 |
| 35 | Ga0070688_100124972 | 3300005365 | Bacteria | 1728 |
| 36 | Ga0070659_100031308 | 3300005366 | Bacteria | 4119 |
| 37 | Ga0070659_100242398 | 3300005366 | Bacteria | 1492 |
| 38 | Ga0070667_100224349 | 3300005367 | Bacteria | 1673 |
| 39 | Ga0070667_100431397 | 3300005367 | Bacteria | 1202 |
| 40 | Ga0070709_10005727 | 3300005434 | Bacteria | 6738 |
| 41 | Ga0070709_10013748 | 3300005434 | Bacteria | 4558 |
| 42 | Ga0070709_10099917 | 3300005434 | Bacteria | 1931 |
| 43 | Ga0070714_100045153 | 3300005435 | Bacteria | 3733 |
| 44 | Ga0070714_100105662 | 3300005435 | Bacteria | 2487 |
| 45 | Ga0070714_100477341 | 3300005435 | Bacteria | 1187 |
| 46 | Ga0070713_100006321 | 3300005436 | Bacteria | 8206 |
| 47 | Ga0070713_100040111 | 3300005436 | Bacteria | 3805 |
| 48 | Ga0070713_100342409 | 3300005436 | Bacteria | 1386 |
| 49 | Ga0070710_10003453 | 3300005437 | Bacteria | 7486 |
| 50 | Ga0070710_10005902 | 3300005437 | Bacteria | 5849 |
| 51 | Ga0070711_100154300 | 3300005439 | Bacteria | 1734 |
| 52 | Ga0070663_100000736 | 3300005455 | Bacteria | 17673 |
| 53 | Ga0070663_100038209 | 3300005455 | Bacteria | 3347 |
| 54 | Ga0070663_100054724 | 3300005455 | Bacteria | 2853 |
| 55 | Ga0070663_100096174 | 3300005455 | Bacteria | 2202 |
| 56 | Ga0070678_100001495 | 3300005456 | Bacteria | 12487 |
| 57 | Ga0070678_100160332 | 3300005456 | Bacteria | 1822 |
| 58 | Ga0070678_100264073 | 3300005456 | Bacteria | 1449 |
| 59 | Ga0070681_10038462 | 3300005458 | Bacteria | 4797 |
| 60 | Ga0070681_10069555 | 3300005458 | Bacteria | 3486 |
| 61 | Ga0070681_10085629 | 3300005458 | Bacteria | 3104 |
| 62 | Ga0070685_10046449 | 3300005466 | Bacteria | 2493 |
| 63 | Ga0070707_100088318 | 3300005468 | Bacteria | 2999 |
| 64 | Ga0070698_100205473 | 3300005471 | Bacteria | 1905 |
| 65 | Ga0070699_100177587 | 3300005518 | Bacteria | 1889 |
| 66 | Ga0070679_100025293 | 3300005530 | Bacteria | 5824 |
| 67 | Ga0070679_100174211 | 3300005530 | Bacteria | 2124 |
| 68 | Ga0070684_100032530 | 3300005535 | Bacteria | 4445 |
| 69 | Ga0070684_100037616 | 3300005535 | Bacteria | 4153 |
| 70 | Ga0070684_100099479 | 3300005535 | Bacteria | 2596 |
| 71 | Ga0070684_100108725 | 3300005535 | Bacteria | 2484 |
| 72 | Ga0070684_100168638 | 3300005535 | Bacteria | 1988 |
| 73 | Ga0070684_100246159 | 3300005535 | Bacteria | 1634 |
| 74 | Ga0070697_100020178 | 3300005536 | Bacteria | 5269 |
| 75 | Ga0068853_100045263 | 3300005539 | Bacteria | 3768 |
| 76 | Ga0068853_100103120 | 3300005539 | Bacteria | 2525 |
| 77 | Ga0068853_100151223 | 3300005539 | Bacteria | 2090 |
| 78 | Ga0068853_100239796 | 3300005539 | Bacteria | 1661 |
| 79 | Ga0068853_100315738 | 3300005539 | Bacteria | 1448 |
| 80 | Ga0070672_100236148 | 3300005543 | Bacteria | 1537 |
| 81 | Ga0070693_100115720 | 3300005547 | Bacteria | 1656 |
| 82 | Ga0070693_100135799 | 3300005547 | Bacteria | 1543 |
| 83 | Ga0070665_100007828 | 3300005548 | Bacteria | 10840 |
| 84 | Ga0070665_100029862 | 3300005548 | Bacteria | 5486 |
| 85 | Ga0070665_100030204 | 3300005548 | Bacteria | 5454 |
| 86 | Ga0070665_100074161 | 3300005548 | Bacteria | 3408 |
| 87 | Ga0070665_100091436 | 3300005548 | Bacteria | 3048 |
| 88 | Ga0070665_100165178 | 3300005548 | Bacteria | 2216 |
| 89 | Ga0070665_100431543 | 3300005548 | Bacteria | 1327 |
| 90 | Ga0070704_100086659 | 3300005549 | Bacteria | 2322 |
| 91 | Ga0068855_100001651 | 3300005563 | Bacteria | 27931 |
| 92 | Ga0068855_100008249 | 3300005563 | Bacteria | 12592 |
| 93 | Ga0068855_100067236 | 3300005563 | Bacteria | 4176 |
| 94 | Ga0068855_100136313 | 3300005563 | Bacteria | 2800 |
| 95 | Ga0068855_100178799 | 3300005563 | Bacteria | 2399 |
| 96 | Ga0068855_100690160 | 3300005563 | Bacteria | 1093 |
| 97 | Ga0070664_100009890 | 3300005564 | Bacteria | 7731 |
| 98 | Ga0070664_100081776 | 3300005564 | Bacteria | 2784 |
| 99 | Ga0068857_100119045 | 3300005577 | Bacteria | 2377 |
| 100 | Ga0068854_100129953 | 3300005578 | Bacteria | 1922 |
| 101 | Ga0068856_100000066 | 3300005614 | Bacteria | 98376 |
| 102 | Ga0068856_100071616 | 3300005614 | Bacteria | 3432 |
| 103 | Ga0068856_100080501 | 3300005614 | Bacteria | 3230 |
| 104 | Ga0068856_100156914 | 3300005614 | Bacteria | 2286 |
| 105 | Ga0068856_100268996 | 3300005614 | Bacteria | 1720 |
| 106 | Ga0068852_100002208 | 3300005616 | Bacteria | 13359 |
| 107 | Ga0068852_100003029 | 3300005616 | Bacteria | 11683 |
| 108 | Ga0068852_100003507 | 3300005616 | Bacteria | 10967 |
| 109 | Ga0068852_100028663 | 3300005616 | Bacteria | 4562 |
| 110 | Ga0068852_100037217 | 3300005616 | Bacteria | 4078 |
| 111 | Ga0068852_100048237 | 3300005616 | Bacteria | 3638 |
| 112 | Ga0068859_100062799 | 3300005617 | Bacteria | 3745 |
| 113 | Ga0068864_100197071 | 3300005618 | Bacteria | 1848 |
| 114 | Ga0068861_100090710 | 3300005719 | Bacteria | 2411 |
| 115 | Ga0068851_10018416 | 3300005834 | Bacteria | 3362 |
| 116 | Ga0068863_100017738 | 3300005841 | Bacteria | 6813 |
| 117 | Ga0068863_100248791 | 3300005841 | Bacteria | 1717 |
| 118 | Ga0068863_100442015 | 3300005841 | Bacteria | 1275 |
| 119 | Ga0068858_100012301 | 3300005842 | Bacteria | 8071 |
| 120 | Ga0068858_100024609 | 3300005842 | Bacteria | 5610 |
| 121 | Ga0068858_100186955 | 3300005842 | Bacteria | 1957 |
| 122 | Ga0068858_100224757 | 3300005842 | Bacteria | 1779 |
| 123 | Ga0068858_100260344 | 3300005842 | Bacteria | 1649 |
| 124 | Ga0068860_100000302 | 3300005843 | Bacteria | 68581 |
| 125 | Ga0068860_100331889 | 3300005843 | Bacteria | 1494 |
| 126 | Ga0068862_100062037 | 3300005844 | Bacteria | 3214 |
| 127 | Ga0068862_100074199 | 3300005844 | Bacteria | 2940 |
| 128 | Ga0081455_10001374 | 3300005937 | Bacteria | 30050 |
| 129 | Ga0081455_10006992 | 3300005937 | Bacteria | 11989 |
| 130 | Ga0081455_10011660 | 3300005937 | Bacteria | 8816 |
| 131 | Ga0081455_10012994 | 3300005937 | Bacteria | 8255 |
| 132 | Ga0081455_10033372 | 3300005937 | Bacteria | 4626 |
| 133 | Ga0081540_1000918 | 3300005983 | Bacteria | 26491 |
| 134 | Ga0081540_1002732 | 3300005983 | Bacteria | 14358 |
| 135 | Ga0081540_1002906 | 3300005983 | Bacteria | 13809 |
| 136 | Ga0081540_1005394 | 3300005983 | Bacteria | 9555 |
| 137 | Ga0081540_1013045 | 3300005983 | Bacteria | 5426 |
| 138 | Ga0081540_1040733 | 3300005983 | Bacteria | 2417 |
| 139 | Ga0081540_1078242 | 3300005983 | Bacteria | 1500 |
| 140 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 141 | Ga0081539_10000640 | 3300005985 | Bacteria | 70720 |
| 142 | Ga0081539_10011398 | 3300005985 | Bacteria | 7032 |
| 143 | Ga0081539_10040956 | 3300005985 | Bacteria | 2714 |
| 144 | Ga0081539_10041169 | 3300005985 | Bacteria | 2704 |
| 145 | Ga0070717_10008077 | 3300006028 | Bacteria | 7847 |
| 146 | Ga0070717_10036379 | 3300006028 | Bacteria | 3993 |
| 147 | Ga0070717_10363919 | 3300006028 | Bacteria | 1295 |
| 148 | Ga0075365_10019879 | 3300006038 | Bacteria | 4154 |
| 149 | Ga0075365_10048899 | 3300006038 | Bacteria | 2785 |
| 150 | Ga0075365_10087007 | 3300006038 | Bacteria | 2124 |
| 151 | Ga0075365_10101279 | 3300006038 | Bacteria | 1972 |
| 152 | Ga0075365_10148091 | 3300006038 | Bacteria | 1632 |
| 153 | Ga0075363_100024494 | 3300006048 | Bacteria | 3068 |
| 154 | Ga0075363_100046739 | 3300006048 | Bacteria | 2297 |
| 155 | Ga0075364_10208457 | 3300006051 | Bacteria | 1325 |
| 156 | Ga0070716_100021690 | 3300006173 | Bacteria | 3387 |
| 157 | Ga0070716_100046897 | 3300006173 | Bacteria | 2434 |
| 158 | Ga0070716_100234801 | 3300006173 | Bacteria | 1240 |
| 159 | Ga0070712_100013846 | 3300006175 | Bacteria | 5162 |
| 160 | Ga0070712_100020160 | 3300006175 | Bacteria | 4360 |
| 161 | Ga0070712_100036035 | 3300006175 | Bacteria | 3363 |
| 162 | Ga0075362_10051422 | 3300006177 | Bacteria | 1844 |
| 163 | Ga0075366_10025300 | 3300006195 | Bacteria | 3466 |
| 164 | Ga0075366_10107789 | 3300006195 | Bacteria | 1675 |
| 165 | Ga0097621_100007616 | 3300006237 | Bacteria | 7759 |
| 166 | Ga0097621_100009054 | 3300006237 | Bacteria | 7213 |
| 167 | Ga0097621_100068529 | 3300006237 | Bacteria | 2927 |
| 168 | Ga0097621_100210286 | 3300006237 | Bacteria | 1692 |
| 169 | Ga0075370_10007780 | 3300006353 | Bacteria | 5476 |
| 170 | Ga0068871_100021353 | 3300006358 | Bacteria | 4975 |
| 171 | Ga0068871_100031289 | 3300006358 | Bacteria | 4196 |
| 172 | Ga0068871_100146040 | 3300006358 | Bacteria | 2014 |
| 173 | Ga0075428_100215289 | 3300006844 | Bacteria | 2075 |
| 174 | Ga0068865_100227804 | 3300006881 | Bacteria | 1460 |
| 175 | Ga0068865_100333951 | 3300006881 | Bacteria | 1223 |
| 176 | Ga0075436_100000352 | 3300006914 | Bacteria | 29413 |
| 177 | Ga0075436_100001634 | 3300006914 | Bacteria | 15321 |
| 178 | Ga0097620_100062795 | 3300006931 | Bacteria | 3745 |
| 179 | Ga0097620_100175803 | 3300006931 | Bacteria | 2222 |
| 180 | Ga0097620_100374231 | 3300006931 | Bacteria | 1520 |
| 181 | Ga0099794_10009840 | 3300007265 | Bacteria | 4040 |
| 182 | Ga0099794_10029876 | 3300007265 | Bacteria | 2541 |
| 183 | Ga0099795_10059292 | 3300007788 | Bacteria | 1416 |
| 184 | Ga0099795_10089975 | 3300007788 | Bacteria | 1188 |
| 185 | Ga0105245_10002531 | 3300009098 | Bacteria | 16481 |
| 186 | Ga0105245_10034525 | 3300009098 | Bacteria | 4487 |
| 187 | Ga0105245_10120492 | 3300009098 | Bacteria | 2450 |
| 188 | Ga0105245_10162145 | 3300009098 | Bacteria | 2122 |
| 189 | Ga0105245_10520068 | 3300009098 | Bacteria | 1208 |
| 190 | Ga0105247_10006243 | 3300009101 | Bacteria | 7391 |
| 191 | Ga0105247_10028254 | 3300009101 | Bacteria | 3393 |
| 192 | Ga0105243_10043679 | 3300009148 | Bacteria | 3513 |
| 193 | Ga0105243_10127683 | 3300009148 | Bacteria | 2153 |
| 194 | Ga0105241_10008810 | 3300009174 | Bacteria | 7413 |
| 195 | Ga0105241_10013032 | 3300009174 | Bacteria | 6096 |
| 196 | Ga0105241_10030773 | 3300009174 | Bacteria | 4015 |
| 197 | Ga0105241_10214301 | 3300009174 | Bacteria | 1615 |
| 198 | Ga0105241_10469949 | 3300009174 | Bacteria | 1116 |
| 199 | Ga0105242_10004829 | 3300009176 | Bacteria | 10435 |
| 200 | Ga0105242_10006976 | 3300009176 | Bacteria | 8718 |
| 201 | Ga0105242_10026161 | 3300009176 | Bacteria | 4624 |
| 202 | Ga0105242_10093721 | 3300009176 | Bacteria | 2532 |
| 203 | Ga0105248_10007036 | 3300009177 | Bacteria | 12323 |
| 204 | Ga0105248_10010822 | 3300009177 | Bacteria | 10073 |
| 205 | Ga0105248_10017686 | 3300009177 | Bacteria | 7862 |
| 206 | Ga0105248_10031631 | 3300009177 | Bacteria | 5911 |
| 207 | Ga0105248_10093092 | 3300009177 | Bacteria | 3394 |
| 208 | Ga0105248_10175923 | 3300009177 | Bacteria | 2412 |
| 209 | Ga0105237_10002097 | 3300009545 | Bacteria | 25173 |
| 210 | Ga0105237_10007055 | 3300009545 | Bacteria | 12357 |
| 211 | Ga0105237_10025682 | 3300009545 | Bacteria | 6022 |
| 212 | Ga0105237_10052188 | 3300009545 | Bacteria | 4106 |
| 213 | Ga0105237_10091696 | 3300009545 | Bacteria | 3028 |
| 214 | Ga0105237_10170574 | 3300009545 | Bacteria | 2176 |
| 215 | Ga0105238_10007477 | 3300009551 | Bacteria | 10947 |
| 216 | Ga0105238_10020562 | 3300009551 | Bacteria | 6721 |
| 217 | Ga0105238_10038665 | 3300009551 | Bacteria | 4844 |
| 218 | Ga0105238_10078483 | 3300009551 | Bacteria | 3292 |
| 219 | Ga0105238_10092222 | 3300009551 | Bacteria | 3017 |
| 220 | Ga0105238_10200567 | 3300009551 | Bacteria | 1970 |
| 221 | Ga0105249_10553831 | 3300009553 | Bacteria | 1201 |
| 222 | Ga0099796_10001990 | 3300010159 | Bacteria | 4350 |
| 223 | Ga0105239_10018062 | 3300010375 | Bacteria | 7802 |
| 224 | Ga0105246_10002338 | 3300011119 | Bacteria | 11450 |
| 225 | Ga0105246_10036950 | 3300011119 | Bacteria | 3275 |
| 226 | Ga0105246_10045724 | 3300011119 | Bacteria | 2983 |
| 227 | Ga0105246_10130324 | 3300011119 | Bacteria | 1877 |
| 228 | Ga0157370_10038407 | 3300013104 | Bacteria | 4631 |
| 229 | Ga0157369_10009209 | 3300013105 | Bacteria | 11297 |
| 230 | Ga0157369_10054140 | 3300013105 | Bacteria | 4333 |
| 231 | Ga0157374_10005291 | 3300013296 | Bacteria | 10834 |
| 232 | Ga0157374_10012991 | 3300013296 | Bacteria | 7259 |
| 233 | Ga0157374_10028494 | 3300013296 | Bacteria | 5046 |
| 234 | Ga0157374_10073092 | 3300013296 | Bacteria | 3237 |
| 235 | Ga0157378_10031134 | 3300013297 | Bacteria | 4712 |
| 236 | Ga0157378_10068359 | 3300013297 | Bacteria | 3186 |
| 237 | Ga0157378_10230081 | 3300013297 | Bacteria | 1766 |
| 238 | Ga0157378_10313264 | 3300013297 | Bacteria | 1522 |
| 239 | Ga0163162_10081858 | 3300013306 | Bacteria | 3299 |
| 240 | Ga0163162_10097049 | 3300013306 | Bacteria | 3036 |
| 241 | Ga0163162_10114089 | 3300013306 | Bacteria | 2801 |
| 242 | Ga0163162_10670293 | 3300013306 | Bacteria | 1160 |
