F479928

General Info

Members Datasets Scaffolds Average Seq Length
767 364 757 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2922386360|2922390553
Length 393
Sequence HLQSWFTSLGAWHRHSEPIGTFKGAHPDRPGDSLSAPSPPWDRLQSRGFGGKLPSRNGGSHKSAADSWGARMGIIHLLIPALALLSSHQALAQAGYPDRPIKMIVPLAAASAVDVAARIVTQKMADNMGQQIVILNQPGASGLIGAEAVARAEPDGYTIGGFNDSIMTMVPNLQSKIRWDILKDFEPVSLVATVEWGLVASNRASFRSAADLIAAAKAAPGKIDYGSGGPGSPQHLAMAMFASAAGISLTHVPYKGATQAATDIAAGQIPVGFQGLGTVATLVRGGQLKLIGVTTEKRLPQFADVPTVSESGLPGFFFNSWFAILAPAGTPKEILARLNSEVQKAVGDPDVRRKLEELGFAVRGSSAEELRAMTRDQLAKYERVIREMEIAKE

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2791355199
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
7 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
8 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
339 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
340 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
343 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
344 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
349 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
350 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
353 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
354 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
355 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
356 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
361 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
364 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0.52
Rhizoplane 5.48
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 6.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000025 3300003203 Bacteria 74627
2 JGI25406J46586_10002937 3300003203 Bacteria 8039
3 rootH1_10005602 3300003323 Bacteria 5836
4 Ga0065715_10126910 3300005293 Bacteria 2098
5 Ga0070658_10026861 3300005327 Bacteria 4622
6 Ga0070683_100001891 3300005329 Bacteria 16357
7 Ga0070683_100018017 3300005329 Bacteria 6245
8 Ga0070683_100128202 3300005329 Bacteria 2400
9 Ga0070690_100196253 3300005330 Bacteria 1402
10 Ga0070670_100105760 3300005331 Bacteria 2425
11 Ga0068869_100006651 3300005334 Bacteria 7341
12 Ga0068869_100074198 3300005334 Bacteria 2524
13 Ga0070666_10212896 3300005335 Bacteria 1361
14 Ga0070680_100014185 3300005336 Bacteria 6224
15 Ga0070680_100034100 3300005336 Bacteria 4105
16 Ga0070680_100227749 3300005336 Bacteria 1574
17 Ga0070682_100175701 3300005337 Bacteria 1492
18 Ga0068868_100013029 3300005338 Bacteria 6087
19 Ga0068868_100024575 3300005338 Bacteria 4573
20 Ga0068868_100051929 3300005338 Bacteria 3227
21 Ga0070660_100082352 3300005339 Bacteria 2527
22 Ga0070660_100085895 3300005339 Bacteria 2475
23 Ga0070660_100225539 3300005339 Bacteria 1524
24 Ga0070689_100160442 3300005340 Bacteria 1817
25 Ga0070687_100109838 3300005343 Bacteria 1559
26 Ga0070661_100141580 3300005344 Bacteria 1813
27 Ga0070661_100171920 3300005344 Bacteria 1645
28 Ga0070668_100040629 3300005347 Bacteria 3559
29 Ga0070668_100066608 3300005347 Bacteria 2795
30 Ga0070668_100094097 3300005347 Bacteria 2365
31 Ga0070671_100112865 3300005355 Bacteria 2283
32 Ga0070674_100276203 3300005356 Bacteria 1330
33 Ga0070673_100181004 3300005364 Bacteria 1804
34 Ga0070673_100183414 3300005364 Bacteria 1793
35 Ga0070688_100124972 3300005365 Bacteria 1728
36 Ga0070659_100031308 3300005366 Bacteria 4119
37 Ga0070659_100242398 3300005366 Bacteria 1492
38 Ga0070667_100224349 3300005367 Bacteria 1673
39 Ga0070667_100431397 3300005367 Bacteria 1202
40 Ga0070709_10005727 3300005434 Bacteria 6738
41 Ga0070709_10013748 3300005434 Bacteria 4558
42 Ga0070709_10099917 3300005434 Bacteria 1931
43 Ga0070714_100045153 3300005435 Bacteria 3733
44 Ga0070714_100105662 3300005435 Bacteria 2487
45 Ga0070714_100477341 3300005435 Bacteria 1187
46 Ga0070713_100006321 3300005436 Bacteria 8206
47 Ga0070713_100040111 3300005436 Bacteria 3805
48 Ga0070713_100342409 3300005436 Bacteria 1386
49 Ga0070710_10003453 3300005437 Bacteria 7486
50 Ga0070710_10005902 3300005437 Bacteria 5849
51 Ga0070711_100154300 3300005439 Bacteria 1734
52 Ga0070663_100000736 3300005455 Bacteria 17673
53 Ga0070663_100038209 3300005455 Bacteria 3347
54 Ga0070663_100054724 3300005455 Bacteria 2853
55 Ga0070663_100096174 3300005455 Bacteria 2202
56 Ga0070678_100001495 3300005456 Bacteria 12487
57 Ga0070678_100160332 3300005456 Bacteria 1822
58 Ga0070678_100264073 3300005456 Bacteria 1449
59 Ga0070681_10038462 3300005458 Bacteria 4797
60 Ga0070681_10069555 3300005458 Bacteria 3486
61 Ga0070681_10085629 3300005458 Bacteria 3104
62 Ga0070685_10046449 3300005466 Bacteria 2493
63 Ga0070707_100088318 3300005468 Bacteria 2999
64 Ga0070698_100205473 3300005471 Bacteria 1905
65 Ga0070699_100177587 3300005518 Bacteria 1889
66 Ga0070679_100025293 3300005530 Bacteria 5824
67 Ga0070679_100174211 3300005530 Bacteria 2124
68 Ga0070684_100032530 3300005535 Bacteria 4445
69 Ga0070684_100037616 3300005535 Bacteria 4153
70 Ga0070684_100099479 3300005535 Bacteria 2596
71 Ga0070684_100108725 3300005535 Bacteria 2484
72 Ga0070684_100168638 3300005535 Bacteria 1988
73 Ga0070684_100246159 3300005535 Bacteria 1634
74 Ga0070697_100020178 3300005536 Bacteria 5269
75 Ga0068853_100045263 3300005539 Bacteria 3768
76 Ga0068853_100103120 3300005539 Bacteria 2525
77 Ga0068853_100151223 3300005539 Bacteria 2090
78 Ga0068853_100239796 3300005539 Bacteria 1661
79 Ga0068853_100315738 3300005539 Bacteria 1448
80 Ga0070672_100236148 3300005543 Bacteria 1537
81 Ga0070693_100115720 3300005547 Bacteria 1656
82 Ga0070693_100135799 3300005547 Bacteria 1543
83 Ga0070665_100007828 3300005548 Bacteria 10840
84 Ga0070665_100029862 3300005548 Bacteria 5486
85 Ga0070665_100030204 3300005548 Bacteria 5454
86 Ga0070665_100074161 3300005548 Bacteria 3408
87 Ga0070665_100091436 3300005548 Bacteria 3048
88 Ga0070665_100165178 3300005548 Bacteria 2216
89 Ga0070665_100431543 3300005548 Bacteria 1327
90 Ga0070704_100086659 3300005549 Bacteria 2322
91 Ga0068855_100001651 3300005563 Bacteria 27931
92 Ga0068855_100008249 3300005563 Bacteria 12592
93 Ga0068855_100067236 3300005563 Bacteria 4176
94 Ga0068855_100136313 3300005563 Bacteria 2800
95 Ga0068855_100178799 3300005563 Bacteria 2399
96 Ga0068855_100690160 3300005563 Bacteria 1093
97 Ga0070664_100009890 3300005564 Bacteria 7731
98 Ga0070664_100081776 3300005564 Bacteria 2784
99 Ga0068857_100119045 3300005577 Bacteria 2377
100 Ga0068854_100129953 3300005578 Bacteria 1922
101 Ga0068856_100000066 3300005614 Bacteria 98376
102 Ga0068856_100071616 3300005614 Bacteria 3432
103 Ga0068856_100080501 3300005614 Bacteria 3230
104 Ga0068856_100156914 3300005614 Bacteria 2286
105 Ga0068856_100268996 3300005614 Bacteria 1720
106 Ga0068852_100002208 3300005616 Bacteria 13359
107 Ga0068852_100003029 3300005616 Bacteria 11683
108 Ga0068852_100003507 3300005616 Bacteria 10967
109 Ga0068852_100028663 3300005616 Bacteria 4562
110 Ga0068852_100037217 3300005616 Bacteria 4078
111 Ga0068852_100048237 3300005616 Bacteria 3638
112 Ga0068859_100062799 3300005617 Bacteria 3745
113 Ga0068864_100197071 3300005618 Bacteria 1848
114 Ga0068861_100090710 3300005719 Bacteria 2411
115 Ga0068851_10018416 3300005834 Bacteria 3362
116 Ga0068863_100017738 3300005841 Bacteria 6813
117 Ga0068863_100248791 3300005841 Bacteria 1717
118 Ga0068863_100442015 3300005841 Bacteria 1275
119 Ga0068858_100012301 3300005842 Bacteria 8071
120 Ga0068858_100024609 3300005842 Bacteria 5610
121 Ga0068858_100186955 3300005842 Bacteria 1957
122 Ga0068858_100224757 3300005842 Bacteria 1779
123 Ga0068858_100260344 3300005842 Bacteria 1649
124 Ga0068860_100000302 3300005843 Bacteria 68581
125 Ga0068860_100331889 3300005843 Bacteria 1494
126 Ga0068862_100062037 3300005844 Bacteria 3214
127 Ga0068862_100074199 3300005844 Bacteria 2940
128 Ga0081455_10001374 3300005937 Bacteria 30050
129 Ga0081455_10006992 3300005937 Bacteria 11989
130 Ga0081455_10011660 3300005937 Bacteria 8816
131 Ga0081455_10012994 3300005937 Bacteria 8255
132 Ga0081455_10033372 3300005937 Bacteria 4626
133 Ga0081540_1000918 3300005983 Bacteria 26491
134 Ga0081540_1002732 3300005983 Bacteria 14358
135 Ga0081540_1002906 3300005983 Bacteria 13809
136 Ga0081540_1005394 3300005983 Bacteria 9555
137 Ga0081540_1013045 3300005983 Bacteria 5426
138 Ga0081540_1040733 3300005983 Bacteria 2417
139 Ga0081540_1078242 3300005983 Bacteria 1500
140 Ga0081539_10000008 3300005985 Bacteria 525071
141 Ga0081539_10000640 3300005985 Bacteria 70720
142 Ga0081539_10011398 3300005985 Bacteria 7032
143 Ga0081539_10040956 3300005985 Bacteria 2714
144 Ga0081539_10041169 3300005985 Bacteria 2704
145 Ga0070717_10008077 3300006028 Bacteria 7847
146 Ga0070717_10036379 3300006028 Bacteria 3993
147 Ga0070717_10363919 3300006028 Bacteria 1295
148 Ga0075365_10019879 3300006038 Bacteria 4154
149 Ga0075365_10048899 3300006038 Bacteria 2785
150 Ga0075365_10087007 3300006038 Bacteria 2124
151 Ga0075365_10101279 3300006038 Bacteria 1972
152 Ga0075365_10148091 3300006038 Bacteria 1632
153 Ga0075363_100024494 3300006048 Bacteria 3068
154 Ga0075363_100046739 3300006048 Bacteria 2297
155 Ga0075364_10208457 3300006051 Bacteria 1325
156 Ga0070716_100021690 3300006173 Bacteria 3387
157 Ga0070716_100046897 3300006173 Bacteria 2434
158 Ga0070716_100234801 3300006173 Bacteria 1240
159 Ga0070712_100013846 3300006175 Bacteria 5162
160 Ga0070712_100020160 3300006175 Bacteria 4360
161 Ga0070712_100036035 3300006175 Bacteria 3363
162 Ga0075362_10051422 3300006177 Bacteria 1844
163 Ga0075366_10025300 3300006195 Bacteria 3466
164 Ga0075366_10107789 3300006195 Bacteria 1675
165 Ga0097621_100007616 3300006237 Bacteria 7759
166 Ga0097621_100009054 3300006237 Bacteria 7213
167 Ga0097621_100068529 3300006237 Bacteria 2927
168 Ga0097621_100210286 3300006237 Bacteria 1692
169 Ga0075370_10007780 3300006353 Bacteria 5476
170 Ga0068871_100021353 3300006358 Bacteria 4975
171 Ga0068871_100031289 3300006358 Bacteria 4196
172 Ga0068871_100146040 3300006358 Bacteria 2014
173 Ga0075428_100215289 3300006844 Bacteria 2075
174 Ga0068865_100227804 3300006881 Bacteria 1460
175 Ga0068865_100333951 3300006881 Bacteria 1223
176 Ga0075436_100000352 3300006914 Bacteria 29413
177 Ga0075436_100001634 3300006914 Bacteria 15321
178 Ga0097620_100062795 3300006931 Bacteria 3745
179 Ga0097620_100175803 3300006931 Bacteria 2222
180 Ga0097620_100374231 3300006931 Bacteria 1520
181 Ga0099794_10009840 3300007265 Bacteria 4040
182 Ga0099794_10029876 3300007265 Bacteria 2541
183 Ga0099795_10059292 3300007788 Bacteria 1416
184 Ga0099795_10089975 3300007788 Bacteria 1188
185 Ga0105245_10002531 3300009098 Bacteria 16481
186 Ga0105245_10034525 3300009098 Bacteria 4487
187 Ga0105245_10120492 3300009098 Bacteria 2450
188 Ga0105245_10162145 3300009098 Bacteria 2122
189 Ga0105245_10520068 3300009098 Bacteria 1208
