F479911

General Info

Members Datasets Scaffolds Average Seq Length
767 404 1534 472

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0023441|Ga0466961_0023441_1469_3082
Length 537
Sequence MFGLTMAYIHTLPRQREPRLQVAMHTAANAGCVIMFNSFSRSLWKFCTIDGARRRTKNLQFMCTKPMDSDLQIRIDRTAKLSLSEQIRASISRAIESGLLPPGARLPSWQDLAARLGVARGTVQAAYERLSDAQLIETFRAGGTCVAARPLTTATQSSAPRLGDFMKSYQEMNAGPAIFQLGIPAFEGLPEKLFARTRSSNLLKAGCLASPLYPDPRGEFELRREIAGYLSIARNLHCDPEQVFITSGYISGLGLALRVLGLDGKKVWMEEPGFHLARKGLELARLHIVPVPVDAEGLDVGYGIKHAADAALAVVTPGQQAPLGVTLSLKRRRQLLEWAASTGAWIIEDDYLSELQLEGRAAPALASSDEGKRVIHIGSFSKTISPGLRLGFIVAPAELANAFSEVSAALVPAPSPIVQVATAQFMRDGHYIRRVRRLKRLYSSQRDALCAQLRKHKAQWTHAGLAVLLKLPANVSDAEIVRDARTMGMAPSPLSAWFAIPTRHSSGLLLGVATAPEQHVATACRQLLQIMDQHRRG