| 243 | Ga0157372_10000281 | 3300013307 | Bacteria | 56476 |
| 244 | Ga0157372_10324064 | 3300013307 | Bacteria | 1794 |
| 245 | Ga0157372_10406718 | 3300013307 | Bacteria | 1586 |
| 246 | Ga0157372_10462287 | 3300013307 | Bacteria | 1479 |
| 247 | Ga0157375_10007126 | 3300013308 | Bacteria | 9768 |
| 248 | Ga0157375_10025335 | 3300013308 | Bacteria | 5509 |
| 249 | Ga0157375_10100137 | 3300013308 | Bacteria | 2978 |
| 250 | Ga0157375_10193457 | 3300013308 | Bacteria | 2189 |
| 251 | Ga0163163_10003162 | 3300014325 | Bacteria | 13951 |
| 252 | Ga0157380_10455453 | 3300014326 | Bacteria | 1230 |
| 253 | Ga0157379_10022769 | 3300014968 | Bacteria | 5552 |
| 254 | Ga0157379_10147740 | 3300014968 | Bacteria | 2120 |
| 255 | Ga0157379_10280566 | 3300014968 | Bacteria | 1516 |
| 256 | Ga0157376_10007855 | 3300014969 | Bacteria | 7651 |
| 257 | Ga0157376_10025197 | 3300014969 | Bacteria | 4682 |
| 258 | Ga0157376_10211048 | 3300014969 | Bacteria | 1792 |
| 259 | Ga0213876_10000471 | 3300021384 | Bacteria | 32066 |
| 260 | Ga0213876_10033360 | 3300021384 | Bacteria | 2715 |
| 261 | Ga0209758_1004659 | 3300025297 | Bacteria | 11219 |
| 262 | Ga0209758_1004698 | 3300025297 | Bacteria | 11156 |
| 263 | Ga0207656_10016168 | 3300025321 | Bacteria | 2901 |
| 264 | Ga0207692_10003854 | 3300025898 | Bacteria | 5890 |
| 265 | Ga0207692_10005779 | 3300025898 | Bacteria | 4979 |
| 266 | Ga0207692_10265955 | 3300025898 | Bacteria | 1033 |
| 267 | Ga0207710_10006455 | 3300025900 | Bacteria | 5006 |
| 268 | Ga0207688_10005151 | 3300025901 | Bacteria | 7105 |
| 269 | Ga0207688_10232630 | 3300025901 | Bacteria | 1113 |
| 270 | Ga0207647_10061889 | 3300025904 | Bacteria | 2282 |
| 271 | Ga0207699_10007005 | 3300025906 | Bacteria | 5491 |
| 272 | Ga0207699_10010420 | 3300025906 | Bacteria | 4664 |
| 273 | Ga0207699_10016501 | 3300025906 | Bacteria | 3865 |
| 274 | Ga0207699_10160941 | 3300025906 | Bacteria | 1494 |
| 275 | Ga0207645_10084279 | 3300025907 | Bacteria | 2040 |
| 276 | Ga0207643_10022187 | 3300025908 | Bacteria | 3493 |
| 277 | Ga0207705_10012074 | 3300025909 | Bacteria | 6240 |
| 278 | Ga0207705_10142508 | 3300025909 | Bacteria | 1791 |
| 279 | Ga0207705_10196289 | 3300025909 | Bacteria | 1528 |
| 280 | Ga0207705_10247397 | 3300025909 | Bacteria | 1359 |
| 281 | Ga0207684_10097070 | 3300025910 | Bacteria | 2515 |
| 282 | Ga0207684_10250200 | 3300025910 | Bacteria | 1529 |
| 283 | Ga0207654_10003642 | 3300025911 | Bacteria | 7768 |
| 284 | Ga0207654_10095910 | 3300025911 | Bacteria | 1818 |
| 285 | Ga0207654_10096868 | 3300025911 | Bacteria | 1810 |
| 286 | Ga0207654_10166135 | 3300025911 | Bacteria | 1429 |
| 287 | Ga0207707_10006804 | 3300025912 | Bacteria | 9975 |
| 288 | Ga0207707_10008746 | 3300025912 | Bacteria | 8788 |
| 289 | Ga0207707_10123983 | 3300025912 | Bacteria | 2259 |
| 290 | Ga0207707_10211013 | 3300025912 | Bacteria | 1691 |
| 291 | Ga0207695_10035532 | 3300025913 | Bacteria | 5402 |
| 292 | Ga0207695_10051579 | 3300025913 | Bacteria | 4317 |
| 293 | Ga0207695_10329384 | 3300025913 | Bacteria | 1416 |
| 294 | Ga0207671_10016029 | 3300025914 | Bacteria | 5840 |
| 295 | Ga0207671_10040558 | 3300025914 | Bacteria | 3447 |
| 296 | Ga0207671_10089923 | 3300025914 | Bacteria | 2311 |
| 297 | Ga0207671_10103910 | 3300025914 | Bacteria | 2155 |
| 298 | Ga0207671_10192949 | 3300025914 | Bacteria | 1589 |
| 299 | Ga0207693_10003223 | 3300025915 | Bacteria | 14005 |
| 300 | Ga0207693_10012061 | 3300025915 | Bacteria | 6988 |
| 301 | Ga0207693_10090290 | 3300025915 | Bacteria | 2402 |
| 302 | Ga0207693_10243935 | 3300025915 | Bacteria | 1410 |
| 303 | Ga0207660_10013723 | 3300025917 | Bacteria | 5315 |
| 304 | Ga0207660_10039829 | 3300025917 | Bacteria | 3287 |
| 305 | Ga0207660_10198406 | 3300025917 | Bacteria | 1566 |
| 306 | Ga0207662_10097898 | 3300025918 | Bacteria | 1814 |
| 307 | Ga0207662_10111408 | 3300025918 | Bacteria | 1707 |
| 308 | Ga0207657_10002580 | 3300025919 | Bacteria | 19599 |
| 309 | Ga0207657_10106614 | 3300025919 | Bacteria | 2318 |
| 310 | Ga0207649_10169460 | 3300025920 | Bacteria | 1520 |
| 311 | Ga0207649_10340908 | 3300025920 | Bacteria | 1107 |
| 312 | Ga0207652_10034651 | 3300025921 | Bacteria | 4255 |
| 313 | Ga0207652_10047988 | 3300025921 | Bacteria | 3649 |
| 314 | Ga0207652_10058526 | 3300025921 | Bacteria | 3321 |
| 315 | Ga0207652_10148587 | 3300025921 | Bacteria | 2098 |
| 316 | Ga0207646_10053641 | 3300025922 | Bacteria | 3606 |
| 317 | Ga0207694_10014649 | 3300025924 | Bacteria | 5912 |
| 318 | Ga0207694_10069105 | 3300025924 | Bacteria | 2759 |
| 319 | Ga0207694_10131744 | 3300025924 | Bacteria | 2004 |
| 320 | Ga0207650_10076868 | 3300025925 | Bacteria | 2523 |
| 321 | Ga0207687_10074785 | 3300025927 | Bacteria | 2429 |
| 322 | Ga0207687_10105497 | 3300025927 | Bacteria | 2082 |
| 323 | Ga0207687_10195151 | 3300025927 | Bacteria | 1578 |
| 324 | Ga0207687_10255711 | 3300025927 | Bacteria | 1394 |
| 325 | Ga0207700_10002090 | 3300025928 | Bacteria | 11393 |
| 326 | Ga0207700_10073711 | 3300025928 | Bacteria | 2637 |
| 327 | Ga0207700_10392206 | 3300025928 | Bacteria | 1215 |
| 328 | Ga0207664_10047500 | 3300025929 | Bacteria | 3373 |
| 329 | Ga0207644_10097535 | 3300025931 | Bacteria | 2202 |
| 330 | Ga0207644_10402976 | 3300025931 | Bacteria | 1118 |
| 331 | Ga0207690_10142934 | 3300025932 | Bacteria | 1765 |
| 332 | Ga0207690_10191111 | 3300025932 | Bacteria | 1548 |
| 333 | Ga0207706_10038396 | 3300025933 | Bacteria | 4248 |
| 334 | Ga0207706_10423659 | 3300025933 | Bacteria | 1153 |
| 335 | Ga0207686_10021025 | 3300025934 | Bacteria | 3738 |
| 336 | Ga0207686_10023050 | 3300025934 | Bacteria | 3591 |
| 337 | Ga0207686_10276382 | 3300025934 | Bacteria | 1238 |
| 338 | Ga0207709_10072977 | 3300025935 | Bacteria | 2185 |
| 339 | Ga0207670_10036027 | 3300025936 | Bacteria | 3214 |
| 340 | Ga0207704_10039801 | 3300025938 | Bacteria | 2741 |
| 341 | Ga0207704_10077063 | 3300025938 | Bacteria | 2139 |
| 342 | Ga0207665_10033748 | 3300025939 | Bacteria | 3394 |
| 343 | Ga0207691_10020813 | 3300025940 | Bacteria | 6199 |
| 344 | Ga0207691_10106687 | 3300025940 | Bacteria | 2494 |
| 345 | Ga0207691_10170162 | 3300025940 | Bacteria | 1908 |
| 346 | Ga0207711_10068848 | 3300025941 | Bacteria | 3066 |
| 347 | Ga0207711_10136383 | 3300025941 | Bacteria | 2204 |
| 348 | Ga0207689_10040006 | 3300025942 | Bacteria | 3881 |
| 349 | Ga0207689_10069849 | 3300025942 | Bacteria | 2886 |
| 350 | Ga0207689_10107589 | 3300025942 | Bacteria | 2291 |
| 351 | Ga0207661_10001182 | 3300025944 | Bacteria | 17455 |
| 352 | Ga0207667_10025565 | 3300025949 | Bacteria | 6461 |
| 353 | Ga0207667_10119200 | 3300025949 | Bacteria | 2720 |
| 354 | Ga0207667_10153257 | 3300025949 | Bacteria | 2371 |
| 355 | Ga0207667_10255530 | 3300025949 | Bacteria | 1792 |
| 356 | Ga0207651_10034141 | 3300025960 | Bacteria | 3291 |
| 357 | Ga0207651_10043843 | 3300025960 | Bacteria | 2989 |
| 358 | Ga0207651_10107184 | 3300025960 | Bacteria | 2088 |
| 359 | Ga0207651_10163036 | 3300025960 | Bacteria | 1750 |
| 360 | Ga0207668_10038900 | 3300025972 | Bacteria | 3196 |
| 361 | Ga0207668_10320346 | 3300025972 | Bacteria | 1286 |
| 362 | Ga0207640_10124415 | 3300025981 | Bacteria | 1854 |
| 363 | Ga0207677_10019019 | 3300026023 | Bacteria | 4137 |
| 364 | Ga0207677_10118332 | 3300026023 | Bacteria | 1987 |
| 365 | Ga0207703_10015754 | 3300026035 | Bacteria | 5897 |
| 366 | Ga0207639_10057418 | 3300026041 | Bacteria | 2988 |
| 367 | Ga0207678_10022039 | 3300026067 | Bacteria | 5581 |
| 368 | Ga0207678_10046165 | 3300026067 | Bacteria | 3767 |
| 369 | Ga0207678_10056785 | 3300026067 | Bacteria | 3369 |
| 370 | Ga0207678_10104735 | 3300026067 | Bacteria | 2414 |
| 371 | Ga0207678_10209374 | 3300026067 | Bacteria | 1668 |
| 372 | Ga0207708_10062959 | 3300026075 | Bacteria | 2834 |
| 373 | Ga0207708_10142557 | 3300026075 | Bacteria | 1881 |
| 374 | Ga0207702_10000044 | 3300026078 | Bacteria | 149419 |
| 375 | Ga0207702_10011800 | 3300026078 | Bacteria | 7275 |
| 376 | Ga0207702_10038290 | 3300026078 | Bacteria | 4016 |
| 377 | Ga0207702_10433628 | 3300026078 | Bacteria | 1272 |
| 378 | Ga0207702_10560315 | 3300026078 | Bacteria | 1118 |
| 379 | Ga0207648_10025902 | 3300026089 | Bacteria | 5218 |
| 380 | Ga0207648_10089987 | 3300026089 | Bacteria | 2682 |
| 381 | Ga0207648_10242579 | 3300026089 | Bacteria | 1605 |
| 382 | Ga0207674_10106336 | 3300026116 | Bacteria | 2784 |
| 383 | Ga0207674_10441293 | 3300026116 | Bacteria | 1258 |
| 384 | Ga0207675_100025901 | 3300026118 | Bacteria | 5457 |
| 385 | Ga0207675_100035023 | 3300026118 | Bacteria | 4682 |
| 386 | Ga0207675_100159578 | 3300026118 | Bacteria | 2150 |
| 387 | Ga0207675_100180963 | 3300026118 | Bacteria | 2018 |
| 388 | Ga0207683_10019334 | 3300026121 | Bacteria | 5816 |
| 389 | Ga0207683_10036657 | 3300026121 | Bacteria | 4271 |
| 390 | Ga0207683_10171899 | 3300026121 | Bacteria | 1963 |
| 391 | Ga0207683_10212885 | 3300026121 | Bacteria | 1759 |
| 392 | Ga0207683_10285765 | 3300026121 | Bacteria | 1508 |
| 393 | Ga0207683_10331325 | 3300026121 | Bacteria | 1395 |
| 394 | Ga0207683_10505900 | 3300026121 | Bacteria | 1116 |
| 395 | Ga0207698_10001058 | 3300026142 | Bacteria | 15993 |
| 396 | Ga0207698_10014550 | 3300026142 | Bacteria | 5235 |
| 397 | Ga0207698_10056652 | 3300026142 | Bacteria | 3028 |
| 398 | Ga0207698_10104623 | 3300026142 | Bacteria | 2356 |
| 399 | Ga0207698_10138909 | 3300026142 | Bacteria | 2090 |
| 400 | Ga0207698_10323106 | 3300026142 | Bacteria | 1446 |
| 401 | Ga0209179_1000258 | 3300027512 | Bacteria | 5054 |
| 402 | Ga0268266_10006822 | 3300028379 | Bacteria | 10399 |
| 403 | Ga0268266_10010084 | 3300028379 | Bacteria | 8284 |
| 404 | Ga0268266_10013882 | 3300028379 | Bacteria | 6935 |
| 405 | Ga0268266_10148490 | 3300028379 | Bacteria | 2110 |
| 406 | Ga0268266_10214650 | 3300028379 | Bacteria | 1766 |
| 407 | Ga0268265_10053781 | 3300028380 | Bacteria | 3051 |
| 408 | Ga0268265_10086968 | 3300028380 | Bacteria | 2485 |
| 409 | Ga0268265_10116848 | 3300028380 | Bacteria | 2189 |
| 410 | Ga0268265_10177151 | 3300028380 | Bacteria | 1828 |
| 411 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 412 | Ga0268264_10113882 | 3300028381 | Bacteria | 2373 |
| 413 | Ga0268264_10453210 | 3300028381 | Bacteria | 1243 |
| 414 | Ga0307517_10000756 | 3300028786 | Bacteria | 55661 |
| 415 | Ga0307515_10016019 | 3300028794 | Bacteria | 13759 |
| 416 | Ga0307511_10042759 | 3300030521 | Bacteria | 3799 |
| 417 | Ga0265332_10053859 | 3300031238 | Bacteria | 1726 |
| 418 | Ga0265325_10004341 | 3300031241 | Bacteria | 8981 |
| 419 | Ga0265340_10007679 | 3300031247 | Bacteria | 5848 |
| 420 | Ga0307513_10089283 | 3300031456 | Bacteria | 3147 |
| 421 | Ga0307513_10381498 | 3300031456 | Bacteria | 1149 |
| 422 | Ga0307408_100172282 | 3300031548 | Bacteria | 1729 |
| 423 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 424 | Ga0307508_10006654 | 3300031616 | Bacteria | 10852 |
| 425 | Ga0307508_10091464 | 3300031616 | Bacteria | 2631 |
| 426 | Ga0307508_10183935 | 3300031616 | Bacteria | 1692 |
| 427 | Ga0307508_10215817 | 3300031616 | Bacteria | 1518 |
| 428 | Ga0307413_10040995 | 3300031824 | Bacteria | 2707 |
| 429 | Ga0307409_100081685 | 3300031995 | Bacteria | 2613 |
| 430 | Ga0307416_100391907 | 3300032002 | Bacteria | 1423 |
| 431 | Ga0307416_100692623 | 3300032002 | Bacteria | 1107 |
| 432 | Ga0307411_10085776 | 3300032005 | Bacteria | 2182 |
| 433 | Ga0307411_10169493 | 3300032005 | Bacteria | 1645 |
| 434 | Ga0307411_10262252 | 3300032005 | Bacteria | 1365 |
| 435 | Ga0307415_100118633 | 3300032126 | Bacteria | 1979 |
| 436 | Ga0307507_10070779 | 3300033179 | Bacteria | 3160 |
| 437 | Ga0307510_10100937 | 3300033180 | Bacteria | 2676 |
| 438 | Ga0307510_10167954 | 3300033180 | Bacteria | 1778 |
| 439 | Ga0307510_10208577 | 3300033180 | Bacteria | 1479 |
| 440 | Ga0373938_0013787 | 3300034957 | Bacteria | 1540 |
| 441 | Ga0373949_0016342 | 3300035090 | Bacteria | 1663 |
| 442 | Ga0373923_0012313 | 3300035111 | Bacteria | 3159 |
| 443 | Ga0373923_0052527 | 3300035111 | Bacteria | 1712 |
| 444 | Ga0373936_0009729 | 3300035113 | Bacteria | 3627 |
| 445 | Ga0373936_0045666 | 3300035113 | Bacteria | 1765 |
| 446 | Ga0373936_0092138 | 3300035113 | Bacteria | 1272 |
| 447 | Ga0373945_0004105 | 3300035116 | Bacteria | 4617 |
| 448 | Ga0373953_0004934 | 3300035117 | Bacteria | 4294 |
| 449 | Ga0373954_0011591 | 3300035118 | Bacteria | 3909 |
| 450 | Ga0373954_0080940 | 3300035118 | Bacteria | 1552 |
| 451 | Ga0373956_0009599 | 3300035119 | Bacteria | 3941 |