190 Ga0105247_10006243 3300009101 Bacteria 7391
191 Ga0105247_10028254 3300009101 Bacteria 3393
192 Ga0105243_10043679 3300009148 Bacteria 3513
193 Ga0105243_10127683 3300009148 Bacteria 2153
194 Ga0105241_10008810 3300009174 Bacteria 7413
195 Ga0105241_10013032 3300009174 Bacteria 6096
196 Ga0105241_10030773 3300009174 Bacteria 4015
197 Ga0105241_10214301 3300009174 Bacteria 1615
198 Ga0105241_10469949 3300009174 Bacteria 1116
199 Ga0105242_10004829 3300009176 Bacteria 10435
200 Ga0105242_10006976 3300009176 Bacteria 8718
201 Ga0105242_10026161 3300009176 Bacteria 4624
202 Ga0105242_10093721 3300009176 Bacteria 2532
203 Ga0105248_10007036 3300009177 Bacteria 12323
204 Ga0105248_10010822 3300009177 Bacteria 10073
205 Ga0105248_10017686 3300009177 Bacteria 7862
206 Ga0105248_10031631 3300009177 Bacteria 5911
207 Ga0105248_10093092 3300009177 Bacteria 3394
208 Ga0105248_10175923 3300009177 Bacteria 2412
209 Ga0105237_10002097 3300009545 Bacteria 25173
210 Ga0105237_10007055 3300009545 Bacteria 12357
211 Ga0105237_10025682 3300009545 Bacteria 6022
212 Ga0105237_10052188 3300009545 Bacteria 4106
213 Ga0105237_10091696 3300009545 Bacteria 3028
214 Ga0105237_10170574 3300009545 Bacteria 2176
215 Ga0105238_10007477 3300009551 Bacteria 10947
216 Ga0105238_10020562 3300009551 Bacteria 6721
217 Ga0105238_10038665 3300009551 Bacteria 4844
218 Ga0105238_10078483 3300009551 Bacteria 3292
219 Ga0105238_10092222 3300009551 Bacteria 3017
220 Ga0105238_10200567 3300009551 Bacteria 1970
221 Ga0105249_10553831 3300009553 Bacteria 1201
222 Ga0099796_10001990 3300010159 Bacteria 4350
223 Ga0105239_10018062 3300010375 Bacteria 7802
224 Ga0105246_10002338 3300011119 Bacteria 11450
225 Ga0105246_10036950 3300011119 Bacteria 3275
226 Ga0105246_10045724 3300011119 Bacteria 2983
227 Ga0105246_10130324 3300011119 Bacteria 1877
228 Ga0157370_10038407 3300013104 Bacteria 4631
229 Ga0157369_10009209 3300013105 Bacteria 11297
230 Ga0157369_10054140 3300013105 Bacteria 4333
231 Ga0157374_10005291 3300013296 Bacteria 10834
232 Ga0157374_10012991 3300013296 Bacteria 7259
233 Ga0157374_10028494 3300013296 Bacteria 5046
234 Ga0157374_10073092 3300013296 Bacteria 3237
235 Ga0157378_10031134 3300013297 Bacteria 4712
236 Ga0157378_10068359 3300013297 Bacteria 3186
237 Ga0157378_10230081 3300013297 Bacteria 1766
238 Ga0157378_10313264 3300013297 Bacteria 1522
239 Ga0163162_10081858 3300013306 Bacteria 3299
240 Ga0163162_10097049 3300013306 Bacteria 3036
241 Ga0163162_10114089 3300013306 Bacteria 2801
242 Ga0163162_10670293 3300013306 Bacteria 1160
243 Ga0157372_10000281 3300013307 Bacteria 56476
244 Ga0157372_10324064 3300013307 Bacteria 1794
245 Ga0157372_10406718 3300013307 Bacteria 1586
246 Ga0157372_10462287 3300013307 Bacteria 1479
247 Ga0157375_10007126 3300013308 Bacteria 9768
248 Ga0157375_10025335 3300013308 Bacteria 5509
249 Ga0157375_10100137 3300013308 Bacteria 2978
250 Ga0157375_10193457 3300013308 Bacteria 2189
251 Ga0163163_10003162 3300014325 Bacteria 13951
252 Ga0157380_10455453 3300014326 Bacteria 1230
253 Ga0157379_10022769 3300014968 Bacteria 5552
254 Ga0157379_10147740 3300014968 Bacteria 2120
255 Ga0157379_10280566 3300014968 Bacteria 1516
256 Ga0157376_10007855 3300014969 Bacteria 7651
257 Ga0157376_10025197 3300014969 Bacteria 4682
258 Ga0157376_10211048 3300014969 Bacteria 1792
259 Ga0213876_10000471 3300021384 Bacteria 32066
260 Ga0213876_10033360 3300021384 Bacteria 2715
261 Ga0209758_1004659 3300025297 Bacteria 11219
262 Ga0209758_1004698 3300025297 Bacteria 11156
263 Ga0207656_10016168 3300025321 Bacteria 2901
264 Ga0207692_10003854 3300025898 Bacteria 5890
265 Ga0207692_10005779 3300025898 Bacteria 4979
266 Ga0207692_10265955 3300025898 Bacteria 1033
267 Ga0207710_10006455 3300025900 Bacteria 5006
268 Ga0207688_10005151 3300025901 Bacteria 7105
269 Ga0207688_10232630 3300025901 Bacteria 1113
270 Ga0207647_10061889 3300025904 Bacteria 2282
271 Ga0207699_10007005 3300025906 Bacteria 5491
272 Ga0207699_10010420 3300025906 Bacteria 4664
273 Ga0207699_10016501 3300025906 Bacteria 3865
274 Ga0207699_10160941 3300025906 Bacteria 1494
275 Ga0207645_10084279 3300025907 Bacteria 2040
276 Ga0207643_10022187 3300025908 Bacteria 3493
277 Ga0207705_10012074 3300025909 Bacteria 6240
278 Ga0207705_10142508 3300025909 Bacteria 1791
279 Ga0207705_10196289 3300025909 Bacteria 1528
280 Ga0207705_10247397 3300025909 Bacteria 1359
281 Ga0207684_10097070 3300025910 Bacteria 2515
282 Ga0207684_10250200 3300025910 Bacteria 1529
283 Ga0207654_10003642 3300025911 Bacteria 7768
284 Ga0207654_10095910 3300025911 Bacteria 1818
285 Ga0207654_10096868 3300025911 Bacteria 1810
286 Ga0207654_10166135 3300025911 Bacteria 1429
287 Ga0207707_10006804 3300025912 Bacteria 9975
288 Ga0207707_10008746 3300025912 Bacteria 8788
289 Ga0207707_10123983 3300025912 Bacteria 2259
290 Ga0207707_10211013 3300025912 Bacteria 1691
291 Ga0207695_10035532 3300025913 Bacteria 5402
292 Ga0207695_10051579 3300025913 Bacteria 4317
293 Ga0207695_10329384 3300025913 Bacteria 1416
294 Ga0207671_10016029 3300025914 Bacteria 5840
295 Ga0207671_10040558 3300025914 Bacteria 3447
296 Ga0207671_10089923 3300025914 Bacteria 2311
297 Ga0207671_10103910 3300025914 Bacteria 2155
298 Ga0207671_10192949 3300025914 Bacteria 1589
299 Ga0207693_10003223 3300025915 Bacteria 14005
300 Ga0207693_10012061 3300025915 Bacteria 6988
301 Ga0207693_10090290 3300025915 Bacteria 2402
302 Ga0207693_10243935 3300025915 Bacteria 1410
303 Ga0207660_10013723 3300025917 Bacteria 5315
304 Ga0207660_10039829 3300025917 Bacteria 3287
305 Ga0207660_10198406 3300025917 Bacteria 1566
306 Ga0207662_10097898 3300025918 Bacteria 1814
307 Ga0207662_10111408 3300025918 Bacteria 1707
308 Ga0207657_10002580 3300025919 Bacteria 19599
309 Ga0207657_10106614 3300025919 Bacteria 2318
310 Ga0207649_10169460 3300025920 Bacteria 1520
311 Ga0207649_10340908 3300025920 Bacteria 1107
312 Ga0207652_10034651 3300025921 Bacteria 4255
313 Ga0207652_10047988 3300025921 Bacteria 3649
314 Ga0207652_10058526 3300025921 Bacteria 3321
315 Ga0207652_10148587 3300025921 Bacteria 2098
316 Ga0207646_10053641 3300025922 Bacteria 3606
317 Ga0207694_10014649 3300025924 Bacteria 5912
318 Ga0207694_10069105 3300025924 Bacteria 2759
319 Ga0207694_10131744 3300025924 Bacteria 2004
320 Ga0207650_10076868 3300025925 Bacteria 2523
321 Ga0207687_10074785 3300025927 Bacteria 2429
322 Ga0207687_10105497 3300025927 Bacteria 2082
323 Ga0207687_10195151 3300025927 Bacteria 1578
324 Ga0207687_10255711 3300025927 Bacteria 1394
325 Ga0207700_10002090 3300025928 Bacteria 11393
326 Ga0207700_10073711 3300025928 Bacteria 2637
327 Ga0207700_10392206 3300025928 Bacteria 1215
328 Ga0207664_10047500 3300025929 Bacteria 3373
329 Ga0207644_10097535 3300025931 Bacteria 2202
330 Ga0207644_10402976 3300025931 Bacteria 1118
331 Ga0207690_10142934 3300025932 Bacteria 1765
332 Ga0207690_10191111 3300025932 Bacteria 1548
333 Ga0207706_10038396 3300025933 Bacteria 4248
334 Ga0207706_10423659 3300025933 Bacteria 1153
335 Ga0207686_10021025 3300025934 Bacteria 3738
336 Ga0207686_10023050 3300025934 Bacteria 3591
337 Ga0207686_10276382 3300025934 Bacteria 1238
338 Ga0207709_10072977 3300025935 Bacteria 2185
339 Ga0207670_10036027 3300025936 Bacteria 3214
340 Ga0207704_10039801 3300025938 Bacteria 2741
341 Ga0207704_10077063 3300025938 Bacteria 2139
342 Ga0207665_10033748 3300025939 Bacteria 3394
343 Ga0207691_10020813 3300025940 Bacteria 6199
344 Ga0207691_10106687 3300025940 Bacteria 2494
345 Ga0207691_10170162 3300025940 Bacteria 1908
346 Ga0207711_10068848 3300025941 Bacteria 3066
347 Ga0207711_10136383 3300025941 Bacteria 2204
348 Ga0207689_10040006 3300025942 Bacteria 3881
349 Ga0207689_10069849 3300025942 Bacteria 2886
350 Ga0207689_10107589 3300025942 Bacteria 2291
351 Ga0207661_10001182 3300025944 Bacteria 17455
352 Ga0207667_10025565 3300025949 Bacteria 6461
353 Ga0207667_10119200 3300025949 Bacteria 2720
354 Ga0207667_10153257 3300025949 Bacteria 2371
355 Ga0207667_10255530 3300025949 Bacteria 1792
356 Ga0207651_10034141 3300025960 Bacteria 3291
357 Ga0207651_10043843 3300025960 Bacteria 2989
358 Ga0207651_10107184 3300025960 Bacteria 2088
359 Ga0207651_10163036 3300025960 Bacteria 1750
360 Ga0207668_10038900 3300025972 Bacteria 3196
361 Ga0207668_10320346 3300025972 Bacteria 1286
362 Ga0207640_10124415 3300025981 Bacteria 1854
363 Ga0207677_10019019 3300026023 Bacteria 4137
364 Ga0207677_10118332 3300026023 Bacteria 1987
365 Ga0207703_10015754 3300026035 Bacteria 5897
366 Ga0207639_10057418 3300026041 Bacteria 2988
367 Ga0207678_10022039 3300026067 Bacteria 5581
368 Ga0207678_10046165 3300026067 Bacteria 3767
369 Ga0207678_10056785 3300026067 Bacteria 3369
370 Ga0207678_10104735 3300026067 Bacteria 2414
371 Ga0207678_10209374 3300026067 Bacteria 1668
372 Ga0207708_10062959 3300026075 Bacteria 2834
373 Ga0207708_10142557 3300026075 Bacteria 1881
374 Ga0207702_10000044 3300026078 Bacteria 149419
375 Ga0207702_10011800 3300026078 Bacteria 7275
376 Ga0207702_10038290 3300026078 Bacteria 4016
377 Ga0207702_10433628 3300026078 Bacteria 1272
378 Ga0207702_10560315 3300026078 Bacteria 1118
379 Ga0207648_10025902 3300026089 Bacteria 5218
380 Ga0207648_10089987 3300026089 Bacteria 2682
381 Ga0207648_10242579 3300026089 Bacteria 1605
382 Ga0207674_10106336 3300026116 Bacteria 2784
383 Ga0207674_10441293 3300026116 Bacteria 1258
384 Ga0207675_100025901 3300026118 Bacteria 5457
385 Ga0207675_100035023 3300026118 Bacteria 4682
386 Ga0207675_100159578 3300026118 Bacteria 2150
387 Ga0207675_100180963 3300026118 Bacteria 2018
388 Ga0207683_10019334 3300026121 Bacteria 5816
389 Ga0207683_10036657 3300026121 Bacteria 4271
390 Ga0207683_10171899 3300026121 Bacteria 1963
391 Ga0207683_10212885 3300026121 Bacteria 1759
392 Ga0207683_10285765 3300026121 Bacteria 1508
393 Ga0207683_10331325 3300026121 Bacteria 1395
394 Ga0207683_10505900 3300026121 Bacteria 1116
395 Ga0207698_10001058 3300026142 Bacteria 15993
396 Ga0207698_10014550 3300026142 Bacteria 5235
397 Ga0207698_10056652 3300026142 Bacteria 3028
398 Ga0207698_10104623 3300026142 Bacteria 2356
399 Ga0207698_10138909 3300026142 Bacteria 2090
400 Ga0207698_10323106 3300026142 Bacteria 1446
401 Ga0209179_1000258 3300027512 Bacteria 5054
402 Ga0268266_10006822 3300028379 Bacteria 10399
403 Ga0268266_10010084 3300028379 Bacteria 8284
404 Ga0268266_10013882 3300028379 Bacteria 6935
405 Ga0268266_10148490 3300028379 Bacteria 2110
406 Ga0268266_10214650 3300028379 Bacteria 1766
407 Ga0268265_10053781 3300028380 Bacteria 3051
408 Ga0268265_10086968 3300028380 Bacteria 2485
409 Ga0268265_10116848 3300028380 Bacteria 2189
410 Ga0268265_10177151 3300028380 Bacteria 1828
411 Ga0268264_10000020 3300028381 Bacteria 483593
412 Ga0268264_10113882 3300028381 Bacteria 2373
