F479911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 767 | 404 | 1534 | 472 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0023441|Ga0466961_0023441_1469_3082 |
| Length | 537 |
| Sequence | MFGLTMAYIHTLPRQREPRLQVAMHTAANAGCVIMFNSFSRSLWKFCTIDGARRRTKNLQFMCTKPMDSDLQIRIDRTAKLSLSEQIRASISRAIESGLLPPGARLPSWQDLAARLGVARGTVQAAYERLSDAQLIETFRAGGTCVAARPLTTATQSSAPRLGDFMKSYQEMNAGPAIFQLGIPAFEGLPEKLFARTRSSNLLKAGCLASPLYPDPRGEFELRREIAGYLSIARNLHCDPEQVFITSGYISGLGLALRVLGLDGKKVWMEEPGFHLARKGLELARLHIVPVPVDAEGLDVGYGIKHAADAALAVVTPGQQAPLGVTLSLKRRRQLLEWAASTGAWIIEDDYLSELQLEGRAAPALASSDEGKRVIHIGSFSKTISPGLRLGFIVAPAELANAFSEVSAALVPAPSPIVQVATAQFMRDGHYIRRVRRLKRLYSSQRDALCAQLRKHKAQWTHAGLAVLLKLPANVSDAEIVRDARTMGMAPSPLSAWFAIPTRHSSGLLLGVATAPEQHVATACRQLLQIMDQHRRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 53 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 54 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 117 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 118 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 119 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 136 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 146 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 260 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 262 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 263 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 270 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 274 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 275 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 276 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 277 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 278 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 279 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 280 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 281 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 282 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 283 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 284 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 285 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 286 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 287 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 288 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 289 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 290 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 291 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 292 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 293 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 294 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 295 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 296 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 297 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 298 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 299 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 300 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 301 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 302 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 303 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 304 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 305 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 306 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 307 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 308 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 309 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 310 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 311 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 312 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 313 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 314 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 315 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 316 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 317 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 318 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 319 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 320 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 321 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 322 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 323 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 324 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 325 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 326 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 327 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 328 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 329 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 330 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 331 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 332 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 333 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 334 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 335 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 336 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 337 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 338 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 339 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 340 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 341 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 342 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 343 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 344 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 345 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 346 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 347 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 348 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 349 | 2904699407 | |||
| 350 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 351 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 352 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 353 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 354 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 355 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 356 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 357 | 2922425934 | |||
| 358 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 359 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 360 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 361 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 362 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 363 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 364 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 365 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 366 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 367 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 368 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 369 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 370 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 371 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 372 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 373 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 374 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 375 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 376 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 377 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 378 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 379 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 380 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 381 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 382 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 383 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 384 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 385 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 386 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 387 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 388 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 389 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 390 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 391 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 392 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 393 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 394 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 395 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 396 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 397 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 398 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 399 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 400 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 401 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 402 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 403 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 404 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.22 |
| Metatranscriptomes | 0 |
| Isolates | 17.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.65 |
| Nodule | 10.43 |
| Rhizoplane | 3 |
| Rhizosphere | 56.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466961_0023441 | 3300044693 | Bacteria | 3971 |
| 2 | JGI24738J21930_10000521 | 3300002075 | Bacteria | 10952 |
| 3 | JGI25158J39367_1001076 | 3300002739 | Bacteria | 4961 |
| 4 | JGI25150J39212_1003484 | 3300002774 | Bacteria | 3674 |
| 5 | JGI25159J45721_1003778 | 3300002987 | Bacteria | 5224 |
| 6 | JGI25151J46595_10000338 | 3300003187 | Bacteria | 50270 |
| 7 | rootH1_10004683 | 3300003316 | Bacteria | 3382 |
| 8 | rootH2_10023281 | 3300003320 | Bacteria | 4210 |
| 9 | rootH2_10063443 | 3300003320 | Bacteria | 3496 |
| 10 | rootH2_10101131 | 3300003320 | Bacteria | 2504 |
| 11 | rootL2_10001921 | 3300003322 | Bacteria | 16576 |
| 12 | rootL2_10066572 | 3300003322 | Bacteria | 3516 |
| 13 | rootL2_10236162 | 3300003322 | Bacteria | 3620 |
| 14 | rootH1_10056171 | 3300003323 | Bacteria | 2467 |