| 452 | Ga0373956_0012819 | 3300035119 | Bacteria | 3481 |
| 453 | Ga0373957_0030722 | 3300035120 | Bacteria | 1970 |
| 454 | Ga0373957_0030935 | 3300035120 | Bacteria | 1964 |
| 455 | Ga0373946_0008137 | 3300035171 | Bacteria | 3849 |
| 456 | Ga0373946_0010026 | 3300035171 | Bacteria | 3503 |
| 457 | Ga0373955_0008931 | 3300035172 | Bacteria | 4675 |
| 458 | Ga0373955_0033341 | 3300035172 | Bacteria | 2712 |
| 459 | Ga0373955_0056434 | 3300035172 | Bacteria | 2154 |
| 460 | Ga0373924_0011697 | 3300035410 | Bacteria | 3264 |
| 461 | Ga0373931_0004803 | 3300035691 | Bacteria | 6202 |
| 462 | Ga0373931_0137976 | 3300035691 | Bacteria | 1410 |
| 463 | Ga0373935_0032380 | 3300035692 | Bacteria | 3249 |
| 464 | Ga0373935_0037652 | 3300035692 | Bacteria | 3027 |
| 465 | Ga0373935_0119417 | 3300035692 | Bacteria | 1759 |
| 466 | Ga0373935_0178692 | 3300035692 | Bacteria | 1456 |
| 467 | Ga0373927_0007631 | 3300035695 | Bacteria | 7321 |
| 468 | Ga0373927_0019240 | 3300035695 | Bacteria | 4478 |
| 469 | Ga0373927_0054843 | 3300035695 | Bacteria | 2578 |
| 470 | Ga0373927_0185136 | 3300035695 | Bacteria | 1366 |
| 471 | Ga0373927_0192119 | 3300035695 | Bacteria | 1339 |
| 472 | Ga0373933_0000052 | 3300035724 | Bacteria | 70592 |
| 473 | Ga0373933_0060560 | 3300035724 | Bacteria | 2282 |
| 474 | Ga0373933_0173359 | 3300035724 | Bacteria | 1373 |
| 475 | Ga0373947_0027914 | 3300035725 | Bacteria | 3306 |
| 476 | Ga0373947_0029232 | 3300035725 | Bacteria | 3233 |
| 477 | Ga0373947_0040528 | 3300035725 | Bacteria | 2774 |
| 478 | Ga0373947_0094910 | 3300035725 | Bacteria | 1866 |
| 479 | Ga0373937_0028837 | 3300036401 | Bacteria | 5025 |
| 480 | Ga0373937_0035376 | 3300036401 | Bacteria | 4546 |
| 481 | Ga0373925_0019351 | 3300037068 | Bacteria | 4952 |
| 482 | Ga0373925_0039060 | 3300037068 | Bacteria | 3511 |
| 483 | Ga0373925_0064426 | 3300037068 | Bacteria | 2759 |
| 484 | Ga0373925_0097327 | 3300037068 | Bacteria | 2257 |
| 485 | Ga0395900_0029066 | 3300037418 | Bacteria | 5670 |
| 486 | Ga0395898_0109382 | 3300037466 | Bacteria | 2650 |
| 487 | Ga0395898_0233964 | 3300037466 | Bacteria | 1752 |
| 488 | Ga0395905_0176565 | 3300037471 | Bacteria | 2005 |
| 489 | Ga0436364_1523027 | 3300037853 | Bacteria | 1939 |
| 490 | Ga0395901_0015428 | 3300038443 | Bacteria | 7780 |
| 491 | Ga0436365_0667075 | 3300039437 | Bacteria | 4544 |
| 492 | Ga0436365_1356819 | 3300039437 | Bacteria | 3467 |
| 493 | Ga0436365_1566529 | 3300039437 | Bacteria | 1932 |
| 494 | Ga0436365_1838347 | 3300039437 | Bacteria | 2030 |
| 495 | Ga0436365_1898196 | 3300039437 | Bacteria | 5297 |
| 496 | Ga0436362_1224309 | 3300039453 | Bacteria | 2330 |
| 497 | Ga0466966_0058285 | 3300044684 | Bacteria | 2441 |
| 498 | Ga0466964_0018113 | 3300044706 | Bacteria | 2701 |
| 499 | Ga0466971_0019528 | 3300044719 | Bacteria | 3011 |
| 500 | Ga0466968_0027364 | 3300044735 | Bacteria | 2347 |
| 501 | Ga0466957_0045464 | 3300044842 | Bacteria | 2663 |
| 502 | Ga0466959_0009917 | 3300045049 | Bacteria | 6790 |
| 503 | Ga0466959_0127107 | 3300045049 | Bacteria | 1809 |
| 504 | Ga0466958_0115638 | 3300045836 | Bacteria | 1676 |
| 505 | Ga0495617_049086 | 3300046452 | Bacteria | 1405 |
| 506 | Ga0495617_060573 | 3300046452 | Bacteria | 1252 |
| 507 | Ga0495592_0018394 | 3300046454 | Bacteria | 5314 |
| 508 | Ga0495592_0028184 | 3300046454 | Bacteria | 4254 |
| 509 | Ga0495592_0178286 | 3300046454 | Bacteria | 1449 |
| 510 | Ga0495603_0009067 | 3300046455 | Bacteria | 6015 |
| 511 | Ga0495603_0192254 | 3300046455 | Bacteria | 1180 |
| 512 | Ga0495629_0019820 | 3300046459 | Bacteria | 4800 |
| 513 | Ga0495629_0034435 | 3300046459 | Bacteria | 3580 |
| 514 | Ga0495629_0152729 | 3300046459 | Bacteria | 1605 |
| 515 | Ga0495641_0033371 | 3300046461 | Bacteria | 2443 |
| 516 | Ga0495651_0133014 | 3300046462 | Bacteria | 1813 |
| 517 | Ga0495580_0004026 | 3300046472 | Bacteria | 12402 |
| 518 | Ga0495580_0110160 | 3300046472 | Bacteria | 1912 |
| 519 | Ga0495582_0010995 | 3300046473 | Bacteria | 4982 |
| 520 | Ga0495639_0000899 | 3300046475 | Bacteria | 13445 |
| 521 | Ga0495639_0029116 | 3300046475 | Bacteria | 2451 |
| 522 | Ga0495639_0046118 | 3300046475 | Bacteria | 1973 |
| 523 | Ga0495662_0021541 | 3300046476 | Bacteria | 3114 |
| 524 | Ga0495664_0011992 | 3300046477 | Bacteria | 4898 |
| 525 | Ga0495664_0107178 | 3300046477 | Bacteria | 1685 |
| 526 | Ga0495585_0177022 | 3300046492 | Bacteria | 1098 |
| 527 | Ga0495594_0095493 | 3300046499 | Bacteria | 1669 |
| 528 | Ga0495596_0050404 | 3300046500 | Bacteria | 1631 |
| 529 | Ga0495583_0026495 | 3300046506 | Bacteria | 2873 |
| 530 | Ga0495606_0003362 | 3300046507 | Bacteria | 17052 |
| 531 | Ga0495606_0065047 | 3300046507 | Bacteria | 2318 |
| 532 | Ga0495608_0026982 | 3300046511 | Bacteria | 3911 |
| 533 | Ga0495608_0034519 | 3300046511 | Bacteria | 3414 |
| 534 | Ga0495608_0113060 | 3300046511 | Bacteria | 1745 |
| 535 | Ga0495610_0098803 | 3300046512 | Bacteria | 1311 |
| 536 | Ga0495616_0079842 | 3300046513 | Bacteria | 1567 |
| 537 | Ga0495618_0222618 | 3300046514 | Bacteria | 1190 |
| 538 | Ga0495620_0007763 | 3300046515 | Bacteria | 5796 |
| 539 | Ga0495620_0098838 | 3300046515 | Bacteria | 1165 |
| 540 | Ga0495628_0147921 | 3300046516 | Bacteria | 1790 |
| 541 | Ga0495628_0168501 | 3300046516 | Bacteria | 1661 |
| 542 | Ga0495630_0016906 | 3300046517 | Bacteria | 5338 |
| 543 | Ga0495643_0024681 | 3300046522 | Bacteria | 3408 |
| 544 | Ga0495648_0041417 | 3300046524 | Bacteria | 2909 |
| 545 | Ga0495666_0019863 | 3300046526 | Bacteria | 3332 |
| 546 | Ga0495652_0148780 | 3300046529 | Bacteria | 1832 |
| 547 | Ga0495652_0294860 | 3300046529 | Bacteria | 1181 |
| 548 | Ga0495665_0004419 | 3300046531 | Bacteria | 7592 |
| 549 | Ga0495665_0023864 | 3300046531 | Bacteria | 3286 |
| 550 | Ga0495640_0056743 | 3300046533 | Bacteria | 2674 |
| 551 | Ga0495587_0034227 | 3300046536 | Bacteria | 3064 |
| 552 | Ga0495587_0035270 | 3300046536 | Bacteria | 3013 |
| 553 | Ga0495621_0019753 | 3300046539 | Bacteria | 2203 |
| 554 | Ga0495621_0023214 | 3300046539 | Bacteria | 2062 |
| 555 | Ga0495645_0005078 | 3300046543 | Bacteria | 9021 |
| 556 | Ga0495645_0075490 | 3300046543 | Bacteria | 2426 |
| 557 | Ga0495645_0091054 | 3300046543 | Bacteria | 2178 |
| 558 | Ga0495645_0213767 | 3300046543 | Bacteria | 1301 |
| 559 | Ga0495622_0061532 | 3300046557 | Bacteria | 1738 |
| 560 | Ga0495633_0040247 | 3300046558 | Bacteria | 2228 |
| 561 | Ga0495667_0035666 | 3300046559 | Bacteria | 3322 |
| 562 | Ga0495667_0053053 | 3300046559 | Bacteria | 2671 |
| 563 | Ga0495656_0005677 | 3300046615 | Bacteria | 4321 |
| 564 | Ga0495656_0009890 | 3300046615 | Bacteria | 3447 |
| 565 | Ga0495668_0045751 | 3300046616 | Bacteria | 2433 |
| 566 | Ga0495634_0005123 | 3300046642 | Bacteria | 10116 |
| 567 | Ga0495634_0113135 | 3300046642 | Bacteria | 1743 |
| 568 | Ga0495625_0091127 | 3300046660 | Bacteria | 2107 |
| 569 | Ga0495635_0012340 | 3300046663 | Bacteria | 5987 |
| 570 | Ga0495635_0014647 | 3300046663 | Bacteria | 5486 |
| 571 | Ga0495635_0327113 | 3300046663 | Bacteria | 1025 |
| 572 | Ga0495588_0030046 | 3300046674 | Bacteria | 2729 |
| 573 | Ga0495588_0100471 | 3300046674 | Bacteria | 1520 |
| 574 | Ga0495657_0011839 | 3300046675 | Bacteria | 6502 |
| 575 | Ga0495657_0094707 | 3300046675 | Bacteria | 1909 |
| 576 | Ga0495599_0003308 | 3300046678 | Bacteria | 9409 |
| 577 | Ga0495599_0027314 | 3300046678 | Bacteria | 3578 |
| 578 | Ga0495599_0035657 | 3300046678 | Bacteria | 3123 |
| 579 | Ga0495623_0040596 | 3300046679 | Bacteria | 2971 |
| 580 | Ga0495646_0042756 | 3300046680 | Bacteria | 2779 |
| 581 | Ga0495647_0010288 | 3300046681 | Bacteria | 3183 |
| 582 | Ga0495647_0030841 | 3300046681 | Bacteria | 1991 |
| 583 | Ga0495658_0026874 | 3300046683 | Bacteria | 3090 |
| 584 | Ga0495669_0015205 | 3300046684 | Bacteria | 3294 |
| 585 | Ga0495613_0050738 | 3300046689 | Bacteria | 3060 |
| 586 | Ga0495613_0111896 | 3300046689 | Bacteria | 1967 |
| 587 | Ga0495624_0056286 | 3300046690 | Bacteria | 2475 |
| 588 | Ga0495671_0085597 | 3300046692 | Bacteria | 1544 |
| 589 | Ga0495649_0091476 | 3300046694 | Bacteria | 1621 |
| 590 | Ga0495589_0032798 | 3300046794 | Bacteria | 2611 |
| 591 | Ga0495600_0082658 | 3300046809 | Bacteria | 2095 |
| 592 | Ga0495660_0114938 | 3300046810 | Bacteria | 1369 |
| 593 | Ga0495581_0013346 | 3300047315 | Bacteria | 4763 |
| 594 | Ga0495581_0045955 | 3300047315 | Bacteria | 2524 |
| 595 | Ga0495604_0046850 | 3300047317 | Bacteria | 3370 |
| 596 | Ga0495604_0083239 | 3300047317 | Bacteria | 2391 |
| 597 | Ga0495604_0193896 | 3300047317 | Bacteria | 1414 |
| 598 | Ga0495636_0006943 | 3300047318 | Bacteria | 4454 |
| 599 | Ga0495674_0023047 | 3300047319 | Bacteria | 5737 |
| 600 | Ga0495674_0023255 | 3300047319 | Bacteria | 5714 |
| 601 | Ga0495672_0017046 | 3300047320 | Bacteria | 4866 |
| 602 | Ga0495676_0020256 | 3300047321 | Bacteria | 5841 |
| 603 | Ga0495680_0105492 | 3300047322 | Bacteria | 2095 |
| 604 | Ga0495680_0112543 | 3300047322 | Bacteria | 2016 |
| 605 | Ga0495683_0024079 | 3300047323 | Bacteria | 3126 |
| 606 | Ga0495675_0013961 | 3300047444 | Bacteria | 5079 |
| 607 | Ga0495673_0042647 | 3300047469 | Bacteria | 2035 |
| 608 | Ga0495673_0096778 | 3300047469 | Bacteria | 1199 |
| 609 | Ga0495681_0049382 | 3300047470 | Bacteria | 1989 |
| 610 | Ga0495684_0035903 | 3300047471 | Bacteria | 3801 |
| 611 | Ga0495684_0040381 | 3300047471 | Bacteria | 3577 |
| 612 | Ga0495684_0095293 | 3300047471 | Bacteria | 2253 |
| 613 | Ga0495686_0074536 | 3300047472 | Bacteria | 2082 |
| 614 | Ga0495602_0118393 | 3300048088 | Bacteria | 2136 |
| 615 | Ga0496100_0160931 | 3300048903 | Bacteria | 1609 |
| 616 | Ga0496101_0004598 | 3300048904 | Bacteria | 8715 |
| 617 | Ga0496101_0024803 | 3300048904 | Bacteria | 4156 |
| 618 | Ga0496102_0013859 | 3300048905 | Bacteria | 6996 |
| 619 | Ga0496102_0023166 | 3300048905 | Bacteria | 5511 |
| 620 | Ga0496103_0046088 | 3300048906 | Bacteria | 2691 |
| 621 | Ga0496104_0024522 | 3300048907 | Bacteria | 5548 |
| 622 | Ga0496104_0106969 | 3300048907 | Bacteria | 2680 |
| 623 | Ga0496104_0118251 | 3300048907 | Bacteria | 2544 |
| 624 | Ga0496104_0435685 | 3300048907 | Bacteria | 1223 |
| 625 | Ga0496105_0018401 | 3300048908 | Bacteria | 5613 |
| 626 | Ga0496105_0021519 | 3300048908 | Bacteria | 5218 |
| 627 | Ga0496105_0098245 | 3300048908 | Bacteria | 2418 |
| 628 | Ga0496106_0003440 | 3300048909 | Bacteria | 11795 |
| 629 | Ga0496106_0019858 | 3300048909 | Bacteria | 4982 |
| 630 | Ga0496106_0023485 | 3300048909 | Bacteria | 4581 |
| 631 | Ga0496106_0055888 | 3300048909 | Bacteria | 2984 |
| 632 | Ga0496107_0003096 | 3300048910 | Bacteria | 11050 |
| 633 | Ga0496108_0013251 | 3300048911 | Bacteria | 6719 |
| 634 | Ga0496108_0195129 | 3300048911 | Bacteria | 1756 |
| 635 | Ga0496108_0248749 | 3300048911 | Bacteria | 1546 |
| 636 | Ga0496109_0013303 | 3300048912 | Bacteria | 7129 |
| 637 | Ga0496109_0183415 | 3300048912 | Bacteria | 1966 |
| 638 | Ga0496109_0211088 | 3300048912 | Bacteria | 1826 |
| 639 | Ga0496109_0216108 | 3300048912 | Bacteria | 1803 |
| 640 | Ga0496110_0006199 | 3300048913 | Bacteria | 9436 |
| 641 | Ga0496110_0078123 | 3300048913 | Bacteria | 2946 |
| 642 | Ga0496110_0115432 | 3300048913 | Bacteria | 2417 |
| 643 | Ga0496111_0079286 | 3300048914 | Bacteria | 2395 |
| 644 | Ga0496111_0101390 | 3300048914 | Bacteria | 2115 |
| 645 | Ga0496111_0258873 | 3300048914 | Bacteria | 1291 |
| 646 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 647 | Ga0496112_0027890 | 3300048915 | Bacteria | 5447 |
| 648 | Ga0496112_0032724 | 3300048915 | Bacteria | 5049 |
| 649 | Ga0496112_0040218 | 3300048915 | Bacteria | 4571 |
| 650 | Ga0496112_0072106 | 3300048915 | Bacteria | 3414 |
| 651 | Ga0496113_0003249 | 3300048916 | Bacteria | 9694 |
| 652 | Ga0496113_0019464 | 3300048916 | Bacteria | 4749 |
| 653 | Ga0496113_0029916 | 3300048916 | Bacteria | 3938 |
| 654 | Ga0496114_0007527 | 3300048917 | Bacteria | 8611 |
| 655 | Ga0496115_0002391 | 3300048918 | Bacteria | 13453 |
| 656 | Ga0496115_0011937 | 3300048918 | Bacteria | 6524 |
| 657 | Ga0496117_0008333 | 3300048920 | Bacteria | 9863 |
| 658 | Ga0496118_0010695 | 3300048921 | Bacteria | 9047 |
| 659 | Ga0496118_0045705 | 3300048921 | Bacteria | 3414 |
| 660 | Ga0496119_0095615 | 3300048922 | Bacteria | 1678 |
| 661 | Ga0496121_0003205 | 3300048924 | Bacteria | 23550 |
| 662 | Ga0496121_0005199 | 3300048924 | Bacteria | 16866 |
| 663 | Ga0496121_0012595 | 3300048924 | Bacteria | 9193 |
| 664 | Ga0496121_0012878 | 3300048924 | Bacteria | 9048 |