413 Ga0268264_10453210 3300028381 Bacteria 1243
414 Ga0307517_10000756 3300028786 Bacteria 55661
415 Ga0307515_10016019 3300028794 Bacteria 13759
416 Ga0307511_10042759 3300030521 Bacteria 3799
417 Ga0265332_10053859 3300031238 Bacteria 1726
418 Ga0265325_10004341 3300031241 Bacteria 8981
419 Ga0265340_10007679 3300031247 Bacteria 5848
420 Ga0307513_10089283 3300031456 Bacteria 3147
421 Ga0307513_10381498 3300031456 Bacteria 1149
422 Ga0307408_100172282 3300031548 Bacteria 1729
423 Ga0307508_10000058 3300031616 Bacteria 125293
424 Ga0307508_10006654 3300031616 Bacteria 10852
425 Ga0307508_10091464 3300031616 Bacteria 2631
426 Ga0307508_10183935 3300031616 Bacteria 1692
427 Ga0307508_10215817 3300031616 Bacteria 1518
428 Ga0307413_10040995 3300031824 Bacteria 2707
429 Ga0307409_100081685 3300031995 Bacteria 2613
430 Ga0307416_100391907 3300032002 Bacteria 1423
431 Ga0307416_100692623 3300032002 Bacteria 1107
432 Ga0307411_10085776 3300032005 Bacteria 2182
433 Ga0307411_10169493 3300032005 Bacteria 1645
434 Ga0307411_10262252 3300032005 Bacteria 1365
435 Ga0307415_100118633 3300032126 Bacteria 1979
436 Ga0307507_10070779 3300033179 Bacteria 3160
437 Ga0307510_10100937 3300033180 Bacteria 2676
438 Ga0307510_10167954 3300033180 Bacteria 1778
439 Ga0307510_10208577 3300033180 Bacteria 1479
440 Ga0373938_0013787 3300034957 Bacteria 1540
441 Ga0373949_0016342 3300035090 Bacteria 1663
442 Ga0373923_0012313 3300035111 Bacteria 3159
443 Ga0373923_0052527 3300035111 Bacteria 1712
444 Ga0373936_0009729 3300035113 Bacteria 3627
445 Ga0373936_0045666 3300035113 Bacteria 1765
446 Ga0373936_0092138 3300035113 Bacteria 1272
447 Ga0373945_0004105 3300035116 Bacteria 4617
448 Ga0373953_0004934 3300035117 Bacteria 4294
449 Ga0373954_0011591 3300035118 Bacteria 3909
450 Ga0373954_0080940 3300035118 Bacteria 1552
451 Ga0373956_0009599 3300035119 Bacteria 3941
452 Ga0373956_0012819 3300035119 Bacteria 3481
453 Ga0373957_0030722 3300035120 Bacteria 1970
454 Ga0373957_0030935 3300035120 Bacteria 1964
455 Ga0373946_0008137 3300035171 Bacteria 3849
456 Ga0373946_0010026 3300035171 Bacteria 3503
457 Ga0373955_0008931 3300035172 Bacteria 4675
458 Ga0373955_0033341 3300035172 Bacteria 2712
459 Ga0373955_0056434 3300035172 Bacteria 2154
460 Ga0373924_0011697 3300035410 Bacteria 3264
461 Ga0373931_0004803 3300035691 Bacteria 6202
462 Ga0373931_0137976 3300035691 Bacteria 1410
463 Ga0373935_0032380 3300035692 Bacteria 3249
464 Ga0373935_0037652 3300035692 Bacteria 3027
465 Ga0373935_0119417 3300035692 Bacteria 1759
466 Ga0373935_0178692 3300035692 Bacteria 1456
467 Ga0373927_0007631 3300035695 Bacteria 7321
468 Ga0373927_0019240 3300035695 Bacteria 4478
469 Ga0373927_0054843 3300035695 Bacteria 2578
470 Ga0373927_0185136 3300035695 Bacteria 1366
471 Ga0373927_0192119 3300035695 Bacteria 1339
472 Ga0373933_0000052 3300035724 Bacteria 70592
473 Ga0373933_0060560 3300035724 Bacteria 2282
474 Ga0373933_0173359 3300035724 Bacteria 1373
475 Ga0373947_0027914 3300035725 Bacteria 3306
476 Ga0373947_0029232 3300035725 Bacteria 3233
477 Ga0373947_0040528 3300035725 Bacteria 2774
478 Ga0373947_0094910 3300035725 Bacteria 1866
479 Ga0373937_0028837 3300036401 Bacteria 5025
480 Ga0373937_0035376 3300036401 Bacteria 4546
481 Ga0373925_0019351 3300037068 Bacteria 4952
482 Ga0373925_0039060 3300037068 Bacteria 3511
483 Ga0373925_0064426 3300037068 Bacteria 2759
484 Ga0373925_0097327 3300037068 Bacteria 2257
485 Ga0395900_0029066 3300037418 Bacteria 5670
486 Ga0395898_0109382 3300037466 Bacteria 2650
487 Ga0395898_0233964 3300037466 Bacteria 1752
488 Ga0395905_0176565 3300037471 Bacteria 2005
489 Ga0436364_1523027 3300037853 Bacteria 1939
490 Ga0395901_0015428 3300038443 Bacteria 7780
491 Ga0436365_0667075 3300039437 Bacteria 4544
492 Ga0436365_1356819 3300039437 Bacteria 3467
493 Ga0436365_1566529 3300039437 Bacteria 1932
494 Ga0436365_1838347 3300039437 Bacteria 2030
495 Ga0436365_1898196 3300039437 Bacteria 5297
496 Ga0436362_1224309 3300039453 Bacteria 2330
497 Ga0466966_0058285 3300044684 Bacteria 2441
498 Ga0466964_0018113 3300044706 Bacteria 2701
499 Ga0466971_0019528 3300044719 Bacteria 3011
500 Ga0466968_0027364 3300044735 Bacteria 2347
501 Ga0466957_0045464 3300044842 Bacteria 2663
502 Ga0466959_0009917 3300045049 Bacteria 6790
503 Ga0466959_0127107 3300045049 Bacteria 1809
504 Ga0466958_0115638 3300045836 Bacteria 1676
505 Ga0495617_049086 3300046452 Bacteria 1405
506 Ga0495617_060573 3300046452 Bacteria 1252
507 Ga0495592_0018394 3300046454 Bacteria 5314
508 Ga0495592_0028184 3300046454 Bacteria 4254
509 Ga0495592_0178286 3300046454 Bacteria 1449
510 Ga0495603_0009067 3300046455 Bacteria 6015
511 Ga0495603_0192254 3300046455 Bacteria 1180
512 Ga0495629_0019820 3300046459 Bacteria 4800
513 Ga0495629_0034435 3300046459 Bacteria 3580
514 Ga0495629_0152729 3300046459 Bacteria 1605
515 Ga0495641_0033371 3300046461 Bacteria 2443
516 Ga0495651_0133014 3300046462 Bacteria 1813
517 Ga0495580_0004026 3300046472 Bacteria 12402
518 Ga0495580_0110160 3300046472 Bacteria 1912
519 Ga0495582_0010995 3300046473 Bacteria 4982
520 Ga0495639_0000899 3300046475 Bacteria 13445
521 Ga0495639_0029116 3300046475 Bacteria 2451
522 Ga0495639_0046118 3300046475 Bacteria 1973
523 Ga0495662_0021541 3300046476 Bacteria 3114
524 Ga0495664_0011992 3300046477 Bacteria 4898
525 Ga0495664_0107178 3300046477 Bacteria 1685
526 Ga0495585_0177022 3300046492 Bacteria 1098
527 Ga0495594_0095493 3300046499 Bacteria 1669
528 Ga0495596_0050404 3300046500 Bacteria 1631
529 Ga0495583_0026495 3300046506 Bacteria 2873
530 Ga0495606_0003362 3300046507 Bacteria 17052
531 Ga0495606_0065047 3300046507 Bacteria 2318
532 Ga0495608_0026982 3300046511 Bacteria 3911
533 Ga0495608_0034519 3300046511 Bacteria 3414
534 Ga0495608_0113060 3300046511 Bacteria 1745
535 Ga0495610_0098803 3300046512 Bacteria 1311
536 Ga0495616_0079842 3300046513 Bacteria 1567
537 Ga0495618_0222618 3300046514 Bacteria 1190
538 Ga0495620_0007763 3300046515 Bacteria 5796
539 Ga0495620_0098838 3300046515 Bacteria 1165
540 Ga0495628_0147921 3300046516 Bacteria 1790
541 Ga0495628_0168501 3300046516 Bacteria 1661
542 Ga0495630_0016906 3300046517 Bacteria 5338
543 Ga0495643_0024681 3300046522 Bacteria 3408
544 Ga0495648_0041417 3300046524 Bacteria 2909
545 Ga0495666_0019863 3300046526 Bacteria 3332
546 Ga0495652_0148780 3300046529 Bacteria 1832
547 Ga0495652_0294860 3300046529 Bacteria 1181
548 Ga0495665_0004419 3300046531 Bacteria 7592
549 Ga0495665_0023864 3300046531 Bacteria 3286
550 Ga0495640_0056743 3300046533 Bacteria 2674
551 Ga0495587_0034227 3300046536 Bacteria 3064
552 Ga0495587_0035270 3300046536 Bacteria 3013
553 Ga0495621_0019753 3300046539 Bacteria 2203
554 Ga0495621_0023214 3300046539 Bacteria 2062
555 Ga0495645_0005078 3300046543 Bacteria 9021
556 Ga0495645_0075490 3300046543 Bacteria 2426
557 Ga0495645_0091054 3300046543 Bacteria 2178
558 Ga0495645_0213767 3300046543 Bacteria 1301
559 Ga0495622_0061532 3300046557 Bacteria 1738
560 Ga0495633_0040247 3300046558 Bacteria 2228
561 Ga0495667_0035666 3300046559 Bacteria 3322
562 Ga0495667_0053053 3300046559 Bacteria 2671
563 Ga0495656_0005677 3300046615 Bacteria 4321
564 Ga0495656_0009890 3300046615 Bacteria 3447
565 Ga0495668_0045751 3300046616 Bacteria 2433
566 Ga0495634_0005123 3300046642 Bacteria 10116
567 Ga0495634_0113135 3300046642 Bacteria 1743
568 Ga0495625_0091127 3300046660 Bacteria 2107
569 Ga0495635_0012340 3300046663 Bacteria 5987
570 Ga0495635_0014647 3300046663 Bacteria 5486
571 Ga0495635_0327113 3300046663 Bacteria 1025
572 Ga0495588_0030046 3300046674 Bacteria 2729
573 Ga0495588_0100471 3300046674 Bacteria 1520
574 Ga0495657_0011839 3300046675 Bacteria 6502
575 Ga0495657_0094707 3300046675 Bacteria 1909
576 Ga0495599_0003308 3300046678 Bacteria 9409
577 Ga0495599_0027314 3300046678 Bacteria 3578
578 Ga0495599_0035657 3300046678 Bacteria 3123
579 Ga0495623_0040596 3300046679 Bacteria 2971
580 Ga0495646_0042756 3300046680 Bacteria 2779
581 Ga0495647_0010288 3300046681 Bacteria 3183
582 Ga0495647_0030841 3300046681 Bacteria 1991
583 Ga0495658_0026874 3300046683 Bacteria 3090
584 Ga0495669_0015205 3300046684 Bacteria 3294
585 Ga0495613_0050738 3300046689 Bacteria 3060
586 Ga0495613_0111896 3300046689 Bacteria 1967
587 Ga0495624_0056286 3300046690 Bacteria 2475
588 Ga0495671_0085597 3300046692 Bacteria 1544
589 Ga0495649_0091476 3300046694 Bacteria 1621
590 Ga0495589_0032798 3300046794 Bacteria 2611
591 Ga0495600_0082658 3300046809 Bacteria 2095
592 Ga0495660_0114938 3300046810 Bacteria 1369
593 Ga0495581_0013346 3300047315 Bacteria 4763
594 Ga0495581_0045955 3300047315 Bacteria 2524
595 Ga0495604_0046850 3300047317 Bacteria 3370
596 Ga0495604_0083239 3300047317 Bacteria 2391
597 Ga0495604_0193896 3300047317 Bacteria 1414
598 Ga0495636_0006943 3300047318 Bacteria 4454
599 Ga0495674_0023047 3300047319 Bacteria 5737
600 Ga0495674_0023255 3300047319 Bacteria 5714
601 Ga0495672_0017046 3300047320 Bacteria 4866
602 Ga0495676_0020256 3300047321 Bacteria 5841
603 Ga0495680_0105492 3300047322 Bacteria 2095
604 Ga0495680_0112543 3300047322 Bacteria 2016
605 Ga0495683_0024079 3300047323 Bacteria 3126
606 Ga0495675_0013961 3300047444 Bacteria 5079
607 Ga0495673_0042647 3300047469 Bacteria 2035
608 Ga0495673_0096778 3300047469 Bacteria 1199
609 Ga0495681_0049382 3300047470 Bacteria 1989
610 Ga0495684_0035903 3300047471 Bacteria 3801
611 Ga0495684_0040381 3300047471 Bacteria 3577
612 Ga0495684_0095293 3300047471 Bacteria 2253
613 Ga0495686_0074536 3300047472 Bacteria 2082
614 Ga0495602_0118393 3300048088 Bacteria 2136
615 Ga0496100_0160931 3300048903 Bacteria 1609
616 Ga0496101_0004598 3300048904 Bacteria 8715
617 Ga0496101_0024803 3300048904 Bacteria 4156
618 Ga0496102_0013859 3300048905 Bacteria 6996
619 Ga0496102_0023166 3300048905 Bacteria 5511
620 Ga0496103_0046088 3300048906 Bacteria 2691
621 Ga0496104_0024522 3300048907 Bacteria 5548
622 Ga0496104_0106969 3300048907 Bacteria 2680
623 Ga0496104_0118251 3300048907 Bacteria 2544
624 Ga0496104_0435685 3300048907 Bacteria 1223
625 Ga0496105_0018401 3300048908 Bacteria 5613
626 Ga0496105_0021519 3300048908 Bacteria 5218
627 Ga0496105_0098245 3300048908 Bacteria 2418
628 Ga0496106_0003440 3300048909 Bacteria 11795
629 Ga0496106_0019858 3300048909 Bacteria 4982
630 Ga0496106_0023485 3300048909 Bacteria 4581
631 Ga0496106_0055888 3300048909 Bacteria 2984
632 Ga0496107_0003096 3300048910 Bacteria 11050
633 Ga0496108_0013251 3300048911 Bacteria 6719
634 Ga0496108_0195129 3300048911 Bacteria 1756
635 Ga0496108_0248749 3300048911 Bacteria 1546
636 Ga0496109_0013303 3300048912 Bacteria 7129
637 Ga0496109_0183415 3300048912 Bacteria 1966
638 Ga0496109_0211088 3300048912 Bacteria 1826
639 Ga0496109_0216108 3300048912 Bacteria 1803