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
53 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
54 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
118 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
262 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
275 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
276 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
277 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
278 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
279 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
280 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
281 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
282 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
283 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
284 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
285 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
286 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
287 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
288 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
289 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
290 2643221556 Massilia sp. Root1485 Isolate Unclassified
291 2643221584 Caulobacter sp. Root656 Isolate Unclassified
292 2643221618 Ensifer sp. Root231 Isolate Unclassified
293 2643221626 Ensifer sp. Root31 Isolate Unclassified
294 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
295 2643221638 Duganella sp. Root336D2 Isolate Unclassified
296 2643221655 Ensifer sp. Root1252 Isolate Unclassified
297 2643221659 Ensifer sp. Root127 Isolate Unclassified
298 2643221684 Massilia sp. Root133 Isolate Unclassified
299 2643221698 Ensifer sp. Root142 Isolate Unclassified
300 2643221712 Ensifer sp. Root258 Isolate Unclassified
301 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
302 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
303 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
304 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
305 2738541307 Variovorax sp. GV008 Isolate Unclassified
306 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
307 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
308 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
309 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
310 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
311 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
312 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
313 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
314 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
315 2791355260 Rhizobium sp. L9 Isolate Nodule
316 2791355267 Rhizobium sp. L18 Isolate Nodule
317 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
318 2802429634 Rhizobium anhuiense S10 Isolate Nodule
319 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
320 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
321 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
322 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
323 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
324 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
325 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
326 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
327 2831864461 Roseateles noduli HZ7 Isolate Nodule
328 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
329 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
330 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
331 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
332 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
333 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
334 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
335 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
336 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
337 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
338 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
339 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
340 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
341 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
342 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
343 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
344 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
345 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
346 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
347 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
348 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
349 2904699407
350 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
351 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
352 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
353 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
354 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
355 2909042592 Labrys sp. LIt4 Isolate Nodule
356 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
357 2922425934
358 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
359 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
360 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
361 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
362 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
363 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
364 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
365 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
366 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
367 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
368 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
369 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
370 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
371 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
372 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
373 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
374 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
375 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
376 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
377 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
378 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
379 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
380 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
381 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
382 2941471342 Luteibacter sp. 621 Isolate Unclassified
383 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
384 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
385 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
386 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
387 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
388 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
389 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
390 641522639 Methylobacterium sp. 4-46 Isolate Nodule
391 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
392 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
393 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
394 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
395 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
396 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
397 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
398 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
399 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
400 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
401 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
402 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
403 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
404 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.22
Metatranscriptomes 0
Isolates 17.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.65
Nodule 10.43
Rhizoplane 3
Rhizosphere 56.58
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0023441 3300044693 Bacteria 3971
2 JGI24738J21930_10000521 3300002075 Bacteria 10952
3 JGI25158J39367_1001076 3300002739 Bacteria 4961
4 JGI25150J39212_1003484 3300002774 Bacteria 3674
5 JGI25159J45721_1003778 3300002987 Bacteria 5224
6 JGI25151J46595_10000338 3300003187 Bacteria 50270
7 rootH1_10004683 3300003316 Bacteria 3382
8 rootH2_10023281 3300003320 Bacteria 4210
9 rootH2_10063443 3300003320 Bacteria 3496
10 rootH2_10101131 3300003320 Bacteria 2504
11 rootL2_10001921 3300003322 Bacteria 16576
12 rootL2_10066572 3300003322 Bacteria 3516
13 rootL2_10236162 3300003322 Bacteria 3620
14 rootH1_10056171 3300003323 Bacteria 2467
15 rootH1_10099455 3300003323 Bacteria 7948
16 rootH1_10238995 3300003323 Bacteria 1947
17 JGI25160J50197_1012996 3300003354 Bacteria 2858
18 JGI25161J50226_1000422 3300003374 Bacteria 20266
19 Ga0055539_1001020 3300003752 Bacteria 6031
20 Ga0055526_1000344 3300003771 Bacteria 38140
21 Ga0055526_1001794 3300003771 Bacteria 14879
22 Ga0055526_1004959 3300003771 Bacteria 7816
23 Ga0055526_1007352 3300003771 Bacteria 5748
24 Ga0055526_1012889 3300003771 Bacteria 3594
25 Ga0055537_1000066 3300003773 Bacteria 76478
26 Ga0055537_1001231 3300003773 Bacteria 10751
27 Ga0055537_1002572 3300003773 Bacteria 5957
28 Ga0055537_1009522 3300003773 Bacteria 2134
29 Ga0055524_1001045 3300003775 Bacteria 17074
30 Ga0055524_1001055 3300003775 Bacteria 16979
31 Ga0055524_1002019 3300003775 Bacteria 10828
32 Ga0055524_1002588 3300003775 Bacteria 9213
33 Ga0055536_1000103 3300003781 Bacteria 73706
34 Ga0055534_1000057 3300003784 Bacteria 85576
35 Ga0055534_1000085 3300003784 Bacteria 72934
36 Ga0055534_1000104 3300003784 Bacteria 64767
37 Ga0055534_1000158 3300003784 Bacteria 50846
38 Ga0055534_1002848 3300003784 Bacteria 5760
39 Ga0055534_1005419 3300003784 Bacteria 3417
40 Ga0055528_1000318 3300003790 Bacteria 40528
41 Ga0055528_1000457 3300003790 Bacteria 32565
42 Ga0055530_10000164 3300003791 Bacteria 60316
43 Ga0055530_10001073 3300003791 Bacteria 21517
44 Ga0055530_10006703 3300003791 Bacteria 5058
45 Ga0055530_10015783 3300003791 Bacteria 2446
46 Ga0055530_10018560 3300003791 Bacteria 2139
47 Ga0055531_10002244 3300003794 Bacteria 13080
48 Ga0055531_10002595 3300003794 Bacteria 11968
49 Ga0055531_10002776 3300003794 Bacteria 11495
50 Ga0055531_10009846 3300003794 Bacteria 4840
51 Ga0055531_10021787 3300003794 Bacteria 2471
52 Ga0058692_1000001 3300003856 Bacteria 834230
53 Ga0055543_1000750 3300004625 Bacteria 16316
54 Ga0055543_1013092 3300004625 Bacteria 1649
55 Ga0065165_1000323 3300005262 Bacteria 78079
56 Ga0065165_1001295 3300005262 Bacteria 28121
57 Ga0065165_1001608 3300005262 Bacteria 23076
58 Ga0065165_1001785 3300005262 Bacteria 21254
59 Ga0065165_1002099 3300005262 Bacteria 18236
60 Ga0070683_100073572 3300005329 Bacteria 3191
61 Ga0068868_100081083 3300005338 Bacteria 2601
62 Ga0070668_100171535 3300005347 Bacteria 1766
63 Ga0070675_100055471 3300005354 Bacteria 3262
64 Ga0070671_100077934 3300005355 Bacteria 2770
65 Ga0070673_100057279 3300005364 Bacteria 3079
66 Ga0070673_100191034 3300005364 Bacteria 1759
67 Ga0070667_100031006 3300005367 Bacteria 4457
68 Ga0070667_100076083 3300005367 Bacteria 2866
69 Ga0070663_100026674 3300005455 Bacteria 3915
70 Ga0070706_100016569 3300005467 Bacteria 6807
71 Ga0070698_100006981 3300005471 Bacteria 12227
72 Ga0070699_100021704 3300005518 Bacteria 5536
73 Ga0070679_100066236 3300005530 Bacteria 3600
74 Ga0070684_100035827 3300005535 Bacteria 4250
75 Ga0070697_100025973 3300005536 Bacteria 4673
76 Ga0070697_100144410 3300005536 Bacteria 2002
77 Ga0070665_100003864 3300005548 Bacteria 15851
78 Ga0070665_100011128 3300005548 Bacteria 9092
79 Ga0070665_100181465 3300005548 Bacteria 2106
80 Ga0068855_100065623 3300005563 Bacteria 4232
81 Ga0070664_100013756 3300005564 Bacteria 6594
82 Ga0068857_100001662 3300005577 Bacteria 17849
83 Ga0068857_100069985 3300005577 Bacteria 3125
84 Ga0068854_100002216 3300005578 Bacteria 11955
85 Ga0068856_100002254 3300005614 Bacteria 19910
86 Ga0068852_100151502 3300005616 Bacteria 2157
87 Ga0081455_10030359 3300005937 Bacteria 4910
88 Ga0075432_10006014 3300006058 Bacteria 4133
89 Ga0070712_100085252 3300006175 Bacteria 2299
90 Ga0075370_10021735 3300006353 Bacteria 3516
91 Ga0068871_100031714 3300006358 Bacteria 4169
92 Ga0068865_100116142 3300006881 Bacteria 1982
93 Ga0099825_1022681 3300006941 Bacteria 3999
94 Ga0099824_1002487 3300006942 Bacteria 26950
95 Ga0099822_1001480 3300006943 Bacteria 27484
96 Ga0105251_10025719 3300009011 Bacteria 3007
97 Ga0105244_10003674 3300009036 Bacteria 10835
98 Ga0105244_10013049 3300009036 Bacteria 4874
99 Ga0105240_10003464 3300009093 Bacteria 24478
100 Ga0105240_10008605 3300009093 Bacteria 14585
101 Ga0105240_10048479 3300009093 Bacteria 5368
102 Ga0105240_10144472 3300009093 Bacteria 2840
103 Ga0105241_10011257 3300009174 Bacteria 6559
104 Ga0105248_10003289 3300009177 Bacteria 17935
105 Ga0105248_10044933 3300009177 Bacteria 4954
106 Ga0105238_10001028 3300009551 Bacteria 28385
107 Ga0105238_10031004 3300009551 Bacteria 5443
108 Ga0105238_10042210 3300009551 Bacteria 4619
109 Ga0105246_10028919 3300011119 Bacteria 3645
110 Ga0157319_1000026 3300012497 Bacteria 63349
111 Ga0157370_10010294 3300013104 Bacteria 9866
112 Ga0157369_10002208 3300013105 Bacteria 23445
113 Ga0157369_10005932 3300013105 Bacteria 14188
114 Ga0157369_10014477 3300013105 Bacteria 8902
115 Ga0157369_10108132 3300013105 Bacteria 2958
116 Ga0157374_10265234 3300013296 Bacteria 1692
117 Ga0163162_10104303 3300013306 Bacteria 2930
118 Ga0157372_10025495 3300013307 Bacteria 6430
119 Ga0157372_10031668 3300013307 Bacteria 5791
120 Ga0163163_10134767 3300014325 Bacteria 2510
121 Ga0157380_10038615 3300014326 Bacteria 3708
122 Ga0182008_10010733 3300014497 Bacteria 4894
123 Ga0157377_10064211 3300014745 Bacteria 2105
124 Ga0157376_10098612 3300014969 Bacteria 2548
125 Ga0182007_10007531 3300015262 Bacteria 4554
126 Ga0213872_10000017 3300021361 Bacteria 178787
127 Ga0213872_10000340 3300021361 Bacteria 39602
128 Ga0213872_10000601 3300021361 Bacteria 27442
129 Ga0209436_100646 3300025208 Bacteria 14855
130 Ga0209436_101485 3300025208 Bacteria 8114
131 Ga0209436_102991 3300025208 Bacteria 4697
132 Ga0207425_1000093 3300025245 Bacteria 87038
133 Ga0209646_1000039 3300025246 Bacteria 349637
134 Ga0209026_1000006 3300025250 Bacteria 677225
135 Ga0209677_100131 3300025253 Bacteria 72722
136 Ga0209677_103741 3300025253 Bacteria 4753
137 Ga0209148_1000480 3300025254 Bacteria 42052
138 Ga0209759_1000020 3300025256 Bacteria 344904
139 Ga0209759_1013763 3300025256 Bacteria 2172
140 Ga0209129_1003503 3300025258 Bacteria 6781
141 Ga0209565_1000006 3300025263 Bacteria 897294
142 Ga0209565_1000082 3300025263 Bacteria 154452
143 Ga0209565_1000493 3300025263 Bacteria 28875
144 Ga0209565_1000589 3300025263 Bacteria 24545
145 Ga0209565_1003314 3300025263 Bacteria 5276
146 Ga0209565_1014228 3300025263 Bacteria 1835
147 Ga0209455_1000546 3300025272 Bacteria 25771
148 Ga0209673_1000004 3300025273 Bacteria 896155
149 Ga0209673_1000422 3300025273 Bacteria 73685
150 Ga0209673_1010617 3300025273 Bacteria 3864
151 Ga0209673_1023251 3300025273 Bacteria 2116
152 Ga0209130_1000016 3300025284 Bacteria 395540
153 Ga0209130_1000139 3300025284 Bacteria 115951
154 Ga0209130_1001085 3300025284 Bacteria 20318
155 Ga0209675_1000006 3300025291 Bacteria 732267
156 Ga0209675_1000078 3300025291 Bacteria 156111
157 Ga0209675_1000176 3300025291 Bacteria 73644
158 Ga0209675_1000183 3300025291 Bacteria 70391
159 Ga0209676_1000121 3300025292 Bacteria 198920
160 Ga0209676_1000234 3300025292 Bacteria 119888
161 Ga0209676_1000475 3300025292 Bacteria 66299
162 Ga0209025_1000051 3300025294 Bacteria 330080
163 Ga0209025_1001389 3300025294 Bacteria 32297
164 Ga0209564_1000102 3300025295 Bacteria 222597
165 Ga0209564_1000133 3300025295 Bacteria 189140
166 Ga0209564_1000438 3300025295 Bacteria 71794
167 Ga0209564_1000959 3300025295 Bacteria 36638
168 Ga0209564_1001315 3300025295 Bacteria 26597
169 Ga0209564_1016465 3300025295 Bacteria 2941
170 Ga0209758_1010715 3300025297 Bacteria 5440
171 Ga0209050_1000086 3300025298 Bacteria 262009
172 Ga0209050_1000132 3300025298 Bacteria 185906
173 Ga0209050_1000211 3300025298 Bacteria 129614
174 Ga0209050_1000901 3300025298 Bacteria 39362
175 Ga0209050_1002185 3300025298 Bacteria 17651
176 Ga0209050_1002364 3300025298 Bacteria 16429
177 Ga0209050_1006427 3300025298 Bacteria 6962
178 Ga0209256_1000037 3300025299 Bacteria 377661
179 Ga0209256_1000075 3300025299 Bacteria 236149
180 Ga0209256_1000323 3300025299 Bacteria 82313
181 Ga0209256_1001354 3300025299 Bacteria 25880
182 Ga0209256_1001994 3300025299 Bacteria 18311
183 Ga0207426_1001352 3300025302 Bacteria 20790
184 Ga0209257_1000087 3300025304 Bacteria 282503
185 Ga0209257_1000176 3300025304 Bacteria 161436
186 Ga0209257_1001687 3300025304 Bacteria 24841
187 Ga0209257_1002887 3300025304 Bacteria 15976
188 Ga0209257_1006793 3300025304 Bacteria 7200
189 Ga0209257_1007083 3300025304 Bacteria 6920
190 Ga0209257_1008617 3300025304 Bacteria 5726
191 Ga0207697_10023243 3300025315 Bacteria 2538
192 Ga0207655_1000353 3300025728 Bacteria 66222
193 Ga0207647_10000056 3300025904 Bacteria 86476
194 Ga0207654_10004740 3300025911 Bacteria 6886
195 Ga0207707_10032895 3300025912 Bacteria 4539
196 Ga0207695_10018217 3300025913 Bacteria 8126
197 Ga0207695_10157574 3300025913 Bacteria 2204
198 Ga0207693_10023813 3300025915 Bacteria 4860
199 Ga0207652_10039347 3300025921 Bacteria 4013
200 Ga0207694_10001251 3300025924 Bacteria 21943
201 Ga0207694_10014394 3300025924 Bacteria 5962
202 Ga0207694_10085049 3300025924 Bacteria 2489
203 Ga0207659_10077002 3300025926 Bacteria 2454
204 Ga0207704_10093523 3300025938 Bacteria 1982
205 Ga0207711_10014773 3300025941 Bacteria 6489
206 Ga0207711_10134500 3300025941 Bacteria 2220
207 Ga0207658_10121320 3300025986 Bacteria 2085
208 Ga0207677_10043488 3300026023 Bacteria 2986
209 Ga0207678_10037743 3300026067 Bacteria 4201
210 Ga0207678_10119150 3300026067 Bacteria 2252
211 Ga0207678_10137201 3300026067 Bacteria 2087
212 Ga0207702_10000310 3300026078 Bacteria 55596
213 Ga0207702_10059788 3300026078 Bacteria 3247
214 Ga0207674_10005337 3300026116 Bacteria 15287
215 Ga0207674_10033062 3300026116 Bacteria 5418
216 Ga0207683_10091351 3300026121 Bacteria 2712
217 Ga0207698_10120822 3300026142 Bacteria 2217
218 Ga0209371_1000008 3300027312 Bacteria 1024606
219 Ga0209589_1000001 3300027357 Bacteria 794224
220 Ga0209489_100001 3300027361 Bacteria 794224
221 Ga0209700_100001 3300027363 Bacteria 794224
222 Ga0209282_1000295 3300027666 Bacteria 24592
223 Ga0268266_10020911 3300028379 Bacteria 5578
224 Ga0268266_10066984 3300028379 Bacteria 3107
225 Ga0268256_1000009 3300030500 Bacteria 1022625
226 Ga0268256_1003305 3300030500 Bacteria 7399
227 Ga0307408_100000106 3300031548 Bacteria 91438
228 Ga0307408_100007672 3300031548 Bacteria 7134
229 Ga0307408_100021926 3300031548 Bacteria 4331
230 Ga0307412_10000039 3300031911 Bacteria 182976
231 Ga0307412_10008824 3300031911 Bacteria 5773
232 Ga0307414_10000625 3300032004 Bacteria 18080
233 Ga0307414_10003068 3300032004 Bacteria 8863
234 Ga0307510_10054892 3300033180 Bacteria 4167
235 Ga0307510_10144619 3300033180 Bacteria 2013
236 Ga0315911_1000006 3300033442 Bacteria 414563
237 Ga0373925_0174503 3300037068 Bacteria 1698
238 Ga0395899_0025088 3300037312 Bacteria 4501
239 Ga0395899_0082082 3300037312 Bacteria 2345
240 Ga0395900_0065228 3300037418 Bacteria 3740
241 Ga0395900_0105371 3300037418 Bacteria 2897
242 Ga0395898_0018936 3300037466 Bacteria 7014
243 Ga0395905_0000017 3300037471 Bacteria 376619
244 Ga0395905_0002694 3300037471 Bacteria 19467
245 Ga0395905_0068821 3300037471 Bacteria 3316
246 Ga0395905_0153203 3300037471 Bacteria 2168
247 Ga0395905_0187963 3300037471 Bacteria 1938
248 Ga0395905_0234142 3300037471 Bacteria 1717
249 Ga0395901_0148287 3300038443 Bacteria 2465
250 Ga0436361_0066216 3300039447 Bacteria 14338
251 Ga0436361_0267501 3300039447 Bacteria 17700
252 Ga0436361_0713206 3300039447 Bacteria 50586
253 Ga0466972_0000113 3300044658 Bacteria 69042
254 Ga0466973_0042256 3300044659 Bacteria 4287
255 Ga0466965_0101852 3300044683 Bacteria 1469
256 Ga0466966_0015365 3300044684 Bacteria 5063
257 Ga0466963_0102937 3300044694 Bacteria 1956
258 Ga0466964_0063385 3300044706 Bacteria 1544
259 Ga0466971_0035000 3300044719 Bacteria 2251
260 Ga0466970_0023132 3300044765 Bacteria 3244
261 Ga0466957_0035886 3300044842 Bacteria 2977
262 Ga0466960_0027303 3300044901 Bacteria 2602
263 Ga0466959_0083614 3300045049 Bacteria 2298
264 Ga0466958_0018512 3300045836 Bacteria 4043
265 Ga0495617_000055 3300046452 Bacteria 102065
266 Ga0495617_002131 3300046452 Bacteria 8144
267 Ga0495627_000123 3300046453 Bacteria 94862
268 Ga0495627_004917 3300046453 Bacteria 5499
269 Ga0495603_0042339 3300046455 Bacteria 2722
270 Ga0495590_0000013 3300046457 Bacteria 271977
271 Ga0495590_0000377 3300046457 Bacteria 22736
272 Ga0495590_0000379 3300046457 Bacteria 22644
273 Ga0495590_0011248 3300046457 Bacteria 3350
274 Ga0495590_0024301 3300046457 Bacteria 2135
275 Ga0495591_000176 3300046458 Bacteria 66020
276 Ga0495591_008008 3300046458 Bacteria 4391
277 Ga0495629_0000115 3300046459 Bacteria 72648
278 Ga0495629_0013994 3300046459 Bacteria 5782
279 Ga0495629_0060852 3300046459 Bacteria 2638
280 Ga0495638_0000316 3300046460 Bacteria 62373
281 Ga0495638_0014655 3300046460 Bacteria 5290
282 Ga0495638_0015372 3300046460 Bacteria 5141
283 Ga0495638_0100667 3300046460 Bacteria 1729
284 Ga0495653_0025917 3300046463 Bacteria 4705
285 Ga0495650_0017832 3300046471 Bacteria 3548
286 Ga0495650_0022015 3300046471 Bacteria 3064
287 Ga0495580_0007991 3300046472 Bacteria 8453
288 Ga0495582_0013488 3300046473 Bacteria 4500
289 Ga0495605_0000035 3300046474 Bacteria 208069
290 Ga0495605_0010050 3300046474 Bacteria 5300
291 Ga0495605_0010344 3300046474 Bacteria 5223
292 Ga0495605_0037315 3300046474 Bacteria 2445
293 Ga0495605_0048247 3300046474 Bacteria 2085
294 Ga0495605_0055143 3300046474 Bacteria 1921
295 Ga0495664_0034857 3300046477 Bacteria 2962
296 Ga0495584_0000029 3300046491 Bacteria 105850
297 Ga0495584_0000710 3300046491 Bacteria 21958
298 Ga0495584_0001111 3300046491 Bacteria 16697
299 Ga0495584_0059053 3300046491 Bacteria 1929
300 Ga0495585_0000106 3300046492 Bacteria 89096
301 Ga0495585_0000229 3300046492 Bacteria 57675
302 Ga0495585_0001128 3300046492 Bacteria 21900
303 Ga0495585_0005576 3300046492 Bacteria 7904
304 Ga0495585_0013289 3300046492 Bacteria 4822
305 Ga0495585_0014721 3300046492 Bacteria 4551
306 Ga0495585_0022156 3300046492 Bacteria 3647
307 Ga0495585_0075937 3300046492 Bacteria 1826
308 Ga0495585_0096668 3300046492 Bacteria 1584
309 Ga0495594_0004607 3300046499 Bacteria 7101
310 Ga0495594_0007102 3300046499 Bacteria 5760
311 Ga0495594_0011370 3300046499 Bacteria 4625
312 Ga0495594_0013155 3300046499 Bacteria 4315
313 Ga0495596_0000011 3300046500 Bacteria 129089
314 Ga0495596_0000831 3300046500 Bacteria 18667
315 Ga0495596_0005573 3300046500 Bacteria 5916
316 Ga0495596_0007503 3300046500 Bacteria 4917
317 Ga0495596_0008269 3300046500 Bacteria 4639
318 Ga0495596_0009259 3300046500 Bacteria 4339
319 Ga0495596_0013241 3300046500 Bacteria 3505
320 Ga0495596_0035127 3300046500 Bacteria 1988
321 Ga0495607_0001166 3300046501 Bacteria 23766
322 Ga0495607_0001312 3300046501 Bacteria 22173
323 Ga0495607_0002001 3300046501 Bacteria 17120
324 Ga0495607_0004125 3300046501 Bacteria 10839
325 Ga0495607_0004590 3300046501 Bacteria 10119
326 Ga0495583_0000078 3300046506 Bacteria 171719
327 Ga0495583_0000461 3300046506 Bacteria 60164
328 Ga0495583_0004535 3300046506 Bacteria 9889
329 Ga0495583_0017018 3300046506 Bacteria 3877
330 Ga0495606_0000768 3300046507 Bacteria 49245
331 Ga0495606_0002036 3300046507 Bacteria 24770
332 Ga0495606_0002482 3300046507 Bacteria 21346
333 Ga0495606_0003708 3300046507 Bacteria 15959
334 Ga0495606_0005159 3300046507 Bacteria 12641
335 Ga0495606_0008542 3300046507 Bacteria 8870
336 Ga0495606_0052998 3300046507 Bacteria 2634
337 Ga0495610_0007788 3300046512 Bacteria 7062
338 Ga0495610_0011297 3300046512 Bacteria 5470
339 Ga0495610_0035320 3300046512 Bacteria 2568
340 Ga0495616_0001754 3300046513 Bacteria 14757
341 Ga0495616_0001933 3300046513 Bacteria 13938
342 Ga0495616_0004418 3300046513 Bacteria 8865
343 Ga0495616_0025903 3300046513 Bacteria 3127
344 Ga0495616_0027319 3300046513 Bacteria 3029
345 Ga0495616_0027678 3300046513 Bacteria 3006
346 Ga0495620_0002400 3300046515 Bacteria 10853
347 Ga0495628_0004561 3300046516 Bacteria 12265
348 Ga0495630_0053411 3300046517 Bacteria 3025
349 Ga0495631_0002790 3300046518 Bacteria 9691
350 Ga0495631_0005006 3300046518 Bacteria 6981
351 Ga0495631_0017627 3300046518 Bacteria 3374
352 Ga0495631_0035198 3300046518 Bacteria 2241
353 Ga0495631_0046090 3300046518 Bacteria 1917
354 Ga0495632_0006072 3300046519 Bacteria 7836
355 Ga0495632_0026740 3300046519 Bacteria 3032
356 Ga0495637_0000008 3300046520 Bacteria 404658
357 Ga0495637_0037168 3300046520 Bacteria 2116
358 Ga0495643_0004707 3300046522 Bacteria 9458
359 Ga0495643_0009146 3300046522 Bacteria 6191
360 Ga0495643_0009738 3300046522 Bacteria 5944
361 Ga0495643_0014120 3300046522 Bacteria 4760
362 Ga0495643_0044131 3300046522 Bacteria 2423
363 Ga0495644_0002537 3300046523 Bacteria 7275
364 Ga0495644_0004610 3300046523 Bacteria 5415
365 Ga0495644_0009804 3300046523 Bacteria 3687
366 Ga0495644_0032759 3300046523 Bacteria 1964
367 Ga0495648_0000410 3300046524 Bacteria 47244
368 Ga0495648_0000527 3300046524 Bacteria 41184
369 Ga0495648_0001273 3300046524 Bacteria 25146
370 Ga0495648_0005588 3300046524 Bacteria 10425
371 Ga0495648_0007550 3300046524 Bacteria 8691
372 Ga0495648_0009591 3300046524 Bacteria 7472
373 Ga0495648_0034008 3300046524 Bacteria 3323
374 Ga0495648_0052268 3300046524 Bacteria 2483
375 Ga0495648_0065821 3300046524 Bacteria 2127
376 Ga0495666_0022568 3300046526 Bacteria 3116
377 Ga0495642_0000005 3300046528 Bacteria 176726
378 Ga0495642_0000946 3300046528 Bacteria 13585
379 Ga0495642_0008610 3300046528 Bacteria 3902
380 Ga0495665_0001347 3300046531 Bacteria 13125
381 Ga0495665_0015486 3300046531 Bacteria 4106
382 Ga0495586_0003975 3300046535 Bacteria 7934
383 Ga0495609_0000754 3300046538 Bacteria 24406
384 Ga0495609_0001400 3300046538 Bacteria 16184
385 Ga0495609_0003203 3300046538 Bacteria 9501
386 Ga0495609_0007383 3300046538 Bacteria 5494
387 Ga0495609_0010817 3300046538 Bacteria 4363
388 Ga0495597_0000157 3300046542 Bacteria 60125
389 Ga0495597_0000277 3300046542 Bacteria 46764
390 Ga0495597_0000422 3300046542 Bacteria 36291
391 Ga0495597_0010954 3300046542 Bacteria 4409
392 Ga0495597_0016658 3300046542 Bacteria 3469
393 Ga0495622_0006257 3300046557 Bacteria 5524
394 Ga0495622_0020682 3300046557 Bacteria 3064
395 Ga0495622_0021939 3300046557 Bacteria 2974
396 Ga0495622_0023931 3300046557 Bacteria 2850
397 Ga0495622_0039968 3300046557 Bacteria 2184
398 Ga0495633_0004992 3300046558 Bacteria 8276
399 Ga0495668_0000160 3300046616 Bacteria 101615
400 Ga0495668_0000987 3300046616 Bacteria 31002
401 Ga0495668_0002104 3300046616 Bacteria 17216
402 Ga0495668_0004835 3300046616 Bacteria 9371
403 Ga0495611_0000976 3300046648 Bacteria 15225
404 Ga0495611_0009008 3300046648 Bacteria 4220
405 Ga0495611_0010637 3300046648 Bacteria 3894
406 Ga0495611_0016598 3300046648 Bacteria 3146
407 Ga0495611_0021647 3300046648 Bacteria 2778
408 Ga0495611_0031932 3300046648 Bacteria 2320
409 Ga0495611_0033151 3300046648 Bacteria 2279
410 Ga0495611_0041704 3300046648 Bacteria 2047
411 Ga0495625_0000351 3300046660 Bacteria 70408
412 Ga0495625_0002025 3300046660 Bacteria 22827
413 Ga0495625_0004594 3300046660 Bacteria 12980
414 Ga0495625_0085939 3300046660 Bacteria 2183
415 Ga0495625_0172386 3300046660 Bacteria 1444
416 Ga0495661_0000198 3300046665 Bacteria 69566
417 Ga0495661_0001403 3300046665 Bacteria 20212
418 Ga0495661_0002353 3300046665 Bacteria 14589
419 Ga0495661_0005921 3300046665 Bacteria 8639
420 Ga0495661_0006329 3300046665 Bacteria 8326
421 Ga0495661_0012180 3300046665 Bacteria 5808
422 Ga0495588_0011362 3300046674 Bacteria 4175
423 Ga0495588_0014329 3300046674 Bacteria 3793
424 Ga0495623_0007537 3300046679 Bacteria 7062
425 Ga0495646_0049497 3300046680 Bacteria 2550
426 Ga0495669_0000015 3300046684 Bacteria 140309
427 Ga0495669_0001059 3300046684 Bacteria 11471
428 Ga0495669_0001177 3300046684 Bacteria 10867
429 Ga0495669_0011562 3300046684 Bacteria 3751
430 Ga0495669_0018100 3300046684 Bacteria 3026
431 Ga0495669_0072874 3300046684 Bacteria 1567
432 Ga0495613_0043829 3300046689 Bacteria 3311
433 Ga0495624_0071872 3300046690 Bacteria 2152
434 Ga0495670_0000009 3300046691 Bacteria 210956
435 Ga0495670_0001567 3300046691 Bacteria 11179
436 Ga0495670_0013858 3300046691 Bacteria 3964
437 Ga0495670_0021187 3300046691 Bacteria 3206
438 Ga0495670_0041926 3300046691 Bacteria 2284
439 Ga0495670_0053888 3300046691 Bacteria 2014
440 Ga0495671_0000294 3300046692 Bacteria 41764
441 Ga0495671_0000326 3300046692 Bacteria 39898
442 Ga0495649_0000071 3300046694 Bacteria 89386
443 Ga0495649_0013880 3300046694 Bacteria 4632
444 Ga0495649_0026776 3300046694 Bacteria 3203
445 Ga0495589_0000033 3300046794 Bacteria 162794
446 Ga0495589_0002183 3300046794 Bacteria 11015
447 Ga0495589_0012544 3300046794 Bacteria 4387
448 Ga0495589_0015373 3300046794 Bacteria 3940
449 Ga0495660_0005491 3300046810 Bacteria 7595
450 Ga0495660_0009038 3300046810 Bacteria 5820
451 Ga0495660_0013564 3300046810 Bacteria 4722
452 Ga0495660_0026662 3300046810 Bacteria 3274
453 Ga0495660_0041439 3300046810 Bacteria 2549
454 Ga0495604_0088962 3300047317 Bacteria 2296
455 Ga0495636_0002361 3300047318 Bacteria 7243
456 Ga0495636_0058990 3300047318 Bacteria 1619
457 Ga0495674_0009273 3300047319 Bacteria 9352
458 Ga0495674_0078808 3300047319 Bacteria 2830
459 Ga0495674_0095508 3300047319 Bacteria 2534
460 Ga0495672_0000033 3300047320 Bacteria 291992
461 Ga0495672_0000074 3300047320 Bacteria 179013
462 Ga0495672_0007413 3300047320 Bacteria 8253
463 Ga0495672_0034322 3300047320 Bacteria 3136
464 Ga0495672_0064247 3300047320 Bacteria 2102
465 Ga0495672_0090187 3300047320 Bacteria 1685
466 Ga0495676_0000223 3300047321 Bacteria 45610
467 Ga0495676_0000643 3300047321 Bacteria 28962
468 Ga0495676_0014902 3300047321 Bacteria 6942
469 Ga0495676_0022190 3300047321 Bacteria 5529
470 Ga0495676_0079875 3300047321 Bacteria 2485
471 Ga0495676_0094089 3300047321 Bacteria 2233
472 Ga0495683_0000024 3300047323 Bacteria 156554
473 Ga0495687_000046 3300047443 Bacteria 210412
474 Ga0495687_027855 3300047443 Bacteria 2638
475 Ga0495687_048187 3300047443 Bacteria 1829
476 Ga0495677_0000203 3300047445 Bacteria 27348
477 Ga0495677_0003472 3300047445 Bacteria 6119
478 Ga0495679_000641 3300047446 Bacteria 23464
479 Ga0495679_005255 3300047446 Bacteria 5775
480 Ga0495679_006520 3300047446 Bacteria 5002
481 Ga0495685_012445 3300047447 Bacteria 2883
482 Ga0495685_019051 3300047447 Bacteria 2356
483 Ga0495673_0001551 3300047469 Bacteria 18022
484 Ga0495673_0010794 3300047469 Bacteria 4947
485 Ga0495673_0052650 3300047469 Bacteria 1778
486 Ga0495686_0000026 3300047472 Bacteria 383637
487 Ga0495686_0000171 3300047472 Bacteria 123194
488 Ga0495686_0000431 3300047472 Bacteria 65240
489 Ga0495686_0000735 3300047472 Bacteria 43727
490 Ga0495686_0013210 3300047472 Bacteria 5741
491 Ga0495686_0022962 3300047472 Bacteria 4120
492 Ga0495686_0070966 3300047472 Bacteria 2145
493 Ga0495686_0095209 3300047472 Unclassified 1803
494 Ga0495626_0003138 3300048091 Bacteria 10816
495 Ga0495626_0003399 3300048091 Bacteria 10240
496 Ga0495626_0016691 3300048091 Bacteria 3724
497 Ga0495626_0025955 3300048091 Bacteria 2860
498 Ga0495626_0026119 3300048091 Bacteria 2849
499 Ga0495626_0027815 3300048091 Bacteria 2746
500 Ga0495626_0038852 3300048091 Bacteria 2254
501 Ga0496101_0167696 3300048904 Bacteria 1686
502 Ga0496102_0000173 3300048905 Bacteria 87737
503 Ga0496102_0004216 3300048905 Bacteria 12155
504 Ga0496104_0024578 3300048907 Bacteria 5542
505 Ga0496104_0285040 3300048907 Bacteria 1565
506 Ga0496105_0045689 3300048908 Bacteria 3614
507 Ga0496106_0000014 3300048909 Bacteria 194239
508 Ga0496106_0009589 3300048909 Bacteria 7148
509 Ga0496106_0111622 3300048909 Bacteria 2129
510 Ga0496107_0000132 3300048910 Bacteria 36454
511 Ga0496107_0001367 3300048910 Bacteria 15005
512 Ga0496108_0028897 3300048911 Bacteria 4588
513 Ga0496109_0004253 3300048912 Bacteria 11960
514 Ga0496109_0026661 3300048912 Bacteria 5155
515 Ga0496110_0008299 3300048913 Bacteria 8351
516 Ga0496112_0042191 3300048915 Bacteria 4463
517 Ga0496113_0074615 3300048916 Bacteria 2586
518 Ga0496114_0087882 3300048917 Bacteria 2636
519 Ga0496115_0008897 3300048918 Bacteria 7443
520 Ga0496115_0084964 3300048918 Bacteria 2580
521 Ga0496116_0030126 3300048919 Bacteria 3903
522 Ga0496117_0006503 3300048920 Bacteria 11786
523 Ga0496117_0039671 3300048920 Bacteria 3472
524 Ga0496117_0047522 3300048920 Bacteria 3076
525 Ga0496118_0000228 3300048921 Bacteria 98198
526 Ga0496118_0055687 3300048921 Bacteria 2981
527 Ga0496118_0077965 3300048921 Bacteria 2347
528 Ga0496121_0000044 3300048924 Bacteria 337672
529 Ga0496121_0000316 3300048924 Bacteria 100872
530 Ga0496121_0001059 3300048924 Bacteria 48728
531 Ga0496121_0006484 3300048924 Bacteria 14498
532 Ga0496121_0008062 3300048924 Bacteria 12551
533 Ga0496121_0009250 3300048924 Bacteria 11378
534 Ga0496121_0013070 3300048924 Bacteria 8963
535 Ga0496121_0013272 3300048924 Bacteria 8871
536 Ga0496121_0018745 3300048924 Bacteria 6958
537 Ga0496121_0020825 3300048924 Bacteria 6462
538 Ga0496121_0045090 3300048924 Bacteria 3793
539 Ga0496121_0053978 3300048924 Bacteria 3362
540 Ga0496121_0062936 3300048924 Bacteria 3035
541 Ga0496121_0067760 3300048924 Bacteria 2891
542 Ga0496121_0089425 3300048924 Bacteria 2411
543 Ga0496121_0134096 3300048924 Bacteria 1848
544 Ga0496121_0181245 3300048924 Bacteria 1520
545 Ga0496122_0000263 3300048925 Bacteria 117762
546 Ga0496122_0004692 3300048925 Bacteria 16781
547 Ga0496122_0116860 3300048925 Bacteria 1733
548 Ga0496123_0000156 3300048926 Bacteria 139362
549 Ga0496123_0000840 3300048926 Bacteria 49126
550 Ga0496123_0008440 3300048926 Bacteria 9464
551 Ga0496124_0069925 3300048927 Bacteria 2913
552 Ga0496125_0000672 3300048928 Bacteria 57073
553 Ga0496125_0027325 3300048928 Bacteria 5176
554 Ga0496125_0055254 3300048928 Bacteria 3237
555 Ga0496125_0121946 3300048928 Bacteria 1857
556 Ga0496126_0001940 3300048929 Bacteria 29487
557 Ga0496126_0003509 3300048929 Bacteria 19758
558 Ga0496126_0037944 3300048929 Bacteria 4486
559 Ga0496126_0041881 3300048929 Bacteria 4234
560 Ga0496126_0068978 3300048929 Bacteria 3155
561 Ga0496126_0069054 3300048929 Bacteria 3153
562 Ga0466983_0006966 3300048986 Bacteria 8111
563 Ga0495678_000024 3300049459 Bacteria 229034
564 Ga0495678_000084 3300049459 Bacteria 117340
565 Ga0495678_012670 3300049459 Bacteria 3988
566 Ga0495678_027512 3300049459 Bacteria 2412
567 Ga0495682_0000114 3300049460 Bacteria 69788
568 Ga0495682_0001658 3300049460 Bacteria 11425
569 Ga0495682_0002118 3300049460 Bacteria 9653
570 Ga0495682_0008300 3300049460 Bacteria 4098
571 Ga0495682_0013577 3300049460 Bacteria 3098
572 Ga0495682_0014505 3300049460 Bacteria 2987
573 Ga0501032_0027862 3300049569 Bacteria 3882
574 Ga0501033_0002631 3300049570 Bacteria 15105
575 Ga0501033_0089457 3300049570 Bacteria 2252
576 Ga0501034_0015233 3300049571 Bacteria 7902
577 Ga0501036_0001868 3300049572 Bacteria 16328
578 Ga0501037_0005101 3300049573 Bacteria 9553
579 Ga0501038_0000276 3300049574 Bacteria 43448
580 Ga0501038_0029628 3300049574 Bacteria 4848
581 Ga0501039_0009202 3300049575 Bacteria 7527
582 Ga0501043_0003013 3300049579 Bacteria 14020
583 Ga0501043_0080638 3300049579 Bacteria 2557
584 Ga0501046_0011595 3300049580 Bacteria 7534
585 Ga0501047_0004929 3300049581 Bacteria 12538
586 Ga0501047_0006910 3300049581 Bacteria 10662
587 Ga0501047_0014333 3300049581 Bacteria 7539
588 Ga0501047_0077944 3300049581 Bacteria 3187
589 Ga0501048_0038426 3300049582 Bacteria 3434
590 Ga0501067_0002106 3300049583 Bacteria 10960
591 Ga0501068_0024578 3300049584 Bacteria 3539
592 Ga0501068_0090958 3300049584 Bacteria 1883
593 Ga0501069_0000483 3300049585 Bacteria 18234
594 Ga0501070_0003133 3300049586 Bacteria 14401
595 Ga0501070_0024967 3300049586 Bacteria 5012
596 Ga0501073_0000456 3300049589 Bacteria 28306
597 Ga0501073_0020341 3300049589 Bacteria 4789
598 Ga0501073_0170183 3300049589 Bacteria 1508
599 Ga0501074_0023481 3300049590 Bacteria 4482
600 Ga0501080_0001321 3300049742 Bacteria 20652
601 Ga0501080_0255474 3300049742 Bacteria 1597
602 Ga0501083_0014280 3300049744 Bacteria 5555
603 Ga0501083_0037976 3300049744 Bacteria 3275
604 Ga0501035_0015892 3300049822 Bacteria 6945
605 Ga0501035_0023613 3300049822 Bacteria 5642
606 Ga0501035_0023771 3300049822 Bacteria 5622
607 Ga0501044_0001875 3300049823 Bacteria 24361
608 Ga0501044_0018935 3300049823 Bacteria 7371
609 Ga0501044_0021138 3300049823 Bacteria 6948
610 Ga0501044_0038973 3300049823 Bacteria 4961
611 Ga0501044_0171353 3300049823 Bacteria 2142
612 nmdc:mga00v17_29895_c1 3300050491 Bacteria 3200
613 nmdc:mga0sz30_10285_c1 3300050516 Bacteria 3583
614 nmdc:mga0sz30_21426_c1 3300050516 Bacteria 2616
615 nmdc:mga0sz30_26189_c1 3300050516 Bacteria 2389
616 Ga0500554_007438 3300053102 Bacteria 2520
617 Ga0500594_0004725 3300053118 Bacteria 3006
618 Ga0500595_004260 3300053119 Bacteria 6453
619 Ga0500658_0013447 3300053134 Bacteria 3024
620 Ga0500568_0002410 3300053139 Bacteria 11031
621 Ga0500568_0032258 3300053139 Bacteria 2155
622 Ga0500577_0000067 3300053142 Bacteria 23642
623 Ga0500603_000163 3300053150 Bacteria 16654
624 Ga0500616_0018758 3300053153 Bacteria 3909
625 Ga0500622_0012625 3300053156 Bacteria 4572
626 Ga0500637_0000178 3300053178 Bacteria 23661
627 Ga0501084_0181568 3300054114 Bacteria 1776
628 Ga0501082_0027393 3300060353 Bacteria 4905
629 Ga0466962_0042538 3300061719 Bacteria 2174
630 2513657037 2513237096 Bacteria 8722461
631 2513675735 2513237098 Bacteria 9902361
632 2513855478 2513237137 Bacteria 9558895
633 2513876503 2513237139 Bacteria 8737671
634 2513918777 2513237145 Bacteria 8979722
635 2514010844 2513237161 Bacteria 8871253
636 2514053928 2513237166 Bacteria 10373764
637 2515608463 2515154107 Bacteria 6795637
638 2517892026 2517572143 Bacteria 9484767
639 2524441341 2524023205 Bacteria 8918781
640 2524466092 2524023210 Bacteria 9029266
641 2524534102 2524023228 Bacteria 10118060
642 2545675215 2545555834 Bacteria 8130841
643 2599105867 2597490356 Bacteria 7030811
644 2617352901 2617270735 Bacteria 9163226
645 2643792622 2643221554 Bacteria 6603920
646 2643796970 2643221556 Bacteria 7251154
647 2643798481 2643221556 Bacteria 7251154
648 2643927308 2643221584 Bacteria 5511711
649 2644105883 2643221618 Bacteria 7717186
650 2644147152 2643221626 Bacteria 8069654
651 2644191999 2643221634 Bacteria 6705461
652 2644216866 2643221638 Bacteria 6579467
653 2644310495 2643221655 Bacteria 7722067
654 2644334720 2643221659 Bacteria 7890716
655 2644469926 2643221684 Bacteria 7145183
656 2644475487 2643221684 Bacteria 7145183
657 2644545087 2643221698 Bacteria 7756764
658 2644612597 2643221712 Bacteria 7729434
659 2671121931 2667528175 Bacteria 7532676
660 2738819289 2738541296 Bacteria 7285013
661 2738831768 2738541298 Bacteria 7286732
662 2738873296 2738541306 Bacteria 7284992
663 2738885977 2738541307 Bacteria 8606193
664 2739184926 2738543002 Bacteria 7284546
665 2739219895 2738543008 Bacteria 7282815
666 2753765038 2751185897 Bacteria 5322941
667 2770195909 2767802442 Bacteria 5747986
668 2774389381 2773857761 Bacteria 3837365
669 2776267043 2775506902 Bacteria 6208009
670 2776284869 2775506904 Bacteria 5954060
671 2793063998 2791355196 Bacteria 7323613
672 2793068899 2791355197 Bacteria 8420563
673 2793323261 2791355260 Bacteria 6598818
674 2793370782 2791355267 Bacteria 7222458
675 2805919782 2802429603 Bacteria 8777136
676 2806052289 2802429634 Bacteria 7083200
677 2806058590 2802429635 Bacteria 7650140
678 2819643170 2818991453 Bacteria 7181617
679 2824668701 2824661429 Bacteria 9877870
680 2824699168 2824696289 Bacteria 8335049
681 2824710695 2824704595 Bacteria 9667483
682 2824758543 2824753945 Bacteria 9787441
683 2824768282 2824763712 Bacteria 9792355
684 2824779098 2824773399 Bacteria 8360218
685 2831867227 2831864461 Bacteria 6502356
686 2834642177 2834641062 Bacteria 5559922
687 2834643612 2834641062 Bacteria 5559922
688 2838126497 2838122688 Bacteria 8803140
689 2840766690 2840764183 Bacteria 6358399
690 2841947154 2841941048 Bacteria 8688029
691 2841950598 2841949485 Bacteria 8680857
692 2841966912 2841966195 Bacteria 8673214
693 2841975661 2841974524 Bacteria 8931498
694 2841990024 2841983080 Bacteria 8395090
695 2842047340 2842045827 Bacteria 8006841
696 2846955650 2846952575 Bacteria 6587527
697 2847945908 2847939898 Bacteria 8606328
698 2848862364 2848858292 Bacteria 7391279
699 2852682747 2852680915 Bacteria 4100189
700 2879102544 2879099564 Bacteria 10442239
701 2884340623 2884338543 Bacteria 4610696
702 2885277598 2885270888 Bacteria 9831543
703 2885375980 2885374607 Bacteria 8927485
704 2885390805 2885383462 Bacteria 9473874
705 2886853969 2886848708 Bacteria 5632523
706 2903753793 2903748898 Bacteria 9972761
707 2903772970 2903768456 Bacteria 9749579
708 2904702126
709 2904717211 2904711408 Bacteria 9771557
710 2906639214 2906635258 Bacteria 8601019
711 2906662414 2906660503 Bacteria 8595048
712 2908674329 2908669403 Bacteria 5740494
713 2908742302 2908739725 Bacteria 8628932
714 2909047611 2909042592 Bacteria 6499737
715 2919104808 2919100787 Bacteria 7710546
716 2922430691
717 2929617287 2929615660 Bacteria 9193770
718 2929618926 2929615660 Bacteria 9193770
719 2929626991 2929624759 Bacteria 9339455
720 2929631003 2929624759 Bacteria 9339455
721 2932813147 2932809354 Bacteria 9135765
722 2932820939 2932818245 Bacteria 9955613
723 2933579244 2933577622 Bacteria 9116884
724 2933580364 2933577622 Bacteria 9116884
725 2935611804 2935608549 Bacteria 8203142
726 2935645587 2935638405 Bacteria 10015038
727 2935667705 2935665750 Bacteria 9571747
728 2935706545 2935703347 Bacteria 10242284
729 2935768344 2935760218 Bacteria 9817913
730 2935813080 2935810662 Bacteria 9401221
731 2935821282 2935819856 Bacteria 8261050
732 2935830733 2935827899 Bacteria 10038562
733 2935840760 2935837841 Bacteria 9454360
734 2935850457 2935847175 Bacteria 8228321
735 2935914060 2935908558 Bacteria 8568796
736 2935921229 2935916978 Bacteria 9113783
737 2935931751 2935926038 Bacteria 8601059
738 2935940314 2935934488 Bacteria 8602579
739 2935947861 2935942939 Bacteria 8599779
740 2935956598 2935951376 Bacteria 8602333
741 2935973391 2935967501 Bacteria 8603075
742 2936006589 2936002035 Bacteria 9362176
743 2936043632 2936037263 Bacteria 9446081
744 2941473628 2941471342 Bacteria 5018624
745 2941506481 2941499720 Bacteria 7599444
746 2941541109 2941538514 Bacteria 9402094
747 2945940304 2945934425 Bacteria 7444609
748 2990707433 2990703756 Bacteria 7715990
749 3005413552 3005409236 Bacteria 7188837
750 3005447896 3005445848 Bacteria 6906074
751 3005480594 3005474847 Bacteria 9259049
752 641645748 641522639 Bacteria 7737025
753 642423873 641736151 Bacteria 7477263
754 642598637 642555112 Bacteria 8676562
755 8002062456 8002060224 Bacteria 4026565
756 8003401202 8003400568 Bacteria 5535898
757 8005320895 8005314921 Bacteria 7072929
758 8006940178 8006933436 Bacteria 10410654
759 8006979959 8006973647 Bacteria 10679141
760 8019556155 8019555841 Bacteria 9642137
761 8019569152 8019565922 Bacteria 9639779
762 8019627387 8019619141 Bacteria 9218857
763 8019689277 8019687851 Bacteria 8712826
764 8047676773 8047673197 Bacteria 7395230
765 8055742775 8055742211 Bacteria 9226248
766 8055747098 8055742211 Bacteria 9226248
767 8056688186 8056681323 Bacteria 8472857
768 Ga0466961_0023441
769 JGI24738J21930_10000521
770 JGI25158J39367_1001076
771 JGI25150J39212_1003484
772 JGI25159J45721_1003778
773 JGI25151J46595_10000338
774 rootH1_10004683
775 rootH2_10023281
776 rootH2_10063443
777 rootH2_10101131
778 rootL2_10001921
779 rootL2_10066572
780 rootL2_10236162
781 rootH1_10056171
782 rootH1_10099455
783 rootH1_10238995
784 JGI25160J50197_1012996
785 JGI25161J50226_1000422
786 Ga0055539_1001020
787 Ga0055526_1000344
788 Ga0055526_1001794
789 Ga0055526_1004959
790 Ga0055526_1007352
791 Ga0055526_1012889
792 Ga0055537_1000066
793 Ga0055537_1001231
794 Ga0055537_1002572
795 Ga0055537_1009522
796 Ga0055524_1001045
797 Ga0055524_1001055
798 Ga0055524_1002019
799 Ga0055524_1002588
800 Ga0055536_1000103
801 Ga0055534_1000057
802 Ga0055534_1000085
803 Ga0055534_1000104
804 Ga0055534_1000158
805 Ga0055534_1002848
806 Ga0055534_1005419
807 Ga0055528_1000318
808 Ga0055528_1000457
809 Ga0055530_10000164
810 Ga0055530_10001073
811 Ga0055530_10006703
812 Ga0055530_10015783
813 Ga0055530_10018560
814 Ga0055531_10002244
815 Ga0055531_10002595
816 Ga0055531_10002776
817 Ga0055531_10009846
818 Ga0055531_10021787
819 Ga0058692_1000001
820 Ga0055543_1000750
821 Ga0055543_1013092
822 Ga0065165_1000323
823 Ga0065165_1001295
824 Ga0065165_1001608
825 Ga0065165_1001785
826 Ga0065165_1002099
827 Ga0070683_100073572
828 Ga0068868_100081083
829 Ga0070668_100171535
830 Ga0070675_100055471
831 Ga0070671_100077934
832 Ga0070673_100057279
833 Ga0070673_100191034
834 Ga0070667_100031006
835 Ga0070667_100076083
836 Ga0070663_100026674
837 Ga0070706_100016569
838 Ga0070698_100006981
839 Ga0070699_100021704
840 Ga0070679_100066236
841 Ga0070684_100035827
842 Ga0070697_100025973
843 Ga0070697_100144410
844 Ga0070665_100003864
845 Ga0070665_100011128
846 Ga0070665_100181465
847 Ga0068855_100065623
848 Ga0070664_100013756
849 Ga0068857_100001662
850 Ga0068857_100069985
851 Ga0068854_100002216
852 Ga0068856_100002254
853 Ga0068852_100151502
854 Ga0081455_10030359
855 Ga0075432_10006014
856 Ga0070712_100085252
857 Ga0075370_10021735
858 Ga0068871_100031714
859 Ga0068865_100116142
860 Ga0099825_1022681
861 Ga0099824_1002487
862 Ga0099822_1001480
863 Ga0105251_10025719
864 Ga0105244_10003674
865 Ga0105244_10013049
866 Ga0105240_10003464
867 Ga0105240_10008605
868 Ga0105240_10048479
869 Ga0105240_10144472
870 Ga0105241_10011257
871 Ga0105248_10003289
872 Ga0105248_10044933
873 Ga0105238_10001028
874 Ga0105238_10031004
875 Ga0105238_10042210
876 Ga0105246_10028919
877 Ga0157319_1000026
878 Ga0157370_10010294
879 Ga0157369_10002208
880 Ga0157369_10005932
881 Ga0157369_10014477
882 Ga0157369_10108132
883 Ga0157374_10265234
884 Ga0163162_10104303
885 Ga0157372_10025495
886 Ga0157372_10031668
887 Ga0163163_10134767
888 Ga0157380_10038615
889 Ga0182008_10010733
890 Ga0157377_10064211
891 Ga0157376_10098612
892 Ga0182007_10007531
893 Ga0213872_10000017
894 Ga0213872_10000340
895 Ga0213872_10000601
896 Ga0209436_100646
897 Ga0209436_101485
898 Ga0209436_102991
899 Ga0207425_1000093
900 Ga0209646_1000039
901 Ga0209026_1000006
902 Ga0209677_100131
903 Ga0209677_103741
904 Ga0209148_1000480
905 Ga0209759_1000020
906 Ga0209759_1013763
907 Ga0209129_1003503
908 Ga0209565_1000006
909 Ga0209565_1000082
910 Ga0209565_1000493
911 Ga0209565_1000589
912 Ga0209565_1003314
913 Ga0209565_1014228
914 Ga0209455_1000546
915 Ga0209673_1000004
916 Ga0209673_1000422
917 Ga0209673_1010617
918 Ga0209673_1023251
919 Ga0209130_1000016
920 Ga0209130_1000139
921 Ga0209130_1001085
922 Ga0209675_1000006
923 Ga0209675_1000078
924 Ga0209675_1000176
925 Ga0209675_1000183
926 Ga0209676_1000121
927 Ga0209676_1000234
928 Ga0209676_1000475
929 Ga0209025_1000051
930 Ga0209025_1001389
931 Ga0209564_1000102
932 Ga0209564_1000133
933 Ga0209564_1000438
934 Ga0209564_1000959
935 Ga0209564_1001315
936 Ga0209564_1016465
937 Ga0209758_1010715
938 Ga0209050_1000086
939 Ga0209050_1000132
940 Ga0209050_1000211
941 Ga0209050_1000901
942 Ga0209050_1002185
943 Ga0209050_1002364
944 Ga0209050_1006427
945 Ga0209256_1000037
946 Ga0209256_1000075
947 Ga0209256_1000323
948 Ga0209256_1001354
949 Ga0209256_1001994
950 Ga0207426_1001352
951 Ga0209257_1000087
952 Ga0209257_1000176
953 Ga0209257_1001687
954 Ga0209257_1002887
955 Ga0209257_1006793
956 Ga0209257_1007083
957 Ga0209257_1008617
958 Ga0207697_10023243
959 Ga0207655_1000353
960 Ga0207647_10000056
961 Ga0207654_10004740
962 Ga0207707_10032895
963 Ga0207695_10018217
964 Ga0207695_10157574
965 Ga0207693_10023813
966 Ga0207652_10039347
967 Ga0207694_10001251
968 Ga0207694_10014394
969 Ga0207694_10085049
970 Ga0207659_10077002
971 Ga0207704_10093523
972 Ga0207711_10014773
973 Ga0207711_10134500
974 Ga0207658_10121320
975 Ga0207677_10043488
976 Ga0207678_10037743
977 Ga0207678_10119150
978 Ga0207678_10137201
979 Ga0207702_10000310
980 Ga0207702_10059788
981 Ga0207674_10005337
982 Ga0207674_10033062
983 Ga0207683_10091351
984 Ga0207698_10120822
985 Ga0209371_1000008
986 Ga0209589_1000001
987 Ga0209489_100001
988 Ga0209700_100001
989 Ga0209282_1000295
990 Ga0268266_10020911
991 Ga0268266_10066984
992 Ga0268256_1000009
993 Ga0268256_1003305
994 Ga0307408_100000106
995 Ga0307408_100007672
996 Ga0307408_100021926
997 Ga0307412_10000039
998 Ga0307412_10008824
999 Ga0307414_10000625
1000 Ga0307414_10003068
1001 Ga0307510_10054892
1002 Ga0307510_10144619
1003 Ga0315911_1000006
1004 Ga0373925_0174503
1005 Ga0395899_0025088
1006 Ga0395899_0082082
1007 Ga0395900_0065228
1008 Ga0395900_0105371
1009 Ga0395898_0018936
1010 Ga0395905_0000017
1011 Ga0395905_0002694
1012 Ga0395905_0068821
1013 Ga0395905_0153203
1014 Ga0395905_0187963
1015 Ga0395905_0234142
1016 Ga0395901_0148287
1017 Ga0436361_0066216
1018 Ga0436361_0267501
1019 Ga0436361_0713206
1020 Ga0466972_0000113
1021 Ga0466973_0042256
1022 Ga0466965_0101852
1023 Ga0466966_0015365
1024 Ga0466963_0102937
1025 Ga0466964_0063385
1026 Ga0466971_0035000
1027 Ga0466970_0023132
1028 Ga0466957_0035886
1029 Ga0466960_0027303
1030 Ga0466959_0083614
1031 Ga0466958_0018512
1032 Ga0495617_000055
1033 Ga0495617_002131
1034 Ga0495627_000123
1035 Ga0495627_004917
1036 Ga0495603_0042339
1037 Ga0495590_0000013
1038 Ga0495590_0000377
1039 Ga0495590_0000379
1040 Ga0495590_0011248
1041 Ga0495590_0024301
1042 Ga0495591_000176
1043 Ga0495591_008008
1044 Ga0495629_0000115
1045 Ga0495629_0013994
1046 Ga0495629_0060852
1047 Ga0495638_0000316
1048 Ga0495638_0014655
1049 Ga0495638_0015372
1050 Ga0495638_0100667
1051 Ga0495653_0025917
1052 Ga0495650_0017832
1053 Ga0495650_0022015
1054 Ga0495580_0007991
1055 Ga0495582_0013488
1056 Ga0495605_0000035
1057 Ga0495605_0010050
1058 Ga0495605_0010344
1059 Ga0495605_0037315
1060 Ga0495605_0048247
1061 Ga0495605_0055143
1062 Ga0495664_0034857
1063 Ga0495584_0000029
1064 Ga0495584_0000710
1065 Ga0495584_0001111
1066 Ga0495584_0059053
1067 Ga0495585_0000106
1068 Ga0495585_0000229
1069 Ga0495585_0001128
1070 Ga0495585_0005576
1071 Ga0495585_0013289
1072 Ga0495585_0014721
1073 Ga0495585_0022156
1074 Ga0495585_0075937
1075 Ga0495585_0096668
1076 Ga0495594_0004607
1077 Ga0495594_0007102
1078 Ga0495594_0011370
1079 Ga0495594_0013155
1080 Ga0495596_0000011
1081 Ga0495596_0000831
1082 Ga0495596_0005573
1083 Ga0495596_0007503
1084 Ga0495596_0008269
1085 Ga0495596_0009259
1086 Ga0495596_0013241
1087 Ga0495596_0035127
1088 Ga0495607_0001166
1089 Ga0495607_0001312
1090 Ga0495607_0002001
1091 Ga0495607_0004125
1092 Ga0495607_0004590
1093 Ga0495583_0000078
1094 Ga0495583_0000461
1095 Ga0495583_0004535
1096 Ga0495583_0017018
1097 Ga0495606_0000768
1098 Ga0495606_0002036
1099 Ga0495606_0002482
1100 Ga0495606_0003708
1101 Ga0495606_0005159
1102 Ga0495606_0008542
1103 Ga0495606_0052998
1104 Ga0495610_0007788
1105 Ga0495610_0011297
1106 Ga0495610_0035320
1107 Ga0495616_0001754
1108 Ga0495616_0001933
1109 Ga0495616_0004418
1110 Ga0495616_0025903
1111 Ga0495616_0027319
1112 Ga0495616_0027678
1113 Ga0495620_0002400
1114 Ga0495628_0004561
1115 Ga0495630_0053411
1116 Ga0495631_0002790
1117 Ga0495631_0005006
1118 Ga0495631_0017627
1119 Ga0495631_0035198
1120 Ga0495631_0046090
1121 Ga0495632_0006072
1122 Ga0495632_0026740
1123 Ga0495637_0000008
1124 Ga0495637_0037168
1125 Ga0495643_0004707
1126 Ga0495643_0009146
1127 Ga0495643_0009738
1128 Ga0495643_0014120
1129 Ga0495643_0044131
1130 Ga0495644_0002537
1131 Ga0495644_0004610
1132 Ga0495644_0009804
1133 Ga0495644_0032759
1134 Ga0495648_0000410
1135 Ga0495648_0000527
1136 Ga0495648_0001273
1137 Ga0495648_0005588
1138 Ga0495648_0007550
1139 Ga0495648_0009591
1140 Ga0495648_0034008
1141 Ga0495648_0052268
1142 Ga0495648_0065821
1143 Ga0495666_0022568
1144 Ga0495642_0000005
1145 Ga0495642_0000946
1146 Ga0495642_0008610
1147 Ga0495665_0001347
1148 Ga0495665_0015486
1149 Ga0495586_0003975
1150 Ga0495609_0000754
1151 Ga0495609_0001400
1152 Ga0495609_0003203
1153 Ga0495609_0007383
1154 Ga0495609_0010817
1155 Ga0495597_0000157
1156 Ga0495597_0000277
1157 Ga0495597_0000422
1158 Ga0495597_0010954
1159 Ga0495597_0016658
1160 Ga0495622_0006257
1161 Ga0495622_0020682
1162 Ga0495622_0021939
1163 Ga0495622_0023931
1164 Ga0495622_0039968
1165 Ga0495633_0004992
1166 Ga0495668_0000160
1167 Ga0495668_0000987
1168 Ga0495668_0002104
1169 Ga0495668_0004835
1170 Ga0495611_0000976
1171 Ga0495611_0009008
1172 Ga0495611_0010637
1173 Ga0495611_0016598
1174 Ga0495611_0021647
1175 Ga0495611_0031932
1176 Ga0495611_0033151
1177 Ga0495611_0041704
1178 Ga0495625_0000351
1179 Ga0495625_0002025
1180 Ga0495625_0004594
1181 Ga0495625_0085939
1182 Ga0495625_0172386
1183 Ga0495661_0000198
1184 Ga0495661_0001403
1185 Ga0495661_0002353
1186 Ga0495661_0005921
1187 Ga0495661_0006329
1188 Ga0495661_0012180
1189 Ga0495588_0011362
1190 Ga0495588_0014329
1191 Ga0495623_0007537
1192 Ga0495646_0049497
1193 Ga0495669_0000015
1194 Ga0495669_0001059
1195 Ga0495669_0001177
1196 Ga0495669_0011562
1197 Ga0495669_0018100
1198 Ga0495669_0072874
1199 Ga0495613_0043829
1200 Ga0495624_0071872
1201 Ga0495670_0000009
1202 Ga0495670_0001567
1203 Ga0495670_0013858
1204 Ga0495670_0021187
1205 Ga0495670_0041926
1206 Ga0495670_0053888
1207 Ga0495671_0000294
1208 Ga0495671_0000326
1209 Ga0495649_0000071
1210 Ga0495649_0013880
1211 Ga0495649_0026776
1212 Ga0495589_0000033
1213 Ga0495589_0002183
1214 Ga0495589_0012544
1215 Ga0495589_0015373
1216 Ga0495660_0005491
1217 Ga0495660_0009038
1218 Ga0495660_0013564
1219 Ga0495660_0026662
1220 Ga0495660_0041439
1221 Ga0495604_0088962
1222 Ga0495636_0002361
1223 Ga0495636_0058990
1224 Ga0495674_0009273
1225 Ga0495674_0078808
1226 Ga0495674_0095508
1227 Ga0495672_0000033
1228 Ga0495672_0000074
1229 Ga0495672_0007413
1230 Ga0495672_0034322
1231 Ga0495672_0064247
1232 Ga0495672_0090187
1233 Ga0495676_0000223
1234 Ga0495676_0000643
1235 Ga0495676_0014902
1236 Ga0495676_0022190
1237 Ga0495676_0079875
1238 Ga0495676_0094089
1239 Ga0495683_0000024
1240 Ga0495687_000046
1241 Ga0495687_027855
1242 Ga0495687_048187
1243 Ga0495677_0000203
1244 Ga0495677_0003472
1245 Ga0495679_000641
1246 Ga0495679_005255
1247 Ga0495679_006520
1248 Ga0495685_012445
1249 Ga0495685_019051
1250 Ga0495673_0001551
1251 Ga0495673_0010794
1252 Ga0495673_0052650
1253 Ga0495686_0000026
1254 Ga0495686_0000171
1255 Ga0495686_0000431
1256 Ga0495686_0000735
1257 Ga0495686_0013210
1258 Ga0495686_0022962
1259 Ga0495686_0070966
1260 Ga0495686_0095209
1261 Ga0495626_0003138
1262 Ga0495626_0003399
1263 Ga0495626_0016691
1264 Ga0495626_0025955
1265 Ga0495626_0026119
1266 Ga0495626_0027815
1267 Ga0495626_0038852
1268 Ga0496101_0167696
1269 Ga0496102_0000173
1270 Ga0496102_0004216
1271 Ga0496104_0024578
1272 Ga0496104_0285040
1273 Ga0496105_0045689
1274 Ga0496106_0000014
1275 Ga0496106_0009589
1276 Ga0496106_0111622
1277 Ga0496107_0000132
1278 Ga0496107_0001367
1279 Ga0496108_0028897
1280 Ga0496109_0004253
1281 Ga0496109_0026661
1282 Ga0496110_0008299
1283 Ga0496112_0042191
1284 Ga0496113_0074615
1285 Ga0496114_0087882
1286 Ga0496115_0008897
1287 Ga0496115_0084964
1288 Ga0496116_0030126
1289 Ga0496117_0006503
1290 Ga0496117_0039671
1291 Ga0496117_0047522
1292 Ga0496118_0000228
1293 Ga0496118_0055687
1294 Ga0496118_0077965
1295 Ga0496121_0000044
1296 Ga0496121_0000316
1297 Ga0496121_0001059
1298 Ga0496121_0006484
1299 Ga0496121_0008062
1300 Ga0496121_0009250
1301 Ga0496121_0013070
1302 Ga0496121_0013272
1303 Ga0496121_0018745
1304 Ga0496121_0020825
1305 Ga0496121_0045090
1306 Ga0496121_0053978
1307 Ga0496121_0062936
1308 Ga0496121_0067760
1309 Ga0496121_0089425
1310 Ga0496121_0134096
1311 Ga0496121_0181245
1312 Ga0496122_0000263
1313 Ga0496122_0004692
1314 Ga0496122_0116860
1315 Ga0496123_0000156
1316 Ga0496123_0000840
1317 Ga0496123_0008440
1318 Ga0496124_0069925
1319 Ga0496125_0000672
1320 Ga0496125_0027325
1321 Ga0496125_0055254
1322 Ga0496125_0121946
1323 Ga0496126_0001940
1324 Ga0496126_0003509
1325 Ga0496126_0037944
1326 Ga0496126_0041881
1327 Ga0496126_0068978
1328 Ga0496126_0069054
1329 Ga0466983_0006966
1330 Ga0495678_000024
1331 Ga0495678_000084
1332 Ga0495678_012670
1333 Ga0495678_027512
1334 Ga0495682_0000114
1335 Ga0495682_0001658
1336 Ga0495682_0002118
1337 Ga0495682_0008300
1338 Ga0495682_0013577
1339 Ga0495682_0014505
1340 Ga0501032_0027862
1341 Ga0501033_0002631
1342 Ga0501033_0089457
1343 Ga0501034_0015233
1344 Ga0501036_0001868
1345 Ga0501037_0005101
1346 Ga0501038_0000276
1347 Ga0501038_0029628
1348 Ga0501039_0009202
1349 Ga0501043_0003013
1350 Ga0501043_0080638
1351 Ga0501046_0011595
1352 Ga0501047_0004929
1353 Ga0501047_0006910
1354 Ga0501047_0014333
1355 Ga0501047_0077944
1356 Ga0501048_0038426
1357 Ga0501067_0002106
1358 Ga0501068_0024578
1359 Ga0501068_0090958
1360 Ga0501069_0000483
1361 Ga0501070_0003133
1362 Ga0501070_0024967
1363 Ga0501073_0000456
1364 Ga0501073_0020341
1365 Ga0501073_0170183
1366 Ga0501074_0023481
1367 Ga0501080_0001321
1368 Ga0501080_0255474
1369 Ga0501083_0014280
1370 Ga0501083_0037976
1371 Ga0501035_0015892
1372 Ga0501035_0023613
1373 Ga0501035_0023771
1374 Ga0501044_0001875
1375 Ga0501044_0018935
1376 Ga0501044_0021138
1377 Ga0501044_0038973
1378 Ga0501044_0171353
1379 nmdc:mga00v17_29895_c1
1380 nmdc:mga0sz30_10285_c1
1381 nmdc:mga0sz30_21426_c1
1382 nmdc:mga0sz30_26189_c1
1383 Ga0500554_007438
1384 Ga0500594_0004725
1385 Ga0500595_004260
1386 Ga0500658_0013447
1387 Ga0500568_0002410
1388 Ga0500568_0032258
1389 Ga0500577_0000067
1390 Ga0500603_000163
1391 Ga0500616_0018758
1392 Ga0500622_0012625
1393 Ga0500637_0000178
1394 Ga0501084_0181568
1395 Ga0501082_0027393
1396 Ga0466962_0042538
1397 2513657037
1398 2513675735
1399 2513855478
1400 2513876503
1401 2513918777
1402 2514010844
1403 2514053928
1404 2515608463
1405 2517892026
1406 2524441341
1407 2524466092
1408 2524534102
1409 2545675215
1410 2599105867
1411 2617352901
1412 2643792622
1413 2643796970
1414 2643798481
1415 2643927308
1416 2644105883
1417 2644147152
1418 2644191999
1419 2644216866
1420 2644310495
1421 2644334720
1422 2644469926
1423 2644475487
1424 2644545087
1425 2644612597
1426 2671121931
1427 2738819289
1428 2738831768
1429 2738873296
1430 2738885977
1431 2739184926
1432 2739219895
1433 2753765038
1434 2770195909
1435 2774389381
1436 2776267043
1437 2776284869
1438 2793063998
1439 2793068899
1440 2793323261
1441 2793370782
1442 2805919782
1443 2806052289
1444 2806058590
1445 2819643170
1446 2824668701
1447 2824699168
1448 2824710695
1449 2824758543
1450 2824768282
1451 2824779098
1452 2831867227
1453 2834642177
1454 2834643612
1455 2838126497
1456 2840766690
1457 2841947154
1458 2841950598
1459 2841966912
1460 2841975661
1461 2841990024
1462 2842047340
1463 2846955650
1464 2847945908
1465 2848862364
1466 2852682747
1467 2879102544
1468 2884340623
1469 2885277598
1470 2885375980
1471 2885390805
1472 2886853969
1473 2903753793
1474 2903772970
1475 2904702126
1476 2904717211
1477 2906639214
1478 2906662414
1479 2908674329
1480 2908742302
1481 2909047611
1482 2919104808
1483 2922430691
1484 2929617287
1485 2929618926
1486 2929626991
1487 2929631003
1488 2932813147
1489 2932820939
1490 2933579244
1491 2933580364
1492 2935611804
1493 2935645587
1494 2935667705
1495 2935706545
1496 2935768344
1497 2935813080
1498 2935821282
1499 2935830733
1500 2935840760
1501 2935850457
1502 2935914060
1503 2935921229
1504 2935931751
1505 2935940314
1506 2935947861
1507 2935956598
1508 2935973391
1509 2936006589
1510 2936043632
1511 2941473628
1512 2941506481
1513 2941541109
1514 2945940304
1515 2990707433
1516 3005413552
1517 3005447896
1518 3005480594
1519 641645748
1520 642423873
1521 642598637
1522 8002062456
1523 8003401202
1524 8005320895
1525 8006940178
1526 8006979959
1527 8019556155
1528 8019569152
1529 8019627387
1530 8019689277
1531 8047676773
1532 8055742775
1533 8055747098
1534 8056688186

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

83

146

0.97

PF00155

Aminotran_1_2

Aminotransferase class I and II

205

501

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9444 8 81
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9379 5 84
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9295 15 81
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9209 8 81
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9161 5 84
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9696 38 80 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9637 5 81 1.10.10.10
af_P9WMG5_6_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9528 18 81 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9516 6 81 1.10.10.10
4u0wA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9505 6 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K2X9J2-F1-model_v4 GntR family transcriptional regulator 0.9896 5 81 GO:0003677
GO:0003700
AF-H8G6P6-F1-model_v4 Putative transcriptional regulator 0.9875 7 81 GO:0003677
GO:0003700
AF-A0A3Q9B4B5-F1-model_v4 deleted 0.9813 6 81
AF-A0A838IV63-F1-model_v4 GntR family transcriptional regulator 0.9725 5 81 GO:0003677
GO:0003700
GO:0045892
AF-A0A4P6MQK0-F1-model_v4 GntR family transcriptional regulator 0.961 4 81 GO:0003677
GO:0003700
GO:0045892

Map