| 665 | Ga0496121_0039309 | 3300048924 | Bacteria | 4172 |
| 666 | Ga0496121_0043868 | 3300048924 | Bacteria | 3866 |
| 667 | Ga0496121_0098115 | 3300048924 | Bacteria | 2268 |
| 668 | Ga0496124_0019555 | 3300048927 | Bacteria | 6295 |
| 669 | Ga0496124_0065533 | 3300048927 | Bacteria | 3028 |
| 670 | Ga0496124_0323048 | 3300048927 | Bacteria | 1104 |
| 671 | Ga0496125_0014654 | 3300048928 | Bacteria | 7621 |
| 672 | Ga0496126_0006488 | 3300048929 | Bacteria | 13022 |
| 673 | Ga0496126_0040423 | 3300048929 | Bacteria | 4323 |
| 674 | Ga0496126_0071150 | 3300048929 | Bacteria | 3097 |
| 675 | Ga0496126_0088041 | 3300048929 | Bacteria | 2736 |
| 676 | Ga0496126_0129446 | 3300048929 | Bacteria | 2182 |
| 677 | Ga0496126_0212295 | 3300048929 | Bacteria | 1629 |
| 678 | Ga0501032_0108848 | 3300049569 | Bacteria | 1835 |
| 679 | Ga0501039_0355387 | 3300049575 | Bacteria | 1151 |
| 680 | Ga0501047_0190673 | 3300049581 | Bacteria | 1913 |
| 681 | Ga0501072_0229277 | 3300049588 | Bacteria | 1480 |
| 682 | Ga0501072_0297471 | 3300049588 | Bacteria | 1283 |
| 683 | Ga0501073_0133837 | 3300049589 | Bacteria | 1718 |
| 684 | Ga0501079_0413797 | 3300049741 | Bacteria | 1058 |
| 685 | Ga0501080_0000669 | 3300049742 | Bacteria | 27250 |
| 686 | Ga0501044_0019256 | 3300049823 | Bacteria | 7306 |
| 687 | Ga0501045_0211306 | 3300049824 | Bacteria | 1445 |
| 688 | nmdc:mga03683_27171_c1 | 3300050489 | Bacteria | 2263 |
| 689 | nmdc:mga03n38_5720_c1 | 3300050490 | Bacteria | 4260 |
| 690 | nmdc:mga0yw44_11424_c1 | 3300050492 | Bacteria | 4584 |
| 691 | nmdc:mga0k408_125701_c1 | 3300050493 | Bacteria | 1521 |
| 692 | nmdc:mga0k408_24642_c1 | 3300050493 | Bacteria | 3402 |
| 693 | nmdc:mga0k408_53969_c1 | 3300050493 | Bacteria | 2330 |
| 694 | nmdc:mga06z11_53890_c1 | 3300050494 | Bacteria | 2071 |
| 695 | nmdc:mga07m45_29779_c1 | 3300050496 | Bacteria | 3022 |
| 696 | nmdc:mga05p37_153577_c1 | 3300050507 | Bacteria | 2814 |
| 697 | nmdc:mga05p37_382644_c1 | 3300050507 | Bacteria | 1648 |
| 698 | nmdc:mga0qj67_400028_c1 | 3300050509 | Bacteria | 1108 |
| 699 | nmdc:mga08y16_37341_c1 | 3300050511 | Bacteria | 5102 |
| 700 | nmdc:mga0n895_29119_c1 | 3300050512 | Bacteria | 5261 |
| 701 | nmdc:mga0n895_77512_c1 | 3300050512 | Bacteria | 3306 |
| 702 | nmdc:mga08x19_119331_c1 | 3300050514 | Bacteria | 1766 |
| 703 | nmdc:mga08x19_12116_c1 | 3300050514 | Bacteria | 5189 |
| 704 | nmdc:mga08x19_32084_c1 | 3300050514 | Bacteria | 3309 |
| 705 | nmdc:mga0sz30_118752_c1 | 3300050516 | Bacteria | 1161 |
| 706 | nmdc:mga0sz30_64522_c1 | 3300050516 | Bacteria | 1569 |
| 707 | Ga0495601_0007759 | 3300053077 | Bacteria | 6309 |
| 708 | Ga0495601_0016859 | 3300053077 | Bacteria | 4431 |
| 709 | Ga0500635_0042887 | 3300053080 | Bacteria | 1519 |
| 710 | Ga0495619_0058357 | 3300053085 | Bacteria | 2562 |
| 711 | Ga0495619_0083003 | 3300053085 | Bacteria | 2160 |
| 712 | Ga0500583_0093959 | 3300053092 | Bacteria | 1462 |
| 713 | Ga0500651_0138016 | 3300053093 | Bacteria | 1471 |
| 714 | Ga0500566_0000400 | 3300053094 | Bacteria | 24130 |
| 715 | Ga0500566_0022004 | 3300053094 | Bacteria | 3747 |
| 716 | Ga0500640_023893 | 3300053095 | Bacteria | 2651 |
| 717 | Ga0500641_0007780 | 3300053096 | Bacteria | 3819 |
| 718 | Ga0500648_055052 | 3300053097 | Bacteria | 2256 |
| 719 | Ga0500554_000351 | 3300053102 | Bacteria | 9898 |
| 720 | Ga0500554_001566 | 3300053102 | Bacteria | 4412 |
| 721 | Ga0500572_000121 | 3300053111 | Bacteria | 26132 |
| 722 | Ga0500595_001441 | 3300053119 | Bacteria | 12702 |
| 723 | Ga0500595_004813 | 3300053119 | Bacteria | 5976 |
| 724 | Ga0500595_014526 | 3300053119 | Bacteria | 2984 |
| 725 | Ga0500595_017366 | 3300053119 | Bacteria | 2658 |
| 726 | Ga0500608_061323 | 3300053122 | Bacteria | 1797 |
| 727 | Ga0500608_072823 | 3300053122 | Bacteria | 1632 |
| 728 | Ga0500614_001800 | 3300053123 | Bacteria | 4968 |
| 729 | Ga0500642_0100199 | 3300053130 | Bacteria | 1346 |
| 730 | Ga0500658_0020931 | 3300053134 | Bacteria | 2473 |
| 731 | Ga0500658_0034702 | 3300053134 | Bacteria | 1993 |
| 732 | Ga0500559_0001424 | 3300053136 | Bacteria | 13570 |
| 733 | Ga0500568_0017873 | 3300053139 | Bacteria | 3119 |
| 734 | Ga0500573_0163590 | 3300053140 | Bacteria | 1209 |
| 735 | Ga0500603_001381 | 3300053150 | Bacteria | 5534 |
| 736 | Ga0500603_033051 | 3300053150 | Bacteria | 1345 |
| 737 | Ga0500604_0027668 | 3300053151 | Bacteria | 1642 |
| 738 | Ga0500616_0090601 | 3300053153 | Bacteria | 1515 |
| 739 | Ga0500620_038175 | 3300053155 | Bacteria | 1562 |
| 740 | Ga0500622_0064657 | 3300053156 | Bacteria | 1860 |
| 741 | Ga0500630_001045 | 3300053159 | Bacteria | 12946 |
| 742 | Ga0500638_000584 | 3300053162 | Bacteria | 9342 |
| 743 | Ga0500638_041576 | 3300053162 | Bacteria | 2232 |
| 744 | Ga0500639_000219 | 3300053163 | Bacteria | 28391 |
| 745 | Ga0500639_003192 | 3300053163 | Bacteria | 8278 |
| 746 | Ga0500636_0021134 | 3300053177 | Bacteria | 3854 |
| 747 | Ga0500636_0034794 | 3300053177 | Bacteria | 2982 |
| 748 | Ga0500636_0089803 | 3300053177 | Bacteria | 1761 |
| 749 | Ga0500637_0000129 | 3300053178 | Bacteria | 27540 |
| 750 | Ga0500637_0000660 | 3300053178 | Bacteria | 13684 |
| 751 | Ga0500637_0164936 | 3300053178 | Bacteria | 1275 |
| 752 | Ga0500645_019226 | 3300053730 | Bacteria | 2126 |
| 753 | Ga0500645_043542 | 3300053730 | Unclassified | 1322 |
| 754 | Ga0500601_002028 | 3300053737 | Bacteria | 2175 |
| 755 | Ga0500661_001004 | 3300055283 | Bacteria | 5301 |
| 756 | Ga0501082_0130762 | 3300060353 | Bacteria | 2178 |
| 757 | Ga0466962_0036646 | 3300061719 | Bacteria | 2348 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0413797 | Ga0501079_0413797_165_1040 | 281 |
| 2 | 3300049575 | Ga0501039_0355387 | Ga0501039_0355387_289_1137 | 282 |
| 3 | 3300047318 | Ga0495636_0006943 | Ga0495636_0006943_1331_2293 | 283 |
| 4 | 3300049588 | Ga0501072_0229277 | Ga0501072_0229277_292_1287 | 306 |
| 5 | 3300050509 | nmdc:mga0qj67_400028_c1 | nmdc:mga0qj67_400028_c1_74_1054 | 307 |
| 6 | 3300060353 | Ga0501082_0130762 | Ga0501082_0130762_1090_2070 | 308 |
| 7 | 3300049588 | Ga0501072_0297471 | Ga0501072_0297471_173_1153 | 309 |
| 8 | 3300049824 | Ga0501045_0211306 | Ga0501045_0211306_310_1290 | 309 |
| 9 | 3300006038 | Ga0075365_10019879 | Ga0075365_100198794 | 310 |
| 10 | 3300050507 | nmdc:mga05p37_153577_c1 | nmdc:mga05p37_153577_c1_1716_2669 | 310 |
| 11 | 3300050489 | nmdc:mga03683_27171_c1 | nmdc:mga03683_27171_c1_948_1907 | 312 |
| 12 | 3300005548 | Ga0070665_100074161 | Ga0070665_1000741614 | 314 |
| 13 | 3300006195 | Ga0075366_10107789 | Ga0075366_101077892 | 314 |
| 14 | 3300014326 | Ga0157380_10455453 | Ga0157380_104554532 | 314 |
| 15 | 3300044706 | Ga0466964_0018113 | Ga0466964_0018113_893_1855 | 314 |
| 16 | 3300050493 | nmdc:mga0k408_24642_c1 | nmdc:mga0k408_24642_c1_1999_2955 | 314 |
| 17 | 3300050516 | nmdc:mga0sz30_118752_c1 | nmdc:mga0sz30_118752_c1_162_1118 | 314 |
| 18 | iso_pu_bacteria | 2939631187 | 2939633551 | 315 |
| 19 | 3300005338 | Ga0068868_100051929 | Ga0068868_1000519292 | 316 |
| 20 | 3300005339 | Ga0070660_100225539 | Ga0070660_1002255391 | 316 |
| 21 | 3300005343 | Ga0070687_100109838 | Ga0070687_1001098382 | 316 |
| 22 | 3300005456 | Ga0070678_100160332 | Ga0070678_1001603321 | 316 |
| 23 | 3300005547 | Ga0070693_100115720 | Ga0070693_1001157202 | 316 |
| 24 | 3300005549 | Ga0070704_100086659 | Ga0070704_1000866592 | 316 |
| 25 | 3300005616 | Ga0068852_100002208 | Ga0068852_1000022081 | 316 |
| 26 | 3300005617 | Ga0068859_100062799 | Ga0068859_1000627992 | 316 |
| 27 | 3300005834 | Ga0068851_10018416 | Ga0068851_100184165 | 316 |
| 28 | 3300006237 | Ga0097621_100007616 | Ga0097621_1000076162 | 316 |
| 29 | 3300006931 | Ga0097620_100062795 | Ga0097620_1000627952 | 316 |
| 30 | 3300009174 | Ga0105241_10214301 | Ga0105241_102143012 | 316 |
| 31 | 3300013296 | Ga0157374_10073092 | Ga0157374_100730922 | 316 |
| 32 | 3300025321 | Ga0207656_10016168 | Ga0207656_100161685 | 316 |
| 33 | 3300025909 | Ga0207705_10247397 | Ga0207705_102473972 | 316 |
| 34 | 3300025911 | Ga0207654_10166135 | Ga0207654_101661352 | 316 |
| 35 | 3300025940 | Ga0207691_10170162 | Ga0207691_101701622 | 316 |
| 36 | 3300026023 | Ga0207677_10019019 | Ga0207677_100190192 | 316 |
| 37 | 3300026075 | Ga0207708_10142557 | Ga0207708_101425572 | 316 |
| 38 | 3300026089 | Ga0207648_10025902 | Ga0207648_100259022 | 316 |
| 39 | 3300026121 | Ga0207683_10285765 | Ga0207683_102857652 | 316 |
| 40 | 3300026142 | Ga0207698_10001058 | Ga0207698_1000105818 | 316 |
| 41 | 3300048907 | Ga0496104_0118251 | Ga0496104_0118251_1497_2453 | 316 |
| 42 | 3300048913 | Ga0496110_0006199 | Ga0496110_0006199_832_1788 | 316 |
| 43 | iso_pu_bacteria | 2939631187 | 2939635615 | 316 |
| 44 | 3300005366 | Ga0070659_100031308 | Ga0070659_1000313084 | 317 |
| 45 | 3300005563 | Ga0068855_100136313 | Ga0068855_1001363132 | 317 |
| 46 | 3300005616 | Ga0068852_100003507 | Ga0068852_1000035078 | 317 |
| 47 | 3300005842 | Ga0068858_100012301 | Ga0068858_1000123016 | 317 |
| 48 | 3300005937 | Ga0081455_10001374 | Ga0081455_100013747 | 317 |
| 49 | 3300005985 | Ga0081539_10040956 | Ga0081539_100409562 | 317 |
| 50 | 3300009098 | Ga0105245_10520068 | Ga0105245_105200682 | 317 |
| 51 | 3300009148 | Ga0105243_10127683 | Ga0105243_101276832 | 317 |
| 52 | 3300009176 | Ga0105242_10004829 | Ga0105242_100048299 | 317 |
| 53 | 3300009177 | Ga0105248_10031631 | Ga0105248_100316314 | 317 |
| 54 | 3300013105 | Ga0157369_10054140 | Ga0157369_100541403 | 317 |
| 55 | 3300013307 | Ga0157372_10000281 | Ga0157372_1000028132 | 317 |
| 56 | 3300025909 | Ga0207705_10012074 | Ga0207705_100120741 | 317 |
| 57 | 3300025918 | Ga0207662_10097898 | Ga0207662_100978982 | 317 |
| 58 | 3300025918 | Ga0207662_10111408 | Ga0207662_101114082 | 317 |
| 59 | 3300025927 | Ga0207687_10255711 | Ga0207687_102557112 | 317 |
| 60 | 3300025932 | Ga0207690_10142934 | Ga0207690_101429341 | 317 |
| 61 | 3300025934 | Ga0207686_10021025 | Ga0207686_100210253 | 317 |
| 62 | 3300025935 | Ga0207709_10072977 | Ga0207709_100729771 | 317 |
| 63 | 3300026035 | Ga0207703_10015754 | Ga0207703_100157545 | 317 |
| 64 | 3300026121 | Ga0207683_10505900 | Ga0207683_105059001 | 317 |
| 65 | 3300026142 | Ga0207698_10014550 | Ga0207698_100145503 | 317 |
| 66 | 3300039437 | Ga0436365_0667075 | Ga0436365_0667075_2626_3591 | 317 |
| 67 | 3300046539 | Ga0495621_0019753 | Ga0495621_0019753_898_1857 | 317 |
| 68 | 3300046539 | Ga0495621_0023214 | Ga0495621_0023214_693_1652 | 317 |
| 69 | 3300005841 | Ga0068863_100442015 | Ga0068863_1004420151 | 318 |
| 70 | 3300025910 | Ga0207684_10250200 | Ga0207684_102502002 | 318 |
| 71 | 3300046472 | Ga0495580_0110160 | Ga0495580_0110160_204_1175 | 318 |
| 72 | 3300047317 | Ga0495604_0046850 | Ga0495604_0046850_686_1654 | 318 |
| 73 | iso_pu_bacteria | 2513237141 | 2513888421 | 318 |
| 74 | iso_pu_bacteria | 2791355199 | 2793081321 | 318 |
| 75 | iso_pu_bacteria | 2874604998 | 2874611478 | 318 |
| 76 | iso_pu_bacteria | 2876808645 | 2876817056 | 318 |
| 77 | iso_pu_bacteria | 2879110137 | 2879117559 | 318 |
| 78 | iso_pu_bacteria | 8006984368 | 8006985445 | 318 |
| 79 | 3300005364 | Ga0070673_100183414 | Ga0070673_1001834142 | 319 |
| 80 | 3300005367 | Ga0070667_100431397 | Ga0070667_1004313971 | 319 |
| 81 | 3300005436 | Ga0070713_100040111 | Ga0070713_1000401112 | 319 |
| 82 | 3300005466 | Ga0070685_10046449 | Ga0070685_100464492 | 319 |
| 83 | 3300006028 | Ga0070717_10363919 | Ga0070717_103639192 | 319 |
| 84 | 3300006177 | Ga0075362_10051422 | Ga0075362_100514222 | 319 |
| 85 | 3300006237 | Ga0097621_100009054 | Ga0097621_1000090543 | 319 |
| 86 | 3300006237 | Ga0097621_100068529 | Ga0097621_1000685292 | 319 |
| 87 | 3300006358 | Ga0068871_100021353 | Ga0068871_1000213533 | 319 |
| 88 | 3300006881 | Ga0068865_100333951 | Ga0068865_1003339511 | 319 |
| 89 | 3300006914 | Ga0075436_100001634 | Ga0075436_1000016344 | 319 |
| 90 | 3300006931 | Ga0097620_100374231 | Ga0097620_1003742312 | 319 |
| 91 | 3300009176 | Ga0105242_10006976 | Ga0105242_100069763 | 319 |
| 92 | 3300009177 | Ga0105248_10017686 | Ga0105248_100176864 | 319 |
| 93 | 3300009177 | Ga0105248_10175923 | Ga0105248_101759232 | 319 |
| 94 | 3300013296 | Ga0157374_10028494 | Ga0157374_100284944 | 319 |
| 95 | 3300013306 | Ga0163162_10081858 | Ga0163162_100818582 | 319 |
| 96 | 3300013308 | Ga0157375_10025335 | Ga0157375_100253353 | 319 |
| 97 | 3300025898 | Ga0207692_10265955 | Ga0207692_102659551 | 319 |
| 98 | 3300025915 | Ga0207693_10012061 | Ga0207693_100120614 | 319 |
| 99 | 3300025927 | Ga0207687_10195151 | Ga0207687_101951511 | 319 |