640 Ga0496110_0006199 3300048913 Bacteria 9436
641 Ga0496110_0078123 3300048913 Bacteria 2946
642 Ga0496110_0115432 3300048913 Bacteria 2417
643 Ga0496111_0079286 3300048914 Bacteria 2395
644 Ga0496111_0101390 3300048914 Bacteria 2115
645 Ga0496111_0258873 3300048914 Bacteria 1291
646 Ga0496112_0000008 3300048915 Bacteria 310323
647 Ga0496112_0027890 3300048915 Bacteria 5447
648 Ga0496112_0032724 3300048915 Bacteria 5049
649 Ga0496112_0040218 3300048915 Bacteria 4571
650 Ga0496112_0072106 3300048915 Bacteria 3414
651 Ga0496113_0003249 3300048916 Bacteria 9694
652 Ga0496113_0019464 3300048916 Bacteria 4749
653 Ga0496113_0029916 3300048916 Bacteria 3938
654 Ga0496114_0007527 3300048917 Bacteria 8611
655 Ga0496115_0002391 3300048918 Bacteria 13453
656 Ga0496115_0011937 3300048918 Bacteria 6524
657 Ga0496117_0008333 3300048920 Bacteria 9863
658 Ga0496118_0010695 3300048921 Bacteria 9047
659 Ga0496118_0045705 3300048921 Bacteria 3414
660 Ga0496119_0095615 3300048922 Bacteria 1678
661 Ga0496121_0003205 3300048924 Bacteria 23550
662 Ga0496121_0005199 3300048924 Bacteria 16866
663 Ga0496121_0012595 3300048924 Bacteria 9193
664 Ga0496121_0012878 3300048924 Bacteria 9048
665 Ga0496121_0039309 3300048924 Bacteria 4172
666 Ga0496121_0043868 3300048924 Bacteria 3866
667 Ga0496121_0098115 3300048924 Bacteria 2268
668 Ga0496124_0019555 3300048927 Bacteria 6295
669 Ga0496124_0065533 3300048927 Bacteria 3028
670 Ga0496124_0323048 3300048927 Bacteria 1104
671 Ga0496125_0014654 3300048928 Bacteria 7621
672 Ga0496126_0006488 3300048929 Bacteria 13022
673 Ga0496126_0040423 3300048929 Bacteria 4323
674 Ga0496126_0071150 3300048929 Bacteria 3097
675 Ga0496126_0088041 3300048929 Bacteria 2736
676 Ga0496126_0129446 3300048929 Bacteria 2182
677 Ga0496126_0212295 3300048929 Bacteria 1629
678 Ga0501032_0108848 3300049569 Bacteria 1835
679 Ga0501039_0355387 3300049575 Bacteria 1151
680 Ga0501047_0190673 3300049581 Bacteria 1913
681 Ga0501072_0229277 3300049588 Bacteria 1480
682 Ga0501072_0297471 3300049588 Bacteria 1283
683 Ga0501073_0133837 3300049589 Bacteria 1718
684 Ga0501079_0413797 3300049741 Bacteria 1058
685 Ga0501080_0000669 3300049742 Bacteria 27250
686 Ga0501044_0019256 3300049823 Bacteria 7306
687 Ga0501045_0211306 3300049824 Bacteria 1445
688 nmdc:mga03683_27171_c1 3300050489 Bacteria 2263
689 nmdc:mga03n38_5720_c1 3300050490 Bacteria 4260
690 nmdc:mga0yw44_11424_c1 3300050492 Bacteria 4584
691 nmdc:mga0k408_125701_c1 3300050493 Bacteria 1521
692 nmdc:mga0k408_24642_c1 3300050493 Bacteria 3402
693 nmdc:mga0k408_53969_c1 3300050493 Bacteria 2330
694 nmdc:mga06z11_53890_c1 3300050494 Bacteria 2071
695 nmdc:mga07m45_29779_c1 3300050496 Bacteria 3022
696 nmdc:mga05p37_153577_c1 3300050507 Bacteria 2814
697 nmdc:mga05p37_382644_c1 3300050507 Bacteria 1648
698 nmdc:mga0qj67_400028_c1 3300050509 Bacteria 1108
699 nmdc:mga08y16_37341_c1 3300050511 Bacteria 5102
700 nmdc:mga0n895_29119_c1 3300050512 Bacteria 5261
701 nmdc:mga0n895_77512_c1 3300050512 Bacteria 3306
702 nmdc:mga08x19_119331_c1 3300050514 Bacteria 1766
703 nmdc:mga08x19_12116_c1 3300050514 Bacteria 5189
704 nmdc:mga08x19_32084_c1 3300050514 Bacteria 3309
705 nmdc:mga0sz30_118752_c1 3300050516 Bacteria 1161
706 nmdc:mga0sz30_64522_c1 3300050516 Bacteria 1569
707 Ga0495601_0007759 3300053077 Bacteria 6309
708 Ga0495601_0016859 3300053077 Bacteria 4431
709 Ga0500635_0042887 3300053080 Bacteria 1519
710 Ga0495619_0058357 3300053085 Bacteria 2562
711 Ga0495619_0083003 3300053085 Bacteria 2160
712 Ga0500583_0093959 3300053092 Bacteria 1462
713 Ga0500651_0138016 3300053093 Bacteria 1471
714 Ga0500566_0000400 3300053094 Bacteria 24130
715 Ga0500566_0022004 3300053094 Bacteria 3747
716 Ga0500640_023893 3300053095 Bacteria 2651
717 Ga0500641_0007780 3300053096 Bacteria 3819
718 Ga0500648_055052 3300053097 Bacteria 2256
719 Ga0500554_000351 3300053102 Bacteria 9898
720 Ga0500554_001566 3300053102 Bacteria 4412
721 Ga0500572_000121 3300053111 Bacteria 26132
722 Ga0500595_001441 3300053119 Bacteria 12702
723 Ga0500595_004813 3300053119 Bacteria 5976
724 Ga0500595_014526 3300053119 Bacteria 2984
725 Ga0500595_017366 3300053119 Bacteria 2658
726 Ga0500608_061323 3300053122 Bacteria 1797
727 Ga0500608_072823 3300053122 Bacteria 1632
728 Ga0500614_001800 3300053123 Bacteria 4968
729 Ga0500642_0100199 3300053130 Bacteria 1346
730 Ga0500658_0020931 3300053134 Bacteria 2473
731 Ga0500658_0034702 3300053134 Bacteria 1993
732 Ga0500559_0001424 3300053136 Bacteria 13570
733 Ga0500568_0017873 3300053139 Bacteria 3119
734 Ga0500573_0163590 3300053140 Bacteria 1209
735 Ga0500603_001381 3300053150 Bacteria 5534
736 Ga0500603_033051 3300053150 Bacteria 1345
737 Ga0500604_0027668 3300053151 Bacteria 1642
738 Ga0500616_0090601 3300053153 Bacteria 1515
739 Ga0500620_038175 3300053155 Bacteria 1562
740 Ga0500622_0064657 3300053156 Bacteria 1860
741 Ga0500630_001045 3300053159 Bacteria 12946
742 Ga0500638_000584 3300053162 Bacteria 9342
743 Ga0500638_041576 3300053162 Bacteria 2232
744 Ga0500639_000219 3300053163 Bacteria 28391
745 Ga0500639_003192 3300053163 Bacteria 8278
746 Ga0500636_0021134 3300053177 Bacteria 3854
747 Ga0500636_0034794 3300053177 Bacteria 2982
748 Ga0500636_0089803 3300053177 Bacteria 1761
749 Ga0500637_0000129 3300053178 Bacteria 27540
750 Ga0500637_0000660 3300053178 Bacteria 13684
751 Ga0500637_0164936 3300053178 Bacteria 1275
752 Ga0500645_019226 3300053730 Bacteria 2126
753 Ga0500645_043542 3300053730 Unclassified 1322
754 Ga0500601_002028 3300053737 Bacteria 2175
755 Ga0500661_001004 3300055283 Bacteria 5301
756 Ga0501082_0130762 3300060353 Bacteria 2178
757 Ga0466962_0036646 3300061719 Bacteria 2348

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0413797 Ga0501079_0413797_165_1040 281
2 3300049575 Ga0501039_0355387 Ga0501039_0355387_289_1137 282
3 3300047318 Ga0495636_0006943 Ga0495636_0006943_1331_2293 283
4 3300049588 Ga0501072_0229277 Ga0501072_0229277_292_1287 306
5 3300050509 nmdc:mga0qj67_400028_c1 nmdc:mga0qj67_400028_c1_74_1054 307
6 3300060353 Ga0501082_0130762 Ga0501082_0130762_1090_2070 308
7 3300049588 Ga0501072_0297471 Ga0501072_0297471_173_1153 309
8 3300049824 Ga0501045_0211306 Ga0501045_0211306_310_1290 309
9 3300006038 Ga0075365_10019879 Ga0075365_100198794 310
10 3300050507 nmdc:mga05p37_153577_c1 nmdc:mga05p37_153577_c1_1716_2669 310
11 3300050489 nmdc:mga03683_27171_c1 nmdc:mga03683_27171_c1_948_1907 312
12 3300005548 Ga0070665_100074161 Ga0070665_1000741614 314
13 3300006195 Ga0075366_10107789 Ga0075366_101077892 314
14 3300014326 Ga0157380_10455453 Ga0157380_104554532 314
15 3300044706 Ga0466964_0018113 Ga0466964_0018113_893_1855 314
16 3300050493 nmdc:mga0k408_24642_c1 nmdc:mga0k408_24642_c1_1999_2955 314
17 3300050516 nmdc:mga0sz30_118752_c1 nmdc:mga0sz30_118752_c1_162_1118 314
18 iso_pu_bacteria 2939631187 2939633551 315
19 3300005338 Ga0068868_100051929 Ga0068868_1000519292 316
20 3300005339 Ga0070660_100225539 Ga0070660_1002255391 316
21 3300005343 Ga0070687_100109838 Ga0070687_1001098382 316
22 3300005456 Ga0070678_100160332 Ga0070678_1001603321 316
23 3300005547 Ga0070693_100115720 Ga0070693_1001157202 316
24 3300005549 Ga0070704_100086659 Ga0070704_1000866592 316
25 3300005616 Ga0068852_100002208 Ga0068852_1000022081 316
26 3300005617 Ga0068859_100062799 Ga0068859_1000627992 316
27 3300005834 Ga0068851_10018416 Ga0068851_100184165 316
28 3300006237 Ga0097621_100007616 Ga0097621_1000076162 316
29 3300006931 Ga0097620_100062795 Ga0097620_1000627952 316
30 3300009174 Ga0105241_10214301 Ga0105241_102143012 316
31 3300013296 Ga0157374_10073092 Ga0157374_100730922 316
32 3300025321 Ga0207656_10016168 Ga0207656_100161685 316
33 3300025909 Ga0207705_10247397 Ga0207705_102473972 316
34 3300025911 Ga0207654_10166135 Ga0207654_101661352 316
35 3300025940 Ga0207691_10170162 Ga0207691_101701622 316
36 3300026023 Ga0207677_10019019 Ga0207677_100190192 316
37 3300026075 Ga0207708_10142557 Ga0207708_101425572 316
38 3300026089 Ga0207648_10025902 Ga0207648_100259022 316
39 3300026121 Ga0207683_10285765 Ga0207683_102857652 316
40 3300026142 Ga0207698_10001058 Ga0207698_1000105818 316
41 3300048907 Ga0496104_0118251 Ga0496104_0118251_1497_2453 316
42 3300048913 Ga0496110_0006199 Ga0496110_0006199_832_1788 316
43 iso_pu_bacteria 2939631187 2939635615 316
44 3300005366 Ga0070659_100031308 Ga0070659_1000313084 317
45 3300005563 Ga0068855_100136313 Ga0068855_1001363132 317
46 3300005616 Ga0068852_100003507 Ga0068852_1000035078 317
47 3300005842 Ga0068858_100012301 Ga0068858_1000123016 317
48 3300005937 Ga0081455_10001374 Ga0081455_100013747 317
49 3300005985 Ga0081539_10040956 Ga0081539_100409562 317
50 3300009098 Ga0105245_10520068 Ga0105245_105200682 317
51 3300009148 Ga0105243_10127683 Ga0105243_101276832 317
52 3300009176 Ga0105242_10004829 Ga0105242_100048299 317
53 3300009177 Ga0105248_10031631 Ga0105248_100316314 317
54 3300013105 Ga0157369_10054140 Ga0157369_100541403 317
55 3300013307 Ga0157372_10000281 Ga0157372_1000028132 317
56 3300025909 Ga0207705_10012074 Ga0207705_100120741 317
57 3300025918 Ga0207662_10097898 Ga0207662_100978982 317
58 3300025918 Ga0207662_10111408 Ga0207662_101114082 317
59 3300025927 Ga0207687_10255711 Ga0207687_102557112 317
60 3300025932 Ga0207690_10142934 Ga0207690_101429341 317
61 3300025934 Ga0207686_10021025 Ga0207686_100210253 317
62 3300025935 Ga0207709_10072977 Ga0207709_100729771 317
63 3300026035 Ga0207703_10015754 Ga0207703_100157545 317
64 3300026121 Ga0207683_10505900 Ga0207683_105059001 317
65 3300026142 Ga0207698_10014550 Ga0207698_100145503 317
66 3300039437 Ga0436365_0667075 Ga0436365_0667075_2626_3591 317
67 3300046539 Ga0495621_0019753 Ga0495621_0019753_898_1857 317
68 3300046539 Ga0495621_0023214 Ga0495621_0023214_693_1652 317
69 3300005841 Ga0068863_100442015 Ga0068863_1004420151 318
70 3300025910 Ga0207684_10250200 Ga0207684_102502002 318
71 3300046472 Ga0495580_0110160 Ga0495580_0110160_204_1175 318
72 3300047317 Ga0495604_0046850 Ga0495604_0046850_686_1654 318
73 iso_pu_bacteria 2513237141 2513888421 318
74 iso_pu_bacteria 2791355199 2793081321 318
75 iso_pu_bacteria 2874604998 2874611478 318
76 iso_pu_bacteria 2876808645 2876817056 318
77 iso_pu_bacteria 2879110137 2879117559 318
78 iso_pu_bacteria 8006984368 8006985445 318
79 3300005364 Ga0070673_100183414 Ga0070673_1001834142 319
80 3300005367 Ga0070667_100431397 Ga0070667_1004313971 319
81 3300005436 Ga0070713_100040111 Ga0070713_1000401112 319
82 3300005466 Ga0070685_10046449 Ga0070685_100464492 319
83 3300006028 Ga0070717_10363919 Ga0070717_103639192 319
84 3300006177 Ga0075362_10051422 Ga0075362_100514222 319
85 3300006237 Ga0097621_100009054 Ga0097621_1000090543 319
86 3300006237 Ga0097621_100068529 Ga0097621_1000685292 319
87 3300006358 Ga0068871_100021353 Ga0068871_1000213533 319