| 15 | rootH1_10099455 | 3300003323 | Bacteria | 7948 |
| 16 | rootH1_10238995 | 3300003323 | Bacteria | 1947 |
| 17 | JGI25160J50197_1012996 | 3300003354 | Bacteria | 2858 |
| 18 | JGI25161J50226_1000422 | 3300003374 | Bacteria | 20266 |
| 19 | Ga0055539_1001020 | 3300003752 | Bacteria | 6031 |
| 20 | Ga0055526_1000344 | 3300003771 | Bacteria | 38140 |
| 21 | Ga0055526_1001794 | 3300003771 | Bacteria | 14879 |
| 22 | Ga0055526_1004959 | 3300003771 | Bacteria | 7816 |
| 23 | Ga0055526_1007352 | 3300003771 | Bacteria | 5748 |
| 24 | Ga0055526_1012889 | 3300003771 | Bacteria | 3594 |
| 25 | Ga0055537_1000066 | 3300003773 | Bacteria | 76478 |
| 26 | Ga0055537_1001231 | 3300003773 | Bacteria | 10751 |
| 27 | Ga0055537_1002572 | 3300003773 | Bacteria | 5957 |
| 28 | Ga0055537_1009522 | 3300003773 | Bacteria | 2134 |
| 29 | Ga0055524_1001045 | 3300003775 | Bacteria | 17074 |
| 30 | Ga0055524_1001055 | 3300003775 | Bacteria | 16979 |
| 31 | Ga0055524_1002019 | 3300003775 | Bacteria | 10828 |
| 32 | Ga0055524_1002588 | 3300003775 | Bacteria | 9213 |
| 33 | Ga0055536_1000103 | 3300003781 | Bacteria | 73706 |
| 34 | Ga0055534_1000057 | 3300003784 | Bacteria | 85576 |
| 35 | Ga0055534_1000085 | 3300003784 | Bacteria | 72934 |
| 36 | Ga0055534_1000104 | 3300003784 | Bacteria | 64767 |
| 37 | Ga0055534_1000158 | 3300003784 | Bacteria | 50846 |
| 38 | Ga0055534_1002848 | 3300003784 | Bacteria | 5760 |
| 39 | Ga0055534_1005419 | 3300003784 | Bacteria | 3417 |
| 40 | Ga0055528_1000318 | 3300003790 | Bacteria | 40528 |
| 41 | Ga0055528_1000457 | 3300003790 | Bacteria | 32565 |
| 42 | Ga0055530_10000164 | 3300003791 | Bacteria | 60316 |
| 43 | Ga0055530_10001073 | 3300003791 | Bacteria | 21517 |
| 44 | Ga0055530_10006703 | 3300003791 | Bacteria | 5058 |
| 45 | Ga0055530_10015783 | 3300003791 | Bacteria | 2446 |
| 46 | Ga0055530_10018560 | 3300003791 | Bacteria | 2139 |
| 47 | Ga0055531_10002244 | 3300003794 | Bacteria | 13080 |
| 48 | Ga0055531_10002595 | 3300003794 | Bacteria | 11968 |
| 49 | Ga0055531_10002776 | 3300003794 | Bacteria | 11495 |
| 50 | Ga0055531_10009846 | 3300003794 | Bacteria | 4840 |
| 51 | Ga0055531_10021787 | 3300003794 | Bacteria | 2471 |
| 52 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 53 | Ga0055543_1000750 | 3300004625 | Bacteria | 16316 |
| 54 | Ga0055543_1013092 | 3300004625 | Bacteria | 1649 |
| 55 | Ga0065165_1000323 | 3300005262 | Bacteria | 78079 |
| 56 | Ga0065165_1001295 | 3300005262 | Bacteria | 28121 |
| 57 | Ga0065165_1001608 | 3300005262 | Bacteria | 23076 |
| 58 | Ga0065165_1001785 | 3300005262 | Bacteria | 21254 |
| 59 | Ga0065165_1002099 | 3300005262 | Bacteria | 18236 |
| 60 | Ga0070683_100073572 | 3300005329 | Bacteria | 3191 |
| 61 | Ga0068868_100081083 | 3300005338 | Bacteria | 2601 |
| 62 | Ga0070668_100171535 | 3300005347 | Bacteria | 1766 |
| 63 | Ga0070675_100055471 | 3300005354 | Bacteria | 3262 |
| 64 | Ga0070671_100077934 | 3300005355 | Bacteria | 2770 |
| 65 | Ga0070673_100057279 | 3300005364 | Bacteria | 3079 |
| 66 | Ga0070673_100191034 | 3300005364 | Bacteria | 1759 |
| 67 | Ga0070667_100031006 | 3300005367 | Bacteria | 4457 |
| 68 | Ga0070667_100076083 | 3300005367 | Bacteria | 2866 |
| 69 | Ga0070663_100026674 | 3300005455 | Bacteria | 3915 |
| 70 | Ga0070706_100016569 | 3300005467 | Bacteria | 6807 |
| 71 | Ga0070698_100006981 | 3300005471 | Bacteria | 12227 |
| 72 | Ga0070699_100021704 | 3300005518 | Bacteria | 5536 |
| 73 | Ga0070679_100066236 | 3300005530 | Bacteria | 3600 |
| 74 | Ga0070684_100035827 | 3300005535 | Bacteria | 4250 |
| 75 | Ga0070697_100025973 | 3300005536 | Bacteria | 4673 |
| 76 | Ga0070697_100144410 | 3300005536 | Bacteria | 2002 |
| 77 | Ga0070665_100003864 | 3300005548 | Bacteria | 15851 |
| 78 | Ga0070665_100011128 | 3300005548 | Bacteria | 9092 |
| 79 | Ga0070665_100181465 | 3300005548 | Bacteria | 2106 |
| 80 | Ga0068855_100065623 | 3300005563 | Bacteria | 4232 |
| 81 | Ga0070664_100013756 | 3300005564 | Bacteria | 6594 |
| 82 | Ga0068857_100001662 | 3300005577 | Bacteria | 17849 |
| 83 | Ga0068857_100069985 | 3300005577 | Bacteria | 3125 |
| 84 | Ga0068854_100002216 | 3300005578 | Bacteria | 11955 |
| 85 | Ga0068856_100002254 | 3300005614 | Bacteria | 19910 |
| 86 | Ga0068852_100151502 | 3300005616 | Bacteria | 2157 |
| 87 | Ga0081455_10030359 | 3300005937 | Bacteria | 4910 |
| 88 | Ga0075432_10006014 | 3300006058 | Bacteria | 4133 |
| 89 | Ga0070712_100085252 | 3300006175 | Bacteria | 2299 |
| 90 | Ga0075370_10021735 | 3300006353 | Bacteria | 3516 |
| 91 | Ga0068871_100031714 | 3300006358 | Bacteria | 4169 |
| 92 | Ga0068865_100116142 | 3300006881 | Bacteria | 1982 |
| 93 | Ga0099825_1022681 | 3300006941 | Bacteria | 3999 |
| 94 | Ga0099824_1002487 | 3300006942 | Bacteria | 26950 |
| 95 | Ga0099822_1001480 | 3300006943 | Bacteria | 27484 |
| 96 | Ga0105251_10025719 | 3300009011 | Bacteria | 3007 |
| 97 | Ga0105244_10003674 | 3300009036 | Bacteria | 10835 |
| 98 | Ga0105244_10013049 | 3300009036 | Bacteria | 4874 |
| 99 | Ga0105240_10003464 | 3300009093 | Bacteria | 24478 |
| 100 | Ga0105240_10008605 | 3300009093 | Bacteria | 14585 |
| 101 | Ga0105240_10048479 | 3300009093 | Bacteria | 5368 |
| 102 | Ga0105240_10144472 | 3300009093 | Bacteria | 2840 |
| 103 | Ga0105241_10011257 | 3300009174 | Bacteria | 6559 |
| 104 | Ga0105248_10003289 | 3300009177 | Bacteria | 17935 |
| 105 | Ga0105248_10044933 | 3300009177 | Bacteria | 4954 |
| 106 | Ga0105238_10001028 | 3300009551 | Bacteria | 28385 |
| 107 | Ga0105238_10031004 | 3300009551 | Bacteria | 5443 |
| 108 | Ga0105238_10042210 | 3300009551 | Bacteria | 4619 |
| 109 | Ga0105246_10028919 | 3300011119 | Bacteria | 3645 |
| 110 | Ga0157319_1000026 | 3300012497 | Bacteria | 63349 |
| 111 | Ga0157370_10010294 | 3300013104 | Bacteria | 9866 |
| 112 | Ga0157369_10002208 | 3300013105 | Bacteria | 23445 |
| 113 | Ga0157369_10005932 | 3300013105 | Bacteria | 14188 |
| 114 | Ga0157369_10014477 | 3300013105 | Bacteria | 8902 |
| 115 | Ga0157369_10108132 | 3300013105 | Bacteria | 2958 |
| 116 | Ga0157374_10265234 | 3300013296 | Bacteria | 1692 |
| 117 | Ga0163162_10104303 | 3300013306 | Bacteria | 2930 |
| 118 | Ga0157372_10025495 | 3300013307 | Bacteria | 6430 |
| 119 | Ga0157372_10031668 | 3300013307 | Bacteria | 5791 |
| 120 | Ga0163163_10134767 | 3300014325 | Bacteria | 2510 |
| 121 | Ga0157380_10038615 | 3300014326 | Bacteria | 3708 |
| 122 | Ga0182008_10010733 | 3300014497 | Bacteria | 4894 |
| 123 | Ga0157377_10064211 | 3300014745 | Bacteria | 2105 |
| 124 | Ga0157376_10098612 | 3300014969 | Bacteria | 2548 |
| 125 | Ga0182007_10007531 | 3300015262 | Bacteria | 4554 |
| 126 | Ga0213872_10000017 | 3300021361 | Bacteria | 178787 |
| 127 | Ga0213872_10000340 | 3300021361 | Bacteria | 39602 |
| 128 | Ga0213872_10000601 | 3300021361 | Bacteria | 27442 |
| 129 | Ga0209436_100646 | 3300025208 | Bacteria | 14855 |
| 130 | Ga0209436_101485 | 3300025208 | Bacteria | 8114 |
| 131 | Ga0209436_102991 | 3300025208 | Bacteria | 4697 |
| 132 | Ga0207425_1000093 | 3300025245 | Bacteria | 87038 |
| 133 | Ga0209646_1000039 | 3300025246 | Bacteria | 349637 |
| 134 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 135 | Ga0209677_100131 | 3300025253 | Bacteria | 72722 |
| 136 | Ga0209677_103741 | 3300025253 | Bacteria | 4753 |
| 137 | Ga0209148_1000480 | 3300025254 | Bacteria | 42052 |
| 138 | Ga0209759_1000020 | 3300025256 | Bacteria | 344904 |
| 139 | Ga0209759_1013763 | 3300025256 | Bacteria | 2172 |
| 140 | Ga0209129_1003503 | 3300025258 | Bacteria | 6781 |
| 141 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 142 | Ga0209565_1000082 | 3300025263 | Bacteria | 154452 |
| 143 | Ga0209565_1000493 | 3300025263 | Bacteria | 28875 |
| 144 | Ga0209565_1000589 | 3300025263 | Bacteria | 24545 |
| 145 | Ga0209565_1003314 | 3300025263 | Bacteria | 5276 |
| 146 | Ga0209565_1014228 | 3300025263 | Bacteria | 1835 |
| 147 | Ga0209455_1000546 | 3300025272 | Bacteria | 25771 |
| 148 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 149 | Ga0209673_1000422 | 3300025273 | Bacteria | 73685 |
| 150 | Ga0209673_1010617 | 3300025273 | Bacteria | 3864 |
| 151 | Ga0209673_1023251 | 3300025273 | Bacteria | 2116 |
| 152 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 153 | Ga0209130_1000139 | 3300025284 | Bacteria | 115951 |
| 154 | Ga0209130_1001085 | 3300025284 | Bacteria | 20318 |
| 155 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 156 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 157 | Ga0209675_1000176 | 3300025291 | Bacteria | 73644 |
| 158 | Ga0209675_1000183 | 3300025291 | Bacteria | 70391 |
| 159 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 160 | Ga0209676_1000234 | 3300025292 | Bacteria | 119888 |
| 161 | Ga0209676_1000475 | 3300025292 | Bacteria | 66299 |
| 162 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 163 | Ga0209025_1001389 | 3300025294 | Bacteria | 32297 |
| 164 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 165 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 166 | Ga0209564_1000438 | 3300025295 | Bacteria | 71794 |
| 167 | Ga0209564_1000959 | 3300025295 | Bacteria | 36638 |
| 168 | Ga0209564_1001315 | 3300025295 | Bacteria | 26597 |
| 169 | Ga0209564_1016465 | 3300025295 | Bacteria | 2941 |
| 170 | Ga0209758_1010715 | 3300025297 | Bacteria | 5440 |
| 171 | Ga0209050_1000086 | 3300025298 | Bacteria | 262009 |
| 172 | Ga0209050_1000132 | 3300025298 | Bacteria | 185906 |
| 173 | Ga0209050_1000211 | 3300025298 | Bacteria | 129614 |
| 174 | Ga0209050_1000901 | 3300025298 | Bacteria | 39362 |
| 175 | Ga0209050_1002185 | 3300025298 | Bacteria | 17651 |
| 176 | Ga0209050_1002364 | 3300025298 | Bacteria | 16429 |
| 177 | Ga0209050_1006427 | 3300025298 | Bacteria | 6962 |
| 178 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 179 | Ga0209256_1000075 | 3300025299 | Bacteria | 236149 |
| 180 | Ga0209256_1000323 | 3300025299 | Bacteria | 82313 |
| 181 | Ga0209256_1001354 | 3300025299 | Bacteria | 25880 |
| 182 | Ga0209256_1001994 | 3300025299 | Bacteria | 18311 |
| 183 | Ga0207426_1001352 | 3300025302 | Bacteria | 20790 |
| 184 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 185 | Ga0209257_1000176 | 3300025304 | Bacteria | 161436 |
| 186 | Ga0209257_1001687 | 3300025304 | Bacteria | 24841 |
| 187 | Ga0209257_1002887 | 3300025304 | Bacteria | 15976 |
| 188 | Ga0209257_1006793 | 3300025304 | Bacteria | 7200 |
| 189 | Ga0209257_1007083 | 3300025304 | Bacteria | 6920 |
| 190 | Ga0209257_1008617 | 3300025304 | Bacteria | 5726 |
| 191 | Ga0207697_10023243 | 3300025315 | Bacteria | 2538 |
| 192 | Ga0207655_1000353 | 3300025728 | Bacteria | 66222 |
| 193 | Ga0207647_10000056 | 3300025904 | Bacteria | 86476 |
| 194 | Ga0207654_10004740 | 3300025911 | Bacteria | 6886 |
| 195 | Ga0207707_10032895 | 3300025912 | Bacteria | 4539 |
| 196 | Ga0207695_10018217 | 3300025913 | Bacteria | 8126 |
| 197 | Ga0207695_10157574 | 3300025913 | Bacteria | 2204 |
| 198 | Ga0207693_10023813 | 3300025915 | Bacteria | 4860 |
| 199 | Ga0207652_10039347 | 3300025921 | Bacteria | 4013 |
| 200 | Ga0207694_10001251 | 3300025924 | Bacteria | 21943 |
| 201 | Ga0207694_10014394 | 3300025924 | Bacteria | 5962 |
| 202 | Ga0207694_10085049 | 3300025924 | Bacteria | 2489 |
| 203 | Ga0207659_10077002 | 3300025926 | Bacteria | 2454 |
| 204 | Ga0207704_10093523 | 3300025938 | Bacteria | 1982 |
| 205 | Ga0207711_10014773 | 3300025941 | Bacteria | 6489 |
| 206 | Ga0207711_10134500 | 3300025941 | Bacteria | 2220 |
| 207 | Ga0207658_10121320 | 3300025986 | Bacteria | 2085 |
| 208 | Ga0207677_10043488 | 3300026023 | Bacteria | 2986 |
| 209 | Ga0207678_10037743 | 3300026067 | Bacteria | 4201 |
| 210 | Ga0207678_10119150 | 3300026067 | Bacteria | 2252 |
| 211 | Ga0207678_10137201 | 3300026067 | Bacteria | 2087 |
| 212 | Ga0207702_10000310 | 3300026078 | Bacteria | 55596 |
| 213 | Ga0207702_10059788 | 3300026078 | Bacteria | 3247 |
| 214 | Ga0207674_10005337 | 3300026116 | Bacteria | 15287 |
| 215 | Ga0207674_10033062 | 3300026116 | Bacteria | 5418 |
| 216 | Ga0207683_10091351 | 3300026121 | Bacteria | 2712 |
| 217 | Ga0207698_10120822 | 3300026142 | Bacteria | 2217 |
| 218 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 219 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 220 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 221 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 222 | Ga0209282_1000295 | 3300027666 | Bacteria | 24592 |
| 223 | Ga0268266_10020911 | 3300028379 | Bacteria | 5578 |
| 224 | Ga0268266_10066984 | 3300028379 | Bacteria | 3107 |
| 225 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 226 | Ga0268256_1003305 | 3300030500 | Bacteria | 7399 |
| 227 | Ga0307408_100000106 | 3300031548 | Bacteria | 91438 |
| 228 | Ga0307408_100007672 | 3300031548 | Bacteria | 7134 |
| 229 | Ga0307408_100021926 | 3300031548 | Bacteria | 4331 |
| 230 | Ga0307412_10000039 | 3300031911 | Bacteria | 182976 |
| 231 | Ga0307412_10008824 | 3300031911 | Bacteria | 5773 |
| 232 | Ga0307414_10000625 | 3300032004 | Bacteria | 18080 |
| 233 | Ga0307414_10003068 | 3300032004 | Bacteria | 8863 |
| 234 | Ga0307510_10054892 | 3300033180 | Bacteria | 4167 |
| 235 | Ga0307510_10144619 | 3300033180 | Bacteria | 2013 |
| 236 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 237 | Ga0373925_0174503 | 3300037068 | Bacteria | 1698 |
| 238 | Ga0395899_0025088 | 3300037312 | Bacteria | 4501 |
| 239 | Ga0395899_0082082 | 3300037312 | Bacteria | 2345 |
| 240 | Ga0395900_0065228 | 3300037418 | Bacteria | 3740 |
| 241 | Ga0395900_0105371 | 3300037418 | Bacteria | 2897 |
| 242 | Ga0395898_0018936 | 3300037466 | Bacteria | 7014 |
| 243 | Ga0395905_0000017 | 3300037471 | Bacteria | 376619 |
| 244 | Ga0395905_0002694 | 3300037471 | Bacteria | 19467 |
| 245 | Ga0395905_0068821 | 3300037471 | Bacteria | 3316 |
| 246 | Ga0395905_0153203 | 3300037471 | Bacteria | 2168 |
| 247 | Ga0395905_0187963 | 3300037471 | Bacteria | 1938 |
| 248 | Ga0395905_0234142 | 3300037471 | Bacteria | 1717 |
| 249 | Ga0395901_0148287 | 3300038443 | Bacteria | 2465 |
| 250 | Ga0436361_0066216 | 3300039447 | Bacteria | 14338 |
| 251 | Ga0436361_0267501 | 3300039447 | Bacteria | 17700 |
| 252 | Ga0436361_0713206 | 3300039447 | Bacteria | 50586 |
| 253 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 254 | Ga0466973_0042256 | 3300044659 | Bacteria | 4287 |
| 255 | Ga0466965_0101852 | 3300044683 | Bacteria | 1469 |
| 256 | Ga0466966_0015365 | 3300044684 | Bacteria | 5063 |
| 257 | Ga0466963_0102937 | 3300044694 | Bacteria | 1956 |
| 258 | Ga0466964_0063385 | 3300044706 | Bacteria | 1544 |
| 259 | Ga0466971_0035000 | 3300044719 | Bacteria | 2251 |
| 260 | Ga0466970_0023132 | 3300044765 | Bacteria | 3244 |
| 261 | Ga0466957_0035886 | 3300044842 | Bacteria | 2977 |
| 262 | Ga0466960_0027303 | 3300044901 | Bacteria | 2602 |
| 263 | Ga0466959_0083614 | 3300045049 | Bacteria | 2298 |
| 264 | Ga0466958_0018512 | 3300045836 | Bacteria | 4043 |
| 265 | Ga0495617_000055 | 3300046452 | Bacteria | 102065 |
| 266 | Ga0495617_002131 | 3300046452 | Bacteria | 8144 |
| 267 | Ga0495627_000123 | 3300046453 | Bacteria | 94862 |
| 268 | Ga0495627_004917 | 3300046453 | Bacteria | 5499 |
| 269 | Ga0495603_0042339 | 3300046455 | Bacteria | 2722 |
| 270 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 271 | Ga0495590_0000377 | 3300046457 | Bacteria | 22736 |
| 272 | Ga0495590_0000379 | 3300046457 | Bacteria | 22644 |
| 273 | Ga0495590_0011248 | 3300046457 | Bacteria | 3350 |
| 274 | Ga0495590_0024301 | 3300046457 | Bacteria | 2135 |
| 275 | Ga0495591_000176 | 3300046458 | Bacteria | 66020 |
| 276 | Ga0495591_008008 | 3300046458 | Bacteria | 4391 |
| 277 | Ga0495629_0000115 | 3300046459 | Bacteria | 72648 |
| 278 | Ga0495629_0013994 | 3300046459 | Bacteria | 5782 |
| 279 | Ga0495629_0060852 | 3300046459 | Bacteria | 2638 |
| 280 | Ga0495638_0000316 | 3300046460 | Bacteria | 62373 |
| 281 | Ga0495638_0014655 | 3300046460 | Bacteria | 5290 |
| 282 | Ga0495638_0015372 | 3300046460 | Bacteria | 5141 |
| 283 | Ga0495638_0100667 | 3300046460 | Bacteria | 1729 |
| 284 | Ga0495653_0025917 | 3300046463 | Bacteria | 4705 |
| 285 | Ga0495650_0017832 | 3300046471 | Bacteria | 3548 |
| 286 | Ga0495650_0022015 | 3300046471 | Bacteria | 3064 |
| 287 | Ga0495580_0007991 | 3300046472 | Bacteria | 8453 |
| 288 | Ga0495582_0013488 | 3300046473 | Bacteria | 4500 |
| 289 | Ga0495605_0000035 | 3300046474 | Bacteria | 208069 |
| 290 | Ga0495605_0010050 | 3300046474 | Bacteria | 5300 |
| 291 | Ga0495605_0010344 | 3300046474 | Bacteria | 5223 |
| 292 | Ga0495605_0037315 | 3300046474 | Bacteria | 2445 |
| 293 | Ga0495605_0048247 | 3300046474 | Bacteria | 2085 |
| 294 | Ga0495605_0055143 | 3300046474 | Bacteria | 1921 |
| 295 | Ga0495664_0034857 | 3300046477 | Bacteria | 2962 |
| 296 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 297 | Ga0495584_0000710 | 3300046491 | Bacteria | 21958 |
| 298 | Ga0495584_0001111 | 3300046491 | Bacteria | 16697 |
| 299 | Ga0495584_0059053 | 3300046491 | Bacteria | 1929 |
| 300 | Ga0495585_0000106 | 3300046492 | Bacteria | 89096 |
| 301 | Ga0495585_0000229 | 3300046492 | Bacteria | 57675 |
| 302 | Ga0495585_0001128 | 3300046492 | Bacteria | 21900 |
| 303 | Ga0495585_0005576 | 3300046492 | Bacteria | 7904 |
| 304 | Ga0495585_0013289 | 3300046492 | Bacteria | 4822 |
| 305 | Ga0495585_0014721 | 3300046492 | Bacteria | 4551 |
| 306 | Ga0495585_0022156 | 3300046492 | Bacteria | 3647 |
| 307 | Ga0495585_0075937 | 3300046492 | Bacteria | 1826 |
| 308 | Ga0495585_0096668 | 3300046492 | Bacteria | 1584 |
| 309 | Ga0495594_0004607 | 3300046499 | Bacteria | 7101 |
| 310 | Ga0495594_0007102 | 3300046499 | Bacteria | 5760 |
| 311 | Ga0495594_0011370 | 3300046499 | Bacteria | 4625 |
| 312 | Ga0495594_0013155 | 3300046499 | Bacteria | 4315 |
| 313 | Ga0495596_0000011 | 3300046500 | Bacteria | 129089 |
| 314 | Ga0495596_0000831 | 3300046500 | Bacteria | 18667 |
| 315 | Ga0495596_0005573 | 3300046500 | Bacteria | 5916 |
| 316 | Ga0495596_0007503 | 3300046500 | Bacteria | 4917 |
| 317 | Ga0495596_0008269 | 3300046500 | Bacteria | 4639 |
| 318 | Ga0495596_0009259 | 3300046500 | Bacteria | 4339 |
| 319 | Ga0495596_0013241 | 3300046500 | Bacteria | 3505 |
| 320 | Ga0495596_0035127 | 3300046500 | Bacteria | 1988 |
| 321 | Ga0495607_0001166 | 3300046501 | Bacteria | 23766 |
| 322 | Ga0495607_0001312 | 3300046501 | Bacteria | 22173 |
| 323 | Ga0495607_0002001 | 3300046501 | Bacteria | 17120 |
| 324 | Ga0495607_0004125 | 3300046501 | Bacteria | 10839 |
| 325 | Ga0495607_0004590 | 3300046501 | Bacteria | 10119 |
| 326 | Ga0495583_0000078 | 3300046506 | Bacteria | 171719 |
| 327 | Ga0495583_0000461 | 3300046506 | Bacteria | 60164 |
| 328 | Ga0495583_0004535 | 3300046506 | Bacteria | 9889 |
| 329 | Ga0495583_0017018 | 3300046506 | Bacteria | 3877 |
| 330 | Ga0495606_0000768 | 3300046507 | Bacteria | 49245 |
| 331 | Ga0495606_0002036 | 3300046507 | Bacteria | 24770 |
| 332 | Ga0495606_0002482 | 3300046507 | Bacteria | 21346 |
| 333 | Ga0495606_0003708 | 3300046507 | Bacteria | 15959 |
| 334 | Ga0495606_0005159 | 3300046507 | Bacteria | 12641 |
| 335 | Ga0495606_0008542 | 3300046507 | Bacteria | 8870 |
| 336 | Ga0495606_0052998 | 3300046507 | Bacteria | 2634 |
| 337 | Ga0495610_0007788 | 3300046512 | Bacteria | 7062 |
| 338 | Ga0495610_0011297 | 3300046512 | Bacteria | 5470 |
| 339 | Ga0495610_0035320 | 3300046512 | Bacteria | 2568 |
| 340 | Ga0495616_0001754 | 3300046513 | Bacteria | 14757 |
| 341 | Ga0495616_0001933 | 3300046513 | Bacteria | 13938 |
| 342 | Ga0495616_0004418 | 3300046513 | Bacteria | 8865 |
| 343 | Ga0495616_0025903 | 3300046513 | Bacteria | 3127 |
| 344 | Ga0495616_0027319 | 3300046513 | Bacteria | 3029 |
| 345 | Ga0495616_0027678 | 3300046513 | Bacteria | 3006 |
| 346 | Ga0495620_0002400 | 3300046515 | Bacteria | 10853 |
| 347 | Ga0495628_0004561 | 3300046516 | Bacteria | 12265 |
| 348 | Ga0495630_0053411 | 3300046517 | Bacteria | 3025 |
| 349 | Ga0495631_0002790 | 3300046518 | Bacteria | 9691 |
| 350 | Ga0495631_0005006 | 3300046518 | Bacteria | 6981 |
| 351 | Ga0495631_0017627 | 3300046518 | Bacteria | 3374 |
| 352 | Ga0495631_0035198 | 3300046518 | Bacteria | 2241 |
| 353 | Ga0495631_0046090 | 3300046518 | Bacteria | 1917 |
| 354 | Ga0495632_0006072 | 3300046519 | Bacteria | 7836 |
| 355 | Ga0495632_0026740 | 3300046519 | Bacteria | 3032 |
| 356 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 357 | Ga0495637_0037168 | 3300046520 | Bacteria | 2116 |
| 358 | Ga0495643_0004707 | 3300046522 | Bacteria | 9458 |
| 359 | Ga0495643_0009146 | 3300046522 | Bacteria | 6191 |
| 360 | Ga0495643_0009738 | 3300046522 | Bacteria | 5944 |
| 361 | Ga0495643_0014120 | 3300046522 | Bacteria | 4760 |
| 362 | Ga0495643_0044131 | 3300046522 | Bacteria | 2423 |
| 363 | Ga0495644_0002537 | 3300046523 | Bacteria | 7275 |
| 364 | Ga0495644_0004610 | 3300046523 | Bacteria | 5415 |
| 365 | Ga0495644_0009804 | 3300046523 | Bacteria | 3687 |
| 366 | Ga0495644_0032759 | 3300046523 | Bacteria | 1964 |
| 367 | Ga0495648_0000410 | 3300046524 | Bacteria | 47244 |
| 368 | Ga0495648_0000527 | 3300046524 | Bacteria | 41184 |
| 369 | Ga0495648_0001273 | 3300046524 | Bacteria | 25146 |
| 370 | Ga0495648_0005588 | 3300046524 | Bacteria | 10425 |
| 371 | Ga0495648_0007550 | 3300046524 | Bacteria | 8691 |
| 372 | Ga0495648_0009591 | 3300046524 | Bacteria | 7472 |
| 373 | Ga0495648_0034008 | 3300046524 | Bacteria | 3323 |
| 374 | Ga0495648_0052268 | 3300046524 | Bacteria | 2483 |
| 375 | Ga0495648_0065821 | 3300046524 | Bacteria | 2127 |
| 376 | Ga0495666_0022568 | 3300046526 | Bacteria | 3116 |
| 377 | Ga0495642_0000005 | 3300046528 | Bacteria | 176726 |
| 378 | Ga0495642_0000946 | 3300046528 | Bacteria | 13585 |
| 379 | Ga0495642_0008610 | 3300046528 | Bacteria | 3902 |
| 380 | Ga0495665_0001347 | 3300046531 | Bacteria | 13125 |
| 381 | Ga0495665_0015486 | 3300046531 | Bacteria | 4106 |
| 382 | Ga0495586_0003975 | 3300046535 | Bacteria | 7934 |
| 383 | Ga0495609_0000754 | 3300046538 | Bacteria | 24406 |
| 384 | Ga0495609_0001400 | 3300046538 | Bacteria | 16184 |
| 385 | Ga0495609_0003203 | 3300046538 | Bacteria | 9501 |
| 386 | Ga0495609_0007383 | 3300046538 | Bacteria | 5494 |
| 387 | Ga0495609_0010817 | 3300046538 | Bacteria | 4363 |
| 388 | Ga0495597_0000157 | 3300046542 | Bacteria | 60125 |
| 389 | Ga0495597_0000277 | 3300046542 | Bacteria | 46764 |
| 390 | Ga0495597_0000422 | 3300046542 | Bacteria | 36291 |
| 391 | Ga0495597_0010954 | 3300046542 | Bacteria | 4409 |
| 392 | Ga0495597_0016658 | 3300046542 | Bacteria | 3469 |
| 393 | Ga0495622_0006257 | 3300046557 | Bacteria | 5524 |
| 394 | Ga0495622_0020682 | 3300046557 | Bacteria | 3064 |
| 395 | Ga0495622_0021939 | 3300046557 | Bacteria | 2974 |
| 396 | Ga0495622_0023931 | 3300046557 | Bacteria | 2850 |
| 397 | Ga0495622_0039968 | 3300046557 | Bacteria | 2184 |
| 398 | Ga0495633_0004992 | 3300046558 | Bacteria | 8276 |
| 399 | Ga0495668_0000160 | 3300046616 | Bacteria | 101615 |
| 400 | Ga0495668_0000987 | 3300046616 | Bacteria | 31002 |
| 401 | Ga0495668_0002104 | 3300046616 | Bacteria | 17216 |
| 402 | Ga0495668_0004835 | 3300046616 | Bacteria | 9371 |
| 403 | Ga0495611_0000976 | 3300046648 | Bacteria | 15225 |
| 404 | Ga0495611_0009008 | 3300046648 | Bacteria | 4220 |
| 405 | Ga0495611_0010637 | 3300046648 | Bacteria | 3894 |
| 406 | Ga0495611_0016598 | 3300046648 | Bacteria | 3146 |
| 407 | Ga0495611_0021647 | 3300046648 | Bacteria | 2778 |
| 408 | Ga0495611_0031932 | 3300046648 | Bacteria | 2320 |
| 409 | Ga0495611_0033151 | 3300046648 | Bacteria | 2279 |
| 410 | Ga0495611_0041704 | 3300046648 | Bacteria | 2047 |
| 411 | Ga0495625_0000351 | 3300046660 | Bacteria | 70408 |
| 412 | Ga0495625_0002025 | 3300046660 | Bacteria | 22827 |
| 413 | Ga0495625_0004594 | 3300046660 | Bacteria | 12980 |
| 414 | Ga0495625_0085939 | 3300046660 | Bacteria | 2183 |
| 415 | Ga0495625_0172386 | 3300046660 | Bacteria | 1444 |
| 416 | Ga0495661_0000198 | 3300046665 | Bacteria | 69566 |
| 417 | Ga0495661_0001403 | 3300046665 | Bacteria | 20212 |
| 418 | Ga0495661_0002353 | 3300046665 | Bacteria | 14589 |
| 419 | Ga0495661_0005921 | 3300046665 | Bacteria | 8639 |
| 420 | Ga0495661_0006329 | 3300046665 | Bacteria | 8326 |
| 421 | Ga0495661_0012180 | 3300046665 | Bacteria | 5808 |
| 422 | Ga0495588_0011362 | 3300046674 | Bacteria | 4175 |
| 423 | Ga0495588_0014329 | 3300046674 | Bacteria | 3793 |
| 424 | Ga0495623_0007537 | 3300046679 | Bacteria | 7062 |
| 425 | Ga0495646_0049497 | 3300046680 | Bacteria | 2550 |
| 426 | Ga0495669_0000015 | 3300046684 | Bacteria | 140309 |
| 427 | Ga0495669_0001059 | 3300046684 | Bacteria | 11471 |
| 428 | Ga0495669_0001177 | 3300046684 | Bacteria | 10867 |
| 429 | Ga0495669_0011562 | 3300046684 | Bacteria | 3751 |
| 430 | Ga0495669_0018100 | 3300046684 | Bacteria | 3026 |
| 431 | Ga0495669_0072874 | 3300046684 | Bacteria | 1567 |
| 432 | Ga0495613_0043829 | 3300046689 | Bacteria | 3311 |
| 433 | Ga0495624_0071872 | 3300046690 | Bacteria | 2152 |
| 434 | Ga0495670_0000009 | 3300046691 | Bacteria | 210956 |
| 435 | Ga0495670_0001567 | 3300046691 | Bacteria | 11179 |
| 436 | Ga0495670_0013858 | 3300046691 | Bacteria | 3964 |
| 437 | Ga0495670_0021187 | 3300046691 | Bacteria | 3206 |
| 438 | Ga0495670_0041926 | 3300046691 | Bacteria | 2284 |
| 439 | Ga0495670_0053888 | 3300046691 | Bacteria | 2014 |
| 440 | Ga0495671_0000294 | 3300046692 | Bacteria | 41764 |
| 441 | Ga0495671_0000326 | 3300046692 | Bacteria | 39898 |
| 442 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 443 | Ga0495649_0013880 | 3300046694 | Bacteria | 4632 |
| 444 | Ga0495649_0026776 | 3300046694 | Bacteria | 3203 |
| 445 | Ga0495589_0000033 | 3300046794 | Bacteria | 162794 |
| 446 | Ga0495589_0002183 | 3300046794 | Bacteria | 11015 |
| 447 | Ga0495589_0012544 | 3300046794 | Bacteria | 4387 |
| 448 | Ga0495589_0015373 | 3300046794 | Bacteria | 3940 |
| 449 | Ga0495660_0005491 | 3300046810 | Bacteria | 7595 |
| 450 | Ga0495660_0009038 | 3300046810 | Bacteria | 5820 |
| 451 | Ga0495660_0013564 | 3300046810 | Bacteria | 4722 |
| 452 | Ga0495660_0026662 | 3300046810 | Bacteria | 3274 |
| 453 | Ga0495660_0041439 | 3300046810 | Bacteria | 2549 |
| 454 | Ga0495604_0088962 | 3300047317 | Bacteria | 2296 |
| 455 | Ga0495636_0002361 | 3300047318 | Bacteria | 7243 |
| 456 | Ga0495636_0058990 | 3300047318 | Bacteria | 1619 |
| 457 | Ga0495674_0009273 | 3300047319 | Bacteria | 9352 |
| 458 | Ga0495674_0078808 | 3300047319 | Bacteria | 2830 |
| 459 | Ga0495674_0095508 | 3300047319 | Bacteria | 2534 |
| 460 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 461 | Ga0495672_0000074 | 3300047320 | Bacteria | 179013 |
| 462 | Ga0495672_0007413 | 3300047320 | Bacteria | 8253 |
| 463 | Ga0495672_0034322 | 3300047320 | Bacteria | 3136 |
| 464 | Ga0495672_0064247 | 3300047320 | Bacteria | 2102 |
| 465 | Ga0495672_0090187 | 3300047320 | Bacteria | 1685 |
| 466 | Ga0495676_0000223 | 3300047321 | Bacteria | 45610 |
| 467 | Ga0495676_0000643 | 3300047321 | Bacteria | 28962 |
| 468 | Ga0495676_0014902 | 3300047321 | Bacteria | 6942 |
| 469 | Ga0495676_0022190 | 3300047321 | Bacteria | 5529 |
| 470 | Ga0495676_0079875 | 3300047321 | Bacteria | 2485 |
| 471 | Ga0495676_0094089 | 3300047321 | Bacteria | 2233 |
| 472 | Ga0495683_0000024 | 3300047323 | Bacteria | 156554 |
| 473 | Ga0495687_000046 | 3300047443 | Bacteria | 210412 |
| 474 | Ga0495687_027855 | 3300047443 | Bacteria | 2638 |
| 475 | Ga0495687_048187 | 3300047443 | Bacteria | 1829 |
| 476 | Ga0495677_0000203 | 3300047445 | Bacteria | 27348 |
| 477 | Ga0495677_0003472 | 3300047445 | Bacteria | 6119 |
| 478 | Ga0495679_000641 | 3300047446 | Bacteria | 23464 |
| 479 | Ga0495679_005255 | 3300047446 | Bacteria | 5775 |
| 480 | Ga0495679_006520 | 3300047446 | Bacteria | 5002 |
| 481 | Ga0495685_012445 | 3300047447 | Bacteria | 2883 |
| 482 | Ga0495685_019051 | 3300047447 | Bacteria | 2356 |
| 483 | Ga0495673_0001551 | 3300047469 | Bacteria | 18022 |
| 484 | Ga0495673_0010794 | 3300047469 | Bacteria | 4947 |
| 485 | Ga0495673_0052650 | 3300047469 | Bacteria | 1778 |
| 486 | Ga0495686_0000026 | 3300047472 | Bacteria | 383637 |
| 487 | Ga0495686_0000171 | 3300047472 | Bacteria | 123194 |
| 488 | Ga0495686_0000431 | 3300047472 | Bacteria | 65240 |
| 489 | Ga0495686_0000735 | 3300047472 | Bacteria | 43727 |
| 490 | Ga0495686_0013210 | 3300047472 | Bacteria | 5741 |
| 491 | Ga0495686_0022962 | 3300047472 | Bacteria | 4120 |
| 492 | Ga0495686_0070966 | 3300047472 | Bacteria | 2145 |
| 493 | Ga0495686_0095209 | 3300047472 | Unclassified | 1803 |
| 494 | Ga0495626_0003138 | 3300048091 | Bacteria | 10816 |
| 495 | Ga0495626_0003399 | 3300048091 | Bacteria | 10240 |
| 496 | Ga0495626_0016691 | 3300048091 | Bacteria | 3724 |
| 497 | Ga0495626_0025955 | 3300048091 | Bacteria | 2860 |
| 498 | Ga0495626_0026119 | 3300048091 | Bacteria | 2849 |
| 499 | Ga0495626_0027815 | 3300048091 | Bacteria | 2746 |
| 500 | Ga0495626_0038852 | 3300048091 | Bacteria | 2254 |
| 501 | Ga0496101_0167696 | 3300048904 | Bacteria | 1686 |
| 502 | Ga0496102_0000173 | 3300048905 | Bacteria | 87737 |
| 503 | Ga0496102_0004216 | 3300048905 | Bacteria | 12155 |
| 504 | Ga0496104_0024578 | 3300048907 | Bacteria | 5542 |
| 505 | Ga0496104_0285040 | 3300048907 | Bacteria | 1565 |
| 506 | Ga0496105_0045689 | 3300048908 | Bacteria | 3614 |
| 507 | Ga0496106_0000014 | 3300048909 | Bacteria | 194239 |
| 508 | Ga0496106_0009589 | 3300048909 | Bacteria | 7148 |
| 509 | Ga0496106_0111622 | 3300048909 | Bacteria | 2129 |
| 510 | Ga0496107_0000132 | 3300048910 | Bacteria | 36454 |
| 511 | Ga0496107_0001367 | 3300048910 | Bacteria | 15005 |
| 512 | Ga0496108_0028897 | 3300048911 | Bacteria | 4588 |
| 513 | Ga0496109_0004253 | 3300048912 | Bacteria | 11960 |
| 514 | Ga0496109_0026661 | 3300048912 | Bacteria | 5155 |
| 515 | Ga0496110_0008299 | 3300048913 | Bacteria | 8351 |
| 516 | Ga0496112_0042191 | 3300048915 | Bacteria | 4463 |
| 517 | Ga0496113_0074615 | 3300048916 | Bacteria | 2586 |
| 518 | Ga0496114_0087882 | 3300048917 | Bacteria | 2636 |
| 519 | Ga0496115_0008897 | 3300048918 | Bacteria | 7443 |
| 520 | Ga0496115_0084964 | 3300048918 | Bacteria | 2580 |
| 521 | Ga0496116_0030126 | 3300048919 | Bacteria | 3903 |
| 522 | Ga0496117_0006503 | 3300048920 | Bacteria | 11786 |
| 523 | Ga0496117_0039671 | 3300048920 | Bacteria | 3472 |
| 524 | Ga0496117_0047522 | 3300048920 | Bacteria | 3076 |
| 525 | Ga0496118_0000228 | 3300048921 | Bacteria | 98198 |
| 526 | Ga0496118_0055687 | 3300048921 | Bacteria | 2981 |
| 527 | Ga0496118_0077965 | 3300048921 | Bacteria | 2347 |
| 528 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 529 | Ga0496121_0000316 | 3300048924 | Bacteria | 100872 |
| 530 | Ga0496121_0001059 | 3300048924 | Bacteria | 48728 |
| 531 | Ga0496121_0006484 | 3300048924 | Bacteria | 14498 |
| 532 | Ga0496121_0008062 | 3300048924 | Bacteria | 12551 |
| 533 | Ga0496121_0009250 | 3300048924 | Bacteria | 11378 |
| 534 | Ga0496121_0013070 | 3300048924 | Bacteria | 8963 |
| 535 | Ga0496121_0013272 | 3300048924 | Bacteria | 8871 |
| 536 | Ga0496121_0018745 | 3300048924 | Bacteria | 6958 |
| 537 | Ga0496121_0020825 | 3300048924 | Bacteria | 6462 |
| 538 | Ga0496121_0045090 | 3300048924 | Bacteria | 3793 |
| 539 | Ga0496121_0053978 | 3300048924 | Bacteria | 3362 |
| 540 | Ga0496121_0062936 | 3300048924 | Bacteria | 3035 |
| 541 | Ga0496121_0067760 | 3300048924 | Bacteria | 2891 |
| 542 | Ga0496121_0089425 | 3300048924 | Bacteria | 2411 |
| 543 | Ga0496121_0134096 | 3300048924 | Bacteria | 1848 |
| 544 | Ga0496121_0181245 | 3300048924 | Bacteria | 1520 |
| 545 | Ga0496122_0000263 | 3300048925 | Bacteria | 117762 |
| 546 | Ga0496122_0004692 | 3300048925 | Bacteria | 16781 |
| 547 | Ga0496122_0116860 | 3300048925 | Bacteria | 1733 |
| 548 | Ga0496123_0000156 | 3300048926 | Bacteria | 139362 |
| 549 | Ga0496123_0000840 | 3300048926 | Bacteria | 49126 |
| 550 | Ga0496123_0008440 | 3300048926 | Bacteria | 9464 |
| 551 | Ga0496124_0069925 | 3300048927 | Bacteria | 2913 |
| 552 | Ga0496125_0000672 | 3300048928 | Bacteria | 57073 |
| 553 | Ga0496125_0027325 | 3300048928 | Bacteria | 5176 |
| 554 | Ga0496125_0055254 | 3300048928 | Bacteria | 3237 |
| 555 | Ga0496125_0121946 | 3300048928 | Bacteria | 1857 |
| 556 | Ga0496126_0001940 | 3300048929 | Bacteria | 29487 |
| 557 | Ga0496126_0003509 | 3300048929 | Bacteria | 19758 |
| 558 | Ga0496126_0037944 | 3300048929 | Bacteria | 4486 |
| 559 | Ga0496126_0041881 | 3300048929 | Bacteria | 4234 |
| 560 | Ga0496126_0068978 | 3300048929 | Bacteria | 3155 |
| 561 | Ga0496126_0069054 | 3300048929 | Bacteria | 3153 |
| 562 | Ga0466983_0006966 | 3300048986 | Bacteria | 8111 |
| 563 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 564 | Ga0495678_000084 | 3300049459 | Bacteria | 117340 |
| 565 | Ga0495678_012670 | 3300049459 | Bacteria | 3988 |
| 566 | Ga0495678_027512 | 3300049459 | Bacteria | 2412 |
| 567 | Ga0495682_0000114 | 3300049460 | Bacteria | 69788 |
| 568 | Ga0495682_0001658 | 3300049460 | Bacteria | 11425 |
| 569 | Ga0495682_0002118 | 3300049460 | Bacteria | 9653 |
| 570 | Ga0495682_0008300 | 3300049460 | Bacteria | 4098 |
| 571 | Ga0495682_0013577 | 3300049460 | Bacteria | 3098 |
| 572 | Ga0495682_0014505 | 3300049460 | Bacteria | 2987 |
| 573 | Ga0501032_0027862 | 3300049569 | Bacteria | 3882 |
| 574 | Ga0501033_0002631 | 3300049570 | Bacteria | 15105 |
| 575 | Ga0501033_0089457 | 3300049570 | Bacteria | 2252 |
| 576 | Ga0501034_0015233 | 3300049571 | Bacteria | 7902 |
| 577 | Ga0501036_0001868 | 3300049572 | Bacteria | 16328 |
| 578 | Ga0501037_0005101 | 3300049573 | Bacteria | 9553 |
| 579 | Ga0501038_0000276 | 3300049574 | Bacteria | 43448 |
| 580 | Ga0501038_0029628 | 3300049574 | Bacteria | 4848 |
| 581 | Ga0501039_0009202 | 3300049575 | Bacteria | 7527 |
| 582 | Ga0501043_0003013 | 3300049579 | Bacteria | 14020 |
| 583 | Ga0501043_0080638 | 3300049579 | Bacteria | 2557 |
| 584 | Ga0501046_0011595 | 3300049580 | Bacteria | 7534 |
| 585 | Ga0501047_0004929 | 3300049581 | Bacteria | 12538 |
| 586 | Ga0501047_0006910 | 3300049581 | Bacteria | 10662 |
| 587 | Ga0501047_0014333 | 3300049581 | Bacteria | 7539 |
| 588 | Ga0501047_0077944 | 3300049581 | Bacteria | 3187 |
| 589 | Ga0501048_0038426 | 3300049582 | Bacteria | 3434 |
| 590 | Ga0501067_0002106 | 3300049583 | Bacteria | 10960 |
| 591 | Ga0501068_0024578 | 3300049584 | Bacteria | 3539 |
| 592 | Ga0501068_0090958 | 3300049584 | Bacteria | 1883 |
| 593 | Ga0501069_0000483 | 3300049585 | Bacteria | 18234 |
| 594 | Ga0501070_0003133 | 3300049586 | Bacteria | 14401 |
| 595 | Ga0501070_0024967 | 3300049586 | Bacteria | 5012 |
| 596 | Ga0501073_0000456 | 3300049589 | Bacteria | 28306 |
| 597 | Ga0501073_0020341 | 3300049589 | Bacteria | 4789 |
| 598 | Ga0501073_0170183 | 3300049589 | Bacteria | 1508 |
| 599 | Ga0501074_0023481 | 3300049590 | Bacteria | 4482 |
| 600 | Ga0501080_0001321 | 3300049742 | Bacteria | 20652 |
| 601 | Ga0501080_0255474 | 3300049742 | Bacteria | 1597 |
| 602 | Ga0501083_0014280 | 3300049744 | Bacteria | 5555 |
| 603 | Ga0501083_0037976 | 3300049744 | Bacteria | 3275 |
| 604 | Ga0501035_0015892 | 3300049822 | Bacteria | 6945 |
| 605 | Ga0501035_0023613 | 3300049822 | Bacteria | 5642 |
| 606 | Ga0501035_0023771 | 3300049822 | Bacteria | 5622 |
| 607 | Ga0501044_0001875 | 3300049823 | Bacteria | 24361 |
| 608 | Ga0501044_0018935 | 3300049823 | Bacteria | 7371 |
| 609 | Ga0501044_0021138 | 3300049823 | Bacteria | 6948 |
| 610 | Ga0501044_0038973 | 3300049823 | Bacteria | 4961 |
| 611 | Ga0501044_0171353 | 3300049823 | Bacteria | 2142 |
| 612 | nmdc:mga00v17_29895_c1 | 3300050491 | Bacteria | 3200 |
| 613 | nmdc:mga0sz30_10285_c1 | 3300050516 | Bacteria | 3583 |
| 614 | nmdc:mga0sz30_21426_c1 | 3300050516 | Bacteria | 2616 |
| 615 | nmdc:mga0sz30_26189_c1 | 3300050516 | Bacteria | 2389 |
| 616 | Ga0500554_007438 | 3300053102 | Bacteria | 2520 |
| 617 | Ga0500594_0004725 | 3300053118 | Bacteria | 3006 |
| 618 | Ga0500595_004260 | 3300053119 | Bacteria | 6453 |
| 619 | Ga0500658_0013447 | 3300053134 | Bacteria | 3024 |
| 620 | Ga0500568_0002410 | 3300053139 | Bacteria | 11031 |
| 621 | Ga0500568_0032258 | 3300053139 | Bacteria | 2155 |
| 622 | Ga0500577_0000067 | 3300053142 | Bacteria | 23642 |
| 623 | Ga0500603_000163 | 3300053150 | Bacteria | 16654 |
| 624 | Ga0500616_0018758 | 3300053153 | Bacteria | 3909 |
| 625 | Ga0500622_0012625 | 3300053156 | Bacteria | 4572 |
| 626 | Ga0500637_0000178 | 3300053178 | Bacteria | 23661 |
| 627 | Ga0501084_0181568 | 3300054114 | Bacteria | 1776 |
| 628 | Ga0501082_0027393 | 3300060353 | Bacteria | 4905 |
| 629 | Ga0466962_0042538 | 3300061719 | Bacteria | 2174 |
| 630 | 2513657037 | 2513237096 | Bacteria | 8722461 |
| 631 | 2513675735 | 2513237098 | Bacteria | 9902361 |
| 632 | 2513855478 | 2513237137 | Bacteria | 9558895 |
| 633 | 2513876503 | 2513237139 | Bacteria | 8737671 |
| 634 | 2513918777 | 2513237145 | Bacteria | 8979722 |
| 635 | 2514010844 | 2513237161 | Bacteria | 8871253 |
| 636 | 2514053928 | 2513237166 | Bacteria | 10373764 |
| 637 | 2515608463 | 2515154107 | Bacteria | 6795637 |
| 638 | 2517892026 | 2517572143 | Bacteria | 9484767 |
| 639 | 2524441341 | 2524023205 | Bacteria | 8918781 |
| 640 | 2524466092 | 2524023210 | Bacteria | 9029266 |
| 641 | 2524534102 | 2524023228 | Bacteria | 10118060 |
| 642 | 2545675215 | 2545555834 | Bacteria | 8130841 |
| 643 | 2599105867 | 2597490356 | Bacteria | 7030811 |
| 644 | 2617352901 | 2617270735 | Bacteria | 9163226 |
| 645 | 2643792622 | 2643221554 | Bacteria | 6603920 |
| 646 | 2643796970 | 2643221556 | Bacteria | 7251154 |
| 647 | 2643798481 | 2643221556 | Bacteria | 7251154 |
| 648 | 2643927308 | 2643221584 | Bacteria | 5511711 |
| 649 | 2644105883 | 2643221618 | Bacteria | 7717186 |
| 650 | 2644147152 | 2643221626 | Bacteria | 8069654 |
| 651 | 2644191999 | 2643221634 | Bacteria | 6705461 |
| 652 | 2644216866 | 2643221638 | Bacteria | 6579467 |
| 653 | 2644310495 | 2643221655 | Bacteria | 7722067 |
| 654 | 2644334720 | 2643221659 | Bacteria | 7890716 |
| 655 | 2644469926 | 2643221684 | Bacteria | 7145183 |
| 656 | 2644475487 | 2643221684 | Bacteria | 7145183 |
| 657 | 2644545087 | 2643221698 | Bacteria | 7756764 |
| 658 | 2644612597 | 2643221712 | Bacteria | 7729434 |
| 659 | 2671121931 | 2667528175 | Bacteria | 7532676 |
| 660 | 2738819289 | 2738541296 | Bacteria | 7285013 |
| 661 | 2738831768 | 2738541298 | Bacteria | 7286732 |
| 662 | 2738873296 | 2738541306 | Bacteria | 7284992 |
| 663 | 2738885977 | 2738541307 | Bacteria | 8606193 |
| 664 | 2739184926 | 2738543002 | Bacteria | 7284546 |
| 665 | 2739219895 | 2738543008 | Bacteria | 7282815 |
| 666 | 2753765038 | 2751185897 | Bacteria | 5322941 |
| 667 | 2770195909 | 2767802442 | Bacteria | 5747986 |
| 668 | 2774389381 | 2773857761 | Bacteria | 3837365 |
| 669 | 2776267043 | 2775506902 | Bacteria | 6208009 |
| 670 | 2776284869 | 2775506904 | Bacteria | 5954060 |
| 671 | 2793063998 | 2791355196 | Bacteria | 7323613 |
| 672 | 2793068899 | 2791355197 | Bacteria | 8420563 |
| 673 | 2793323261 | 2791355260 | Bacteria | 6598818 |
| 674 | 2793370782 | 2791355267 | Bacteria | 7222458 |
| 675 | 2805919782 | 2802429603 | Bacteria | 8777136 |
| 676 | 2806052289 | 2802429634 | Bacteria | 7083200 |
| 677 | 2806058590 | 2802429635 | Bacteria | 7650140 |
| 678 | 2819643170 | 2818991453 | Bacteria | 7181617 |
| 679 | 2824668701 | 2824661429 | Bacteria | 9877870 |
| 680 | 2824699168 | 2824696289 | Bacteria | 8335049 |
| 681 | 2824710695 | 2824704595 | Bacteria | 9667483 |
| 682 | 2824758543 | 2824753945 | Bacteria | 9787441 |
| 683 | 2824768282 | 2824763712 | Bacteria | 9792355 |
| 684 | 2824779098 | 2824773399 | Bacteria | 8360218 |
| 685 | 2831867227 | 2831864461 | Bacteria | 6502356 |
| 686 | 2834642177 | 2834641062 | Bacteria | 5559922 |
| 687 | 2834643612 | 2834641062 | Bacteria | 5559922 |
| 688 | 2838126497 | 2838122688 | Bacteria | 8803140 |
| 689 | 2840766690 | 2840764183 | Bacteria | 6358399 |
| 690 | 2841947154 | 2841941048 | Bacteria | 8688029 |
| 691 | 2841950598 | 2841949485 | Bacteria | 8680857 |
| 692 | 2841966912 | 2841966195 | Bacteria | 8673214 |
| 693 | 2841975661 | 2841974524 | Bacteria | 8931498 |
| 694 | 2841990024 | 2841983080 | Bacteria | 8395090 |
| 695 | 2842047340 | 2842045827 | Bacteria | 8006841 |
| 696 | 2846955650 | 2846952575 | Bacteria | 6587527 |
| 697 | 2847945908 | 2847939898 | Bacteria | 8606328 |
| 698 | 2848862364 | 2848858292 | Bacteria | 7391279 |
| 699 | 2852682747 | 2852680915 | Bacteria | 4100189 |
| 700 | 2879102544 | 2879099564 | Bacteria | 10442239 |
| 701 | 2884340623 | 2884338543 | Bacteria | 4610696 |
| 702 | 2885277598 | 2885270888 | Bacteria | 9831543 |
| 703 | 2885375980 | 2885374607 | Bacteria | 8927485 |
| 704 | 2885390805 | 2885383462 | Bacteria | 9473874 |
| 705 | 2886853969 | 2886848708 | Bacteria | 5632523 |
| 706 | 2903753793 | 2903748898 | Bacteria | 9972761 |
| 707 | 2903772970 | 2903768456 | Bacteria | 9749579 |
| 708 | 2904702126 | |||
| 709 | 2904717211 | 2904711408 | Bacteria | 9771557 |
| 710 | 2906639214 | 2906635258 | Bacteria | 8601019 |
| 711 | 2906662414 | 2906660503 | Bacteria | 8595048 |
| 712 | 2908674329 | 2908669403 | Bacteria | 5740494 |
| 713 | 2908742302 | 2908739725 | Bacteria | 8628932 |
| 714 | 2909047611 | 2909042592 | Bacteria | 6499737 |
| 715 | 2919104808 | 2919100787 | Bacteria | 7710546 |
| 716 | 2922430691 | |||
| 717 | 2929617287 | 2929615660 | Bacteria | 9193770 |
| 718 | 2929618926 | 2929615660 | Bacteria | 9193770 |
| 719 | 2929626991 | 2929624759 | Bacteria | 9339455 |
| 720 | 2929631003 | 2929624759 | Bacteria | 9339455 |
| 721 | 2932813147 | 2932809354 | Bacteria | 9135765 |
| 722 | 2932820939 | 2932818245 | Bacteria | 9955613 |
| 723 | 2933579244 | 2933577622 | Bacteria | 9116884 |
| 724 | 2933580364 | 2933577622 | Bacteria | 9116884 |
| 725 | 2935611804 | 2935608549 | Bacteria | 8203142 |
| 726 | 2935645587 | 2935638405 | Bacteria | 10015038 |
| 727 | 2935667705 | 2935665750 | Bacteria | 9571747 |
| 728 | 2935706545 | 2935703347 | Bacteria | 10242284 |
| 729 | 2935768344 | 2935760218 | Bacteria | 9817913 |
| 730 | 2935813080 | 2935810662 | Bacteria | 9401221 |
| 731 | 2935821282 | 2935819856 | Bacteria | 8261050 |
| 732 | 2935830733 | 2935827899 | Bacteria | 10038562 |
| 733 | 2935840760 | 2935837841 | Bacteria | 9454360 |
| 734 | 2935850457 | 2935847175 | Bacteria | 8228321 |
| 735 | 2935914060 | 2935908558 | Bacteria | 8568796 |
| 736 | 2935921229 | 2935916978 | Bacteria | 9113783 |
| 737 | 2935931751 | 2935926038 | Bacteria | 8601059 |
| 738 | 2935940314 | 2935934488 | Bacteria | 8602579 |
| 739 | 2935947861 | 2935942939 | Bacteria | 8599779 |
| 740 | 2935956598 | 2935951376 | Bacteria | 8602333 |
| 741 | 2935973391 | 2935967501 | Bacteria | 8603075 |
| 742 | 2936006589 | 2936002035 | Bacteria | 9362176 |
| 743 | 2936043632 | 2936037263 | Bacteria | 9446081 |
| 744 | 2941473628 | 2941471342 | Bacteria | 5018624 |
| 745 | 2941506481 | 2941499720 | Bacteria | 7599444 |
| 746 | 2941541109 | 2941538514 | Bacteria | 9402094 |
| 747 | 2945940304 | 2945934425 | Bacteria | 7444609 |
| 748 | 2990707433 | 2990703756 | Bacteria | 7715990 |
| 749 | 3005413552 | 3005409236 | Bacteria | 7188837 |
| 750 | 3005447896 | 3005445848 | Bacteria | 6906074 |
| 751 | 3005480594 | 3005474847 | Bacteria | 9259049 |
| 752 | 641645748 | 641522639 | Bacteria | 7737025 |
| 753 | 642423873 | 641736151 | Bacteria | 7477263 |
| 754 | 642598637 | 642555112 | Bacteria | 8676562 |
| 755 | 8002062456 | 8002060224 | Bacteria | 4026565 |
| 756 | 8003401202 | 8003400568 | Bacteria | 5535898 |
| 757 | 8005320895 | 8005314921 | Bacteria | 7072929 |
| 758 | 8006940178 | 8006933436 | Bacteria | 10410654 |
| 759 | 8006979959 | 8006973647 | Bacteria | 10679141 |
| 760 | 8019556155 | 8019555841 | Bacteria | 9642137 |
| 761 | 8019569152 | 8019565922 | Bacteria | 9639779 |
| 762 | 8019627387 | 8019619141 | Bacteria | 9218857 |
| 763 | 8019689277 | 8019687851 | Bacteria | 8712826 |
| 764 | 8047676773 | 8047673197 | Bacteria | 7395230 |
| 765 | 8055742775 | 8055742211 | Bacteria | 9226248 |
| 766 | 8055747098 | 8055742211 | Bacteria | 9226248 |
| 767 | 8056688186 | 8056681323 | Bacteria | 8472857 |
| 768 | Ga0466961_0023441 | |||
| 769 | JGI24738J21930_10000521 | |||
| 770 | JGI25158J39367_1001076 | |||
| 771 | JGI25150J39212_1003484 | |||
| 772 | JGI25159J45721_1003778 | |||
| 773 | JGI25151J46595_10000338 | |||
| 774 | rootH1_10004683 | |||
| 775 | rootH2_10023281 | |||
| 776 | rootH2_10063443 | |||
| 777 | rootH2_10101131 | |||
| 778 | rootL2_10001921 | |||
| 779 | rootL2_10066572 | |||
| 780 | rootL2_10236162 | |||
| 781 | rootH1_10056171 | |||
| 782 | rootH1_10099455 | |||
| 783 | rootH1_10238995 | |||
| 784 | JGI25160J50197_1012996 | |||
| 785 | JGI25161J50226_1000422 | |||
| 786 | Ga0055539_1001020 | |||
| 787 | Ga0055526_1000344 | |||
| 788 | Ga0055526_1001794 | |||
| 789 | Ga0055526_1004959 | |||
| 790 | Ga0055526_1007352 | |||
| 791 | Ga0055526_1012889 | |||
| 792 | Ga0055537_1000066 | |||
| 793 | Ga0055537_1001231 | |||
| 794 | Ga0055537_1002572 | |||
| 795 | Ga0055537_1009522 | |||
| 796 | Ga0055524_1001045 | |||
| 797 | Ga0055524_1001055 | |||
| 798 | Ga0055524_1002019 | |||
| 799 | Ga0055524_1002588 | |||
| 800 | Ga0055536_1000103 | |||
| 801 | Ga0055534_1000057 | |||
| 802 | Ga0055534_1000085 | |||
| 803 | Ga0055534_1000104 | |||
| 804 | Ga0055534_1000158 | |||
| 805 | Ga0055534_1002848 | |||
| 806 | Ga0055534_1005419 | |||
| 807 | Ga0055528_1000318 | |||
| 808 | Ga0055528_1000457 | |||
| 809 | Ga0055530_10000164 | |||
| 810 | Ga0055530_10001073 | |||
| 811 | Ga0055530_10006703 | |||
| 812 | Ga0055530_10015783 | |||
| 813 | Ga0055530_10018560 | |||
| 814 | Ga0055531_10002244 | |||
| 815 | Ga0055531_10002595 | |||
| 816 | Ga0055531_10002776 | |||
| 817 | Ga0055531_10009846 | |||
| 818 | Ga0055531_10021787 | |||
| 819 | Ga0058692_1000001 | |||
| 820 | Ga0055543_1000750 | |||
| 821 | Ga0055543_1013092 | |||
| 822 | Ga0065165_1000323 | |||
| 823 | Ga0065165_1001295 | |||
| 824 | Ga0065165_1001608 | |||
| 825 | Ga0065165_1001785 | |||
| 826 | Ga0065165_1002099 | |||
| 827 | Ga0070683_100073572 | |||
| 828 | Ga0068868_100081083 | |||
| 829 | Ga0070668_100171535 | |||
| 830 | Ga0070675_100055471 | |||
| 831 | Ga0070671_100077934 | |||
| 832 | Ga0070673_100057279 | |||
| 833 | Ga0070673_100191034 | |||
| 834 | Ga0070667_100031006 | |||
| 835 | Ga0070667_100076083 | |||
| 836 | Ga0070663_100026674 | |||
| 837 | Ga0070706_100016569 | |||
| 838 | Ga0070698_100006981 | |||
| 839 | Ga0070699_100021704 | |||
| 840 | Ga0070679_100066236 | |||
| 841 | Ga0070684_100035827 | |||
| 842 | Ga0070697_100025973 | |||
| 843 | Ga0070697_100144410 | |||
| 844 | Ga0070665_100003864 | |||
| 845 | Ga0070665_100011128 | |||
| 846 | Ga0070665_100181465 | |||
| 847 | Ga0068855_100065623 | |||
| 848 | Ga0070664_100013756 | |||
| 849 | Ga0068857_100001662 | |||
| 850 | Ga0068857_100069985 | |||
| 851 | Ga0068854_100002216 | |||
| 852 | Ga0068856_100002254 | |||
| 853 | Ga0068852_100151502 | |||
| 854 | Ga0081455_10030359 | |||
| 855 | Ga0075432_10006014 | |||
| 856 | Ga0070712_100085252 | |||
| 857 | Ga0075370_10021735 | |||
| 858 | Ga0068871_100031714 | |||
| 859 | Ga0068865_100116142 | |||
| 860 | Ga0099825_1022681 | |||
| 861 | Ga0099824_1002487 | |||
| 862 | Ga0099822_1001480 | |||
| 863 | Ga0105251_10025719 | |||
| 864 | Ga0105244_10003674 | |||
| 865 | Ga0105244_10013049 | |||
| 866 | Ga0105240_10003464 | |||
| 867 | Ga0105240_10008605 | |||
| 868 | Ga0105240_10048479 | |||
| 869 | Ga0105240_10144472 | |||
| 870 | Ga0105241_10011257 | |||
| 871 | Ga0105248_10003289 | |||
| 872 | Ga0105248_10044933 | |||
| 873 | Ga0105238_10001028 | |||
| 874 | Ga0105238_10031004 | |||
| 875 | Ga0105238_10042210 | |||
| 876 | Ga0105246_10028919 | |||
| 877 | Ga0157319_1000026 | |||
| 878 | Ga0157370_10010294 | |||
| 879 | Ga0157369_10002208 | |||
| 880 | Ga0157369_10005932 | |||
| 881 | Ga0157369_10014477 | |||
| 882 | Ga0157369_10108132 | |||
| 883 | Ga0157374_10265234 | |||
| 884 | Ga0163162_10104303 | |||
| 885 | Ga0157372_10025495 | |||
| 886 | Ga0157372_10031668 | |||
| 887 | Ga0163163_10134767 | |||
| 888 | Ga0157380_10038615 | |||
| 889 | Ga0182008_10010733 | |||
| 890 | Ga0157377_10064211 | |||
| 891 | Ga0157376_10098612 | |||
| 892 | Ga0182007_10007531 | |||
| 893 | Ga0213872_10000017 | |||
| 894 | Ga0213872_10000340 | |||
| 895 | Ga0213872_10000601 | |||
| 896 | Ga0209436_100646 | |||
| 897 | Ga0209436_101485 | |||
| 898 | Ga0209436_102991 | |||
| 899 | Ga0207425_1000093 | |||
| 900 | Ga0209646_1000039 | |||
| 901 | Ga0209026_1000006 | |||
| 902 | Ga0209677_100131 | |||
| 903 | Ga0209677_103741 | |||
| 904 | Ga0209148_1000480 | |||
| 905 | Ga0209759_1000020 | |||
| 906 | Ga0209759_1013763 | |||
| 907 | Ga0209129_1003503 | |||
| 908 | Ga0209565_1000006 | |||
| 909 | Ga0209565_1000082 | |||
| 910 | Ga0209565_1000493 | |||
| 911 | Ga0209565_1000589 | |||
| 912 | Ga0209565_1003314 | |||
| 913 | Ga0209565_1014228 | |||
| 914 | Ga0209455_1000546 | |||
| 915 | Ga0209673_1000004 | |||
| 916 | Ga0209673_1000422 | |||
| 917 | Ga0209673_1010617 | |||
| 918 | Ga0209673_1023251 | |||
| 919 | Ga0209130_1000016 | |||
| 920 | Ga0209130_1000139 | |||
| 921 | Ga0209130_1001085 | |||
| 922 | Ga0209675_1000006 | |||
| 923 | Ga0209675_1000078 | |||
| 924 | Ga0209675_1000176 | |||
| 925 | Ga0209675_1000183 | |||
| 926 | Ga0209676_1000121 | |||
| 927 | Ga0209676_1000234 | |||
| 928 | Ga0209676_1000475 | |||
| 929 | Ga0209025_1000051 | |||
| 930 | Ga0209025_1001389 | |||
| 931 | Ga0209564_1000102 | |||
| 932 | Ga0209564_1000133 | |||
| 933 | Ga0209564_1000438 | |||
| 934 | Ga0209564_1000959 | |||
| 935 | Ga0209564_1001315 | |||
| 936 | Ga0209564_1016465 | |||
| 937 | Ga0209758_1010715 | |||
| 938 | Ga0209050_1000086 | |||
| 939 | Ga0209050_1000132 | |||
| 940 | Ga0209050_1000211 | |||
| 941 | Ga0209050_1000901 | |||
| 942 | Ga0209050_1002185 | |||
| 943 | Ga0209050_1002364 | |||
| 944 | Ga0209050_1006427 | |||
| 945 | Ga0209256_1000037 | |||
| 946 | Ga0209256_1000075 | |||
| 947 | Ga0209256_1000323 | |||
| 948 | Ga0209256_1001354 | |||
| 949 | Ga0209256_1001994 | |||
| 950 | Ga0207426_1001352 | |||
| 951 | Ga0209257_1000087 | |||
| 952 | Ga0209257_1000176 | |||
| 953 | Ga0209257_1001687 | |||
| 954 | Ga0209257_1002887 | |||
| 955 | Ga0209257_1006793 | |||
| 956 | Ga0209257_1007083 | |||
| 957 | Ga0209257_1008617 | |||
| 958 | Ga0207697_10023243 | |||
| 959 | Ga0207655_1000353 | |||
| 960 | Ga0207647_10000056 | |||
| 961 | Ga0207654_10004740 | |||
| 962 | Ga0207707_10032895 | |||
| 963 | Ga0207695_10018217 | |||
| 964 | Ga0207695_10157574 | |||
| 965 | Ga0207693_10023813 | |||
| 966 | Ga0207652_10039347 | |||
| 967 | Ga0207694_10001251 | |||
| 968 | Ga0207694_10014394 | |||
| 969 | Ga0207694_10085049 | |||
| 970 | Ga0207659_10077002 | |||
| 971 | Ga0207704_10093523 | |||
| 972 | Ga0207711_10014773 | |||
| 973 | Ga0207711_10134500 | |||
| 974 | Ga0207658_10121320 | |||
| 975 | Ga0207677_10043488 | |||
| 976 | Ga0207678_10037743 | |||
| 977 | Ga0207678_10119150 | |||
| 978 | Ga0207678_10137201 | |||
| 979 | Ga0207702_10000310 | |||
| 980 | Ga0207702_10059788 | |||
| 981 | Ga0207674_10005337 | |||
| 982 | Ga0207674_10033062 | |||
| 983 | Ga0207683_10091351 | |||
| 984 | Ga0207698_10120822 | |||
| 985 | Ga0209371_1000008 | |||
| 986 | Ga0209589_1000001 | |||
| 987 | Ga0209489_100001 | |||
| 988 | Ga0209700_100001 | |||
| 989 | Ga0209282_1000295 | |||
| 990 | Ga0268266_10020911 | |||
| 991 | Ga0268266_10066984 | |||
| 992 | Ga0268256_1000009 | |||
| 993 | Ga0268256_1003305 | |||
| 994 | Ga0307408_100000106 | |||
| 995 | Ga0307408_100007672 | |||
| 996 | Ga0307408_100021926 | |||
| 997 | Ga0307412_10000039 | |||
| 998 | Ga0307412_10008824 | |||
| 999 | Ga0307414_10000625 | |||
| 1000 | Ga0307414_10003068 | |||
| 1001 | Ga0307510_10054892 | |||
| 1002 | Ga0307510_10144619 | |||
| 1003 | Ga0315911_1000006 | |||
| 1004 | Ga0373925_0174503 | |||
| 1005 | Ga0395899_0025088 | |||
| 1006 | Ga0395899_0082082 | |||
| 1007 | Ga0395900_0065228 | |||
| 1008 | Ga0395900_0105371 | |||
| 1009 | Ga0395898_0018936 | |||
| 1010 | Ga0395905_0000017 | |||
| 1011 | Ga0395905_0002694 | |||
| 1012 | Ga0395905_0068821 | |||
| 1013 | Ga0395905_0153203 | |||
| 1014 | Ga0395905_0187963 | |||
| 1015 | Ga0395905_0234142 | |||
| 1016 | Ga0395901_0148287 | |||
| 1017 | Ga0436361_0066216 | |||
| 1018 | Ga0436361_0267501 | |||
| 1019 | Ga0436361_0713206 | |||
| 1020 | Ga0466972_0000113 | |||
| 1021 | Ga0466973_0042256 | |||
| 1022 | Ga0466965_0101852 | |||
| 1023 | Ga0466966_0015365 | |||
| 1024 | Ga0466963_0102937 | |||
| 1025 | Ga0466964_0063385 | |||
| 1026 | Ga0466971_0035000 | |||
| 1027 | Ga0466970_0023132 | |||
| 1028 | Ga0466957_0035886 | |||
| 1029 | Ga0466960_0027303 | |||
| 1030 | Ga0466959_0083614 | |||
| 1031 | Ga0466958_0018512 | |||
| 1032 | Ga0495617_000055 | |||
| 1033 | Ga0495617_002131 | |||
| 1034 | Ga0495627_000123 | |||
| 1035 | Ga0495627_004917 | |||
| 1036 | Ga0495603_0042339 | |||
| 1037 | Ga0495590_0000013 | |||
| 1038 | Ga0495590_0000377 | |||
| 1039 | Ga0495590_0000379 | |||
| 1040 | Ga0495590_0011248 | |||
| 1041 | Ga0495590_0024301 | |||
| 1042 | Ga0495591_000176 | |||
| 1043 | Ga0495591_008008 | |||
| 1044 | Ga0495629_0000115 | |||
| 1045 | Ga0495629_0013994 | |||
| 1046 | Ga0495629_0060852 | |||
| 1047 | Ga0495638_0000316 | |||
| 1048 | Ga0495638_0014655 | |||
| 1049 | Ga0495638_0015372 | |||
| 1050 | Ga0495638_0100667 | |||
| 1051 | Ga0495653_0025917 | |||
| 1052 | Ga0495650_0017832 | |||
| 1053 | Ga0495650_0022015 | |||
| 1054 | Ga0495580_0007991 | |||
| 1055 | Ga0495582_0013488 | |||
| 1056 | Ga0495605_0000035 | |||
| 1057 | Ga0495605_0010050 | |||
| 1058 | Ga0495605_0010344 | |||
| 1059 | Ga0495605_0037315 | |||
| 1060 | Ga0495605_0048247 | |||
| 1061 | Ga0495605_0055143 | |||
| 1062 | Ga0495664_0034857 | |||
| 1063 | Ga0495584_0000029 | |||
| 1064 | Ga0495584_0000710 | |||
| 1065 | Ga0495584_0001111 | |||
| 1066 | Ga0495584_0059053 | |||
| 1067 | Ga0495585_0000106 | |||
| 1068 | Ga0495585_0000229 | |||
| 1069 | Ga0495585_0001128 | |||
| 1070 | Ga0495585_0005576 | |||
| 1071 | Ga0495585_0013289 | |||
| 1072 | Ga0495585_0014721 | |||
| 1073 | Ga0495585_0022156 | |||
| 1074 | Ga0495585_0075937 | |||
| 1075 | Ga0495585_0096668 | |||
| 1076 | Ga0495594_0004607 | |||
| 1077 | Ga0495594_0007102 | |||
| 1078 | Ga0495594_0011370 | |||
| 1079 | Ga0495594_0013155 | |||
| 1080 | Ga0495596_0000011 | |||
| 1081 | Ga0495596_0000831 | |||
| 1082 | Ga0495596_0005573 | |||
| 1083 | Ga0495596_0007503 | |||
| 1084 | Ga0495596_0008269 | |||
| 1085 | Ga0495596_0009259 | |||
| 1086 | Ga0495596_0013241 | |||
| 1087 | Ga0495596_0035127 | |||
| 1088 | Ga0495607_0001166 | |||
| 1089 | Ga0495607_0001312 | |||
| 1090 | Ga0495607_0002001 | |||
| 1091 | Ga0495607_0004125 | |||
| 1092 | Ga0495607_0004590 | |||
| 1093 | Ga0495583_0000078 | |||
| 1094 | Ga0495583_0000461 | |||
| 1095 | Ga0495583_0004535 | |||
| 1096 | Ga0495583_0017018 | |||
| 1097 | Ga0495606_0000768 | |||
| 1098 | Ga0495606_0002036 | |||
| 1099 | Ga0495606_0002482 | |||
| 1100 | Ga0495606_0003708 | |||
| 1101 | Ga0495606_0005159 | |||
| 1102 | Ga0495606_0008542 | |||
| 1103 | Ga0495606_0052998 | |||
| 1104 | Ga0495610_0007788 | |||
| 1105 | Ga0495610_0011297 | |||
| 1106 | Ga0495610_0035320 | |||
| 1107 | Ga0495616_0001754 | |||
| 1108 | Ga0495616_0001933 | |||
| 1109 | Ga0495616_0004418 | |||
| 1110 | Ga0495616_0025903 | |||
| 1111 | Ga0495616_0027319 | |||
| 1112 | Ga0495616_0027678 | |||
| 1113 | Ga0495620_0002400 | |||
| 1114 | Ga0495628_0004561 | |||
| 1115 | Ga0495630_0053411 | |||
| 1116 | Ga0495631_0002790 | |||
| 1117 | Ga0495631_0005006 | |||
| 1118 | Ga0495631_0017627 | |||
| 1119 | Ga0495631_0035198 | |||
| 1120 | Ga0495631_0046090 | |||
| 1121 | Ga0495632_0006072 | |||
| 1122 | Ga0495632_0026740 | |||
| 1123 | Ga0495637_0000008 | |||
| 1124 | Ga0495637_0037168 | |||
| 1125 | Ga0495643_0004707 | |||
| 1126 | Ga0495643_0009146 | |||
| 1127 | Ga0495643_0009738 | |||
| 1128 | Ga0495643_0014120 | |||
| 1129 | Ga0495643_0044131 | |||
| 1130 | Ga0495644_0002537 | |||
| 1131 | Ga0495644_0004610 | |||
| 1132 | Ga0495644_0009804 | |||
| 1133 | Ga0495644_0032759 | |||
| 1134 | Ga0495648_0000410 | |||
| 1135 | Ga0495648_0000527 | |||
| 1136 | Ga0495648_0001273 | |||
| 1137 | Ga0495648_0005588 | |||
| 1138 | Ga0495648_0007550 | |||
| 1139 | Ga0495648_0009591 | |||
| 1140 | Ga0495648_0034008 | |||
| 1141 | Ga0495648_0052268 | |||
| 1142 | Ga0495648_0065821 | |||
| 1143 | Ga0495666_0022568 | |||
| 1144 | Ga0495642_0000005 | |||
| 1145 | Ga0495642_0000946 | |||
| 1146 | Ga0495642_0008610 | |||
| 1147 | Ga0495665_0001347 | |||
| 1148 | Ga0495665_0015486 | |||
| 1149 | Ga0495586_0003975 | |||
| 1150 | Ga0495609_0000754 | |||
| 1151 | Ga0495609_0001400 | |||
| 1152 | Ga0495609_0003203 | |||
| 1153 | Ga0495609_0007383 | |||
| 1154 | Ga0495609_0010817 | |||
| 1155 | Ga0495597_0000157 | |||
| 1156 | Ga0495597_0000277 | |||
| 1157 | Ga0495597_0000422 | |||
| 1158 | Ga0495597_0010954 | |||
| 1159 | Ga0495597_0016658 | |||
| 1160 | Ga0495622_0006257 | |||
| 1161 | Ga0495622_0020682 | |||
| 1162 | Ga0495622_0021939 | |||
| 1163 | Ga0495622_0023931 | |||
| 1164 | Ga0495622_0039968 | |||
| 1165 | Ga0495633_0004992 | |||
| 1166 | Ga0495668_0000160 | |||
| 1167 | Ga0495668_0000987 | |||
| 1168 | Ga0495668_0002104 | |||
| 1169 | Ga0495668_0004835 | |||
| 1170 | Ga0495611_0000976 | |||
| 1171 | Ga0495611_0009008 | |||
| 1172 | Ga0495611_0010637 | |||
| 1173 | Ga0495611_0016598 | |||
| 1174 | Ga0495611_0021647 | |||
| 1175 | Ga0495611_0031932 | |||
| 1176 | Ga0495611_0033151 | |||
| 1177 | Ga0495611_0041704 | |||
| 1178 | Ga0495625_0000351 | |||
| 1179 | Ga0495625_0002025 | |||
| 1180 | Ga0495625_0004594 | |||
| 1181 | Ga0495625_0085939 | |||
| 1182 | Ga0495625_0172386 | |||
| 1183 | Ga0495661_0000198 | |||
| 1184 | Ga0495661_0001403 | |||
| 1185 | Ga0495661_0002353 | |||
| 1186 | Ga0495661_0005921 | |||
| 1187 | Ga0495661_0006329 | |||
| 1188 | Ga0495661_0012180 | |||
| 1189 | Ga0495588_0011362 | |||
| 1190 | Ga0495588_0014329 | |||
| 1191 | Ga0495623_0007537 | |||
| 1192 | Ga0495646_0049497 | |||
| 1193 | Ga0495669_0000015 | |||
| 1194 | Ga0495669_0001059 | |||
| 1195 | Ga0495669_0001177 | |||
| 1196 | Ga0495669_0011562 | |||
| 1197 | Ga0495669_0018100 | |||
| 1198 | Ga0495669_0072874 | |||
| 1199 | Ga0495613_0043829 | |||
| 1200 | Ga0495624_0071872 | |||
| 1201 | Ga0495670_0000009 | |||
| 1202 | Ga0495670_0001567 | |||
| 1203 | Ga0495670_0013858 | |||
| 1204 | Ga0495670_0021187 | |||
| 1205 | Ga0495670_0041926 | |||
| 1206 | Ga0495670_0053888 | |||
| 1207 | Ga0495671_0000294 | |||
| 1208 | Ga0495671_0000326 | |||
| 1209 | Ga0495649_0000071 | |||
| 1210 | Ga0495649_0013880 | |||
| 1211 | Ga0495649_0026776 | |||
| 1212 | Ga0495589_0000033 | |||
| 1213 | Ga0495589_0002183 | |||
| 1214 | Ga0495589_0012544 | |||
| 1215 | Ga0495589_0015373 | |||
| 1216 | Ga0495660_0005491 | |||
| 1217 | Ga0495660_0009038 | |||
| 1218 | Ga0495660_0013564 | |||
| 1219 | Ga0495660_0026662 | |||
| 1220 | Ga0495660_0041439 | |||
| 1221 | Ga0495604_0088962 | |||
| 1222 | Ga0495636_0002361 | |||
| 1223 | Ga0495636_0058990 | |||
| 1224 | Ga0495674_0009273 | |||
| 1225 | Ga0495674_0078808 | |||
| 1226 | Ga0495674_0095508 | |||
| 1227 | Ga0495672_0000033 | |||
| 1228 | Ga0495672_0000074 | |||
| 1229 | Ga0495672_0007413 | |||
| 1230 | Ga0495672_0034322 | |||
| 1231 | Ga0495672_0064247 | |||
| 1232 | Ga0495672_0090187 | |||
| 1233 | Ga0495676_0000223 | |||
| 1234 | Ga0495676_0000643 | |||
| 1235 | Ga0495676_0014902 | |||
| 1236 | Ga0495676_0022190 | |||
| 1237 | Ga0495676_0079875 | |||
| 1238 | Ga0495676_0094089 | |||
| 1239 | Ga0495683_0000024 | |||
| 1240 | Ga0495687_000046 | |||
| 1241 | Ga0495687_027855 | |||
| 1242 | Ga0495687_048187 | |||
| 1243 | Ga0495677_0000203 | |||
| 1244 | Ga0495677_0003472 | |||
| 1245 | Ga0495679_000641 | |||
| 1246 | Ga0495679_005255 | |||
| 1247 | Ga0495679_006520 | |||
| 1248 | Ga0495685_012445 | |||
| 1249 | Ga0495685_019051 | |||
| 1250 | Ga0495673_0001551 | |||
| 1251 | Ga0495673_0010794 | |||
| 1252 | Ga0495673_0052650 | |||
| 1253 | Ga0495686_0000026 | |||
| 1254 | Ga0495686_0000171 | |||
| 1255 | Ga0495686_0000431 | |||
| 1256 | Ga0495686_0000735 | |||
| 1257 | Ga0495686_0013210 | |||
| 1258 | Ga0495686_0022962 | |||
| 1259 | Ga0495686_0070966 | |||
| 1260 | Ga0495686_0095209 | |||
| 1261 | Ga0495626_0003138 | |||
| 1262 | Ga0495626_0003399 | |||
| 1263 | Ga0495626_0016691 | |||
| 1264 | Ga0495626_0025955 | |||
| 1265 | Ga0495626_0026119 | |||
| 1266 | Ga0495626_0027815 | |||
| 1267 | Ga0495626_0038852 | |||
| 1268 | Ga0496101_0167696 | |||
| 1269 | Ga0496102_0000173 | |||
| 1270 | Ga0496102_0004216 | |||
| 1271 | Ga0496104_0024578 | |||
| 1272 | Ga0496104_0285040 | |||
| 1273 | Ga0496105_0045689 | |||
| 1274 | Ga0496106_0000014 | |||
| 1275 | Ga0496106_0009589 | |||
| 1276 | Ga0496106_0111622 | |||
| 1277 | Ga0496107_0000132 | |||
| 1278 | Ga0496107_0001367 | |||
| 1279 | Ga0496108_0028897 | |||
| 1280 | Ga0496109_0004253 | |||
| 1281 | Ga0496109_0026661 | |||
| 1282 | Ga0496110_0008299 | |||
| 1283 | Ga0496112_0042191 | |||
| 1284 | Ga0496113_0074615 | |||
| 1285 | Ga0496114_0087882 | |||
| 1286 | Ga0496115_0008897 | |||
| 1287 | Ga0496115_0084964 | |||
| 1288 | Ga0496116_0030126 | |||
| 1289 | Ga0496117_0006503 | |||
| 1290 | Ga0496117_0039671 | |||
| 1291 | Ga0496117_0047522 | |||
| 1292 | Ga0496118_0000228 | |||
| 1293 | Ga0496118_0055687 | |||
| 1294 | Ga0496118_0077965 | |||
| 1295 | Ga0496121_0000044 | |||
| 1296 | Ga0496121_0000316 | |||
| 1297 | Ga0496121_0001059 | |||
| 1298 | Ga0496121_0006484 | |||
| 1299 | Ga0496121_0008062 | |||
| 1300 | Ga0496121_0009250 | |||
| 1301 | Ga0496121_0013070 | |||
| 1302 | Ga0496121_0013272 | |||
| 1303 | Ga0496121_0018745 | |||
| 1304 | Ga0496121_0020825 | |||
| 1305 | Ga0496121_0045090 | |||
| 1306 | Ga0496121_0053978 | |||
| 1307 | Ga0496121_0062936 | |||
| 1308 | Ga0496121_0067760 | |||
| 1309 | Ga0496121_0089425 | |||
| 1310 | Ga0496121_0134096 | |||
| 1311 | Ga0496121_0181245 | |||
| 1312 | Ga0496122_0000263 | |||
| 1313 | Ga0496122_0004692 | |||
| 1314 | Ga0496122_0116860 | |||
| 1315 | Ga0496123_0000156 | |||
| 1316 | Ga0496123_0000840 | |||
| 1317 | Ga0496123_0008440 | |||
| 1318 | Ga0496124_0069925 | |||
| 1319 | Ga0496125_0000672 | |||
| 1320 | Ga0496125_0027325 | |||
| 1321 | Ga0496125_0055254 | |||
| 1322 | Ga0496125_0121946 | |||
| 1323 | Ga0496126_0001940 | |||
| 1324 | Ga0496126_0003509 | |||
| 1325 | Ga0496126_0037944 | |||
| 1326 | Ga0496126_0041881 | |||
| 1327 | Ga0496126_0068978 | |||
| 1328 | Ga0496126_0069054 | |||
| 1329 | Ga0466983_0006966 | |||
| 1330 | Ga0495678_000024 | |||
| 1331 | Ga0495678_000084 | |||
| 1332 | Ga0495678_012670 | |||
| 1333 | Ga0495678_027512 | |||
| 1334 | Ga0495682_0000114 | |||
| 1335 | Ga0495682_0001658 | |||
| 1336 | Ga0495682_0002118 | |||
| 1337 | Ga0495682_0008300 | |||
| 1338 | Ga0495682_0013577 | |||
| 1339 | Ga0495682_0014505 | |||
| 1340 | Ga0501032_0027862 | |||
| 1341 | Ga0501033_0002631 | |||
| 1342 | Ga0501033_0089457 | |||
| 1343 | Ga0501034_0015233 | |||
| 1344 | Ga0501036_0001868 | |||
| 1345 | Ga0501037_0005101 | |||
| 1346 | Ga0501038_0000276 | |||
| 1347 | Ga0501038_0029628 | |||
| 1348 | Ga0501039_0009202 | |||
| 1349 | Ga0501043_0003013 | |||
| 1350 | Ga0501043_0080638 | |||
| 1351 | Ga0501046_0011595 | |||
| 1352 | Ga0501047_0004929 | |||
| 1353 | Ga0501047_0006910 | |||
| 1354 | Ga0501047_0014333 | |||
| 1355 | Ga0501047_0077944 | |||
| 1356 | Ga0501048_0038426 | |||
| 1357 | Ga0501067_0002106 | |||
| 1358 | Ga0501068_0024578 | |||
| 1359 | Ga0501068_0090958 | |||
| 1360 | Ga0501069_0000483 | |||
| 1361 | Ga0501070_0003133 | |||
| 1362 | Ga0501070_0024967 | |||
| 1363 | Ga0501073_0000456 | |||
| 1364 | Ga0501073_0020341 | |||
| 1365 | Ga0501073_0170183 | |||
| 1366 | Ga0501074_0023481 | |||
| 1367 | Ga0501080_0001321 | |||
| 1368 | Ga0501080_0255474 | |||
| 1369 | Ga0501083_0014280 | |||
| 1370 | Ga0501083_0037976 | |||
| 1371 | Ga0501035_0015892 | |||
| 1372 | Ga0501035_0023613 | |||
| 1373 | Ga0501035_0023771 | |||
| 1374 | Ga0501044_0001875 | |||
| 1375 | Ga0501044_0018935 | |||
| 1376 | Ga0501044_0021138 | |||
| 1377 | Ga0501044_0038973 | |||
| 1378 | Ga0501044_0171353 | |||
| 1379 | nmdc:mga00v17_29895_c1 | |||
| 1380 | nmdc:mga0sz30_10285_c1 | |||
| 1381 | nmdc:mga0sz30_21426_c1 | |||
| 1382 | nmdc:mga0sz30_26189_c1 | |||
| 1383 | Ga0500554_007438 | |||
| 1384 | Ga0500594_0004725 | |||
| 1385 | Ga0500595_004260 | |||
| 1386 | Ga0500658_0013447 | |||
| 1387 | Ga0500568_0002410 | |||
| 1388 | Ga0500568_0032258 | |||
| 1389 | Ga0500577_0000067 | |||
| 1390 | Ga0500603_000163 | |||
| 1391 | Ga0500616_0018758 | |||
| 1392 | Ga0500622_0012625 | |||
| 1393 | Ga0500637_0000178 | |||
| 1394 | Ga0501084_0181568 | |||
| 1395 | Ga0501082_0027393 | |||
| 1396 | Ga0466962_0042538 | |||
| 1397 | 2513657037 | |||
| 1398 | 2513675735 | |||
| 1399 | 2513855478 | |||
| 1400 | 2513876503 | |||
| 1401 | 2513918777 | |||
| 1402 | 2514010844 | |||
| 1403 | 2514053928 | |||
| 1404 | 2515608463 | |||
| 1405 | 2517892026 | |||
| 1406 | 2524441341 | |||
| 1407 | 2524466092 | |||
| 1408 | 2524534102 | |||
| 1409 | 2545675215 | |||
| 1410 | 2599105867 | |||
| 1411 | 2617352901 | |||
| 1412 | 2643792622 | |||
| 1413 | 2643796970 | |||
| 1414 | 2643798481 | |||
| 1415 | 2643927308 | |||
| 1416 | 2644105883 | |||
| 1417 | 2644147152 | |||
| 1418 | 2644191999 | |||
| 1419 | 2644216866 | |||
| 1420 | 2644310495 | |||
| 1421 | 2644334720 | |||
| 1422 | 2644469926 | |||
| 1423 | 2644475487 | |||
| 1424 | 2644545087 | |||
| 1425 | 2644612597 | |||
| 1426 | 2671121931 | |||
| 1427 | 2738819289 | |||
| 1428 | 2738831768 | |||
| 1429 | 2738873296 | |||
| 1430 | 2738885977 | |||
| 1431 | 2739184926 | |||
| 1432 | 2739219895 | |||
| 1433 | 2753765038 | |||
| 1434 | 2770195909 | |||
| 1435 | 2774389381 | |||
| 1436 | 2776267043 | |||
| 1437 | 2776284869 | |||
| 1438 | 2793063998 | |||
| 1439 | 2793068899 | |||
| 1440 | 2793323261 | |||
| 1441 | 2793370782 | |||
| 1442 | 2805919782 | |||
| 1443 | 2806052289 | |||
| 1444 | 2806058590 | |||
| 1445 | 2819643170 | |||
| 1446 | 2824668701 | |||
| 1447 | 2824699168 | |||
| 1448 | 2824710695 | |||
| 1449 | 2824758543 | |||
| 1450 | 2824768282 | |||
| 1451 | 2824779098 | |||
| 1452 | 2831867227 | |||
| 1453 | 2834642177 | |||
| 1454 | 2834643612 | |||
| 1455 | 2838126497 | |||
| 1456 | 2840766690 | |||
| 1457 | 2841947154 | |||
| 1458 | 2841950598 | |||
| 1459 | 2841966912 | |||
| 1460 | 2841975661 | |||
| 1461 | 2841990024 | |||
| 1462 | 2842047340 | |||
| 1463 | 2846955650 | |||
| 1464 | 2847945908 | |||
| 1465 | 2848862364 | |||
| 1466 | 2852682747 | |||
| 1467 | 2879102544 | |||
| 1468 | 2884340623 | |||
| 1469 | 2885277598 | |||
| 1470 | 2885375980 | |||
| 1471 | 2885390805 | |||
| 1472 | 2886853969 | |||
| 1473 | 2903753793 | |||
| 1474 | 2903772970 | |||
| 1475 | 2904702126 | |||
| 1476 | 2904717211 | |||
| 1477 | 2906639214 | |||
| 1478 | 2906662414 | |||
| 1479 | 2908674329 | |||
| 1480 | 2908742302 | |||
| 1481 | 2909047611 | |||
| 1482 | 2919104808 | |||
| 1483 | 2922430691 | |||
| 1484 | 2929617287 | |||
| 1485 | 2929618926 | |||
| 1486 | 2929626991 | |||
| 1487 | 2929631003 | |||
| 1488 | 2932813147 | |||
| 1489 | 2932820939 | |||
| 1490 | 2933579244 | |||
| 1491 | 2933580364 | |||
| 1492 | 2935611804 | |||
| 1493 | 2935645587 | |||
| 1494 | 2935667705 | |||
| 1495 | 2935706545 | |||
| 1496 | 2935768344 | |||
| 1497 | 2935813080 | |||
| 1498 | 2935821282 | |||
| 1499 | 2935830733 | |||
| 1500 | 2935840760 | |||
| 1501 | 2935850457 | |||
| 1502 | 2935914060 | |||
| 1503 | 2935921229 | |||
| 1504 | 2935931751 | |||
| 1505 | 2935940314 | |||
| 1506 | 2935947861 | |||
| 1507 | 2935956598 | |||
| 1508 | 2935973391 | |||
| 1509 | 2936006589 | |||
| 1510 | 2936043632 | |||
| 1511 | 2941473628 | |||
| 1512 | 2941506481 | |||
| 1513 | 2941541109 | |||
| 1514 | 2945940304 | |||
| 1515 | 2990707433 | |||
| 1516 | 3005413552 | |||
| 1517 | 3005447896 | |||
| 1518 | 3005480594 | |||
| 1519 | 641645748 | |||
| 1520 | 642423873 | |||
| 1521 | 642598637 | |||
| 1522 | 8002062456 | |||
| 1523 | 8003401202 | |||
| 1524 | 8005320895 | |||
| 1525 | 8006940178 | |||
| 1526 | 8006979959 | |||
| 1527 | 8019556155 | |||
| 1528 | 8019569152 | |||
| 1529 | 8019627387 | |||
| 1530 | 8019689277 | |||
| 1531 | 8047676773 | |||
| 1532 | 8055742775 | |||
| 1533 | 8055747098 | |||
| 1534 | 8056688186 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9444 | 8 | 81 |
| 7pq9-assembly7.cif.gz_KKK | crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution | 0.9379 | 5 | 84 |
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.9295 | 15 | 81 |
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9209 | 8 | 81 |
| 7pq9-assembly7.cif.gz_KKK | crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution | 0.9161 | 5 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9696 | 38 | 80 | 1.10.10.10 |
| 4hamA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9637 | 5 | 81 | 1.10.10.10 |
| af_P9WMG5_6_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9528 | 18 | 81 | 1.10.10.10 |
| 4u0vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9516 | 6 | 81 | 1.10.10.10 |
| 4u0wA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9505 | 6 | 81 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2X9J2-F1-model_v4 | GntR family transcriptional regulator | 0.9896 | 5 | 81 |
GO:0003677
GO:0003700 |
| AF-H8G6P6-F1-model_v4 | Putative transcriptional regulator | 0.9875 | 7 | 81 |
GO:0003677
GO:0003700 |
| AF-A0A3Q9B4B5-F1-model_v4 | deleted | 0.9813 | 6 | 81 |
|
| AF-A0A838IV63-F1-model_v4 | GntR family transcriptional regulator | 0.9725 | 5 | 81 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A4P6MQK0-F1-model_v4 | GntR family transcriptional regulator | 0.961 | 4 | 81 |
GO:0003677
GO:0003700 GO:0045892 |