| 100 | 3300025936 | Ga0207670_10036027 | Ga0207670_100360274 | 319 |
| 101 | 3300025940 | Ga0207691_10020813 | Ga0207691_100208136 | 319 |
| 102 | 3300025941 | Ga0207711_10136383 | Ga0207711_101363832 | 319 |
| 103 | 3300025960 | Ga0207651_10107184 | Ga0207651_101071842 | 319 |
| 104 | 3300031548 | Ga0307408_100172282 | Ga0307408_1001722821 | 319 |
| 105 | 3300035113 | Ga0373936_0045666 | Ga0373936_0045666_594_1556 | 319 |
| 106 | 3300035120 | Ga0373957_0030722 | Ga0373957_0030722_475_1437 | 319 |
| 107 | 3300035410 | Ga0373924_0011697 | Ga0373924_0011697_527_1489 | 319 |
| 108 | 3300036401 | Ga0373937_0035376 | Ga0373937_0035376_2582_3544 | 319 |
| 109 | 3300039437 | Ga0436365_1566529 | Ga0436365_1566529_937_1899 | 319 |
| 110 | 3300039437 | Ga0436365_1838347 | Ga0436365_1838347_554_1519 | 319 |
| 111 | 3300046454 | Ga0495592_0028184 | Ga0495592_0028184_1565_2527 | 319 |
| 112 | 3300046459 | Ga0495629_0152729 | Ga0495629_0152729_473_1435 | 319 |
| 113 | 3300046511 | Ga0495608_0034519 | Ga0495608_0034519_502_1464 | 319 |
| 114 | 3300046516 | Ga0495628_0168501 | Ga0495628_0168501_85_1047 | 319 |
| 115 | 3300046529 | Ga0495652_0148780 | Ga0495652_0148780_135_1097 | 319 |
| 116 | 3300046536 | Ga0495587_0035270 | Ga0495587_0035270_1180_2142 | 319 |
| 117 | 3300046543 | Ga0495645_0005078 | Ga0495645_0005078_3441_4403 | 319 |
| 118 | 3300046675 | Ga0495657_0011839 | Ga0495657_0011839_4652_5614 | 319 |
| 119 | 3300046678 | Ga0495599_0035657 | Ga0495599_0035657_1347_2309 | 319 |
| 120 | 3300046679 | Ga0495623_0040596 | Ga0495623_0040596_1008_1970 | 319 |
| 121 | 3300047317 | Ga0495604_0193896 | Ga0495604_0193896_240_1202 | 319 |
| 122 | 3300047322 | Ga0495680_0112543 | Ga0495680_0112543_172_1134 | 319 |
| 123 | 3300050514 | nmdc:mga08x19_12116_c1 | nmdc:mga08x19_12116_c1_2581_3552 | 319 |
| 124 | 3300053077 | Ga0495601_0007759 | Ga0495601_0007759_722_1684 | 319 |
| 125 | 3300003323 | rootH1_10005602 | rootH1_100056023 | 320 |
| 126 | 3300005329 | Ga0070683_100001891 | Ga0070683_10000189110 | 320 |
| 127 | 3300005336 | Ga0070680_100014185 | Ga0070680_1000141852 | 320 |
| 128 | 3300005336 | Ga0070680_100227749 | Ga0070680_1002277492 | 320 |
| 129 | 3300005434 | Ga0070709_10005727 | Ga0070709_100057273 | 320 |
| 130 | 3300005434 | Ga0070709_10013748 | Ga0070709_100137482 | 320 |
| 131 | 3300005435 | Ga0070714_100105662 | Ga0070714_1001056622 | 320 |
| 132 | 3300005437 | Ga0070710_10003453 | Ga0070710_100034535 | 320 |
| 133 | 3300005439 | Ga0070711_100154300 | Ga0070711_1001543001 | 320 |
| 134 | 3300005456 | Ga0070678_100264073 | Ga0070678_1002640732 | 320 |
| 135 | 3300005458 | Ga0070681_10038462 | Ga0070681_100384622 | 320 |
| 136 | 3300005458 | Ga0070681_10085629 | Ga0070681_100856292 | 320 |
| 137 | 3300005530 | Ga0070679_100025293 | Ga0070679_1000252936 | 320 |
| 138 | 3300005530 | Ga0070679_100174211 | Ga0070679_1001742112 | 320 |
| 139 | 3300005535 | Ga0070684_100032530 | Ga0070684_1000325302 | 320 |
| 140 | 3300005535 | Ga0070684_100037616 | Ga0070684_1000376163 | 320 |
| 141 | 3300005535 | Ga0070684_100168638 | Ga0070684_1001686381 | 320 |
| 142 | 3300005535 | Ga0070684_100246159 | Ga0070684_1002461591 | 320 |
| 143 | 3300005539 | Ga0068853_100103120 | Ga0068853_1001031202 | 320 |
| 144 | 3300005547 | Ga0070693_100135799 | Ga0070693_1001357992 | 320 |
| 145 | 3300005548 | Ga0070665_100165178 | Ga0070665_1001651782 | 320 |
| 146 | 3300005563 | Ga0068855_100178799 | Ga0068855_1001787992 | 320 |
| 147 | 3300005577 | Ga0068857_100119045 | Ga0068857_1001190451 | 320 |
| 148 | 3300005614 | Ga0068856_100156914 | Ga0068856_1001569142 | 320 |
| 149 | 3300005614 | Ga0068856_100268996 | Ga0068856_1002689962 | 320 |
| 150 | 3300005842 | Ga0068858_100186955 | Ga0068858_1001869552 | 320 |
| 151 | 3300006028 | Ga0070717_10036379 | Ga0070717_100363793 | 320 |
| 152 | 3300006175 | Ga0070712_100020160 | Ga0070712_1000201604 | 320 |
| 153 | 3300006175 | Ga0070712_100036035 | Ga0070712_1000360351 | 320 |
| 154 | 3300006237 | Ga0097621_100210286 | Ga0097621_1002102862 | 320 |
| 155 | 3300006914 | Ga0075436_100000352 | Ga0075436_1000003522 | 320 |
| 156 | 3300007788 | Ga0099795_10089975 | Ga0099795_100899751 | 320 |
| 157 | 3300009174 | Ga0105241_10030773 | Ga0105241_100307732 | 320 |
| 158 | 3300009545 | Ga0105237_10091696 | Ga0105237_100916964 | 320 |
| 159 | 3300009551 | Ga0105238_10038665 | Ga0105238_100386654 | 320 |
| 160 | 3300009551 | Ga0105238_10078483 | Ga0105238_100784833 | 320 |
| 161 | 3300009553 | Ga0105249_10553831 | Ga0105249_105538311 | 320 |
| 162 | 3300013296 | Ga0157374_10012991 | Ga0157374_100129917 | 320 |
| 163 | 3300013297 | Ga0157378_10230081 | Ga0157378_102300812 | 320 |
| 164 | 3300013307 | Ga0157372_10406718 | Ga0157372_104067182 | 320 |
| 165 | 3300013307 | Ga0157372_10462287 | Ga0157372_104622871 | 320 |
| 166 | 3300014969 | Ga0157376_10211048 | Ga0157376_102110482 | 320 |
| 167 | 3300021384 | Ga0213876_10033360 | Ga0213876_100333603 | 320 |
| 168 | 3300025898 | Ga0207692_10005779 | Ga0207692_100057795 | 320 |
| 169 | 3300025904 | Ga0207647_10061889 | Ga0207647_100618892 | 320 |
| 170 | 3300025906 | Ga0207699_10007005 | Ga0207699_100070052 | 320 |
| 171 | 3300025906 | Ga0207699_10010420 | Ga0207699_100104205 | 320 |
| 172 | 3300025911 | Ga0207654_10095910 | Ga0207654_100959101 | 320 |
| 173 | 3300025912 | Ga0207707_10006804 | Ga0207707_100068041 | 320 |
| 174 | 3300025912 | Ga0207707_10211013 | Ga0207707_102110131 | 320 |
| 175 | 3300025913 | Ga0207695_10329384 | Ga0207695_103293841 | 320 |
| 176 | 3300025914 | Ga0207671_10089923 | Ga0207671_100899232 | 320 |
| 177 | 3300025915 | Ga0207693_10243935 | Ga0207693_102439351 | 320 |
| 178 | 3300025917 | Ga0207660_10013723 | Ga0207660_100137231 | 320 |
| 179 | 3300025921 | Ga0207652_10034651 | Ga0207652_100346512 | 320 |
| 180 | 3300025921 | Ga0207652_10058526 | Ga0207652_100585262 | 320 |
| 181 | 3300025921 | Ga0207652_10148587 | Ga0207652_101485872 | 320 |
| 182 | 3300025924 | Ga0207694_10069105 | Ga0207694_100691054 | 320 |
| 183 | 3300025939 | Ga0207665_10033748 | Ga0207665_100337484 | 320 |
| 184 | 3300025944 | Ga0207661_10001182 | Ga0207661_100011829 | 320 |
| 185 | 3300025960 | Ga0207651_10163036 | Ga0207651_101630362 | 320 |
| 186 | 3300025981 | Ga0207640_10124415 | Ga0207640_101244152 | 320 |
| 187 | 3300026078 | Ga0207702_10038290 | Ga0207702_100382904 | 320 |
| 188 | 3300026116 | Ga0207674_10441293 | Ga0207674_104412931 | 320 |
| 189 | 3300026121 | Ga0207683_10212885 | Ga0207683_102128853 | 320 |
| 190 | 3300028379 | Ga0268266_10214650 | Ga0268266_102146502 | 320 |
| 191 | 3300035111 | Ga0373923_0052527 | Ga0373923_0052527_736_1701 | 320 |
| 192 | 3300035113 | Ga0373936_0009729 | Ga0373936_0009729_1071_2036 | 320 |
| 193 | 3300035116 | Ga0373945_0004105 | Ga0373945_0004105_1922_2887 | 320 |
| 194 | 3300035119 | Ga0373956_0009599 | Ga0373956_0009599_2754_3719 | 320 |
| 195 | 3300035171 | Ga0373946_0008137 | Ga0373946_0008137_2662_3627 | 320 |
| 196 | 3300035172 | Ga0373955_0008931 | Ga0373955_0008931_256_1221 | 320 |
| 197 | 3300035692 | Ga0373935_0032380 | Ga0373935_0032380_1461_2426 | 320 |
| 198 | 3300035725 | Ga0373947_0029232 | Ga0373947_0029232_1218_2183 | 320 |
| 199 | 3300037068 | Ga0373925_0039060 | Ga0373925_0039060_2330_3295 | 320 |
| 200 | 3300037466 | Ga0395898_0109382 | Ga0395898_0109382_348_1313 | 320 |
| 201 | 3300037853 | Ga0436364_1523027 | Ga0436364_1523027_854_1819 | 320 |
| 202 | 3300039437 | Ga0436365_1356819 | Ga0436365_1356819_1826_2791 | 320 |
| 203 | 3300044719 | Ga0466971_0019528 | Ga0466971_0019528_1450_2427 | 320 |
| 204 | 3300044735 | Ga0466968_0027364 | Ga0466968_0027364_1080_2057 | 320 |
| 205 | 3300045049 | Ga0466959_0009917 | Ga0466959_0009917_4982_5959 | 320 |
| 206 | 3300046472 | Ga0495580_0004026 | Ga0495580_0004026_11374_12339 | 320 |
| 207 | 3300046477 | Ga0495664_0011992 | Ga0495664_0011992_3817_4782 | 320 |
| 208 | 3300046477 | Ga0495664_0107178 | Ga0495664_0107178_629_1594 | 320 |
| 209 | 3300046511 | Ga0495608_0113060 | Ga0495608_0113060_756_1721 | 320 |
| 210 | 3300046531 | Ga0495665_0023864 | Ga0495665_0023864_2184_3149 | 320 |
| 211 | 3300046543 | Ga0495645_0091054 | Ga0495645_0091054_206_1171 | 320 |
| 212 | 3300046642 | Ga0495634_0005123 | Ga0495634_0005123_743_1708 | 320 |
| 213 | 3300046663 | Ga0495635_0327113 | Ga0495635_0327113_21_986 | 320 |
| 214 | 3300046678 | Ga0495599_0027314 | Ga0495599_0027314_934_1899 | 320 |
| 215 | 3300046681 | Ga0495647_0030841 | Ga0495647_0030841_456_1421 | 320 |
| 216 | 3300046689 | Ga0495613_0111896 | Ga0495613_0111896_853_1818 | 320 |
| 217 | 3300047315 | Ga0495581_0045955 | Ga0495581_0045955_318_1283 | 320 |
| 218 | 3300047319 | Ga0495674_0023047 | Ga0495674_0023047_856_1821 | 320 |
| 219 | 3300047471 | Ga0495684_0035903 | Ga0495684_0035903_2230_3195 | 320 |
| 220 | 3300048914 | Ga0496111_0258873 | Ga0496111_0258873_30_995 | 320 |
| 221 | 3300048915 | Ga0496112_0072106 | Ga0496112_0072106_1736_2701 | 320 |
| 222 | 3300048924 | Ga0496121_0039309 | Ga0496121_0039309_580_1545 | 320 |
| 223 | 3300049569 | Ga0501032_0108848 | Ga0501032_0108848_318_1283 | 320 |
| 224 | 3300049581 | Ga0501047_0190673 | Ga0501047_0190673_221_1186 | 320 |
| 225 | 3300049589 | Ga0501073_0133837 | Ga0501073_0133837_678_1643 | 320 |
| 226 | 3300049742 | Ga0501080_0000669 | Ga0501080_0000669_16857_17822 | 320 |
| 227 | 3300049823 | Ga0501044_0019256 | Ga0501044_0019256_3200_4165 | 320 |
| 228 | 3300050512 | nmdc:mga0n895_29119_c1 | nmdc:mga0n895_29119_c1_3595_4566 | 320 |
| 229 | 3300050514 | nmdc:mga08x19_32084_c1 | nmdc:mga08x19_32084_c1_1063_2034 | 320 |
| 230 | 3300053077 | Ga0495601_0016859 | Ga0495601_0016859_1385_2350 | 320 |
| 231 | 3300053730 | Ga0500645_043542 | Ga0500645_043542_22_1011 | 320 |
| 232 | 3300061719 | Ga0466962_0036646 | Ga0466962_0036646_863_1840 | 320 |
| 233 | 3300005329 | Ga0070683_100128202 | Ga0070683_1001282022 | 321 |
| 234 | 3300005339 | Ga0070660_100085895 | Ga0070660_1000858952 | 321 |
| 235 | 3300005347 | Ga0070668_100040629 | Ga0070668_1000406294 | 321 |
| 236 | 3300005436 | Ga0070713_100342409 | Ga0070713_1003424092 | 321 |
| 237 | 3300005535 | Ga0070684_100108725 | Ga0070684_1001087252 | 321 |
| 238 | 3300005543 | Ga0070672_100236148 | Ga0070672_1002361482 | 321 |
| 239 | 3300005563 | Ga0068855_100001651 | Ga0068855_10000165114 | 321 |
| 240 | 3300005563 | Ga0068855_100008249 | Ga0068855_1000082492 | 321 |
| 241 | 3300005614 | Ga0068856_100071616 | Ga0068856_1000716164 | 321 |
| 242 | 3300005937 | Ga0081455_10012994 | Ga0081455_100129946 | 321 |
| 243 | 3300009174 | Ga0105241_10008810 | Ga0105241_100088106 | 321 |
| 244 | 3300009551 | Ga0105238_10020562 | Ga0105238_100205623 | 321 |
| 245 | 3300013307 | Ga0157372_10324064 | Ga0157372_103240642 | 321 |
| 246 | 3300025911 | Ga0207654_10096868 | Ga0207654_100968682 | 321 |
| 247 | 3300025913 | Ga0207695_10035532 | Ga0207695_100355325 | 321 |
| 248 | 3300025917 | Ga0207660_10039829 | Ga0207660_100398292 | 321 |
| 249 | 3300025919 | Ga0207657_10106614 | Ga0207657_101066142 | 321 |
| 250 | 3300025924 | Ga0207694_10014649 | Ga0207694_100146494 | 321 |
| 251 | 3300025925 | Ga0207650_10076868 | Ga0207650_100768684 | 321 |
| 252 | 3300025949 | Ga0207667_10153257 | Ga0207667_101532573 | 321 |
| 253 | 3300025972 | Ga0207668_10320346 | Ga0207668_103203461 | 321 |
| 254 | 3300026078 | Ga0207702_10011800 | Ga0207702_100118005 | 321 |
| 255 | 3300026118 | Ga0207675_100035023 | Ga0207675_1000350233 | 321 |
| 256 | 3300028380 | Ga0268265_10086968 | Ga0268265_100869682 | 321 |
| 257 | 3300028381 | Ga0268264_10113882 | Ga0268264_101138821 | 321 |
| 258 | 3300037418 | Ga0395900_0029066 | Ga0395900_0029066_2458_3432 | 321 |
| 259 | 3300037471 | Ga0395905_0176565 | Ga0395905_0176565_190_1164 | 321 |
| 260 | 3300038443 | Ga0395901_0015428 | Ga0395901_0015428_5038_6012 | 321 |
| 261 | 3300044684 | Ga0466966_0058285 | Ga0466966_0058285_115_1086 | 321 |
| 262 | 3300044842 | Ga0466957_0045464 | Ga0466957_0045464_116_1087 | 321 |
| 263 | 3300045049 | Ga0466959_0127107 | Ga0466959_0127107_247_1218 | 321 |
| 264 | 3300045836 | Ga0466958_0115638 | Ga0466958_0115638_166_1137 | 321 |
| 265 | 3300047320 | Ga0495672_0017046 | Ga0495672_0017046_2451_3419 | 321 |
| 266 | 3300047472 | Ga0495686_0074536 | Ga0495686_0074536_573_1541 | 321 |
| 267 | 3300048911 | Ga0496108_0195129 | Ga0496108_0195129_58_1050 | 321 |
| 268 | 3300048912 | Ga0496109_0211088 | Ga0496109_0211088_626_1591 | 321 |
| 269 | 3300053119 | Ga0500595_014526 | Ga0500595_014526_1711_2679 | 321 |
| 270 | 3300053139 | Ga0500568_0017873 | Ga0500568_0017873_127_1095 | 321 |