88 3300006881 Ga0068865_100333951 Ga0068865_1003339511 319
89 3300006914 Ga0075436_100001634 Ga0075436_1000016344 319
90 3300006931 Ga0097620_100374231 Ga0097620_1003742312 319
91 3300009176 Ga0105242_10006976 Ga0105242_100069763 319
92 3300009177 Ga0105248_10017686 Ga0105248_100176864 319
93 3300009177 Ga0105248_10175923 Ga0105248_101759232 319
94 3300013296 Ga0157374_10028494 Ga0157374_100284944 319
95 3300013306 Ga0163162_10081858 Ga0163162_100818582 319
96 3300013308 Ga0157375_10025335 Ga0157375_100253353 319
97 3300025898 Ga0207692_10265955 Ga0207692_102659551 319
98 3300025915 Ga0207693_10012061 Ga0207693_100120614 319
99 3300025927 Ga0207687_10195151 Ga0207687_101951511 319
100 3300025936 Ga0207670_10036027 Ga0207670_100360274 319
101 3300025940 Ga0207691_10020813 Ga0207691_100208136 319
102 3300025941 Ga0207711_10136383 Ga0207711_101363832 319
103 3300025960 Ga0207651_10107184 Ga0207651_101071842 319
104 3300031548 Ga0307408_100172282 Ga0307408_1001722821 319
105 3300035113 Ga0373936_0045666 Ga0373936_0045666_594_1556 319
106 3300035120 Ga0373957_0030722 Ga0373957_0030722_475_1437 319
107 3300035410 Ga0373924_0011697 Ga0373924_0011697_527_1489 319
108 3300036401 Ga0373937_0035376 Ga0373937_0035376_2582_3544 319
109 3300039437 Ga0436365_1566529 Ga0436365_1566529_937_1899 319
110 3300039437 Ga0436365_1838347 Ga0436365_1838347_554_1519 319
111 3300046454 Ga0495592_0028184 Ga0495592_0028184_1565_2527 319
112 3300046459 Ga0495629_0152729 Ga0495629_0152729_473_1435 319
113 3300046511 Ga0495608_0034519 Ga0495608_0034519_502_1464 319
114 3300046516 Ga0495628_0168501 Ga0495628_0168501_85_1047 319
115 3300046529 Ga0495652_0148780 Ga0495652_0148780_135_1097 319
116 3300046536 Ga0495587_0035270 Ga0495587_0035270_1180_2142 319
117 3300046543 Ga0495645_0005078 Ga0495645_0005078_3441_4403 319
118 3300046675 Ga0495657_0011839 Ga0495657_0011839_4652_5614 319
119 3300046678 Ga0495599_0035657 Ga0495599_0035657_1347_2309 319
120 3300046679 Ga0495623_0040596 Ga0495623_0040596_1008_1970 319
121 3300047317 Ga0495604_0193896 Ga0495604_0193896_240_1202 319
122 3300047322 Ga0495680_0112543 Ga0495680_0112543_172_1134 319
123 3300050514 nmdc:mga08x19_12116_c1 nmdc:mga08x19_12116_c1_2581_3552 319
124 3300053077 Ga0495601_0007759 Ga0495601_0007759_722_1684 319
125 3300003323 rootH1_10005602 rootH1_100056023 320
126 3300005329 Ga0070683_100001891 Ga0070683_10000189110 320
127 3300005336 Ga0070680_100014185 Ga0070680_1000141852 320
128 3300005336 Ga0070680_100227749 Ga0070680_1002277492 320
129 3300005434 Ga0070709_10005727 Ga0070709_100057273 320
130 3300005434 Ga0070709_10013748 Ga0070709_100137482 320
131 3300005435 Ga0070714_100105662 Ga0070714_1001056622 320
132 3300005437 Ga0070710_10003453 Ga0070710_100034535 320
133 3300005439 Ga0070711_100154300 Ga0070711_1001543001 320
134 3300005456 Ga0070678_100264073 Ga0070678_1002640732 320
135 3300005458 Ga0070681_10038462 Ga0070681_100384622 320
136 3300005458 Ga0070681_10085629 Ga0070681_100856292 320
137 3300005530 Ga0070679_100025293 Ga0070679_1000252936 320
138 3300005530 Ga0070679_100174211 Ga0070679_1001742112 320
139 3300005535 Ga0070684_100032530 Ga0070684_1000325302 320
140 3300005535 Ga0070684_100037616 Ga0070684_1000376163 320
141 3300005535 Ga0070684_100168638 Ga0070684_1001686381 320
142 3300005535 Ga0070684_100246159 Ga0070684_1002461591 320
143 3300005539 Ga0068853_100103120 Ga0068853_1001031202 320
144 3300005547 Ga0070693_100135799 Ga0070693_1001357992 320
145 3300005548 Ga0070665_100165178 Ga0070665_1001651782 320
146 3300005563 Ga0068855_100178799 Ga0068855_1001787992 320
147 3300005577 Ga0068857_100119045 Ga0068857_1001190451 320
148 3300005614 Ga0068856_100156914 Ga0068856_1001569142 320
149 3300005614 Ga0068856_100268996 Ga0068856_1002689962 320
150 3300005842 Ga0068858_100186955 Ga0068858_1001869552 320
151 3300006028 Ga0070717_10036379 Ga0070717_100363793 320
152 3300006175 Ga0070712_100020160 Ga0070712_1000201604 320
153 3300006175 Ga0070712_100036035 Ga0070712_1000360351 320
154 3300006237 Ga0097621_100210286 Ga0097621_1002102862 320
155 3300006914 Ga0075436_100000352 Ga0075436_1000003522 320
156 3300007788 Ga0099795_10089975 Ga0099795_100899751 320
157 3300009174 Ga0105241_10030773 Ga0105241_100307732 320
158 3300009545 Ga0105237_10091696 Ga0105237_100916964 320
159 3300009551 Ga0105238_10038665 Ga0105238_100386654 320
160 3300009551 Ga0105238_10078483 Ga0105238_100784833 320
161 3300009553 Ga0105249_10553831 Ga0105249_105538311 320
162 3300013296 Ga0157374_10012991 Ga0157374_100129917 320
163 3300013297 Ga0157378_10230081 Ga0157378_102300812 320
164 3300013307 Ga0157372_10406718 Ga0157372_104067182 320
165 3300013307 Ga0157372_10462287 Ga0157372_104622871 320
166 3300014969 Ga0157376_10211048 Ga0157376_102110482 320
167 3300021384 Ga0213876_10033360 Ga0213876_100333603 320
168 3300025898 Ga0207692_10005779 Ga0207692_100057795 320
169 3300025904 Ga0207647_10061889 Ga0207647_100618892 320
170 3300025906 Ga0207699_10007005 Ga0207699_100070052 320
171 3300025906 Ga0207699_10010420 Ga0207699_100104205 320
172 3300025911 Ga0207654_10095910 Ga0207654_100959101 320
173 3300025912 Ga0207707_10006804 Ga0207707_100068041 320
174 3300025912 Ga0207707_10211013 Ga0207707_102110131 320
175 3300025913 Ga0207695_10329384 Ga0207695_103293841 320
176 3300025914 Ga0207671_10089923 Ga0207671_100899232 320
177 3300025915 Ga0207693_10243935 Ga0207693_102439351 320
178 3300025917 Ga0207660_10013723 Ga0207660_100137231 320
179 3300025921 Ga0207652_10034651 Ga0207652_100346512 320
180 3300025921 Ga0207652_10058526 Ga0207652_100585262 320
181 3300025921 Ga0207652_10148587 Ga0207652_101485872 320
182 3300025924 Ga0207694_10069105 Ga0207694_100691054 320
183 3300025939 Ga0207665_10033748 Ga0207665_100337484 320
184 3300025944 Ga0207661_10001182 Ga0207661_100011829 320
185 3300025960 Ga0207651_10163036 Ga0207651_101630362 320
186 3300025981 Ga0207640_10124415 Ga0207640_101244152 320
187 3300026078 Ga0207702_10038290 Ga0207702_100382904 320
188 3300026116 Ga0207674_10441293 Ga0207674_104412931 320
189 3300026121 Ga0207683_10212885 Ga0207683_102128853 320
190 3300028379 Ga0268266_10214650 Ga0268266_102146502 320
191 3300035111 Ga0373923_0052527 Ga0373923_0052527_736_1701 320
192 3300035113 Ga0373936_0009729 Ga0373936_0009729_1071_2036 320
193 3300035116 Ga0373945_0004105 Ga0373945_0004105_1922_2887 320
194 3300035119 Ga0373956_0009599 Ga0373956_0009599_2754_3719 320
195 3300035171 Ga0373946_0008137 Ga0373946_0008137_2662_3627 320
196 3300035172 Ga0373955_0008931 Ga0373955_0008931_256_1221 320
197 3300035692 Ga0373935_0032380 Ga0373935_0032380_1461_2426 320
198 3300035725 Ga0373947_0029232 Ga0373947_0029232_1218_2183 320
199 3300037068 Ga0373925_0039060 Ga0373925_0039060_2330_3295 320
200 3300037466 Ga0395898_0109382 Ga0395898_0109382_348_1313 320
201 3300037853 Ga0436364_1523027 Ga0436364_1523027_854_1819 320
202 3300039437 Ga0436365_1356819 Ga0436365_1356819_1826_2791 320
203 3300044719 Ga0466971_0019528 Ga0466971_0019528_1450_2427 320
204 3300044735 Ga0466968_0027364 Ga0466968_0027364_1080_2057 320
205 3300045049 Ga0466959_0009917 Ga0466959_0009917_4982_5959 320
206 3300046472 Ga0495580_0004026 Ga0495580_0004026_11374_12339 320
207 3300046477 Ga0495664_0011992 Ga0495664_0011992_3817_4782 320
208 3300046477 Ga0495664_0107178 Ga0495664_0107178_629_1594 320
209 3300046511 Ga0495608_0113060 Ga0495608_0113060_756_1721 320
210 3300046531 Ga0495665_0023864 Ga0495665_0023864_2184_3149 320
211 3300046543 Ga0495645_0091054 Ga0495645_0091054_206_1171 320
212 3300046642 Ga0495634_0005123 Ga0495634_0005123_743_1708 320
213 3300046663 Ga0495635_0327113 Ga0495635_0327113_21_986 320
214 3300046678 Ga0495599_0027314 Ga0495599_0027314_934_1899 320
215 3300046681 Ga0495647_0030841 Ga0495647_0030841_456_1421 320
216 3300046689 Ga0495613_0111896 Ga0495613_0111896_853_1818 320
217 3300047315 Ga0495581_0045955 Ga0495581_0045955_318_1283 320
218 3300047319 Ga0495674_0023047 Ga0495674_0023047_856_1821 320
219 3300047471 Ga0495684_0035903 Ga0495684_0035903_2230_3195 320
220 3300048914 Ga0496111_0258873 Ga0496111_0258873_30_995 320
221 3300048915 Ga0496112_0072106 Ga0496112_0072106_1736_2701 320
222 3300048924 Ga0496121_0039309 Ga0496121_0039309_580_1545 320
223 3300049569 Ga0501032_0108848 Ga0501032_0108848_318_1283 320
224 3300049581 Ga0501047_0190673 Ga0501047_0190673_221_1186 320
225 3300049589 Ga0501073_0133837 Ga0501073_0133837_678_1643 320
226 3300049742 Ga0501080_0000669 Ga0501080_0000669_16857_17822 320
227 3300049823 Ga0501044_0019256 Ga0501044_0019256_3200_4165 320
228 3300050512 nmdc:mga0n895_29119_c1 nmdc:mga0n895_29119_c1_3595_4566 320
229 3300050514 nmdc:mga08x19_32084_c1 nmdc:mga08x19_32084_c1_1063_2034 320
230 3300053077 Ga0495601_0016859 Ga0495601_0016859_1385_2350 320
231 3300053730 Ga0500645_043542 Ga0500645_043542_22_1011 320
232 3300061719 Ga0466962_0036646 Ga0466962_0036646_863_1840 320
233 3300005329 Ga0070683_100128202 Ga0070683_1001282022 321
234 3300005339 Ga0070660_100085895 Ga0070660_1000858952 321
235 3300005347 Ga0070668_100040629 Ga0070668_1000406294 321
236 3300005436 Ga0070713_100342409 Ga0070713_1003424092 321
237 3300005535 Ga0070684_100108725 Ga0070684_1001087252 321
238 3300005543 Ga0070672_100236148 Ga0070672_1002361482 321
239 3300005563 Ga0068855_100001651 Ga0068855_10000165114 321
240 3300005563 Ga0068855_100008249 Ga0068855_1000082492 321
241 3300005614 Ga0068856_100071616 Ga0068856_1000716164 321
242 3300005937 Ga0081455_10012994 Ga0081455_100129946 321
243 3300009174 Ga0105241_10008810 Ga0105241_100088106 321
244 3300009551 Ga0105238_10020562 Ga0105238_100205623 321
245 3300013307 Ga0157372_10324064 Ga0157372_103240642 321
246 3300025911 Ga0207654_10096868 Ga0207654_100968682 321
247 3300025913 Ga0207695_10035532 Ga0207695_100355325 321
248 3300025917 Ga0207660_10039829 Ga0207660_100398292 321
249 3300025919 Ga0207657_10106614 Ga0207657_101066142 321
250 3300025924 Ga0207694_10014649 Ga0207694_100146494 321
251 3300025925 Ga0207650_10076868 Ga0207650_100768684 321
252 3300025949 Ga0207667_10153257 Ga0207667_101532573 321
253 3300025972 Ga0207668_10320346 Ga0207668_103203461 321
254 3300026078 Ga0207702_10011800 Ga0207702_100118005 321
255 3300026118 Ga0207675_100035023 Ga0207675_1000350233 321
256 3300028380 Ga0268265_10086968 Ga0268265_100869682 321
257 3300028381 Ga0268264_10113882 Ga0268264_101138821 321
258 3300037418 Ga0395900_0029066 Ga0395900_0029066_2458_3432 321
259 3300037471 Ga0395905_0176565 Ga0395905_0176565_190_1164 321
260 3300038443 Ga0395901_0015428 Ga0395901_0015428_5038_6012 321
261 3300044684 Ga0466966_0058285 Ga0466966_0058285_115_1086 321
262 3300044842 Ga0466957_0045464 Ga0466957_0045464_116_1087 321
263 3300045049 Ga0466959_0127107 Ga0466959_0127107_247_1218 321
264 3300045836 Ga0466958_0115638 Ga0466958_0115638_166_1137 321
265 3300047320 Ga0495672_0017046 Ga0495672_0017046_2451_3419 321
266 3300047472 Ga0495686_0074536 Ga0495686_0074536_573_1541 321
267 3300048911 Ga0496108_0195129 Ga0496108_0195129_58_1050 321
268 3300048912 Ga0496109_0211088 Ga0496109_0211088_626_1591 321
269 3300053119 Ga0500595_014526 Ga0500595_014526_1711_2679 321
270 3300053139 Ga0500568_0017873 Ga0500568_0017873_127_1095 321
271 3300003203 JGI25406J46586_10000025 JGI25406J46586_1000002560 322
272 3300003203 JGI25406J46586_10002937 JGI25406J46586_100029373 322
273 3300005293 Ga0065715_10126910 Ga0065715_101269101 322
274 3300005327 Ga0070658_10026861 Ga0070658_100268615 322
275 3300005329 Ga0070683_100018017 Ga0070683_1000180176 322
276 3300005330 Ga0070690_100196253 Ga0070690_1001962532 322
277 3300005331 Ga0070670_100105760 Ga0070670_1001057602 322
278 3300005334 Ga0068869_100006651 Ga0068869_1000066512 322
279 3300005334 Ga0068869_100074198 Ga0068869_1000741982 322
280 3300005335 Ga0070666_10212896 Ga0070666_102128961 322
281 3300005336 Ga0070680_100034100 Ga0070680_1000341002 322
282 3300005337 Ga0070682_100175701 Ga0070682_1001757012 322
283 3300005338 Ga0068868_100013029 Ga0068868_1000130293 322
284 3300005338 Ga0068868_100024575 Ga0068868_1000245756 322
285 3300005339 Ga0070660_100082352 Ga0070660_1000823522 322
286 3300005340 Ga0070689_100160442 Ga0070689_1001604422 322
287 3300005344 Ga0070661_100141580 Ga0070661_1001415801 322
288 3300005344 Ga0070661_100171920 Ga0070661_1001719202 322
289 3300005347 Ga0070668_100066608 Ga0070668_1000666082 322
290 3300005347 Ga0070668_100094097 Ga0070668_1000940973 322
291 3300005355 Ga0070671_100112865 Ga0070671_1001128651 322
292 3300005356 Ga0070674_100276203 Ga0070674_1002762031 322
293 3300005364 Ga0070673_100181004 Ga0070673_1001810042 322
294 3300005365 Ga0070688_100124972 Ga0070688_1001249722 322
295 3300005366 Ga0070659_100242398 Ga0070659_1002423981 322
296 3300005367 Ga0070667_100224349 Ga0070667_1002243492 322
297 3300005434 Ga0070709_10099917 Ga0070709_100999172 322
298 3300005435 Ga0070714_100045153 Ga0070714_1000451531 322
299 3300005435 Ga0070714_100477341 Ga0070714_1004773411 322
300 3300005436 Ga0070713_100006321 Ga0070713_1000063219 322
301 3300005437 Ga0070710_10005902 Ga0070710_100059026 322
302 3300005455 Ga0070663_100000736 Ga0070663_10000073616 322
303 3300005455 Ga0070663_100038209 Ga0070663_1000382092 322
304 3300005455 Ga0070663_100054724 Ga0070663_1000547242 322
305 3300005455 Ga0070663_100096174 Ga0070663_1000961742 322
306 3300005456 Ga0070678_100001495 Ga0070678_10000149511 322
307 3300005458 Ga0070681_10069555 Ga0070681_100695552 322
308 3300005468 Ga0070707_100088318 Ga0070707_1000883181 322
309 3300005471 Ga0070698_100205473 Ga0070698_1002054732 322
310 3300005518 Ga0070699_100177587 Ga0070699_1001775871 322
311 3300005535 Ga0070684_100099479 Ga0070684_1000994791 322
312 3300005536 Ga0070697_100020178 Ga0070697_1000201783 322
313 3300005539 Ga0068853_100045263 Ga0068853_1000452632 322
314 3300005539 Ga0068853_100151223 Ga0068853_1001512231 322
315 3300005539 Ga0068853_100239796 Ga0068853_1002397962 322
316 3300005539 Ga0068853_100315738 Ga0068853_1003157381 322
317 3300005548 Ga0070665_100007828 Ga0070665_10000782810 322
318 3300005548 Ga0070665_100029862 Ga0070665_1000298623 322
319 3300005548 Ga0070665_100030204 Ga0070665_1000302048 322
320 3300005548 Ga0070665_100091436 Ga0070665_1000914363 322
321 3300005548 Ga0070665_100431543 Ga0070665_1004315432 322
322 3300005563 Ga0068855_100067236 Ga0068855_1000672365 322
323 3300005563 Ga0068855_100690160 Ga0068855_1006901601 322
324 3300005564 Ga0070664_100009890 Ga0070664_1000098908 322
325 3300005564 Ga0070664_100081776 Ga0070664_1000817762 322
326 3300005578 Ga0068854_100129953 Ga0068854_1001299532 322
327 3300005614 Ga0068856_100000066 Ga0068856_10000006681 322
328 3300005614 Ga0068856_100080501 Ga0068856_1000805012 322
329 3300005616 Ga0068852_100003029 Ga0068852_1000030299 322
330 3300005616 Ga0068852_100028663 Ga0068852_1000286632 322
331 3300005616 Ga0068852_100037217 Ga0068852_1000372173 322
332 3300005616 Ga0068852_100048237 Ga0068852_1000482372 322
333 3300005618 Ga0068864_100197071 Ga0068864_1001970712 322
334 3300005719 Ga0068861_100090710 Ga0068861_1000907103 322
335 3300005841 Ga0068863_100017738 Ga0068863_1000177385 322
336 3300005841 Ga0068863_100248791 Ga0068863_1002487913 322
337 3300005842 Ga0068858_100024609 Ga0068858_1000246092 322
338 3300005842 Ga0068858_100224757 Ga0068858_1002247571 322
339 3300005842 Ga0068858_100260344 Ga0068858_1002603442 322
340 3300005843 Ga0068860_100000302 Ga0068860_10000030217 322
341 3300005843 Ga0068860_100331889 Ga0068860_1003318891 322
342 3300005844 Ga0068862_100062037 Ga0068862_1000620371 322
343 3300005844 Ga0068862_100074199 Ga0068862_1000741992 322
344 3300005937 Ga0081455_10006992 Ga0081455_100069924 322
345 3300005937 Ga0081455_10011660 Ga0081455_100116605 322
346 3300005937 Ga0081455_10033372 Ga0081455_100333723 322
347 3300005983 Ga0081540_1000918 Ga0081540_100091816 322
348 3300005983 Ga0081540_1002732 Ga0081540_100273214 322
349 3300005983 Ga0081540_1002906 Ga0081540_10029064 322
350 3300005983 Ga0081540_1005394 Ga0081540_10053943 322
351 3300005983 Ga0081540_1013045 Ga0081540_10130455 322
352 3300005983 Ga0081540_1040733 Ga0081540_10407332 322
353 3300005983 Ga0081540_1078242 Ga0081540_10782422 322
354 3300005985 Ga0081539_10000008 Ga0081539_1000000874 322
355 3300005985 Ga0081539_10000640 Ga0081539_100006405 322
356 3300005985 Ga0081539_10011398 Ga0081539_100113981 322
357 3300005985 Ga0081539_10041169 Ga0081539_100411692 322
358 3300006028 Ga0070717_10008077 Ga0070717_100080776 322
359 3300006038 Ga0075365_10048899 Ga0075365_100488991 322
360 3300006038 Ga0075365_10087007 Ga0075365_100870072 322
361 3300006038 Ga0075365_10101279 Ga0075365_101012792 322
362 3300006038 Ga0075365_10148091 Ga0075365_101480912 322
363 3300006048 Ga0075363_100024494 Ga0075363_1000244943 322
364 3300006048 Ga0075363_100046739 Ga0075363_1000467391 322
365 3300006051 Ga0075364_10208457 Ga0075364_102084572 322
366 3300006173 Ga0070716_100021690 Ga0070716_1000216904 322
367 3300006173 Ga0070716_100046897 Ga0070716_1000468972 322
368 3300006173 Ga0070716_100234801 Ga0070716_1002348012 322
369 3300006175 Ga0070712_100013846 Ga0070712_1000138466 322
370 3300006195 Ga0075366_10025300 Ga0075366_100253005 322
371 3300006353 Ga0075370_10007780 Ga0075370_100077804 322
372 3300006358 Ga0068871_100031289 Ga0068871_1000312894 322
373 3300006358 Ga0068871_100146040 Ga0068871_1001460402 322
374 3300006844 Ga0075428_100215289 Ga0075428_1002152892 322
375 3300006881 Ga0068865_100227804 Ga0068865_1002278041 322
376 3300006931 Ga0097620_100175803 Ga0097620_1001758031 322
377 3300007265 Ga0099794_10009840 Ga0099794_100098402 322
378 3300007265 Ga0099794_10029876 Ga0099794_100298762 322
379 3300007788 Ga0099795_10059292 Ga0099795_100592921 322
380 3300009098 Ga0105245_10002531 Ga0105245_1000253111 322
381 3300009098 Ga0105245_10034525 Ga0105245_100345251 322
382 3300009098 Ga0105245_10120492 Ga0105245_101204922 322
383 3300009098 Ga0105245_10162145 Ga0105245_101621453 322
384 3300009101 Ga0105247_10006243 Ga0105247_100062435 322
385 3300009101 Ga0105247_10028254 Ga0105247_100282541 322
386 3300009148 Ga0105243_10043679 Ga0105243_100436794 322
387 3300009174 Ga0105241_10013032 Ga0105241_100130326 322
388 3300009174 Ga0105241_10469949 Ga0105241_104699492 322
389 3300009176 Ga0105242_10026161 Ga0105242_100261615 322
390 3300009176 Ga0105242_10093721 Ga0105242_100937212 322
391 3300009177 Ga0105248_10007036 Ga0105248_1000703614 322
392 3300009177 Ga0105248_10010822 Ga0105248_100108227 322
393 3300009177 Ga0105248_10093092 Ga0105248_100930924 322
394 3300009545 Ga0105237_10002097 Ga0105237_1000209710 322
395 3300009545 Ga0105237_10007055 Ga0105237_1000705510 322
396 3300009545 Ga0105237_10025682 Ga0105237_100256826 322
397 3300009545 Ga0105237_10052188 Ga0105237_100521883 322
398 3300009545 Ga0105237_10170574 Ga0105237_101705742 322
399 3300009551 Ga0105238_10007477 Ga0105238_100074775 322
400 3300009551 Ga0105238_10092222 Ga0105238_100922222 322
401 3300009551 Ga0105238_10200567 Ga0105238_102005672 322
402 3300010159 Ga0099796_10001990 Ga0099796_100019902 322
403 3300010375 Ga0105239_10018062 Ga0105239_100180622 322
404 3300011119 Ga0105246_10002338 Ga0105246_100023385 322
405 3300011119 Ga0105246_10036950 Ga0105246_100369502 322
406 3300011119 Ga0105246_10045724 Ga0105246_100457242 322
407 3300011119 Ga0105246_10130324 Ga0105246_101303243 322
408 3300013104 Ga0157370_10038407 Ga0157370_100384072 322
409 3300013105 Ga0157369_10009209 Ga0157369_100092096 322
410 3300013296 Ga0157374_10005291 Ga0157374_100052919 322
411 3300013297 Ga0157378_10031134 Ga0157378_100311343 322
412 3300013297 Ga0157378_10068359 Ga0157378_100683592 322
413 3300013297 Ga0157378_10313264 Ga0157378_103132642 322
414 3300013306 Ga0163162_10097049 Ga0163162_100970492 322
415 3300013306 Ga0163162_10114089 Ga0163162_101140892 322
416 3300013306 Ga0163162_10670293 Ga0163162_106702931 322
417 3300013308 Ga0157375_10007126 Ga0157375_100071264 322
418 3300013308 Ga0157375_10100137 Ga0157375_101001373 322
419 3300013308 Ga0157375_10193457 Ga0157375_101934572 322
420 3300014325 Ga0163163_10003162 Ga0163163_100031624 322
421 3300014968 Ga0157379_10022769 Ga0157379_100227693 322
422 3300014968 Ga0157379_10147740 Ga0157379_101477401 322
423 3300014968 Ga0157379_10280566 Ga0157379_102805661 322
424 3300014969 Ga0157376_10007855 Ga0157376_100078555 322
425 3300014969 Ga0157376_10025197 Ga0157376_100251973 322
426 3300021384 Ga0213876_10000471 Ga0213876_1000047130 322
427 3300025297 Ga0209758_1004659 Ga0209758_10046599 322
428 3300025297 Ga0209758_1004698 Ga0209758_10046982 322
429 3300025898 Ga0207692_10003854 Ga0207692_100038545 322
430 3300025900 Ga0207710_10006455 Ga0207710_100064554 322
431 3300025901 Ga0207688_10005151 Ga0207688_100051514 322
432 3300025901 Ga0207688_10232630 Ga0207688_102326301 322
433 3300025906 Ga0207699_10016501 Ga0207699_100165013 322
434 3300025906 Ga0207699_10160941 Ga0207699_101609412 322
435 3300025907 Ga0207645_10084279 Ga0207645_100842791 322
436 3300025908 Ga0207643_10022187 Ga0207643_100221872 322
437 3300025909 Ga0207705_10142508 Ga0207705_101425082 322
438 3300025909 Ga0207705_10196289 Ga0207705_101962891 322
439 3300025910 Ga0207684_10097070 Ga0207684_100970702 322
440 3300025911 Ga0207654_10003642 Ga0207654_100036424 322
441 3300025912 Ga0207707_10008746 Ga0207707_100087468 322
442 3300025912 Ga0207707_10123983 Ga0207707_101239832 322
443 3300025913 Ga0207695_10051579 Ga0207695_100515791 322
444 3300025914 Ga0207671_10016029 Ga0207671_100160292 322
445 3300025914 Ga0207671_10040558 Ga0207671_100405585 322
446 3300025914 Ga0207671_10103910 Ga0207671_101039102 322
447 3300025914 Ga0207671_10192949 Ga0207671_101929492 322
448 3300025915 Ga0207693_10003223 Ga0207693_100032238 322
449 3300025915 Ga0207693_10090290 Ga0207693_100902903 322
450 3300025917 Ga0207660_10198406 Ga0207660_101984061 322
451 3300025919 Ga0207657_10002580 Ga0207657_100025806 322
452 3300025920 Ga0207649_10169460 Ga0207649_101694601 322
453 3300025920 Ga0207649_10340908 Ga0207649_103409081 322
454 3300025921 Ga0207652_10047988 Ga0207652_100479881 322
455 3300025922 Ga0207646_10053641 Ga0207646_100536412 322
456 3300025924 Ga0207694_10131744 Ga0207694_101317442 322
457 3300025927 Ga0207687_10074785 Ga0207687_100747852 322
458 3300025927 Ga0207687_10105497 Ga0207687_101054972 322
459 3300025928 Ga0207700_10002090 Ga0207700_1000209011 322
460 3300025928 Ga0207700_10073711 Ga0207700_100737113 322
461 3300025928 Ga0207700_10392206 Ga0207700_103922062 322
462 3300025929 Ga0207664_10047500 Ga0207664_100475003 322
463 3300025931 Ga0207644_10097535 Ga0207644_100975351 322
464 3300025931 Ga0207644_10402976 Ga0207644_104029761 322
465 3300025932 Ga0207690_10191111 Ga0207690_101911112 322
466 3300025933 Ga0207706_10038396 Ga0207706_100383964 322
467 3300025933 Ga0207706_10423659 Ga0207706_104236591 322
468 3300025934 Ga0207686_10023050 Ga0207686_100230503 322
469 3300025934 Ga0207686_10276382 Ga0207686_102763821 322
470 3300025938 Ga0207704_10039801 Ga0207704_100398013 322
471 3300025938 Ga0207704_10077063 Ga0207704_100770632 322
472 3300025940 Ga0207691_10106687 Ga0207691_101066872 322
473 3300025941 Ga0207711_10068848 Ga0207711_100688484 322
474 3300025942 Ga0207689_10040006 Ga0207689_100400064 322
475 3300025942 Ga0207689_10069849 Ga0207689_100698493 322
476 3300025942 Ga0207689_10107589 Ga0207689_101075892 322
477 3300025949 Ga0207667_10025565 Ga0207667_100255656 322
478 3300025949 Ga0207667_10119200 Ga0207667_101192002 322
479 3300025949 Ga0207667_10255530 Ga0207667_102555302 322
480 3300025960 Ga0207651_10034141 Ga0207651_100341412 322
481 3300025960 Ga0207651_10043843 Ga0207651_100438432 322
482 3300025972 Ga0207668_10038900 Ga0207668_100389004 322
483 3300026023 Ga0207677_10118332 Ga0207677_101183322 322
484 3300026041 Ga0207639_10057418 Ga0207639_100574182 322
485 3300026067 Ga0207678_10022039 Ga0207678_100220394 322
486 3300026067 Ga0207678_10046165 Ga0207678_100461654 322
487 3300026067 Ga0207678_10056785 Ga0207678_100567852 322
488 3300026067 Ga0207678_10104735 Ga0207678_101047352 322
489 3300026067 Ga0207678_10209374 Ga0207678_102093742 322
490 3300026075 Ga0207708_10062959 Ga0207708_100629593 322
491 3300026078 Ga0207702_10000044 Ga0207702_1000004470 322
492 3300026078 Ga0207702_10433628 Ga0207702_104336281 322
493 3300026078 Ga0207702_10560315 Ga0207702_105603151 322
494 3300026089 Ga0207648_10089987 Ga0207648_100899871 322
495 3300026089 Ga0207648_10242579 Ga0207648_102425792 322
496 3300026116 Ga0207674_10106336 Ga0207674_101063361 322
497 3300026118 Ga0207675_100025901 Ga0207675_1000259012 322
498 3300026118 Ga0207675_100159578 Ga0207675_1001595782 322
499 3300026118 Ga0207675_100180963 Ga0207675_1001809632 322
500 3300026121 Ga0207683_10019334 Ga0207683_100193344 322
501 3300026121 Ga0207683_10036657 Ga0207683_100366574 322
502 3300026121 Ga0207683_10171899 Ga0207683_101718992 322
503 3300026121 Ga0207683_10331325 Ga0207683_103313252 322
504 3300026142 Ga0207698_10056652 Ga0207698_100566522 322
505 3300026142 Ga0207698_10104623 Ga0207698_101046232 322
506 3300026142 Ga0207698_10138909 Ga0207698_101389091 322
507 3300026142 Ga0207698_10323106 Ga0207698_103231062 322
508 3300027512 Ga0209179_1000258 Ga0209179_10002583 322
509 3300028379 Ga0268266_10006822 Ga0268266_1000682211 322
510 3300028379 Ga0268266_10010084 Ga0268266_100100843 322
511 3300028379 Ga0268266_10013882 Ga0268266_100138826 322
512 3300028379 Ga0268266_10148490 Ga0268266_101484902 322
513 3300028380 Ga0268265_10053781 Ga0268265_100537813 322
514 3300028380 Ga0268265_10116848 Ga0268265_101168482 322
515 3300028380 Ga0268265_10177151 Ga0268265_101771512 322
516 3300028381 Ga0268264_10000020 Ga0268264_10000020119 322
517 3300028381 Ga0268264_10453210 Ga0268264_104532101 322
518 3300028786 Ga0307517_10000756 Ga0307517_1000075614 322
519 3300028794 Ga0307515_10016019 Ga0307515_1001601911 322
520 3300030521 Ga0307511_10042759 Ga0307511_100427593 322
521 3300031238 Ga0265332_10053859 Ga0265332_100538592 322
522 3300031241 Ga0265325_10004341 Ga0265325_1000434111 322
523 3300031247 Ga0265340_10007679 Ga0265340_100076794 322
524 3300031456 Ga0307513_10089283 Ga0307513_100892833 322
525 3300031456 Ga0307513_10381498 Ga0307513_103814981 322
526 3300031616 Ga0307508_10000058 Ga0307508_1000005824 322
527 3300031616 Ga0307508_10006654 Ga0307508_100066542 322
528 3300031616 Ga0307508_10091464 Ga0307508_100914642 322
529 3300031616 Ga0307508_10183935 Ga0307508_101839351 322
530 3300031616 Ga0307508_10215817 Ga0307508_102158172 322
531 3300031824 Ga0307413_10040995 Ga0307413_100409953 322
532 3300031995 Ga0307409_100081685 Ga0307409_1000816853 322
533 3300032002 Ga0307416_100391907 Ga0307416_1003919072 322
534 3300032002 Ga0307416_100692623 Ga0307416_1006926231 322
535 3300032005 Ga0307411_10085776 Ga0307411_100857763 322
536 3300032005 Ga0307411_10169493 Ga0307411_101694932 322
537 3300032005 Ga0307411_10262252 Ga0307411_102622521 322
538 3300032126 Ga0307415_100118633 Ga0307415_1001186332 322
539 3300033179 Ga0307507_10070779 Ga0307507_100707794 322
540 3300033180 Ga0307510_10100937 Ga0307510_101009372 322
541 3300033180 Ga0307510_10167954 Ga0307510_101679542 322
542 3300033180 Ga0307510_10208577 Ga0307510_102085771 322
543 3300034957 Ga0373938_0013787 Ga0373938_0013787_237_1232 322
544 3300035090 Ga0373949_0016342 Ga0373949_0016342_243_1238 322
545 3300035111 Ga0373923_0012313 Ga0373923_0012313_679_1647 322
546 3300035113 Ga0373936_0092138 Ga0373936_0092138_110_1081 322
547 3300035117 Ga0373953_0004934 Ga0373953_0004934_1850_2818 322
548 3300035118 Ga0373954_0011591 Ga0373954_0011591_2452_3420 322
549 3300035118 Ga0373954_0080940 Ga0373954_0080940_87_1055 322
550 3300035119 Ga0373956_0012819 Ga0373956_0012819_1349_2317 322
551 3300035120 Ga0373957_0030935 Ga0373957_0030935_585_1553 322
552 3300035171 Ga0373946_0010026 Ga0373946_0010026_421_1389 322
553 3300035172 Ga0373955_0033341 Ga0373955_0033341_846_1814 322
554 3300035172 Ga0373955_0056434 Ga0373955_0056434_590_1558 322
555 3300035691 Ga0373931_0004803 Ga0373931_0004803_1745_2740 322
556 3300035691 Ga0373931_0137976 Ga0373931_0137976_119_1087 322
557 3300035692 Ga0373935_0037652 Ga0373935_0037652_1873_2841 322
558 3300035692 Ga0373935_0119417 Ga0373935_0119417_345_1319 322
559 3300035692 Ga0373935_0178692 Ga0373935_0178692_335_1303 322
560 3300035695 Ga0373927_0007631 Ga0373927_0007631_3207_4175 322
561 3300035695 Ga0373927_0019240 Ga0373927_0019240_1480_2454 322
562 3300035695 Ga0373927_0054843 Ga0373927_0054843_840_1808 322
563 3300035695 Ga0373927_0185136 Ga0373927_0185136_93_1061 322
564 3300035695 Ga0373927_0192119 Ga0373927_0192119_306_1274 322
565 3300035724 Ga0373933_0000052 Ga0373933_0000052_31553_32524 322
566 3300035724 Ga0373933_0060560 Ga0373933_0060560_880_1848 322
567 3300035724 Ga0373933_0173359 Ga0373933_0173359_81_1049 322
568 3300035725 Ga0373947_0027914 Ga0373947_0027914_270_1244 322
569 3300035725 Ga0373947_0040528 Ga0373947_0040528_170_1138 322
570 3300035725 Ga0373947_0094910 Ga0373947_0094910_805_1773 322
571 3300036401 Ga0373937_0028837 Ga0373937_0028837_2512_3480 322
572 3300037068 Ga0373925_0019351 Ga0373925_0019351_329_1297 322
573 3300037068 Ga0373925_0064426 Ga0373925_0064426_569_1564 322
574 3300037068 Ga0373925_0097327 Ga0373925_0097327_1229_2197 322
575 3300037466 Ga0395898_0233964 Ga0395898_0233964_164_1132 322
576 3300039437 Ga0436365_1898196 Ga0436365_1898196_2497_3471 322
577 3300039453 Ga0436362_1224309 Ga0436362_1224309_439_1413 322
578 3300046452 Ga0495617_049086 Ga0495617_049086_88_1056 322
579 3300046452 Ga0495617_060573 Ga0495617_060573_39_1007 322
580 3300046454 Ga0495592_0018394 Ga0495592_0018394_2107_3075 322
581 3300046454 Ga0495592_0178286 Ga0495592_0178286_441_1409 322
582 3300046455 Ga0495603_0009067 Ga0495603_0009067_3739_4707 322
583 3300046455 Ga0495603_0192254 Ga0495603_0192254_17_988 322
584 3300046459 Ga0495629_0019820 Ga0495629_0019820_3756_4724 322
585 3300046459 Ga0495629_0034435 Ga0495629_0034435_2460_3428 322
586 3300046461 Ga0495641_0033371 Ga0495641_0033371_1154_2122 322
587 3300046462 Ga0495651_0133014 Ga0495651_0133014_776_1744 322
588 3300046473 Ga0495582_0010995 Ga0495582_0010995_3853_4821 322
589 3300046475 Ga0495639_0000899 Ga0495639_0000899_10838_11806 322
590 3300046475 Ga0495639_0029116 Ga0495639_0029116_1402_2370 322
591 3300046475 Ga0495639_0046118 Ga0495639_0046118_941_1909 322
592 3300046476 Ga0495662_0021541 Ga0495662_0021541_711_1679 322
593 3300046492 Ga0495585_0177022 Ga0495585_0177022_13_981 322
594 3300046499 Ga0495594_0095493 Ga0495594_0095493_650_1618 322
595 3300046500 Ga0495596_0050404 Ga0495596_0050404_352_1320 322
596 3300046506 Ga0495583_0026495 Ga0495583_0026495_1883_2851 322
597 3300046507 Ga0495606_0003362 Ga0495606_0003362_5537_6544 322
598 3300046507 Ga0495606_0065047 Ga0495606_0065047_708_1676 322
599 3300046511 Ga0495608_0026982 Ga0495608_0026982_1087_2055 322
600 3300046512 Ga0495610_0098803 Ga0495610_0098803_226_1194 322
601 3300046513 Ga0495616_0079842 Ga0495616_0079842_535_1503 322
602 3300046514 Ga0495618_0222618 Ga0495618_0222618_207_1175 322
603 3300046515 Ga0495620_0007763 Ga0495620_0007763_129_1097 322
604 3300046515 Ga0495620_0098838 Ga0495620_0098838_27_995 322
605 3300046516 Ga0495628_0147921 Ga0495628_0147921_10_978 322
606 3300046517 Ga0495630_0016906 Ga0495630_0016906_1078_2046 322
607 3300046522 Ga0495643_0024681 Ga0495643_0024681_159_1127 322
608 3300046524 Ga0495648_0041417 Ga0495648_0041417_1487_2455 322
609 3300046526 Ga0495666_0019863 Ga0495666_0019863_933_1901 322
610 3300046529 Ga0495652_0294860 Ga0495652_0294860_70_1038 322
611 3300046531 Ga0495665_0004419 Ga0495665_0004419_4993_5961 322
612 3300046533 Ga0495640_0056743 Ga0495640_0056743_1520_2488 322
613 3300046536 Ga0495587_0034227 Ga0495587_0034227_1152_2120 322
614 3300046543 Ga0495645_0075490 Ga0495645_0075490_1328_2296 322
615 3300046543 Ga0495645_0213767 Ga0495645_0213767_120_1103 322
616 3300046557 Ga0495622_0061532 Ga0495622_0061532_347_1315 322
617 3300046558 Ga0495633_0040247 Ga0495633_0040247_1088_2056 322
618 3300046559 Ga0495667_0035666 Ga0495667_0035666_1897_2865 322
619 3300046559 Ga0495667_0053053 Ga0495667_0053053_469_1437 322
620 3300046615 Ga0495656_0005677 Ga0495656_0005677_544_1542 322
621 3300046615 Ga0495656_0009890 Ga0495656_0009890_106_1074 322