| 271 | 3300003203 | JGI25406J46586_10000025 | JGI25406J46586_1000002560 | 322 |
| 272 | 3300003203 | JGI25406J46586_10002937 | JGI25406J46586_100029373 | 322 |
| 273 | 3300005293 | Ga0065715_10126910 | Ga0065715_101269101 | 322 |
| 274 | 3300005327 | Ga0070658_10026861 | Ga0070658_100268615 | 322 |
| 275 | 3300005329 | Ga0070683_100018017 | Ga0070683_1000180176 | 322 |
| 276 | 3300005330 | Ga0070690_100196253 | Ga0070690_1001962532 | 322 |
| 277 | 3300005331 | Ga0070670_100105760 | Ga0070670_1001057602 | 322 |
| 278 | 3300005334 | Ga0068869_100006651 | Ga0068869_1000066512 | 322 |
| 279 | 3300005334 | Ga0068869_100074198 | Ga0068869_1000741982 | 322 |
| 280 | 3300005335 | Ga0070666_10212896 | Ga0070666_102128961 | 322 |
| 281 | 3300005336 | Ga0070680_100034100 | Ga0070680_1000341002 | 322 |
| 282 | 3300005337 | Ga0070682_100175701 | Ga0070682_1001757012 | 322 |
| 283 | 3300005338 | Ga0068868_100013029 | Ga0068868_1000130293 | 322 |
| 284 | 3300005338 | Ga0068868_100024575 | Ga0068868_1000245756 | 322 |
| 285 | 3300005339 | Ga0070660_100082352 | Ga0070660_1000823522 | 322 |
| 286 | 3300005340 | Ga0070689_100160442 | Ga0070689_1001604422 | 322 |
| 287 | 3300005344 | Ga0070661_100141580 | Ga0070661_1001415801 | 322 |
| 288 | 3300005344 | Ga0070661_100171920 | Ga0070661_1001719202 | 322 |
| 289 | 3300005347 | Ga0070668_100066608 | Ga0070668_1000666082 | 322 |
| 290 | 3300005347 | Ga0070668_100094097 | Ga0070668_1000940973 | 322 |
| 291 | 3300005355 | Ga0070671_100112865 | Ga0070671_1001128651 | 322 |
| 292 | 3300005356 | Ga0070674_100276203 | Ga0070674_1002762031 | 322 |
| 293 | 3300005364 | Ga0070673_100181004 | Ga0070673_1001810042 | 322 |
| 294 | 3300005365 | Ga0070688_100124972 | Ga0070688_1001249722 | 322 |
| 295 | 3300005366 | Ga0070659_100242398 | Ga0070659_1002423981 | 322 |
| 296 | 3300005367 | Ga0070667_100224349 | Ga0070667_1002243492 | 322 |
| 297 | 3300005434 | Ga0070709_10099917 | Ga0070709_100999172 | 322 |
| 298 | 3300005435 | Ga0070714_100045153 | Ga0070714_1000451531 | 322 |
| 299 | 3300005435 | Ga0070714_100477341 | Ga0070714_1004773411 | 322 |
| 300 | 3300005436 | Ga0070713_100006321 | Ga0070713_1000063219 | 322 |
| 301 | 3300005437 | Ga0070710_10005902 | Ga0070710_100059026 | 322 |
| 302 | 3300005455 | Ga0070663_100000736 | Ga0070663_10000073616 | 322 |
| 303 | 3300005455 | Ga0070663_100038209 | Ga0070663_1000382092 | 322 |
| 304 | 3300005455 | Ga0070663_100054724 | Ga0070663_1000547242 | 322 |
| 305 | 3300005455 | Ga0070663_100096174 | Ga0070663_1000961742 | 322 |
| 306 | 3300005456 | Ga0070678_100001495 | Ga0070678_10000149511 | 322 |
| 307 | 3300005458 | Ga0070681_10069555 | Ga0070681_100695552 | 322 |
| 308 | 3300005468 | Ga0070707_100088318 | Ga0070707_1000883181 | 322 |
| 309 | 3300005471 | Ga0070698_100205473 | Ga0070698_1002054732 | 322 |
| 310 | 3300005518 | Ga0070699_100177587 | Ga0070699_1001775871 | 322 |
| 311 | 3300005535 | Ga0070684_100099479 | Ga0070684_1000994791 | 322 |
| 312 | 3300005536 | Ga0070697_100020178 | Ga0070697_1000201783 | 322 |
| 313 | 3300005539 | Ga0068853_100045263 | Ga0068853_1000452632 | 322 |
| 314 | 3300005539 | Ga0068853_100151223 | Ga0068853_1001512231 | 322 |
| 315 | 3300005539 | Ga0068853_100239796 | Ga0068853_1002397962 | 322 |
| 316 | 3300005539 | Ga0068853_100315738 | Ga0068853_1003157381 | 322 |
| 317 | 3300005548 | Ga0070665_100007828 | Ga0070665_10000782810 | 322 |
| 318 | 3300005548 | Ga0070665_100029862 | Ga0070665_1000298623 | 322 |
| 319 | 3300005548 | Ga0070665_100030204 | Ga0070665_1000302048 | 322 |
| 320 | 3300005548 | Ga0070665_100091436 | Ga0070665_1000914363 | 322 |
| 321 | 3300005548 | Ga0070665_100431543 | Ga0070665_1004315432 | 322 |
| 322 | 3300005563 | Ga0068855_100067236 | Ga0068855_1000672365 | 322 |
| 323 | 3300005563 | Ga0068855_100690160 | Ga0068855_1006901601 | 322 |
| 324 | 3300005564 | Ga0070664_100009890 | Ga0070664_1000098908 | 322 |
| 325 | 3300005564 | Ga0070664_100081776 | Ga0070664_1000817762 | 322 |
| 326 | 3300005578 | Ga0068854_100129953 | Ga0068854_1001299532 | 322 |
| 327 | 3300005614 | Ga0068856_100000066 | Ga0068856_10000006681 | 322 |
| 328 | 3300005614 | Ga0068856_100080501 | Ga0068856_1000805012 | 322 |
| 329 | 3300005616 | Ga0068852_100003029 | Ga0068852_1000030299 | 322 |
| 330 | 3300005616 | Ga0068852_100028663 | Ga0068852_1000286632 | 322 |
| 331 | 3300005616 | Ga0068852_100037217 | Ga0068852_1000372173 | 322 |
| 332 | 3300005616 | Ga0068852_100048237 | Ga0068852_1000482372 | 322 |
| 333 | 3300005618 | Ga0068864_100197071 | Ga0068864_1001970712 | 322 |
| 334 | 3300005719 | Ga0068861_100090710 | Ga0068861_1000907103 | 322 |
| 335 | 3300005841 | Ga0068863_100017738 | Ga0068863_1000177385 | 322 |
| 336 | 3300005841 | Ga0068863_100248791 | Ga0068863_1002487913 | 322 |
| 337 | 3300005842 | Ga0068858_100024609 | Ga0068858_1000246092 | 322 |
| 338 | 3300005842 | Ga0068858_100224757 | Ga0068858_1002247571 | 322 |
| 339 | 3300005842 | Ga0068858_100260344 | Ga0068858_1002603442 | 322 |
| 340 | 3300005843 | Ga0068860_100000302 | Ga0068860_10000030217 | 322 |
| 341 | 3300005843 | Ga0068860_100331889 | Ga0068860_1003318891 | 322 |
| 342 | 3300005844 | Ga0068862_100062037 | Ga0068862_1000620371 | 322 |
| 343 | 3300005844 | Ga0068862_100074199 | Ga0068862_1000741992 | 322 |
| 344 | 3300005937 | Ga0081455_10006992 | Ga0081455_100069924 | 322 |
| 345 | 3300005937 | Ga0081455_10011660 | Ga0081455_100116605 | 322 |
| 346 | 3300005937 | Ga0081455_10033372 | Ga0081455_100333723 | 322 |
| 347 | 3300005983 | Ga0081540_1000918 | Ga0081540_100091816 | 322 |
| 348 | 3300005983 | Ga0081540_1002732 | Ga0081540_100273214 | 322 |
| 349 | 3300005983 | Ga0081540_1002906 | Ga0081540_10029064 | 322 |
| 350 | 3300005983 | Ga0081540_1005394 | Ga0081540_10053943 | 322 |
| 351 | 3300005983 | Ga0081540_1013045 | Ga0081540_10130455 | 322 |
| 352 | 3300005983 | Ga0081540_1040733 | Ga0081540_10407332 | 322 |
| 353 | 3300005983 | Ga0081540_1078242 | Ga0081540_10782422 | 322 |
| 354 | 3300005985 | Ga0081539_10000008 | Ga0081539_1000000874 | 322 |
| 355 | 3300005985 | Ga0081539_10000640 | Ga0081539_100006405 | 322 |
| 356 | 3300005985 | Ga0081539_10011398 | Ga0081539_100113981 | 322 |
| 357 | 3300005985 | Ga0081539_10041169 | Ga0081539_100411692 | 322 |
| 358 | 3300006028 | Ga0070717_10008077 | Ga0070717_100080776 | 322 |
| 359 | 3300006038 | Ga0075365_10048899 | Ga0075365_100488991 | 322 |
| 360 | 3300006038 | Ga0075365_10087007 | Ga0075365_100870072 | 322 |
| 361 | 3300006038 | Ga0075365_10101279 | Ga0075365_101012792 | 322 |
| 362 | 3300006038 | Ga0075365_10148091 | Ga0075365_101480912 | 322 |
| 363 | 3300006048 | Ga0075363_100024494 | Ga0075363_1000244943 | 322 |
| 364 | 3300006048 | Ga0075363_100046739 | Ga0075363_1000467391 | 322 |
| 365 | 3300006051 | Ga0075364_10208457 | Ga0075364_102084572 | 322 |
| 366 | 3300006173 | Ga0070716_100021690 | Ga0070716_1000216904 | 322 |
| 367 | 3300006173 | Ga0070716_100046897 | Ga0070716_1000468972 | 322 |
| 368 | 3300006173 | Ga0070716_100234801 | Ga0070716_1002348012 | 322 |
| 369 | 3300006175 | Ga0070712_100013846 | Ga0070712_1000138466 | 322 |
| 370 | 3300006195 | Ga0075366_10025300 | Ga0075366_100253005 | 322 |
| 371 | 3300006353 | Ga0075370_10007780 | Ga0075370_100077804 | 322 |
| 372 | 3300006358 | Ga0068871_100031289 | Ga0068871_1000312894 | 322 |
| 373 | 3300006358 | Ga0068871_100146040 | Ga0068871_1001460402 | 322 |
| 374 | 3300006844 | Ga0075428_100215289 | Ga0075428_1002152892 | 322 |
| 375 | 3300006881 | Ga0068865_100227804 | Ga0068865_1002278041 | 322 |
| 376 | 3300006931 | Ga0097620_100175803 | Ga0097620_1001758031 | 322 |
| 377 | 3300007265 | Ga0099794_10009840 | Ga0099794_100098402 | 322 |
| 378 | 3300007265 | Ga0099794_10029876 | Ga0099794_100298762 | 322 |
| 379 | 3300007788 | Ga0099795_10059292 | Ga0099795_100592921 | 322 |
| 380 | 3300009098 | Ga0105245_10002531 | Ga0105245_1000253111 | 322 |
| 381 | 3300009098 | Ga0105245_10034525 | Ga0105245_100345251 | 322 |
| 382 | 3300009098 | Ga0105245_10120492 | Ga0105245_101204922 | 322 |
| 383 | 3300009098 | Ga0105245_10162145 | Ga0105245_101621453 | 322 |
| 384 | 3300009101 | Ga0105247_10006243 | Ga0105247_100062435 | 322 |
| 385 | 3300009101 | Ga0105247_10028254 | Ga0105247_100282541 | 322 |
| 386 | 3300009148 | Ga0105243_10043679 | Ga0105243_100436794 | 322 |
| 387 | 3300009174 | Ga0105241_10013032 | Ga0105241_100130326 | 322 |
| 388 | 3300009174 | Ga0105241_10469949 | Ga0105241_104699492 | 322 |
| 389 | 3300009176 | Ga0105242_10026161 | Ga0105242_100261615 | 322 |
| 390 | 3300009176 | Ga0105242_10093721 | Ga0105242_100937212 | 322 |
| 391 | 3300009177 | Ga0105248_10007036 | Ga0105248_1000703614 | 322 |
| 392 | 3300009177 | Ga0105248_10010822 | Ga0105248_100108227 | 322 |
| 393 | 3300009177 | Ga0105248_10093092 | Ga0105248_100930924 | 322 |
| 394 | 3300009545 | Ga0105237_10002097 | Ga0105237_1000209710 | 322 |
| 395 | 3300009545 | Ga0105237_10007055 | Ga0105237_1000705510 | 322 |
| 396 | 3300009545 | Ga0105237_10025682 | Ga0105237_100256826 | 322 |
| 397 | 3300009545 | Ga0105237_10052188 | Ga0105237_100521883 | 322 |
| 398 | 3300009545 | Ga0105237_10170574 | Ga0105237_101705742 | 322 |
| 399 | 3300009551 | Ga0105238_10007477 | Ga0105238_100074775 | 322 |
| 400 | 3300009551 | Ga0105238_10092222 | Ga0105238_100922222 | 322 |
| 401 | 3300009551 | Ga0105238_10200567 | Ga0105238_102005672 | 322 |
| 402 | 3300010159 | Ga0099796_10001990 | Ga0099796_100019902 | 322 |
| 403 | 3300010375 | Ga0105239_10018062 | Ga0105239_100180622 | 322 |
| 404 | 3300011119 | Ga0105246_10002338 | Ga0105246_100023385 | 322 |
| 405 | 3300011119 | Ga0105246_10036950 | Ga0105246_100369502 | 322 |
| 406 | 3300011119 | Ga0105246_10045724 | Ga0105246_100457242 | 322 |
| 407 | 3300011119 | Ga0105246_10130324 | Ga0105246_101303243 | 322 |
| 408 | 3300013104 | Ga0157370_10038407 | Ga0157370_100384072 | 322 |
| 409 | 3300013105 | Ga0157369_10009209 | Ga0157369_100092096 | 322 |
| 410 | 3300013296 | Ga0157374_10005291 | Ga0157374_100052919 | 322 |
| 411 | 3300013297 | Ga0157378_10031134 | Ga0157378_100311343 | 322 |
| 412 | 3300013297 | Ga0157378_10068359 | Ga0157378_100683592 | 322 |
| 413 | 3300013297 | Ga0157378_10313264 | Ga0157378_103132642 | 322 |
| 414 | 3300013306 | Ga0163162_10097049 | Ga0163162_100970492 | 322 |
| 415 | 3300013306 | Ga0163162_10114089 | Ga0163162_101140892 | 322 |
| 416 | 3300013306 | Ga0163162_10670293 | Ga0163162_106702931 | 322 |
| 417 | 3300013308 | Ga0157375_10007126 | Ga0157375_100071264 | 322 |
| 418 | 3300013308 | Ga0157375_10100137 | Ga0157375_101001373 | 322 |
| 419 | 3300013308 | Ga0157375_10193457 | Ga0157375_101934572 | 322 |
| 420 | 3300014325 | Ga0163163_10003162 | Ga0163163_100031624 | 322 |
| 421 | 3300014968 | Ga0157379_10022769 | Ga0157379_100227693 | 322 |
| 422 | 3300014968 | Ga0157379_10147740 | Ga0157379_101477401 | 322 |
| 423 | 3300014968 | Ga0157379_10280566 | Ga0157379_102805661 | 322 |
| 424 | 3300014969 | Ga0157376_10007855 | Ga0157376_100078555 | 322 |
| 425 | 3300014969 | Ga0157376_10025197 | Ga0157376_100251973 | 322 |
| 426 | 3300021384 | Ga0213876_10000471 | Ga0213876_1000047130 | 322 |
| 427 | 3300025297 | Ga0209758_1004659 | Ga0209758_10046599 | 322 |
| 428 | 3300025297 | Ga0209758_1004698 | Ga0209758_10046982 | 322 |
| 429 | 3300025898 | Ga0207692_10003854 | Ga0207692_100038545 | 322 |
| 430 | 3300025900 | Ga0207710_10006455 | Ga0207710_100064554 | 322 |
| 431 | 3300025901 | Ga0207688_10005151 | Ga0207688_100051514 | 322 |
| 432 | 3300025901 | Ga0207688_10232630 | Ga0207688_102326301 | 322 |
| 433 | 3300025906 | Ga0207699_10016501 | Ga0207699_100165013 | 322 |
| 434 | 3300025906 | Ga0207699_10160941 | Ga0207699_101609412 | 322 |
| 435 | 3300025907 | Ga0207645_10084279 | Ga0207645_100842791 | 322 |
| 436 | 3300025908 | Ga0207643_10022187 | Ga0207643_100221872 | 322 |
| 437 | 3300025909 | Ga0207705_10142508 | Ga0207705_101425082 | 322 |
| 438 | 3300025909 | Ga0207705_10196289 | Ga0207705_101962891 | 322 |
| 439 | 3300025910 | Ga0207684_10097070 | Ga0207684_100970702 | 322 |
| 440 | 3300025911 | Ga0207654_10003642 | Ga0207654_100036424 | 322 |
| 441 | 3300025912 | Ga0207707_10008746 | Ga0207707_100087468 | 322 |
| 442 | 3300025912 | Ga0207707_10123983 | Ga0207707_101239832 | 322 |
| 443 | 3300025913 | Ga0207695_10051579 | Ga0207695_100515791 | 322 |
| 444 | 3300025914 | Ga0207671_10016029 | Ga0207671_100160292 | 322 |
| 445 | 3300025914 | Ga0207671_10040558 | Ga0207671_100405585 | 322 |
| 446 | 3300025914 | Ga0207671_10103910 | Ga0207671_101039102 | 322 |
| 447 | 3300025914 | Ga0207671_10192949 | Ga0207671_101929492 | 322 |