622 3300046616 Ga0495668_0045751 Ga0495668_0045751_65_1033 322
623 3300046642 Ga0495634_0113135 Ga0495634_0113135_71_1039 322
624 3300046660 Ga0495625_0091127 Ga0495625_0091127_531_1499 322
625 3300046663 Ga0495635_0012340 Ga0495635_0012340_3394_4362 322
626 3300046663 Ga0495635_0014647 Ga0495635_0014647_458_1426 322
627 3300046674 Ga0495588_0030046 Ga0495588_0030046_1512_2480 322
628 3300046674 Ga0495588_0100471 Ga0495588_0100471_78_1046 322
629 3300046675 Ga0495657_0094707 Ga0495657_0094707_272_1240 322
630 3300046678 Ga0495599_0003308 Ga0495599_0003308_5889_6857 322
631 3300046680 Ga0495646_0042756 Ga0495646_0042756_187_1155 322
632 3300046681 Ga0495647_0010288 Ga0495647_0010288_790_1758 322
633 3300046683 Ga0495658_0026874 Ga0495658_0026874_209_1177 322
634 3300046684 Ga0495669_0015205 Ga0495669_0015205_1612_2580 322
635 3300046689 Ga0495613_0050738 Ga0495613_0050738_1415_2383 322
636 3300046690 Ga0495624_0056286 Ga0495624_0056286_1405_2373 322
637 3300046692 Ga0495671_0085597 Ga0495671_0085597_512_1480 322
638 3300046694 Ga0495649_0091476 Ga0495649_0091476_312_1280 322
639 3300046794 Ga0495589_0032798 Ga0495589_0032798_28_1080 322
640 3300046809 Ga0495600_0082658 Ga0495600_0082658_459_1427 322
641 3300046810 Ga0495660_0114938 Ga0495660_0114938_289_1257 322
642 3300047315 Ga0495581_0013346 Ga0495581_0013346_2746_3714 322
643 3300047317 Ga0495604_0083239 Ga0495604_0083239_1152_2120 322
644 3300047319 Ga0495674_0023255 Ga0495674_0023255_1984_2952 322
645 3300047321 Ga0495676_0020256 Ga0495676_0020256_729_1697 322
646 3300047322 Ga0495680_0105492 Ga0495680_0105492_459_1427 322
647 3300047323 Ga0495683_0024079 Ga0495683_0024079_1804_2772 322
648 3300047444 Ga0495675_0013961 Ga0495675_0013961_144_1112 322
649 3300047469 Ga0495673_0042647 Ga0495673_0042647_35_1003 322
650 3300047469 Ga0495673_0096778 Ga0495673_0096778_12_980 322
651 3300047470 Ga0495681_0049382 Ga0495681_0049382_867_1835 322
652 3300047471 Ga0495684_0040381 Ga0495684_0040381_158_1126 322
653 3300047471 Ga0495684_0095293 Ga0495684_0095293_1237_2205 322
654 3300048088 Ga0495602_0118393 Ga0495602_0118393_499_1467 322
655 3300048903 Ga0496100_0160931 Ga0496100_0160931_478_1473 322
656 3300048904 Ga0496101_0004598 Ga0496101_0004598_569_1537 322
657 3300048904 Ga0496101_0024803 Ga0496101_0024803_1920_2915 322
658 3300048905 Ga0496102_0013859 Ga0496102_0013859_2803_3798 322
659 3300048905 Ga0496102_0023166 Ga0496102_0023166_3989_4957 322
660 3300048906 Ga0496103_0046088 Ga0496103_0046088_1217_2212 322
661 3300048907 Ga0496104_0024522 Ga0496104_0024522_4131_5099 322
662 3300048907 Ga0496104_0106969 Ga0496104_0106969_644_1639 322
663 3300048907 Ga0496104_0435685 Ga0496104_0435685_32_1000 322
664 3300048908 Ga0496105_0018401 Ga0496105_0018401_1609_2604 322
665 3300048908 Ga0496105_0021519 Ga0496105_0021519_1821_2789 322
666 3300048908 Ga0496105_0098245 Ga0496105_0098245_1300_2268 322
667 3300048909 Ga0496106_0003440 Ga0496106_0003440_9052_10020 322
668 3300048909 Ga0496106_0019858 Ga0496106_0019858_2405_3400 322
669 3300048909 Ga0496106_0023485 Ga0496106_0023485_789_1763 322
670 3300048909 Ga0496106_0055888 Ga0496106_0055888_281_1249 322
671 3300048910 Ga0496107_0003096 Ga0496107_0003096_4639_5607 322
672 3300048911 Ga0496108_0013251 Ga0496108_0013251_3942_4937 322
673 3300048911 Ga0496108_0248749 Ga0496108_0248749_503_1471 322
674 3300048912 Ga0496109_0013303 Ga0496109_0013303_5571_6539 322
675 3300048912 Ga0496109_0183415 Ga0496109_0183415_451_1419 322
676 3300048912 Ga0496109_0216108 Ga0496109_0216108_127_1095 322
677 3300048913 Ga0496110_0078123 Ga0496110_0078123_397_1392 322
678 3300048913 Ga0496110_0115432 Ga0496110_0115432_413_1381 322
679 3300048914 Ga0496111_0079286 Ga0496111_0079286_1156_2124 322
680 3300048914 Ga0496111_0101390 Ga0496111_0101390_477_1472 322
681 3300048915 Ga0496112_0000008 Ga0496112_0000008_119753_120721 322
682 3300048915 Ga0496112_0027890 Ga0496112_0027890_4090_5058 322
683 3300048915 Ga0496112_0032724 Ga0496112_0032724_1811_2779 322
684 3300048915 Ga0496112_0040218 Ga0496112_0040218_2111_3106 322
685 3300048916 Ga0496113_0003249 Ga0496113_0003249_5846_6841 322
686 3300048916 Ga0496113_0019464 Ga0496113_0019464_1225_2193 322
687 3300048916 Ga0496113_0029916 Ga0496113_0029916_2445_3413 322
688 3300048917 Ga0496114_0007527 Ga0496114_0007527_6048_7043 322
689 3300048918 Ga0496115_0002391 Ga0496115_0002391_1759_2727 322
690 3300048918 Ga0496115_0011937 Ga0496115_0011937_2361_3329 322
691 3300048920 Ga0496117_0008333 Ga0496117_0008333_1441_2415 322
692 3300048921 Ga0496118_0010695 Ga0496118_0010695_5023_5997 322
693 3300048921 Ga0496118_0045705 Ga0496118_0045705_632_1603 322
694 3300048922 Ga0496119_0095615 Ga0496119_0095615_458_1426 322
695 3300048924 Ga0496121_0003205 Ga0496121_0003205_15735_16706 322
696 3300048924 Ga0496121_0005199 Ga0496121_0005199_11650_12621 322
697 3300048924 Ga0496121_0012595 Ga0496121_0012595_4658_5632 322
698 3300048924 Ga0496121_0012878 Ga0496121_0012878_5131_6099 322
699 3300048924 Ga0496121_0043868 Ga0496121_0043868_342_1310 322
700 3300048924 Ga0496121_0098115 Ga0496121_0098115_675_1643 322
701 3300048927 Ga0496124_0019555 Ga0496124_0019555_4571_5545 322
702 3300048927 Ga0496124_0065533 Ga0496124_0065533_879_1847 322
703 3300048927 Ga0496124_0323048 Ga0496124_0323048_85_1053 322
704 3300048928 Ga0496125_0014654 Ga0496125_0014654_3236_4210 322
705 3300048929 Ga0496126_0006488 Ga0496126_0006488_3512_4510 322
706 3300048929 Ga0496126_0040423 Ga0496126_0040423_2526_3497 322
707 3300048929 Ga0496126_0071150 Ga0496126_0071150_1430_2398 322
708 3300048929 Ga0496126_0088041 Ga0496126_0088041_180_1154 322
709 3300048929 Ga0496126_0129446 Ga0496126_0129446_936_1904 322
710 3300048929 Ga0496126_0212295 Ga0496126_0212295_618_1586 322
711 3300050490 nmdc:mga03n38_5720_c1 nmdc:mga03n38_5720_c1_1779_2747 322
712 3300050492 nmdc:mga0yw44_11424_c1 nmdc:mga0yw44_11424_c1_458_1426 322
713 3300050493 nmdc:mga0k408_125701_c1 nmdc:mga0k408_125701_c1_41_1093 322
714 3300050493 nmdc:mga0k408_53969_c1 nmdc:mga0k408_53969_c1_1325_2293 322
715 3300050494 nmdc:mga06z11_53890_c1 nmdc:mga06z11_53890_c1_189_1157 322
716 3300050496 nmdc:mga07m45_29779_c1 nmdc:mga07m45_29779_c1_916_1884 322
717 3300050507 nmdc:mga05p37_382644_c1 nmdc:mga05p37_382644_c1_206_1258 322
718 3300050511 nmdc:mga08y16_37341_c1 nmdc:mga08y16_37341_c1_4062_5030 322
719 3300050512 nmdc:mga0n895_77512_c1 nmdc:mga0n895_77512_c1_94_1062 322
720 3300050514 nmdc:mga08x19_119331_c1 nmdc:mga08x19_119331_c1_66_1034 322
721 3300050516 nmdc:mga0sz30_64522_c1 nmdc:mga0sz30_64522_c1_262_1230 322
722 3300053080 Ga0500635_0042887 Ga0500635_0042887_285_1259 322
723 3300053085 Ga0495619_0058357 Ga0495619_0058357_1231_2199 322
724 3300053085 Ga0495619_0083003 Ga0495619_0083003_497_1465 322
725 3300053092 Ga0500583_0093959 Ga0500583_0093959_28_996 322
726 3300053093 Ga0500651_0138016 Ga0500651_0138016_102_1070 322
727 3300053094 Ga0500566_0000400 Ga0500566_0000400_21050_22021 322
728 3300053094 Ga0500566_0022004 Ga0500566_0022004_1158_2126 322
729 3300053095 Ga0500640_023893 Ga0500640_023893_1350_2321 322
730 3300053096 Ga0500641_0007780 Ga0500641_0007780_1554_2522 322
731 3300053097 Ga0500648_055052 Ga0500648_055052_731_1705 322
732 3300053102 Ga0500554_000351 Ga0500554_000351_4175_5176 322
733 3300053102 Ga0500554_001566 Ga0500554_001566_2295_3263 322
734 3300053111 Ga0500572_000121 Ga0500572_000121_21039_22010 322
735 3300053119 Ga0500595_001441 Ga0500595_001441_10236_11204 322
736 3300053119 Ga0500595_004813 Ga0500595_004813_3258_4226 322
737 3300053119 Ga0500595_017366 Ga0500595_017366_75_1046 322
738 3300053122 Ga0500608_061323 Ga0500608_061323_710_1681 322
739 3300053122 Ga0500608_072823 Ga0500608_072823_146_1117 322
740 3300053123 Ga0500614_001800 Ga0500614_001800_1843_2814 322
741 3300053130 Ga0500642_0100199 Ga0500642_0100199_104_1072 322
742 3300053134 Ga0500658_0020931 Ga0500658_0020931_451_1419 322
743 3300053134 Ga0500658_0034702 Ga0500658_0034702_344_1312 322
744 3300053136 Ga0500559_0001424 Ga0500559_0001424_11644_12615 322
745 3300053140 Ga0500573_0163590 Ga0500573_0163590_107_1081 322
746 3300053150 Ga0500603_001381 Ga0500603_001381_120_1091 322
747 3300053150 Ga0500603_033051 Ga0500603_033051_146_1120 322
748 3300053151 Ga0500604_0027668 Ga0500604_0027668_410_1378 322
749 3300053153 Ga0500616_0090601 Ga0500616_0090601_506_1492 322
750 3300053155 Ga0500620_038175 Ga0500620_038175_554_1522 322
751 3300053156 Ga0500622_0064657 Ga0500622_0064657_399_1367 322
752 3300053159 Ga0500630_001045 Ga0500630_001045_9390_10361 322
753 3300053162 Ga0500638_000584 Ga0500638_000584_2262_3230 322
754 3300053162 Ga0500638_041576 Ga0500638_041576_1083_2054 322
755 3300053163 Ga0500639_000219 Ga0500639_000219_6395_7366 322
756 3300053163 Ga0500639_003192 Ga0500639_003192_724_1695 322
757 3300053177 Ga0500636_0021134 Ga0500636_0021134_2136_3122 322
758 3300053177 Ga0500636_0034794 Ga0500636_0034794_331_1377 322
759 3300053177 Ga0500636_0089803 Ga0500636_0089803_291_1265 322
760 3300053178 Ga0500637_0000129 Ga0500637_0000129_26237_27238 322
761 3300053178 Ga0500637_0000660 Ga0500637_0000660_4366_5334 322
762 3300053178 Ga0500637_0164936 Ga0500637_0164936_89_1063 322
763 3300053730 Ga0500645_019226 Ga0500645_019226_652_1650 322
764 3300053737 Ga0500601_002028 Ga0500601_002028_123_1094 322
765 3300055283 Ga0500661_001004 Ga0500661_001004_1525_2493 322
766 iso_pu_bacteria 2889033259 2889042277 322
767 iso_pu_bacteria 2922386360 2922390553 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

116

390

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9687 25 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9655 25 322
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9561 25 322
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9561 25 320
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9545 29 322
ID Description Score Start End Superfamily
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9501 25 320 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9294 125 247 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9286 25 320 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9282 25 322 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9229 25 322 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1F4CWQ1-F1-model_v4 LacI family transcriptional regulator 0.9731 25 322
AF-A0A0Q4YHE9-F1-model_v4 TctC 0.9723 30 322
AF-A0A5C7PNF1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9692 19 322
AF-A0A536ZN56-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9685 19 322
AF-A0A315FRH4-F1-model_v4 ABC transporter substrate-binding protein 0.966 19 322

Feature Viewer

pLDDT pTM Quality
91.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map