| 448 | 3300025915 | Ga0207693_10003223 | Ga0207693_100032238 | 322 |
| 449 | 3300025915 | Ga0207693_10090290 | Ga0207693_100902903 | 322 |
| 450 | 3300025917 | Ga0207660_10198406 | Ga0207660_101984061 | 322 |
| 451 | 3300025919 | Ga0207657_10002580 | Ga0207657_100025806 | 322 |
| 452 | 3300025920 | Ga0207649_10169460 | Ga0207649_101694601 | 322 |
| 453 | 3300025920 | Ga0207649_10340908 | Ga0207649_103409081 | 322 |
| 454 | 3300025921 | Ga0207652_10047988 | Ga0207652_100479881 | 322 |
| 455 | 3300025922 | Ga0207646_10053641 | Ga0207646_100536412 | 322 |
| 456 | 3300025924 | Ga0207694_10131744 | Ga0207694_101317442 | 322 |
| 457 | 3300025927 | Ga0207687_10074785 | Ga0207687_100747852 | 322 |
| 458 | 3300025927 | Ga0207687_10105497 | Ga0207687_101054972 | 322 |
| 459 | 3300025928 | Ga0207700_10002090 | Ga0207700_1000209011 | 322 |
| 460 | 3300025928 | Ga0207700_10073711 | Ga0207700_100737113 | 322 |
| 461 | 3300025928 | Ga0207700_10392206 | Ga0207700_103922062 | 322 |
| 462 | 3300025929 | Ga0207664_10047500 | Ga0207664_100475003 | 322 |
| 463 | 3300025931 | Ga0207644_10097535 | Ga0207644_100975351 | 322 |
| 464 | 3300025931 | Ga0207644_10402976 | Ga0207644_104029761 | 322 |
| 465 | 3300025932 | Ga0207690_10191111 | Ga0207690_101911112 | 322 |
| 466 | 3300025933 | Ga0207706_10038396 | Ga0207706_100383964 | 322 |
| 467 | 3300025933 | Ga0207706_10423659 | Ga0207706_104236591 | 322 |
| 468 | 3300025934 | Ga0207686_10023050 | Ga0207686_100230503 | 322 |
| 469 | 3300025934 | Ga0207686_10276382 | Ga0207686_102763821 | 322 |
| 470 | 3300025938 | Ga0207704_10039801 | Ga0207704_100398013 | 322 |
| 471 | 3300025938 | Ga0207704_10077063 | Ga0207704_100770632 | 322 |
| 472 | 3300025940 | Ga0207691_10106687 | Ga0207691_101066872 | 322 |
| 473 | 3300025941 | Ga0207711_10068848 | Ga0207711_100688484 | 322 |
| 474 | 3300025942 | Ga0207689_10040006 | Ga0207689_100400064 | 322 |
| 475 | 3300025942 | Ga0207689_10069849 | Ga0207689_100698493 | 322 |
| 476 | 3300025942 | Ga0207689_10107589 | Ga0207689_101075892 | 322 |
| 477 | 3300025949 | Ga0207667_10025565 | Ga0207667_100255656 | 322 |
| 478 | 3300025949 | Ga0207667_10119200 | Ga0207667_101192002 | 322 |
| 479 | 3300025949 | Ga0207667_10255530 | Ga0207667_102555302 | 322 |
| 480 | 3300025960 | Ga0207651_10034141 | Ga0207651_100341412 | 322 |
| 481 | 3300025960 | Ga0207651_10043843 | Ga0207651_100438432 | 322 |
| 482 | 3300025972 | Ga0207668_10038900 | Ga0207668_100389004 | 322 |
| 483 | 3300026023 | Ga0207677_10118332 | Ga0207677_101183322 | 322 |
| 484 | 3300026041 | Ga0207639_10057418 | Ga0207639_100574182 | 322 |
| 485 | 3300026067 | Ga0207678_10022039 | Ga0207678_100220394 | 322 |
| 486 | 3300026067 | Ga0207678_10046165 | Ga0207678_100461654 | 322 |
| 487 | 3300026067 | Ga0207678_10056785 | Ga0207678_100567852 | 322 |
| 488 | 3300026067 | Ga0207678_10104735 | Ga0207678_101047352 | 322 |
| 489 | 3300026067 | Ga0207678_10209374 | Ga0207678_102093742 | 322 |
| 490 | 3300026075 | Ga0207708_10062959 | Ga0207708_100629593 | 322 |
| 491 | 3300026078 | Ga0207702_10000044 | Ga0207702_1000004470 | 322 |
| 492 | 3300026078 | Ga0207702_10433628 | Ga0207702_104336281 | 322 |
| 493 | 3300026078 | Ga0207702_10560315 | Ga0207702_105603151 | 322 |
| 494 | 3300026089 | Ga0207648_10089987 | Ga0207648_100899871 | 322 |
| 495 | 3300026089 | Ga0207648_10242579 | Ga0207648_102425792 | 322 |
| 496 | 3300026116 | Ga0207674_10106336 | Ga0207674_101063361 | 322 |
| 497 | 3300026118 | Ga0207675_100025901 | Ga0207675_1000259012 | 322 |
| 498 | 3300026118 | Ga0207675_100159578 | Ga0207675_1001595782 | 322 |
| 499 | 3300026118 | Ga0207675_100180963 | Ga0207675_1001809632 | 322 |
| 500 | 3300026121 | Ga0207683_10019334 | Ga0207683_100193344 | 322 |
| 501 | 3300026121 | Ga0207683_10036657 | Ga0207683_100366574 | 322 |
| 502 | 3300026121 | Ga0207683_10171899 | Ga0207683_101718992 | 322 |
| 503 | 3300026121 | Ga0207683_10331325 | Ga0207683_103313252 | 322 |
| 504 | 3300026142 | Ga0207698_10056652 | Ga0207698_100566522 | 322 |
| 505 | 3300026142 | Ga0207698_10104623 | Ga0207698_101046232 | 322 |
| 506 | 3300026142 | Ga0207698_10138909 | Ga0207698_101389091 | 322 |
| 507 | 3300026142 | Ga0207698_10323106 | Ga0207698_103231062 | 322 |
| 508 | 3300027512 | Ga0209179_1000258 | Ga0209179_10002583 | 322 |
| 509 | 3300028379 | Ga0268266_10006822 | Ga0268266_1000682211 | 322 |
| 510 | 3300028379 | Ga0268266_10010084 | Ga0268266_100100843 | 322 |
| 511 | 3300028379 | Ga0268266_10013882 | Ga0268266_100138826 | 322 |
| 512 | 3300028379 | Ga0268266_10148490 | Ga0268266_101484902 | 322 |
| 513 | 3300028380 | Ga0268265_10053781 | Ga0268265_100537813 | 322 |
| 514 | 3300028380 | Ga0268265_10116848 | Ga0268265_101168482 | 322 |
| 515 | 3300028380 | Ga0268265_10177151 | Ga0268265_101771512 | 322 |
| 516 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020119 | 322 |
| 517 | 3300028381 | Ga0268264_10453210 | Ga0268264_104532101 | 322 |
| 518 | 3300028786 | Ga0307517_10000756 | Ga0307517_1000075614 | 322 |
| 519 | 3300028794 | Ga0307515_10016019 | Ga0307515_1001601911 | 322 |
| 520 | 3300030521 | Ga0307511_10042759 | Ga0307511_100427593 | 322 |
| 521 | 3300031238 | Ga0265332_10053859 | Ga0265332_100538592 | 322 |
| 522 | 3300031241 | Ga0265325_10004341 | Ga0265325_1000434111 | 322 |
| 523 | 3300031247 | Ga0265340_10007679 | Ga0265340_100076794 | 322 |
| 524 | 3300031456 | Ga0307513_10089283 | Ga0307513_100892833 | 322 |
| 525 | 3300031456 | Ga0307513_10381498 | Ga0307513_103814981 | 322 |
| 526 | 3300031616 | Ga0307508_10000058 | Ga0307508_1000005824 | 322 |
| 527 | 3300031616 | Ga0307508_10006654 | Ga0307508_100066542 | 322 |
| 528 | 3300031616 | Ga0307508_10091464 | Ga0307508_100914642 | 322 |
| 529 | 3300031616 | Ga0307508_10183935 | Ga0307508_101839351 | 322 |
| 530 | 3300031616 | Ga0307508_10215817 | Ga0307508_102158172 | 322 |
| 531 | 3300031824 | Ga0307413_10040995 | Ga0307413_100409953 | 322 |
| 532 | 3300031995 | Ga0307409_100081685 | Ga0307409_1000816853 | 322 |
| 533 | 3300032002 | Ga0307416_100391907 | Ga0307416_1003919072 | 322 |
| 534 | 3300032002 | Ga0307416_100692623 | Ga0307416_1006926231 | 322 |
| 535 | 3300032005 | Ga0307411_10085776 | Ga0307411_100857763 | 322 |
| 536 | 3300032005 | Ga0307411_10169493 | Ga0307411_101694932 | 322 |
| 537 | 3300032005 | Ga0307411_10262252 | Ga0307411_102622521 | 322 |
| 538 | 3300032126 | Ga0307415_100118633 | Ga0307415_1001186332 | 322 |
| 539 | 3300033179 | Ga0307507_10070779 | Ga0307507_100707794 | 322 |
| 540 | 3300033180 | Ga0307510_10100937 | Ga0307510_101009372 | 322 |
| 541 | 3300033180 | Ga0307510_10167954 | Ga0307510_101679542 | 322 |
| 542 | 3300033180 | Ga0307510_10208577 | Ga0307510_102085771 | 322 |
| 543 | 3300034957 | Ga0373938_0013787 | Ga0373938_0013787_237_1232 | 322 |
| 544 | 3300035090 | Ga0373949_0016342 | Ga0373949_0016342_243_1238 | 322 |
| 545 | 3300035111 | Ga0373923_0012313 | Ga0373923_0012313_679_1647 | 322 |
| 546 | 3300035113 | Ga0373936_0092138 | Ga0373936_0092138_110_1081 | 322 |
| 547 | 3300035117 | Ga0373953_0004934 | Ga0373953_0004934_1850_2818 | 322 |
| 548 | 3300035118 | Ga0373954_0011591 | Ga0373954_0011591_2452_3420 | 322 |
| 549 | 3300035118 | Ga0373954_0080940 | Ga0373954_0080940_87_1055 | 322 |
| 550 | 3300035119 | Ga0373956_0012819 | Ga0373956_0012819_1349_2317 | 322 |
| 551 | 3300035120 | Ga0373957_0030935 | Ga0373957_0030935_585_1553 | 322 |
| 552 | 3300035171 | Ga0373946_0010026 | Ga0373946_0010026_421_1389 | 322 |
| 553 | 3300035172 | Ga0373955_0033341 | Ga0373955_0033341_846_1814 | 322 |
| 554 | 3300035172 | Ga0373955_0056434 | Ga0373955_0056434_590_1558 | 322 |
| 555 | 3300035691 | Ga0373931_0004803 | Ga0373931_0004803_1745_2740 | 322 |
| 556 | 3300035691 | Ga0373931_0137976 | Ga0373931_0137976_119_1087 | 322 |
| 557 | 3300035692 | Ga0373935_0037652 | Ga0373935_0037652_1873_2841 | 322 |
| 558 | 3300035692 | Ga0373935_0119417 | Ga0373935_0119417_345_1319 | 322 |
| 559 | 3300035692 | Ga0373935_0178692 | Ga0373935_0178692_335_1303 | 322 |
| 560 | 3300035695 | Ga0373927_0007631 | Ga0373927_0007631_3207_4175 | 322 |
| 561 | 3300035695 | Ga0373927_0019240 | Ga0373927_0019240_1480_2454 | 322 |
| 562 | 3300035695 | Ga0373927_0054843 | Ga0373927_0054843_840_1808 | 322 |
| 563 | 3300035695 | Ga0373927_0185136 | Ga0373927_0185136_93_1061 | 322 |
| 564 | 3300035695 | Ga0373927_0192119 | Ga0373927_0192119_306_1274 | 322 |
| 565 | 3300035724 | Ga0373933_0000052 | Ga0373933_0000052_31553_32524 | 322 |
| 566 | 3300035724 | Ga0373933_0060560 | Ga0373933_0060560_880_1848 | 322 |
| 567 | 3300035724 | Ga0373933_0173359 | Ga0373933_0173359_81_1049 | 322 |
| 568 | 3300035725 | Ga0373947_0027914 | Ga0373947_0027914_270_1244 | 322 |
| 569 | 3300035725 | Ga0373947_0040528 | Ga0373947_0040528_170_1138 | 322 |
| 570 | 3300035725 | Ga0373947_0094910 | Ga0373947_0094910_805_1773 | 322 |
| 571 | 3300036401 | Ga0373937_0028837 | Ga0373937_0028837_2512_3480 | 322 |
| 572 | 3300037068 | Ga0373925_0019351 | Ga0373925_0019351_329_1297 | 322 |
| 573 | 3300037068 | Ga0373925_0064426 | Ga0373925_0064426_569_1564 | 322 |
| 574 | 3300037068 | Ga0373925_0097327 | Ga0373925_0097327_1229_2197 | 322 |
| 575 | 3300037466 | Ga0395898_0233964 | Ga0395898_0233964_164_1132 | 322 |
| 576 | 3300039437 | Ga0436365_1898196 | Ga0436365_1898196_2497_3471 | 322 |
| 577 | 3300039453 | Ga0436362_1224309 | Ga0436362_1224309_439_1413 | 322 |
| 578 | 3300046452 | Ga0495617_049086 | Ga0495617_049086_88_1056 | 322 |
| 579 | 3300046452 | Ga0495617_060573 | Ga0495617_060573_39_1007 | 322 |
| 580 | 3300046454 | Ga0495592_0018394 | Ga0495592_0018394_2107_3075 | 322 |
| 581 | 3300046454 | Ga0495592_0178286 | Ga0495592_0178286_441_1409 | 322 |
| 582 | 3300046455 | Ga0495603_0009067 | Ga0495603_0009067_3739_4707 | 322 |
| 583 | 3300046455 | Ga0495603_0192254 | Ga0495603_0192254_17_988 | 322 |
| 584 | 3300046459 | Ga0495629_0019820 | Ga0495629_0019820_3756_4724 | 322 |
| 585 | 3300046459 | Ga0495629_0034435 | Ga0495629_0034435_2460_3428 | 322 |
| 586 | 3300046461 | Ga0495641_0033371 | Ga0495641_0033371_1154_2122 | 322 |
| 587 | 3300046462 | Ga0495651_0133014 | Ga0495651_0133014_776_1744 | 322 |
| 588 | 3300046473 | Ga0495582_0010995 | Ga0495582_0010995_3853_4821 | 322 |
| 589 | 3300046475 | Ga0495639_0000899 | Ga0495639_0000899_10838_11806 | 322 |
| 590 | 3300046475 | Ga0495639_0029116 | Ga0495639_0029116_1402_2370 | 322 |
| 591 | 3300046475 | Ga0495639_0046118 | Ga0495639_0046118_941_1909 | 322 |
| 592 | 3300046476 | Ga0495662_0021541 | Ga0495662_0021541_711_1679 | 322 |
| 593 | 3300046492 | Ga0495585_0177022 | Ga0495585_0177022_13_981 | 322 |
| 594 | 3300046499 | Ga0495594_0095493 | Ga0495594_0095493_650_1618 | 322 |
| 595 | 3300046500 | Ga0495596_0050404 | Ga0495596_0050404_352_1320 | 322 |
| 596 | 3300046506 | Ga0495583_0026495 | Ga0495583_0026495_1883_2851 | 322 |
| 597 | 3300046507 | Ga0495606_0003362 | Ga0495606_0003362_5537_6544 | 322 |
| 598 | 3300046507 | Ga0495606_0065047 | Ga0495606_0065047_708_1676 | 322 |
| 599 | 3300046511 | Ga0495608_0026982 | Ga0495608_0026982_1087_2055 | 322 |
| 600 | 3300046512 | Ga0495610_0098803 | Ga0495610_0098803_226_1194 | 322 |
| 601 | 3300046513 | Ga0495616_0079842 | Ga0495616_0079842_535_1503 | 322 |
| 602 | 3300046514 | Ga0495618_0222618 | Ga0495618_0222618_207_1175 | 322 |
| 603 | 3300046515 | Ga0495620_0007763 | Ga0495620_0007763_129_1097 | 322 |
| 604 | 3300046515 | Ga0495620_0098838 | Ga0495620_0098838_27_995 | 322 |
| 605 | 3300046516 | Ga0495628_0147921 | Ga0495628_0147921_10_978 | 322 |
| 606 | 3300046517 | Ga0495630_0016906 | Ga0495630_0016906_1078_2046 | 322 |
| 607 | 3300046522 | Ga0495643_0024681 | Ga0495643_0024681_159_1127 | 322 |
| 608 | 3300046524 | Ga0495648_0041417 | Ga0495648_0041417_1487_2455 | 322 |
| 609 | 3300046526 | Ga0495666_0019863 | Ga0495666_0019863_933_1901 | 322 |
| 610 | 3300046529 | Ga0495652_0294860 | Ga0495652_0294860_70_1038 | 322 |
| 611 | 3300046531 | Ga0495665_0004419 | Ga0495665_0004419_4993_5961 | 322 |
| 612 | 3300046533 | Ga0495640_0056743 | Ga0495640_0056743_1520_2488 | 322 |
| 613 | 3300046536 | Ga0495587_0034227 | Ga0495587_0034227_1152_2120 | 322 |
| 614 | 3300046543 | Ga0495645_0075490 | Ga0495645_0075490_1328_2296 | 322 |
| 615 | 3300046543 | Ga0495645_0213767 | Ga0495645_0213767_120_1103 | 322 |
| 616 | 3300046557 | Ga0495622_0061532 | Ga0495622_0061532_347_1315 | 322 |
| 617 | 3300046558 | Ga0495633_0040247 | Ga0495633_0040247_1088_2056 | 322 |
| 618 | 3300046559 | Ga0495667_0035666 | Ga0495667_0035666_1897_2865 | 322 |
| 619 | 3300046559 | Ga0495667_0053053 | Ga0495667_0053053_469_1437 | 322 |
| 620 | 3300046615 | Ga0495656_0005677 | Ga0495656_0005677_544_1542 | 322 |
| 621 | 3300046615 | Ga0495656_0009890 | Ga0495656_0009890_106_1074 | 322 |
| 622 | 3300046616 | Ga0495668_0045751 | Ga0495668_0045751_65_1033 | 322 |
| 623 | 3300046642 | Ga0495634_0113135 | Ga0495634_0113135_71_1039 | 322 |
| 624 | 3300046660 | Ga0495625_0091127 | Ga0495625_0091127_531_1499 | 322 |
| 625 | 3300046663 | Ga0495635_0012340 | Ga0495635_0012340_3394_4362 | 322 |
| 626 | 3300046663 | Ga0495635_0014647 | Ga0495635_0014647_458_1426 | 322 |
| 627 | 3300046674 | Ga0495588_0030046 | Ga0495588_0030046_1512_2480 | 322 |
| 628 | 3300046674 | Ga0495588_0100471 | Ga0495588_0100471_78_1046 | 322 |
| 629 | 3300046675 | Ga0495657_0094707 | Ga0495657_0094707_272_1240 | 322 |
| 630 | 3300046678 | Ga0495599_0003308 | Ga0495599_0003308_5889_6857 | 322 |
| 631 | 3300046680 | Ga0495646_0042756 | Ga0495646_0042756_187_1155 | 322 |
| 632 | 3300046681 | Ga0495647_0010288 | Ga0495647_0010288_790_1758 | 322 |
| 633 | 3300046683 | Ga0495658_0026874 | Ga0495658_0026874_209_1177 | 322 |
| 634 | 3300046684 | Ga0495669_0015205 | Ga0495669_0015205_1612_2580 | 322 |
| 635 | 3300046689 | Ga0495613_0050738 | Ga0495613_0050738_1415_2383 | 322 |
| 636 | 3300046690 | Ga0495624_0056286 | Ga0495624_0056286_1405_2373 | 322 |
| 637 | 3300046692 | Ga0495671_0085597 | Ga0495671_0085597_512_1480 | 322 |
| 638 | 3300046694 | Ga0495649_0091476 | Ga0495649_0091476_312_1280 | 322 |
| 639 | 3300046794 | Ga0495589_0032798 | Ga0495589_0032798_28_1080 | 322 |
| 640 | 3300046809 | Ga0495600_0082658 | Ga0495600_0082658_459_1427 | 322 |
| 641 | 3300046810 | Ga0495660_0114938 | Ga0495660_0114938_289_1257 | 322 |
| 642 | 3300047315 | Ga0495581_0013346 | Ga0495581_0013346_2746_3714 | 322 |
| 643 | 3300047317 | Ga0495604_0083239 | Ga0495604_0083239_1152_2120 | 322 |
| 644 | 3300047319 | Ga0495674_0023255 | Ga0495674_0023255_1984_2952 | 322 |
| 645 | 3300047321 | Ga0495676_0020256 | Ga0495676_0020256_729_1697 | 322 |
| 646 | 3300047322 | Ga0495680_0105492 | Ga0495680_0105492_459_1427 | 322 |
| 647 | 3300047323 | Ga0495683_0024079 | Ga0495683_0024079_1804_2772 | 322 |
| 648 | 3300047444 | Ga0495675_0013961 | Ga0495675_0013961_144_1112 | 322 |
| 649 | 3300047469 | Ga0495673_0042647 | Ga0495673_0042647_35_1003 | 322 |
| 650 | 3300047469 | Ga0495673_0096778 | Ga0495673_0096778_12_980 | 322 |
| 651 | 3300047470 | Ga0495681_0049382 | Ga0495681_0049382_867_1835 | 322 |
| 652 | 3300047471 | Ga0495684_0040381 | Ga0495684_0040381_158_1126 | 322 |
| 653 | 3300047471 | Ga0495684_0095293 | Ga0495684_0095293_1237_2205 | 322 |
| 654 | 3300048088 | Ga0495602_0118393 | Ga0495602_0118393_499_1467 | 322 |
| 655 | 3300048903 | Ga0496100_0160931 | Ga0496100_0160931_478_1473 | 322 |
| 656 | 3300048904 | Ga0496101_0004598 | Ga0496101_0004598_569_1537 | 322 |
| 657 | 3300048904 | Ga0496101_0024803 | Ga0496101_0024803_1920_2915 | 322 |
| 658 | 3300048905 | Ga0496102_0013859 | Ga0496102_0013859_2803_3798 | 322 |
| 659 | 3300048905 | Ga0496102_0023166 | Ga0496102_0023166_3989_4957 | 322 |
| 660 | 3300048906 | Ga0496103_0046088 | Ga0496103_0046088_1217_2212 | 322 |
| 661 | 3300048907 | Ga0496104_0024522 | Ga0496104_0024522_4131_5099 | 322 |
| 662 | 3300048907 | Ga0496104_0106969 | Ga0496104_0106969_644_1639 | 322 |
| 663 | 3300048907 | Ga0496104_0435685 | Ga0496104_0435685_32_1000 | 322 |
| 664 | 3300048908 | Ga0496105_0018401 | Ga0496105_0018401_1609_2604 | 322 |
| 665 | 3300048908 | Ga0496105_0021519 | Ga0496105_0021519_1821_2789 | 322 |
| 666 | 3300048908 | Ga0496105_0098245 | Ga0496105_0098245_1300_2268 | 322 |
| 667 | 3300048909 | Ga0496106_0003440 | Ga0496106_0003440_9052_10020 | 322 |
| 668 | 3300048909 | Ga0496106_0019858 | Ga0496106_0019858_2405_3400 | 322 |
| 669 | 3300048909 | Ga0496106_0023485 | Ga0496106_0023485_789_1763 | 322 |
| 670 | 3300048909 | Ga0496106_0055888 | Ga0496106_0055888_281_1249 | 322 |
| 671 | 3300048910 | Ga0496107_0003096 | Ga0496107_0003096_4639_5607 | 322 |
| 672 | 3300048911 | Ga0496108_0013251 | Ga0496108_0013251_3942_4937 | 322 |
| 673 | 3300048911 | Ga0496108_0248749 | Ga0496108_0248749_503_1471 | 322 |
| 674 | 3300048912 | Ga0496109_0013303 | Ga0496109_0013303_5571_6539 | 322 |
| 675 | 3300048912 | Ga0496109_0183415 | Ga0496109_0183415_451_1419 | 322 |
| 676 | 3300048912 | Ga0496109_0216108 | Ga0496109_0216108_127_1095 | 322 |
| 677 | 3300048913 | Ga0496110_0078123 | Ga0496110_0078123_397_1392 | 322 |
| 678 | 3300048913 | Ga0496110_0115432 | Ga0496110_0115432_413_1381 | 322 |
| 679 | 3300048914 | Ga0496111_0079286 | Ga0496111_0079286_1156_2124 | 322 |
| 680 | 3300048914 | Ga0496111_0101390 | Ga0496111_0101390_477_1472 | 322 |
| 681 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_119753_120721 | 322 |
| 682 | 3300048915 | Ga0496112_0027890 | Ga0496112_0027890_4090_5058 | 322 |
| 683 | 3300048915 | Ga0496112_0032724 | Ga0496112_0032724_1811_2779 | 322 |
| 684 | 3300048915 | Ga0496112_0040218 | Ga0496112_0040218_2111_3106 | 322 |
| 685 | 3300048916 | Ga0496113_0003249 | Ga0496113_0003249_5846_6841 | 322 |
| 686 | 3300048916 | Ga0496113_0019464 | Ga0496113_0019464_1225_2193 | 322 |
| 687 | 3300048916 | Ga0496113_0029916 | Ga0496113_0029916_2445_3413 | 322 |
| 688 | 3300048917 | Ga0496114_0007527 | Ga0496114_0007527_6048_7043 | 322 |
| 689 | 3300048918 | Ga0496115_0002391 | Ga0496115_0002391_1759_2727 | 322 |
| 690 | 3300048918 | Ga0496115_0011937 | Ga0496115_0011937_2361_3329 | 322 |
| 691 | 3300048920 | Ga0496117_0008333 | Ga0496117_0008333_1441_2415 | 322 |
| 692 | 3300048921 | Ga0496118_0010695 | Ga0496118_0010695_5023_5997 | 322 |
| 693 | 3300048921 | Ga0496118_0045705 | Ga0496118_0045705_632_1603 | 322 |
| 694 | 3300048922 | Ga0496119_0095615 | Ga0496119_0095615_458_1426 | 322 |
| 695 | 3300048924 | Ga0496121_0003205 | Ga0496121_0003205_15735_16706 | 322 |
| 696 | 3300048924 | Ga0496121_0005199 | Ga0496121_0005199_11650_12621 | 322 |
| 697 | 3300048924 | Ga0496121_0012595 | Ga0496121_0012595_4658_5632 | 322 |
| 698 | 3300048924 | Ga0496121_0012878 | Ga0496121_0012878_5131_6099 | 322 |
| 699 | 3300048924 | Ga0496121_0043868 | Ga0496121_0043868_342_1310 | 322 |
| 700 | 3300048924 | Ga0496121_0098115 | Ga0496121_0098115_675_1643 | 322 |
| 701 | 3300048927 | Ga0496124_0019555 | Ga0496124_0019555_4571_5545 | 322 |
| 702 | 3300048927 | Ga0496124_0065533 | Ga0496124_0065533_879_1847 | 322 |
| 703 | 3300048927 | Ga0496124_0323048 | Ga0496124_0323048_85_1053 | 322 |
| 704 | 3300048928 | Ga0496125_0014654 | Ga0496125_0014654_3236_4210 | 322 |
| 705 | 3300048929 | Ga0496126_0006488 | Ga0496126_0006488_3512_4510 | 322 |
| 706 | 3300048929 | Ga0496126_0040423 | Ga0496126_0040423_2526_3497 | 322 |
| 707 | 3300048929 | Ga0496126_0071150 | Ga0496126_0071150_1430_2398 | 322 |
| 708 | 3300048929 | Ga0496126_0088041 | Ga0496126_0088041_180_1154 | 322 |
| 709 | 3300048929 | Ga0496126_0129446 | Ga0496126_0129446_936_1904 | 322 |
| 710 | 3300048929 | Ga0496126_0212295 | Ga0496126_0212295_618_1586 | 322 |
| 711 | 3300050490 | nmdc:mga03n38_5720_c1 | nmdc:mga03n38_5720_c1_1779_2747 | 322 |
| 712 | 3300050492 | nmdc:mga0yw44_11424_c1 | nmdc:mga0yw44_11424_c1_458_1426 | 322 |
| 713 | 3300050493 | nmdc:mga0k408_125701_c1 | nmdc:mga0k408_125701_c1_41_1093 | 322 |
| 714 | 3300050493 | nmdc:mga0k408_53969_c1 | nmdc:mga0k408_53969_c1_1325_2293 | 322 |
| 715 | 3300050494 | nmdc:mga06z11_53890_c1 | nmdc:mga06z11_53890_c1_189_1157 | 322 |
| 716 | 3300050496 | nmdc:mga07m45_29779_c1 | nmdc:mga07m45_29779_c1_916_1884 | 322 |
| 717 | 3300050507 | nmdc:mga05p37_382644_c1 | nmdc:mga05p37_382644_c1_206_1258 | 322 |
| 718 | 3300050511 | nmdc:mga08y16_37341_c1 | nmdc:mga08y16_37341_c1_4062_5030 | 322 |
| 719 | 3300050512 | nmdc:mga0n895_77512_c1 | nmdc:mga0n895_77512_c1_94_1062 | 322 |
| 720 | 3300050514 | nmdc:mga08x19_119331_c1 | nmdc:mga08x19_119331_c1_66_1034 | 322 |
| 721 | 3300050516 | nmdc:mga0sz30_64522_c1 | nmdc:mga0sz30_64522_c1_262_1230 | 322 |
| 722 | 3300053080 | Ga0500635_0042887 | Ga0500635_0042887_285_1259 | 322 |
| 723 | 3300053085 | Ga0495619_0058357 | Ga0495619_0058357_1231_2199 | 322 |
| 724 | 3300053085 | Ga0495619_0083003 | Ga0495619_0083003_497_1465 | 322 |
| 725 | 3300053092 | Ga0500583_0093959 | Ga0500583_0093959_28_996 | 322 |
| 726 | 3300053093 | Ga0500651_0138016 | Ga0500651_0138016_102_1070 | 322 |
| 727 | 3300053094 | Ga0500566_0000400 | Ga0500566_0000400_21050_22021 | 322 |
| 728 | 3300053094 | Ga0500566_0022004 | Ga0500566_0022004_1158_2126 | 322 |
| 729 | 3300053095 | Ga0500640_023893 | Ga0500640_023893_1350_2321 | 322 |
| 730 | 3300053096 | Ga0500641_0007780 | Ga0500641_0007780_1554_2522 | 322 |
| 731 | 3300053097 | Ga0500648_055052 | Ga0500648_055052_731_1705 | 322 |
| 732 | 3300053102 | Ga0500554_000351 | Ga0500554_000351_4175_5176 | 322 |
| 733 | 3300053102 | Ga0500554_001566 | Ga0500554_001566_2295_3263 | 322 |
| 734 | 3300053111 | Ga0500572_000121 | Ga0500572_000121_21039_22010 | 322 |
| 735 | 3300053119 | Ga0500595_001441 | Ga0500595_001441_10236_11204 | 322 |
| 736 | 3300053119 | Ga0500595_004813 | Ga0500595_004813_3258_4226 | 322 |
| 737 | 3300053119 | Ga0500595_017366 | Ga0500595_017366_75_1046 | 322 |
| 738 | 3300053122 | Ga0500608_061323 | Ga0500608_061323_710_1681 | 322 |
| 739 | 3300053122 | Ga0500608_072823 | Ga0500608_072823_146_1117 | 322 |
| 740 | 3300053123 | Ga0500614_001800 | Ga0500614_001800_1843_2814 | 322 |
| 741 | 3300053130 | Ga0500642_0100199 | Ga0500642_0100199_104_1072 | 322 |
| 742 | 3300053134 | Ga0500658_0020931 | Ga0500658_0020931_451_1419 | 322 |
| 743 | 3300053134 | Ga0500658_0034702 | Ga0500658_0034702_344_1312 | 322 |
| 744 | 3300053136 | Ga0500559_0001424 | Ga0500559_0001424_11644_12615 | 322 |
| 745 | 3300053140 | Ga0500573_0163590 | Ga0500573_0163590_107_1081 | 322 |
| 746 | 3300053150 | Ga0500603_001381 | Ga0500603_001381_120_1091 | 322 |
| 747 | 3300053150 | Ga0500603_033051 | Ga0500603_033051_146_1120 | 322 |
| 748 | 3300053151 | Ga0500604_0027668 | Ga0500604_0027668_410_1378 | 322 |
| 749 | 3300053153 | Ga0500616_0090601 | Ga0500616_0090601_506_1492 | 322 |
| 750 | 3300053155 | Ga0500620_038175 | Ga0500620_038175_554_1522 | 322 |
| 751 | 3300053156 | Ga0500622_0064657 | Ga0500622_0064657_399_1367 | 322 |
| 752 | 3300053159 | Ga0500630_001045 | Ga0500630_001045_9390_10361 | 322 |
| 753 | 3300053162 | Ga0500638_000584 | Ga0500638_000584_2262_3230 | 322 |
| 754 | 3300053162 | Ga0500638_041576 | Ga0500638_041576_1083_2054 | 322 |
| 755 | 3300053163 | Ga0500639_000219 | Ga0500639_000219_6395_7366 | 322 |
| 756 | 3300053163 | Ga0500639_003192 | Ga0500639_003192_724_1695 | 322 |
| 757 | 3300053177 | Ga0500636_0021134 | Ga0500636_0021134_2136_3122 | 322 |
| 758 | 3300053177 | Ga0500636_0034794 | Ga0500636_0034794_331_1377 | 322 |
| 759 | 3300053177 | Ga0500636_0089803 | Ga0500636_0089803_291_1265 | 322 |
| 760 | 3300053178 | Ga0500637_0000129 | Ga0500637_0000129_26237_27238 | 322 |
| 761 | 3300053178 | Ga0500637_0000660 | Ga0500637_0000660_4366_5334 | 322 |
| 762 | 3300053178 | Ga0500637_0164936 | Ga0500637_0164936_89_1063 | 322 |
| 763 | 3300053730 | Ga0500645_019226 | Ga0500645_019226_652_1650 | 322 |
| 764 | 3300053737 | Ga0500601_002028 | Ga0500601_002028_123_1094 | 322 |
| 765 | 3300055283 | Ga0500661_001004 | Ga0500661_001004_1525_2493 | 322 |
| 766 | iso_pu_bacteria | 2889033259 | 2889042277 | 322 |
| 767 | iso_pu_bacteria | 2922386360 | 2922390553 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9687 | 25 | 320 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9655 | 25 | 322 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9561 | 25 | 322 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9561 | 25 | 320 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9545 | 29 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9501 | 25 | 320 | 3.40.190.150 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9294 | 125 | 247 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9286 | 25 | 320 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9282 | 25 | 322 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9229 | 25 | 322 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4CWQ1-F1-model_v4 | LacI family transcriptional regulator | 0.9731 | 25 | 322 |
|
| AF-A0A0Q4YHE9-F1-model_v4 | TctC | 0.9723 | 30 | 322 |
|
| AF-A0A5C7PNF1-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9692 | 19 | 322 |
|
| AF-A0A536ZN56-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9685 | 19 | 322 |
|
| AF-A0A315FRH4-F1-model_v4 | ABC transporter substrate-binding protein | 0.966 | 19 | 322 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar