F479876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 250 | 766 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_0083142|Ga0495619_0083142_1292_2029 |
| Length | 245 |
| Sequence | LTLGRRALVDSTGLQSERGPTTRELLRLIHSIENSLLDFISSVYDFISWPGVIFLMAIESACIPLPSELIMPLAGWMLIKEKGLGFEWVLLAALCGAIGNTLGSYISYQAGAIGGRPAVEKYGKYILISRHDLDLADRFFTRWGMIAVFFSRMLPIVRTFISLPAGISKMDLRPFILYTFAGSFIWSLALASAGYLLGQNWEDLRTWMRPADYPIAAILAVLLVWYVVRHIRRAWEEPQPSGPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 214 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 217 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 220 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 223 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 224 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 225 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 226 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 227 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 231 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 232 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 233 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 234 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 236 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.04 |
| Rhizosphere | 98.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3991568 | 2162886006 | Bacteria | 1185 |
| 2 | SwRhRL2b_contig_634714 | 2162886007 | Bacteria | 3149 |
| 3 | CNAas_1003399 | 3300000532 | Bacteria | 1057 |
| 4 | JGI24748J21848_1000007 | 3300002074 | Bacteria | 208838 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI24742J22300_10010201 | 3300002244 | Bacteria | 1553 |
| 7 | JGI25406J46586_10003843 | 3300003203 | Bacteria | 7020 |
| 8 | JGI25406J46586_10037658 | 3300003203 | Bacteria | 1741 |
| 9 | Ga0065714_10064507 | 3300005288 | Bacteria | 46235 |
| 10 | Ga0065704_10071515 | 3300005289 | Bacteria | 10836 |
| 11 | Ga0065704_10145422 | 3300005289 | Bacteria | 1476 |
| 12 | Ga0065704_10171333 | 3300005289 | Bacteria | 1289 |
| 13 | Ga0065704_10290960 | 3300005289 | Bacteria | 903 |
| 14 | Ga0065712_10000138 | 3300005290 | Bacteria | 62583 |
| 15 | Ga0065712_10000296 | 3300005290 | Bacteria | 17305 |
| 16 | Ga0065712_10080959 | 3300005290 | Bacteria | 3052 |
| 17 | Ga0065712_10092482 | 3300005290 | Bacteria | 2330 |
| 18 | Ga0065712_10095370 | 3300005290 | Bacteria | 2221 |
| 19 | Ga0065712_10099129 | 3300005290 | Bacteria | 2099 |
| 20 | Ga0065712_10125985 | 3300005290 | Bacteria | 1607 |
| 21 | Ga0065712_10218737 | 3300005290 | Bacteria | 1022 |
| 22 | Ga0065715_10004340 | 3300005293 | Bacteria | 8226 |
| 23 | Ga0065715_10005901 | 3300005293 | Bacteria | 3618 |
| 24 | Ga0065715_10033378 | 3300005293 | Unclassified | 1591 |
| 25 | Ga0065715_10090469 | 3300005293 | Bacteria | 6953 |
| 26 | Ga0065715_10127631 | 3300005293 | Bacteria | 2083 |
| 27 | Ga0065715_10150012 | 3300005293 | Bacteria | 1740 |
| 28 | Ga0065715_10174762 | 3300005293 | Bacteria | 1517 |
| 29 | Ga0065715_10228143 | 3300005293 | Bacteria | 1244 |
| 30 | Ga0065715_10462673 | 3300005293 | Unclassified | 765 |
| 31 | Ga0065707_10003030 | 3300005295 | Bacteria | 4661 |
| 32 | Ga0065707_10087245 | 3300005295 | Bacteria | 5100 |
| 33 | Ga0065707_10087734 | 3300005295 | Bacteria | 4911 |
| 34 | Ga0065707_10094864 | 3300005295 | Bacteria | 3443 |
| 35 | Ga0065707_10190143 | 3300005295 | Bacteria | 1366 |
| 36 | Ga0070676_10057386 | 3300005328 | Viruses | 2304 |
| 37 | Ga0070676_10454192 | 3300005328 | Bacteria | 902 |
| 38 | Ga0070683_100015643 | 3300005329 | Bacteria | 6669 |
| 39 | Ga0070690_100004266 | 3300005330 | Bacteria | 7921 |
| 40 | Ga0070690_100005770 | 3300005330 | Bacteria | 6977 |
| 41 | Ga0070690_100046047 | 3300005330 | Bacteria | 2773 |
| 42 | Ga0070690_100144975 | 3300005330 | Bacteria | 1615 |
| 43 | Ga0070670_100009843 | 3300005331 | Bacteria | 8164 |
| 44 | Ga0070670_100022889 | 3300005331 | Bacteria | 5376 |
| 45 | Ga0070670_100092145 | 3300005331 | Bacteria | 2606 |
| 46 | Ga0070670_100490155 | 3300005331 | Bacteria | 1092 |
| 47 | Ga0068869_100083550 | 3300005334 | Bacteria | 2389 |
| 48 | Ga0068869_100158218 | 3300005334 | Bacteria | 1762 |
| 49 | Ga0068869_100531802 | 3300005334 | Unclassified | 985 |
| 50 | Ga0068869_100629904 | 3300005334 | Unclassified | 909 |
| 51 | Ga0068869_100755954 | 3300005334 | Bacteria | 833 |
| 52 | Ga0068869_100886103 | 3300005334 | Viruses | 771 |
| 53 | Ga0070666_10113732 | 3300005335 | Unclassified | 1873 |
| 54 | Ga0070666_10116685 | 3300005335 | Bacteria | 1849 |
| 55 | Ga0070680_100001059 | 3300005336 | Bacteria | 19716 |
| 56 | Ga0070680_100021413 | 3300005336 | Bacteria | 5139 |
| 57 | Ga0070680_100541342 | 3300005336 | Bacteria | 998 |
| 58 | Ga0070682_100002890 | 3300005337 | Bacteria | 9532 |
| 59 | Ga0070682_100003390 | 3300005337 | Bacteria | 8836 |
| 60 | Ga0070682_100954886 | 3300005337 | Unclassified | 708 |
| 61 | Ga0068868_100013647 | 3300005338 | Bacteria | 5966 |
| 62 | Ga0068868_100060106 | 3300005338 | Bacteria | 3008 |
| 63 | Ga0068868_100333046 | 3300005338 | Bacteria | 1296 |
| 64 | Ga0070689_100009405 | 3300005340 | Bacteria | 6928 |
| 65 | Ga0070689_100128741 | 3300005340 | Bacteria | 2028 |
| 66 | Ga0070687_100016979 | 3300005343 | Bacteria | 3336 |
| 67 | Ga0070687_100104329 | 3300005343 | Bacteria | 1593 |
| 68 | Ga0070687_100124760 | 3300005343 | Unclassified | 1478 |
| 69 | Ga0070687_100140416 | 3300005343 | Bacteria | 1406 |
| 70 | Ga0070661_100005268 | 3300005344 | Bacteria | 8907 |
| 71 | Ga0070692_10009492 | 3300005345 | Unclassified | 4390 |
| 72 | Ga0070692_10029041 | 3300005345 | Bacteria | 2754 |
| 73 | Ga0070692_10226131 | 3300005345 | Bacteria | 1108 |
| 74 | Ga0070692_10237689 | 3300005345 | Unclassified | 1084 |
| 75 | Ga0070692_10307070 | 3300005345 | Bacteria | 971 |
| 76 | Ga0070669_100079505 | 3300005353 | Bacteria | 2439 |
| 77 | Ga0070669_100119808 | 3300005353 | Bacteria | 2006 |
| 78 | Ga0070669_100598924 | 3300005353 | Bacteria | 923 |
| 79 | Ga0070675_100109993 | 3300005354 | Bacteria | 2330 |
| 80 | Ga0070675_100140279 | 3300005354 | Bacteria | 2065 |
| 81 | Ga0070675_100810960 | 3300005354 | Bacteria | 856 |
| 82 | Ga0070671_100003695 | 3300005355 | Bacteria | 11999 |
| 83 | Ga0070671_100044712 | 3300005355 | Bacteria | 3680 |
| 84 | Ga0070671_100075622 | 3300005355 | Bacteria | 2813 |
| 85 | Ga0070671_100783723 | 3300005355 | Bacteria | 829 |
| 86 | Ga0070671_100933002 | 3300005355 | Bacteria | 759 |
| 87 | Ga0070673_100072566 | 3300005364 | Bacteria | 2769 |
| 88 | Ga0070673_100085054 | 3300005364 | Bacteria | 2574 |
| 89 | Ga0070673_100121330 | 3300005364 | Bacteria | 2181 |
| 90 | Ga0070673_100143911 | 3300005364 | Unclassified | 2014 |
| 91 | Ga0070673_100364141 | 3300005364 | Unclassified | 1286 |
| 92 | Ga0070673_100698096 | 3300005364 | Bacteria | 932 |
| 93 | Ga0070688_100171011 | 3300005365 | Bacteria | 1500 |
| 94 | Ga0070688_100211379 | 3300005365 | Bacteria | 1362 |
| 95 | Ga0070688_100582036 | 3300005365 | Unclassified | 855 |
| 96 | Ga0070659_100022165 | 3300005366 | Unclassified | 4846 |
| 97 | Ga0070659_100183035 | 3300005366 | Bacteria | 1720 |
| 98 | Ga0070667_100032807 | 3300005367 | Bacteria | 4333 |
| 99 | Ga0070667_100326771 | 3300005367 | Unclassified | 1385 |
| 100 | Ga0070703_10000313 | 3300005406 | Bacteria | 22089 |
| 101 | Ga0070703_10014271 | 3300005406 | Bacteria | 2262 |
| 102 | Ga0070709_10000001 | 3300005434 | Bacteria | 412391 |
| 103 | Ga0070713_100916282 | 3300005436 | Unclassified | 843 |
| 104 | Ga0070701_10009397 | 3300005438 | Bacteria | 4281 |
| 105 | Ga0070701_10087404 | 3300005438 | Bacteria | 1701 |
| 106 | Ga0070701_10089825 | 3300005438 | Bacteria | 1681 |
| 107 | Ga0070705_100001180 | 3300005440 | Bacteria | 14263 |
| 108 | Ga0070705_100057489 | 3300005440 | Bacteria | 2295 |
| 109 | Ga0070705_100202322 | 3300005440 | Bacteria | 1362 |
| 110 | Ga0070705_100231463 | 3300005440 | Bacteria | 1286 |
| 111 | Ga0070705_100347183 | 3300005440 | Bacteria | 1081 |
| 112 | Ga0070700_100000005 | 3300005441 | Bacteria | 233160 |
| 113 | Ga0070700_100008850 | 3300005441 | Bacteria | 5502 |
| 114 | Ga0070700_100037052 | 3300005441 | Bacteria | 2963 |
| 115 | Ga0070700_100071533 | 3300005441 | Bacteria | 2215 |
| 116 | Ga0070700_100178028 | 3300005441 | Bacteria | 1478 |
| 117 | Ga0070694_100003400 | 3300005444 | Bacteria | 9536 |
| 118 | Ga0070694_100009624 | 3300005444 | Bacteria | 5930 |
| 119 | Ga0070694_100026914 | 3300005444 | Bacteria | 3731 |
| 120 | Ga0070694_100039687 | 3300005444 | Bacteria | 3136 |
| 121 | Ga0070694_100040560 | 3300005444 | Bacteria | 3103 |
| 122 | Ga0070694_100063544 | 3300005444 | Bacteria | 2525 |
| 123 | Ga0070694_100154487 | 3300005444 | Bacteria | 1679 |
| 124 | Ga0070694_100512927 | 3300005444 | Bacteria | 956 |
| 125 | Ga0070694_100644975 | 3300005444 | Bacteria | 857 |
| 126 | Ga0070708_100046443 | 3300005445 | Bacteria | 3832 |
| 127 | Ga0070708_100132733 | 3300005445 | Bacteria | 2305 |
| 128 | Ga0070708_100275416 | 3300005445 | Bacteria | 1583 |
| 129 | Ga0070678_100021052 | 3300005456 | Bacteria | 4292 |
| 130 | Ga0070662_100067297 | 3300005457 | Bacteria | 2630 |
| 131 | Ga0070681_10003413 | 3300005458 | Bacteria | 14879 |
| 132 | Ga0070681_10003933 | 3300005458 | Bacteria | 14010 |
| 133 | Ga0070681_10083531 | 3300005458 | Bacteria | 3147 |
| 134 | Ga0068867_100017771 | 3300005459 | Bacteria | 5049 |
| 135 | Ga0068867_100089599 | 3300005459 | Bacteria | 2333 |
| 136 | Ga0068867_100170264 | 3300005459 | Bacteria | 1724 |
| 137 | Ga0068867_101007696 | 3300005459 | Unclassified | 755 |
| 138 | Ga0070685_10045527 | 3300005466 | Bacteria | 2517 |
| 139 | Ga0070706_100000085 | 3300005467 | Bacteria | 108868 |
| 140 | Ga0070706_100006573 | 3300005467 | Bacteria | 10967 |
| 141 | Ga0070706_100564830 | 3300005467 | Unclassified | 1058 |
| 142 | Ga0070706_100568032 | 3300005467 | Bacteria | 1055 |
| 143 | Ga0070706_100843204 | 3300005467 | Bacteria | 848 |
| 144 | Ga0070707_100000478 | 3300005468 | Bacteria | 39602 |
| 145 | Ga0070707_100084614 | 3300005468 | Bacteria | 3065 |
| 146 | Ga0070707_100805909 | 3300005468 | Bacteria | 903 |
| 147 | Ga0070707_100821157 | 3300005468 | Bacteria | 894 |
| 148 | Ga0070698_100010161 | 3300005471 | Bacteria | 10055 |
| 149 | Ga0070698_100264567 | 3300005471 | Bacteria | 1652 |
| 150 | Ga0070699_100579135 | 3300005518 | Bacteria | 1023 |
| 151 | Ga0070699_100783894 | 3300005518 | Bacteria | 872 |
| 152 | Ga0070699_100869173 | 3300005518 | Bacteria | 826 |
| 153 | Ga0070679_100000060 | 3300005530 | Bacteria | 81237 |
| 154 | Ga0070679_100053076 | 3300005530 | Unclassified | 4035 |
| 155 | Ga0070684_100423357 | 3300005535 | Unclassified | 1229 |
| 156 | Ga0070697_100000366 | 3300005536 | Bacteria | 35335 |
| 157 | Ga0070697_100057838 | 3300005536 | Bacteria | 3154 |
| 158 | Ga0070697_100225684 | 3300005536 | Unclassified | 1597 |
| 159 | Ga0070697_100303033 | 3300005536 | Unclassified | 1374 |
| 160 | Ga0068853_100015348 | 3300005539 | Bacteria | 6295 |
| 161 | Ga0070672_100121466 | 3300005543 | Bacteria | 2138 |
| 162 | Ga0070672_100154798 | 3300005543 | Bacteria | 1898 |
| 163 | Ga0070686_100009728 | 3300005544 | Bacteria | 5402 |
| 164 | Ga0070686_100010860 | 3300005544 | Bacteria | 5152 |
| 165 | Ga0070686_100046212 | 3300005544 | Bacteria | 2746 |
| 166 | Ga0070686_100071842 | 3300005544 | Unclassified | 2267 |
| 167 | Ga0070686_100399807 | 3300005544 | Bacteria | 1044 |
| 168 | Ga0070695_100045162 | 3300005545 | Bacteria | 2807 |
| 169 | Ga0070695_100237089 | 3300005545 | Bacteria | 1322 |
| 170 | Ga0070695_100504357 | 3300005545 | Bacteria | 936 |
| 171 | Ga0070696_100020991 | 3300005546 | Bacteria | 4427 |
| 172 | Ga0070696_100022307 | 3300005546 | Bacteria | 4300 |
| 173 | Ga0070696_100046031 | 3300005546 | Bacteria | 3024 |
| 174 | Ga0070696_100058079 | 3300005546 | Bacteria | 2702 |
| 175 | Ga0070696_100186219 | 3300005546 | Bacteria | 1543 |
| 176 | Ga0070696_100194935 | 3300005546 | Bacteria | 1509 |
| 177 | Ga0070696_100244863 | 3300005546 | Bacteria | 1354 |
| 178 | Ga0070696_100385191 | 3300005546 | Bacteria | 1094 |
| 179 | Ga0070696_100499146 | 3300005546 | Bacteria | 968 |
| 180 | Ga0070696_100646653 | 3300005546 | Bacteria | 857 |
| 181 | Ga0070693_100005900 | 3300005547 | Bacteria | 5921 |
| 182 | Ga0070693_100010936 | 3300005547 | Bacteria | 4559 |
| 183 | Ga0070693_100174303 | 3300005547 | Bacteria | 1380 |
| 184 | Ga0070693_100564552 | 3300005547 | Unclassified | 817 |
| 185 | Ga0070665_100089076 | 3300005548 | Bacteria | 3092 |
| 186 | Ga0070704_100003218 | 3300005549 | Bacteria | 9339 |
| 187 | Ga0070704_100010265 | 3300005549 | Bacteria | 5694 |
| 188 | Ga0070704_100051780 | 3300005549 | Bacteria | 2893 |
| 189 | Ga0070704_100226835 | 3300005549 | Bacteria | 1522 |
| 190 | Ga0070704_100651713 | 3300005549 | Bacteria | 930 |
| 191 | Ga0070664_100001504 | 3300005564 | Bacteria | 18579 |
| 192 | Ga0070664_100031842 | 3300005564 | Bacteria | 4409 |
| 193 | Ga0068857_100001572 | 3300005577 | Bacteria | 18294 |
| 194 | Ga0068857_100271103 | 3300005577 | Bacteria | 1560 |
| 195 | Ga0068857_100541610 | 3300005577 | Bacteria | 1096 |
| 196 | Ga0068857_100690733 | 3300005577 | Bacteria | 969 |
| 197 | Ga0068854_100143266 | 3300005578 | Bacteria | 1836 |
| 198 | Ga0068854_100182940 | 3300005578 | Unclassified | 1638 |
| 199 | Ga0070702_100001575 | 3300005615 | Bacteria | 9405 |
| 200 | Ga0070702_100043929 | 3300005615 | Bacteria | 2520 |
| 201 | Ga0070702_100130136 | 3300005615 | Bacteria | 1588 |
| 202 | Ga0070702_100170062 | 3300005615 | Unclassified | 1417 |
| 203 | Ga0070702_100352676 | 3300005615 | Bacteria | 1037 |
| 204 | Ga0070702_100483417 | 3300005615 | Bacteria | 906 |
| 205 | Ga0068852_100074178 | 3300005616 | Unclassified | 2995 |
| 206 | Ga0068852_100269493 | 3300005616 | Bacteria | 1638 |
| 207 | Ga0068859_100004941 | 3300005617 | Bacteria | 13544 |
| 208 | Ga0068859_100011491 | 3300005617 | Bacteria | 8901 |
| 209 | Ga0068859_100021537 | 3300005617 | Bacteria | 6470 |
| 210 | Ga0068859_100027393 | 3300005617 | Bacteria | 5716 |
| 211 | Ga0068859_100048141 | 3300005617 | Bacteria | 4283 |
| 212 | Ga0068859_100059825 | 3300005617 | Bacteria | 3839 |
| 213 | Ga0068859_100115041 | 3300005617 | Bacteria | 2754 |
| 214 | Ga0068859_100140999 | 3300005617 | Bacteria | 2484 |
| 215 | Ga0068859_100152609 | 3300005617 | Bacteria | 2386 |
| 216 | Ga0068859_100175496 | 3300005617 | Bacteria | 2225 |
| 217 | Ga0068859_100205474 | 3300005617 | Bacteria | 2055 |
| 218 | Ga0068859_100210714 | 3300005617 | Bacteria | 2029 |
| 219 | Ga0068859_101501654 | 3300005617 | Bacteria | 744 |
| 220 | Ga0068864_100010106 | 3300005618 | Bacteria | 7792 |
| 221 | Ga0068864_100017822 | 3300005618 | Bacteria | 5923 |
| 222 | Ga0068864_100023463 | 3300005618 | Bacteria | 5181 |
| 223 | Ga0068864_100175271 | 3300005618 | Bacteria | 1957 |
| 224 | Ga0068864_100368505 | 3300005618 | Bacteria | 1359 |
| 225 | Ga0068864_100396693 | 3300005618 | Bacteria | 1310 |
| 226 | Ga0068864_100540965 | 3300005618 | Bacteria | 1125 |
| 227 | Ga0068864_100996972 | 3300005618 | Bacteria | 831 |
| 228 | Ga0068866_10014995 | 3300005718 | Bacteria | 3435 |
| 229 | Ga0068866_10031205 | 3300005718 | Bacteria | 2564 |
| 230 | Ga0068866_10089366 | 3300005718 | Bacteria | 1674 |
| 231 | Ga0068866_10281750 | 3300005718 | Unclassified | 1030 |
| 232 | Ga0068866_10301701 | 3300005718 | Bacteria | 1001 |
| 233 | Ga0068861_100070334 | 3300005719 | Bacteria | 2709 |
| 234 | Ga0068861_100088073 | 3300005719 | Bacteria | 2444 |
| 235 | Ga0068861_100107052 | 3300005719 | Bacteria | 2235 |
| 236 | Ga0068861_100192740 | 3300005719 | Bacteria | 1705 |
| 237 | Ga0068851_10002245 | 3300005834 | Bacteria | 8494 |
| 238 | Ga0068870_10069572 | 3300005840 | Bacteria | 1915 |
| 239 | Ga0068870_10123259 | 3300005840 | Bacteria | 1496 |
| 240 | Ga0068870_10574044 | 3300005840 | Bacteria | 763 |
| 241 | Ga0068863_100069037 | 3300005841 | Bacteria | 3342 |
| 242 | Ga0068863_100074503 | 3300005841 | Bacteria | 3211 |
| 243 | Ga0068863_100077484 | 3300005841 | Bacteria | 3146 |
| 244 | Ga0068863_100133463 | 3300005841 | Bacteria | 2371 |
| 245 | Ga0068863_100328038 | 3300005841 | Bacteria | 1488 |
| 246 | Ga0068863_100424841 | 3300005841 | Bacteria | 1302 |
| 247 | Ga0068863_100532748 | 3300005841 | Bacteria | 1159 |
| 248 | Ga0068858_100000008 | 3300005842 | Bacteria | 238361 |
| 249 | Ga0068858_100053043 | 3300005842 | Bacteria | 3752 |
| 250 | Ga0068858_100119330 | 3300005842 | Bacteria | 2466 |
| 251 | Ga0068858_100131784 | 3300005842 | Bacteria | 2344 |
| 252 | Ga0068858_100174082 | 3300005842 | Unclassified | 2030 |
| 253 | Ga0068858_100384887 | 3300005842 | Bacteria | 1346 |
| 254 | Ga0068860_100016852 | 3300005843 | Bacteria | 7123 |
| 255 | Ga0068860_100053151 | 3300005843 | Unclassified | 3852 |
| 256 | Ga0068860_100119189 | 3300005843 | Unclassified | 2526 |
| 257 | Ga0068860_100125189 | 3300005843 | Unclassified | 2463 |
| 258 | Ga0068860_100203208 | 3300005843 | Bacteria | 1920 |
| 259 | Ga0068860_100212741 | 3300005843 | Bacteria | 1876 |
| 260 | Ga0068860_100408272 | 3300005843 | Bacteria | 1344 |
| 261 | Ga0068862_100024723 | 3300005844 | Bacteria | 5040 |
| 262 | Ga0068862_100110283 | 3300005844 | Bacteria | 2415 |
| 263 | Ga0068862_100305831 | 3300005844 | Bacteria | 1464 |
| 264 | Ga0081539_10000022 | 3300005985 | Bacteria | 356710 |
| 265 | Ga0081539_10000411 | 3300005985 | Bacteria | 91279 |
| 266 | Ga0081539_10000490 | 3300005985 | Bacteria | 83577 |
| 267 | Ga0081539_10027307 | 3300005985 | Bacteria | 3618 |
| 268 | Ga0075432_10165156 | 3300006058 | Unclassified | 858 |
| 269 | Ga0070715_10000007 | 3300006163 | Bacteria | 192075 |
| 270 | Ga0070716_100000007 | 3300006173 | Bacteria | 256300 |
| 271 | Ga0097621_100003740 | 3300006237 | Bacteria | 10543 |
| 272 | Ga0097621_100005158 | 3300006237 | Bacteria | 9178 |
| 273 | Ga0068871_100041044 | 3300006358 | Bacteria | 3709 |
| 274 | Ga0068871_100125202 | 3300006358 | Bacteria | 2175 |
| 275 | Ga0075428_100112191 | 3300006844 | Bacteria | 2969 |
| 276 | Ga0075430_100113481 | 3300006846 | Bacteria | 2258 |
| 277 | Ga0075431_100010525 | 3300006847 | Bacteria | 9299 |
| 278 | Ga0075431_100125780 | 3300006847 | Unclassified | 2645 |
| 279 | Ga0075433_10011443 | 3300006852 | Bacteria | 7146 |
| 280 | Ga0075433_10027242 | 3300006852 | Bacteria | 4845 |
| 281 | Ga0075433_10030871 | 3300006852 | Bacteria | 4575 |
| 282 | Ga0075433_10088923 | 3300006852 | Bacteria | 2730 |
| 283 | Ga0075433_10092790 | 3300006852 | Viruses | 2671 |
| 284 | Ga0075433_10115905 | 3300006852 | Bacteria | 2377 |
| 285 | Ga0075433_10471782 | 3300006852 | Bacteria | 1106 |
| 286 | Ga0075433_10688538 | 3300006852 | Bacteria | 896 |
| 287 | Ga0075434_100002749 | 3300006871 | Bacteria | 15553 |
| 288 | Ga0075434_100017831 | 3300006871 | Bacteria | 6848 |
| 289 | Ga0075434_100034409 | 3300006871 | Bacteria | 5003 |
| 290 | Ga0075434_100071912 | 3300006871 | Bacteria | 3451 |
| 291 | Ga0075434_100237463 | 3300006871 | Bacteria | 1842 |
| 292 | Ga0075434_100327361 | 3300006871 | Bacteria | 1553 |
| 293 | Ga0075434_100836396 | 3300006871 | Unclassified | 936 |
| 294 | Ga0075429_100110933 | 3300006880 | Bacteria | 2397 |
| 295 | Ga0075429_100397165 | 3300006880 | Bacteria | 1207 |
| 296 | Ga0068865_100244298 | 3300006881 | Unclassified | 1414 |
| 297 | Ga0075436_100000008 | 3300006914 | Bacteria | 279288 |
| 298 | Ga0075436_100001766 | 3300006914 | Bacteria | 14815 |
| 299 | Ga0097620_100004941 | 3300006931 | Bacteria | 13544 |
| 300 | Ga0097620_100011491 | 3300006931 | Bacteria | 8901 |
| 301 | Ga0097620_100021538 | 3300006931 | Bacteria | 6470 |
| 302 | Ga0097620_100027391 | 3300006931 | Bacteria | 5716 |
| 303 | Ga0097620_100048144 | 3300006931 | Bacteria | 4283 |
| 304 | Ga0097620_100059819 | 3300006931 | Bacteria | 3839 |
| 305 | Ga0097620_100115030 | 3300006931 | Bacteria | 2754 |
| 306 | Ga0097620_100141009 | 3300006931 | Bacteria | 2484 |
| 307 | Ga0097620_100152605 | 3300006931 | Bacteria | 2386 |
| 308 | Ga0097620_100175505 | 3300006931 | Bacteria | 2225 |
| 309 | Ga0097620_100205472 | 3300006931 | Bacteria | 2055 |
| 310 | Ga0097620_100210697 | 3300006931 | Bacteria | 2029 |
| 311 | Ga0097620_101501728 | 3300006931 | Bacteria | 744 |
| 312 | Ga0075435_100000244 | 3300007076 | Bacteria | 33626 |
| 313 | Ga0075435_100006045 | 3300007076 | Bacteria | 8525 |
| 314 | Ga0075435_100106144 | 3300007076 | Bacteria | 2332 |
| 315 | Ga0075435_100811721 | 3300007076 | Bacteria | 815 |
| 316 | Ga0075435_100865462 | 3300007076 | Viruses | 788 |
| 317 | Ga0105240_10016665 | 3300009093 | Bacteria | 9940 |
| 318 | Ga0105240_10210653 | 3300009093 | Bacteria | 2271 |
| 319 | Ga0111539_10000363 | 3300009094 | Bacteria | 55793 |
| 320 | Ga0111539_10007694 | 3300009094 | Bacteria | 13758 |
| 321 | Ga0111539_10012818 | 3300009094 | Bacteria | 10492 |
| 322 | Ga0111539_10084943 | 3300009094 | Bacteria | 3721 |
| 323 | Ga0111539_10366872 | 3300009094 | Bacteria | 1676 |
| 324 | Ga0111539_10813049 | 3300009094 | Unclassified | 1088 |
| 325 | Ga0105245_10048819 | 3300009098 | Bacteria | 3787 |
| 326 | Ga0105245_10623793 | 3300009098 | Bacteria | 1106 |
| 327 | Ga0105245_11042266 | 3300009098 | Bacteria | 863 |
| 328 | Ga0105245_11335123 | 3300009098 | Bacteria | 766 |
| 329 | Ga0105245_11356286 | 3300009098 | Bacteria | 761 |
| 330 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 331 | Ga0105247_10008100 | 3300009101 | Bacteria | 6421 |
| 332 | Ga0105247_10039422 | 3300009101 | Bacteria | 2886 |
| 333 | Ga0105247_10043304 | 3300009101 | Bacteria | 2758 |
| 334 | Ga0105247_10345435 | 3300009101 | Bacteria | 1045 |
| 335 | Ga0114129_10004613 | 3300009147 | Bacteria | 19450 |
| 336 | Ga0114129_10164080 | 3300009147 | Bacteria | 3033 |
| 337 | Ga0114129_10164582 | 3300009147 | Bacteria | 3028 |
| 338 | Ga0114129_10175898 | 3300009147 | Bacteria | 2915 |
| 339 | Ga0114129_10235807 | 3300009147 | Bacteria | 2462 |
| 340 | Ga0114129_10236812 | 3300009147 | Bacteria | 2455 |
| 341 | Ga0114129_10292629 | 3300009147 | Bacteria | 2173 |
| 342 | Ga0114129_10512829 | 3300009147 | Bacteria | 1564 |
| 343 | Ga0114129_10612362 | 3300009147 | Bacteria | 1410 |
| 344 | Ga0105243_10000119 | 3300009148 | Bacteria | 91258 |
| 345 | Ga0105243_10001926 | 3300009148 | Bacteria | 17694 |
| 346 | Ga0105243_10008351 | 3300009148 | Bacteria | 7950 |
| 347 | Ga0105243_10008920 | 3300009148 | Bacteria | 7666 |
| 348 | Ga0105243_10028284 | 3300009148 | Bacteria | 4303 |
| 349 | Ga0105243_10068413 | 3300009148 | Bacteria | 2862 |
| 350 | Ga0105243_10902175 | 3300009148 | Bacteria | 879 |
| 351 | Ga0105241_10060700 | 3300009174 | Unclassified | 2909 |
| 352 | Ga0105241_10070199 | 3300009174 | Bacteria | 2717 |
| 353 | Ga0105241_10115658 | 3300009174 | Bacteria | 2153 |
| 354 | Ga0105241_10190194 | 3300009174 | Bacteria | 1708 |
| 355 | Ga0105241_10353606 | 3300009174 | Bacteria | 1276 |
| 356 | Ga0105241_10808350 | 3300009174 | Bacteria | 864 |
| 357 | Ga0105242_10000113 | 3300009176 | Bacteria | 58633 |
| 358 | Ga0105242_10000884 | 3300009176 | Bacteria | 23248 |
| 359 | Ga0105242_10001804 | 3300009176 | Bacteria | 16878 |
| 360 | Ga0105242_10009899 | 3300009176 | Bacteria | 7302 |
| 361 | Ga0105242_10113975 | 3300009176 | Bacteria | 2309 |
| 362 | Ga0105242_10163930 | 3300009176 | Bacteria | 1948 |
| 363 | Ga0105242_10168726 | 3300009176 | Bacteria | 1921 |
| 364 | Ga0105242_10608291 | 3300009176 | Bacteria | 1057 |
| 365 | Ga0105248_10001196 | 3300009177 | Bacteria | 28995 |
| 366 | Ga0105248_10020782 | 3300009177 | Bacteria | 7273 |
| 367 | Ga0105248_10026948 | 3300009177 | Bacteria | 6391 |
| 368 | Ga0105248_10054579 | 3300009177 | Unclassified | 4481 |
| 369 | Ga0105248_10111271 | 3300009177 | Bacteria | 3088 |
| 370 | Ga0105248_10221038 | 3300009177 | Bacteria | 2132 |
| 371 | Ga0105248_10246865 | 3300009177 | Bacteria | 2009 |
| 372 | Ga0105248_10664954 | 3300009177 | Bacteria | 1175 |
| 373 | Ga0105248_10867368 | 3300009177 | Bacteria | 1019 |
| 374 | Ga0105237_10000527 | 3300009545 | Bacteria | 53805 |
| 375 | Ga0105237_10043697 | 3300009545 | Bacteria | 4513 |
| 376 | Ga0105238_10001996 | 3300009551 | Bacteria | 20559 |
| 377 | Ga0105249_10001430 | 3300009553 | Bacteria | 20929 |
| 378 | Ga0105249_10083701 | 3300009553 | Bacteria | 2970 |
| 379 | Ga0105249_10118014 | 3300009553 | Bacteria | 2517 |
| 380 | Ga0105249_10152210 | 3300009553 | Bacteria | 2228 |
| 381 | Ga0105249_10174470 | 3300009553 | Bacteria | 2087 |
| 382 | Ga0105249_10856485 | 3300009553 | Bacteria | 974 |
| 383 | Ga0105249_11098359 | 3300009553 | Bacteria | 865 |
| 384 | Ga0099796_10112636 | 3300010159 | Bacteria | 1037 |
| 385 | Ga0105239_10035696 | 3300010375 | Bacteria | 5458 |
| 386 | Ga0105239_10095819 | 3300010375 | Bacteria | 3278 |
| 387 | Ga0105239_10382904 | 3300010375 | Bacteria | 1590 |
| 388 | Ga0105239_11344009 | 3300010375 | Unclassified | 825 |
| 389 | Ga0105246_10085229 | 3300011119 | Bacteria | 2262 |
| 390 | Ga0105246_11072975 | 3300011119 | Bacteria | 734 |
| 391 | Ga0105246_11289814 | 3300011119 | Unclassified | 676 |
| 392 | Ga0157373_10002322 | 3300013100 | Bacteria | 14422 |
| 393 | Ga0157373_10112898 | 3300013100 | Bacteria | 1910 |
| 394 | Ga0157373_10254302 | 3300013100 | Bacteria | 1243 |
| 395 | Ga0157371_10606219 | 3300013102 | Unclassified | 815 |
| 396 | Ga0157378_10000163 | 3300013297 | Bacteria | 63786 |
| 397 | Ga0157378_10036978 | 3300013297 | Bacteria | 4322 |
| 398 | Ga0157378_10059181 | 3300013297 | Bacteria | 3418 |
| 399 | Ga0157378_10064497 | 3300013297 | Bacteria | 3277 |
| 400 | Ga0157378_10085236 | 3300013297 | Bacteria | 2862 |
| 401 | Ga0157378_10096153 | 3300013297 | Bacteria | 2699 |
| 402 | Ga0157378_10148736 | 3300013297 | Bacteria | 2181 |
| 403 | Ga0157378_10439189 | 3300013297 | Bacteria | 1293 |
| 404 | Ga0157378_11008068 | 3300013297 | Unclassified | 867 |
| 405 | Ga0157378_11039329 | 3300013297 | Bacteria | 855 |
| 406 | Ga0163162_10000027 | 3300013306 | Bacteria | 178451 |
| 407 | Ga0163162_10003480 | 3300013306 | Bacteria | 15046 |
| 408 | Ga0163162_10003901 | 3300013306 | Bacteria | 14319 |
| 409 | Ga0163162_10016787 | 3300013306 | Bacteria | 7158 |
| 410 | Ga0163162_10023609 | 3300013306 | Bacteria | 6072 |
| 411 | Ga0163162_10074860 | 3300013306 | Bacteria | 3445 |
| 412 | Ga0163162_10085806 | 3300013306 | Bacteria | 3226 |
| 413 | Ga0163162_10144081 | 3300013306 | Bacteria | 2497 |
| 414 | Ga0163162_10155774 | 3300013306 | Bacteria | 2404 |
| 415 | Ga0163162_10158553 | 3300013306 | Bacteria | 2384 |
| 416 | Ga0163162_10175419 | 3300013306 | Bacteria | 2269 |
| 417 | Ga0163162_10207754 | 3300013306 | Bacteria | 2087 |
| 418 | Ga0157372_10042422 | 3300013307 | Bacteria | 5032 |
| 419 | Ga0157372_10898692 | 3300013307 | Bacteria | 1028 |
| 420 | Ga0157375_10002929 | 3300013308 | Bacteria | 14806 |
| 421 | Ga0157375_10003116 | 3300013308 | Bacteria | 14397 |
| 422 | Ga0157375_10011770 | 3300013308 | Bacteria | 7736 |
| 423 | Ga0157375_10011832 | 3300013308 | Bacteria | 7715 |
| 424 | Ga0157375_10281022 | 3300013308 | Bacteria | 1828 |
| 425 | Ga0157375_10425810 | 3300013308 | Bacteria | 1493 |
| 426 | Ga0157375_10633416 | 3300013308 | Bacteria | 1226 |
| 427 | Ga0157375_10718795 | 3300013308 | Bacteria | 1152 |
| 428 | Ga0157375_11336633 | 3300013308 | Bacteria | 843 |
| 429 | Ga0157375_11664639 | 3300013308 | Bacteria | 755 |
| 430 | Ga0163163_10000109 | 3300014325 | Bacteria | 87294 |
| 431 | Ga0163163_10000527 | 3300014325 | Bacteria | 34143 |
| 432 | Ga0163163_10001737 | 3300014325 | Bacteria | 18359 |
| 433 | Ga0163163_10103857 | 3300014325 | Unclassified | 2866 |
| 434 | Ga0163163_10129938 | 3300014325 | Unclassified | 2559 |
| 435 | Ga0157380_10000563 | 3300014326 | Bacteria | 22799 |
| 436 | Ga0157380_10004467 | 3300014326 | Bacteria | 9690 |
| 437 | Ga0157380_10088360 | 3300014326 | Unclassified | 2550 |
| 438 | Ga0157380_10228784 | 3300014326 | Bacteria | 1669 |
| 439 | Ga0157380_10653389 | 3300014326 | Bacteria | 1049 |
| 440 | Ga0157377_10021040 | 3300014745 | Unclassified | 3426 |
| 441 | Ga0157379_10070551 | 3300014968 | Bacteria | 3126 |
| 442 | Ga0157379_10166679 | 3300014968 | Bacteria | 1988 |
| 443 | Ga0157379_10448087 | 3300014968 | Bacteria | 1191 |
| 444 | Ga0157379_10628090 | 3300014968 | Bacteria | 1004 |
| 445 | Ga0157376_10016733 | 3300014969 | Bacteria | 5576 |
| 446 | Ga0157376_10283737 | 3300014969 | Bacteria | 1560 |
| 447 | Ga0163161_10055814 | 3300017792 | Bacteria | 2868 |
| 448 | Ga0163161_10075052 | 3300017792 | Bacteria | 2481 |
| 449 | Ga0163161_10186042 | 3300017792 | Bacteria | 1594 |
| 450 | Ga0163161_10405371 | 3300017792 | Bacteria | 1094 |
| 451 | Ga0163161_10696039 | 3300017792 | Unclassified | 846 |
| 452 | Ga0213876_10000527 | 3300021384 | Bacteria | 29161 |
| 453 | Ga0213876_10022807 | 3300021384 | Bacteria | 3307 |
| 454 | Ga0213876_10109877 | 3300021384 | Bacteria | 1463 |
| 455 | Ga0207672_1000172 | 3300025223 | Bacteria | 8920 |
| 456 | Ga0207697_10097516 | 3300025315 | Unclassified | 1251 |
| 457 | Ga0207656_10007353 | 3300025321 | Bacteria | 4005 |
| 458 | Ga0207653_10001006 | 3300025885 | Bacteria | 9292 |
| 459 | Ga0207653_10008043 | 3300025885 | Bacteria | 3287 |
| 460 | Ga0207642_10003705 | 3300025899 | Bacteria | 4859 |
| 461 | Ga0207642_10178745 | 3300025899 | Unclassified | 1154 |
| 462 | Ga0207642_10212916 | 3300025899 | Bacteria | 1075 |
| 463 | Ga0207642_10225441 | 3300025899 | Bacteria | 1050 |
| 464 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 465 | Ga0207710_10000832 | 3300025900 | Bacteria | 16664 |
| 466 | Ga0207680_10559918 | 3300025903 | Bacteria | 816 |
| 467 | Ga0207647_10017531 | 3300025904 | Bacteria | 4866 |
| 468 | Ga0207647_10176023 | 3300025904 | Bacteria | 1245 |
| 469 | Ga0207647_10373602 | 3300025904 | Unclassified | 805 |
| 470 | Ga0207685_10000007 | 3300025905 | Bacteria | 278341 |
| 471 | Ga0207699_10000004 | 3300025906 | Bacteria | 567333 |
| 472 | Ga0207699_10433244 | 3300025906 | Unclassified | 941 |
| 473 | Ga0207645_10401416 | 3300025907 | Viruses | 922 |
| 474 | Ga0207645_10424413 | 3300025907 | Viruses | 896 |
| 475 | Ga0207643_10004012 | 3300025908 | Bacteria | 7920 |
| 476 | Ga0207643_10115455 | 3300025908 | Bacteria | 1585 |
| 477 | Ga0207643_10122668 | 3300025908 | Bacteria | 1540 |
| 478 | Ga0207643_10154827 | 3300025908 | Bacteria | 1376 |
| 479 | Ga0207643_10342936 | 3300025908 | Bacteria | 937 |
| 480 | Ga0207643_10450175 | 3300025908 | Unclassified | 819 |
| 481 | Ga0207684_10000091 | 3300025910 | Bacteria | 170468 |
| 482 | Ga0207684_10036975 | 3300025910 | Bacteria | 4144 |
| 483 | Ga0207684_10606651 | 3300025910 | Unclassified | 935 |
| 484 | Ga0207654_10075558 | 3300025911 | Bacteria | 2014 |
| 485 | Ga0207654_10083469 | 3300025911 | Unclassified | 1929 |
| 486 | Ga0207707_10000015 | 3300025912 | Bacteria | 259670 |
| 487 | Ga0207707_10019734 | 3300025912 | Bacteria | 5884 |
| 488 | Ga0207707_10084084 | 3300025912 | Bacteria | 2779 |
| 489 | Ga0207707_10264975 | 3300025912 | Bacteria | 1490 |
| 490 | Ga0207695_10092686 | 3300025913 | Bacteria | 3031 |
| 491 | Ga0207671_10003690 | 3300025914 | Bacteria | 15096 |
| 492 | Ga0207663_10000074 | 3300025916 | Bacteria | 47918 |
| 493 | Ga0207660_10005726 | 3300025917 | Bacteria | 8063 |
| 494 | Ga0207660_10006252 | 3300025917 | Bacteria | 7731 |
| 495 | Ga0207660_10412158 | 3300025917 | Bacteria | 1089 |
| 496 | Ga0207662_10004270 | 3300025918 | Bacteria | 7501 |
| 497 | Ga0207662_10006504 | 3300025918 | Bacteria | 6313 |
| 498 | Ga0207662_10293377 | 3300025918 | Bacteria | 1079 |
| 499 | Ga0207657_10120733 | 3300025919 | Unclassified | 2156 |
| 500 | Ga0207652_10000253 | 3300025921 | Bacteria | 55673 |
| 501 | Ga0207646_10000849 | 3300025922 | Bacteria | 39555 |
| 502 | Ga0207646_10062586 | 3300025922 | Bacteria | 3322 |
| 503 | Ga0207646_10196560 | 3300025922 | Bacteria | 1821 |
| 504 | Ga0207646_10235403 | 3300025922 | Bacteria | 1655 |
| 505 | Ga0207646_10677627 | 3300025922 | Bacteria | 923 |
| 506 | Ga0207681_10197409 | 3300025923 | Unclassified | 1543 |
| 507 | Ga0207681_10544705 | 3300025923 | Bacteria | 954 |
| 508 | Ga0207681_10891112 | 3300025923 | Unclassified | 745 |
| 509 | Ga0207694_10010396 | 3300025924 | Bacteria | 7016 |
| 510 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 511 | Ga0207650_10044178 | 3300025925 | Bacteria | 3273 |
| 512 | Ga0207650_10225580 | 3300025925 | Bacteria | 1509 |
| 513 | Ga0207650_10245638 | 3300025925 | Bacteria | 1447 |
| 514 | Ga0207659_10052425 | 3300025926 | Bacteria | 2906 |
| 515 | Ga0207659_10118786 | 3300025926 | Bacteria | 2023 |
| 516 | Ga0207687_10393785 | 3300025927 | Bacteria | 1138 |
| 517 | Ga0207644_10000209 | 3300025931 | Bacteria | 40524 |
| 518 | Ga0207644_10010878 | 3300025931 | Bacteria | 6008 |
| 519 | Ga0207644_10164450 | 3300025931 | Bacteria | 1727 |
| 520 | Ga0207644_10523846 | 3300025931 | Unclassified | 979 |
| 521 | Ga0207644_10679274 | 3300025931 | Bacteria | 858 |
| 522 | Ga0207690_10338378 | 3300025932 | Bacteria | 1187 |
| 523 | Ga0207706_10042013 | 3300025933 | Bacteria | 4051 |
| 524 | Ga0207686_10000130 | 3300025934 | Bacteria | 60144 |
| 525 | Ga0207686_10000477 | 3300025934 | Bacteria | 26408 |
| 526 | Ga0207686_10001804 | 3300025934 | Bacteria | 11895 |
| 527 | Ga0207686_10121632 | 3300025934 | Bacteria | 1778 |
| 528 | Ga0207686_10328878 | 3300025934 | Bacteria | 1144 |
| 529 | Ga0207709_10000162 | 3300025935 | Bacteria | 91279 |
| 530 | Ga0207709_10001299 | 3300025935 | Bacteria | 17795 |
| 531 | Ga0207709_10004095 | 3300025935 | Bacteria | 8486 |
| 532 | Ga0207709_10079109 | 3300025935 | Viruses | 2113 |
| 533 | Ga0207709_10325828 | 3300025935 | Bacteria | 1151 |
| 534 | Ga0207709_10504279 | 3300025935 | Bacteria | 945 |
| 535 | Ga0207709_10508947 | 3300025935 | Unclassified | 941 |
| 536 | Ga0207709_10610492 | 3300025935 | Bacteria | 865 |
| 537 | Ga0207709_10865240 | 3300025935 | Bacteria | 733 |
| 538 | Ga0207670_10001600 | 3300025936 | Bacteria | 11799 |
| 539 | Ga0207670_10130963 | 3300025936 | Unclassified | 1838 |
| 540 | Ga0207670_10287819 | 3300025936 | Bacteria | 1283 |
| 541 | Ga0207670_10539771 | 3300025936 | Bacteria | 951 |
| 542 | Ga0207665_10000018 | 3300025939 | Bacteria | 122653 |
| 543 | Ga0207665_10078952 | 3300025939 | Bacteria | 2262 |
| 544 | Ga0207691_10005460 | 3300025940 | Bacteria | 12275 |
| 545 | Ga0207691_10173301 | 3300025940 | Bacteria | 1888 |
| 546 | Ga0207691_10196613 | 3300025940 | Unclassified | 1756 |
| 547 | Ga0207691_10208715 | 3300025940 | Bacteria | 1698 |
| 548 | Ga0207711_10015475 | 3300025941 | Bacteria | 6331 |
| 549 | Ga0207711_10055347 | 3300025941 | Bacteria | 3406 |
| 550 | Ga0207711_10219791 | 3300025941 | Bacteria | 1737 |
| 551 | Ga0207711_10240662 | 3300025941 | Unclassified | 1659 |
| 552 | Ga0207711_10312474 | 3300025941 | Bacteria | 1451 |
| 553 | Ga0207711_10459526 | 3300025941 | Bacteria | 1185 |
| 554 | Ga0207711_10608331 | 3300025941 | Bacteria | 1020 |
| 555 | Ga0207711_10685414 | 3300025941 | Bacteria | 956 |
| 556 | Ga0207711_10704719 | 3300025941 | Bacteria | 942 |
| 557 | Ga0207689_10003363 | 3300025942 | Bacteria | 14640 |
| 558 | Ga0207689_10035998 | 3300025942 | Unclassified | 4109 |
| 559 | Ga0207689_10125951 | 3300025942 | Bacteria | 2107 |
| 560 | Ga0207689_10172405 | 3300025942 | Unclassified | 1784 |
| 561 | Ga0207689_10501170 | 3300025942 | Bacteria | 1017 |
| 562 | Ga0207661_10099802 | 3300025944 | Bacteria | 2436 |
| 563 | Ga0207679_10063737 | 3300025945 | Unclassified | 2752 |
| 564 | Ga0207667_10667631 | 3300025949 | Bacteria | 1044 |
| 565 | Ga0207667_10679281 | 3300025949 | Unclassified | 1033 |
| 566 | Ga0207651_10254881 | 3300025960 | Bacteria | 1437 |
| 567 | Ga0207651_10303602 | 3300025960 | Bacteria | 1328 |
| 568 | Ga0207651_10471323 | 3300025960 | Bacteria | 1081 |
| 569 | Ga0207651_10781858 | 3300025960 | Unclassified | 845 |
| 570 | Ga0207651_10878328 | 3300025960 | Bacteria | 798 |
| 571 | Ga0207712_10000956 | 3300025961 | Bacteria | 20827 |
| 572 | Ga0207712_10015539 | 3300025961 | Bacteria | 4914 |
| 573 | Ga0207712_10037657 | 3300025961 | Bacteria | 3302 |
| 574 | Ga0207712_10423829 | 3300025961 | Bacteria | 1123 |
| 575 | Ga0207640_10030812 | 3300025981 | Bacteria | 3308 |
| 576 | Ga0207640_10202586 | 3300025981 | Bacteria | 1505 |
| 577 | Ga0207640_10548803 | 3300025981 | Bacteria | 970 |
| 578 | Ga0207658_10203170 | 3300025986 | Bacteria | 1656 |
| 579 | Ga0207677_10006705 | 3300026023 | Bacteria | 6326 |
| 580 | Ga0207677_10274566 | 3300026023 | Bacteria | 1381 |
| 581 | Ga0207677_11003292 | 3300026023 | Unclassified | 757 |
| 582 | Ga0207703_10001853 | 3300026035 | Bacteria | 18797 |
| 583 | Ga0207703_10101203 | 3300026035 | Bacteria | 2443 |
| 584 | Ga0207703_10148468 | 3300026035 | Unclassified | 2042 |
| 585 | Ga0207703_10493517 | 3300026035 | Bacteria | 1148 |
| 586 | Ga0207703_10731152 | 3300026035 | Unclassified | 942 |
| 587 | Ga0207703_11231684 | 3300026035 | Bacteria | 719 |
| 588 | Ga0207639_10814825 | 3300026041 | Unclassified | 870 |
| 589 | Ga0207708_10000017 | 3300026075 | Bacteria | 190414 |
| 590 | Ga0207708_10010920 | 3300026075 | Bacteria | 6754 |
| 591 | Ga0207708_10016202 | 3300026075 | Bacteria | 5600 |
| 592 | Ga0207708_10032899 | 3300026075 | Bacteria | 3937 |
| 593 | Ga0207708_10035821 | 3300026075 | Bacteria | 3776 |
| 594 | Ga0207641_10041526 | 3300026088 | Bacteria | 3855 |
| 595 | Ga0207641_10053459 | 3300026088 | Bacteria | 3424 |
| 596 | Ga0207641_10068851 | 3300026088 | Bacteria | 3036 |
| 597 | Ga0207641_10082951 | 3300026088 | Bacteria | 2786 |
| 598 | Ga0207641_10131881 | 3300026088 | Bacteria | 2245 |
| 599 | Ga0207641_10237778 | 3300026088 | Unclassified | 1696 |
| 600 | Ga0207641_10598350 | 3300026088 | Bacteria | 1079 |
| 601 | Ga0207641_10776928 | 3300026088 | Bacteria | 946 |
| 602 | Ga0207641_11057324 | 3300026088 | Bacteria | 810 |
| 603 | Ga0207648_10083630 | 3300026089 | Bacteria | 2783 |
| 604 | Ga0207648_10112640 | 3300026089 | Bacteria | 2389 |
| 605 | Ga0207648_10170744 | 3300026089 | Bacteria | 1922 |
| 606 | Ga0207648_10280012 | 3300026089 | Bacteria | 1491 |
| 607 | Ga0207648_11023462 | 3300026089 | Unclassified | 774 |
| 608 | Ga0207676_10010544 | 3300026095 | Bacteria | 6584 |
| 609 | Ga0207676_10045163 | 3300026095 | Bacteria | 3403 |
| 610 | Ga0207676_10088803 | 3300026095 | Unclassified | 2531 |
| 611 | Ga0207676_10117652 | 3300026095 | Bacteria | 2235 |
| 612 | Ga0207676_10149603 | 3300026095 | Bacteria | 2009 |
| 613 | Ga0207676_10265065 | 3300026095 | Unclassified | 1553 |
| 614 | Ga0207676_10288476 | 3300026095 | Bacteria | 1493 |
| 615 | Ga0207676_10312561 | 3300026095 | Bacteria | 1439 |
| 616 | Ga0207674_10000036 | 3300026116 | Bacteria | 135434 |
| 617 | Ga0207674_10079314 | 3300026116 | Bacteria | 3287 |
| 618 | Ga0207674_10263490 | 3300026116 | Bacteria | 1671 |
| 619 | Ga0207674_10321942 | 3300026116 | Bacteria | 1495 |
| 620 | Ga0207674_10647181 | 3300026116 | Bacteria | 1021 |
| 621 | Ga0207675_100001995 | 3300026118 | Bacteria | 20351 |
| 622 | Ga0207675_100004763 | 3300026118 | Bacteria | 13073 |
| 623 | Ga0207675_100159797 | 3300026118 | Bacteria | 2149 |
| 624 | Ga0207675_100232756 | 3300026118 | Bacteria | 1778 |
| 625 | Ga0207675_100305244 | 3300026118 | Bacteria | 1551 |
| 626 | Ga0207675_100535509 | 3300026118 | Unclassified | 1169 |
| 627 | Ga0207675_100759898 | 3300026118 | Unclassified | 981 |
| 628 | Ga0207675_100827378 | 3300026118 | Bacteria | 940 |
| 629 | Ga0207698_10118214 | 3300026142 | Bacteria | 2238 |
| 630 | Ga0207428_10007463 | 3300027907 | Bacteria | 9967 |
| 631 | Ga0207428_10008435 | 3300027907 | Bacteria | 9303 |
| 632 | Ga0207428_10169838 | 3300027907 | Bacteria | 1652 |
| 633 | Ga0207428_10310020 | 3300027907 | Bacteria | 1167 |
| 634 | Ga0268265_10029798 | 3300028380 | Bacteria | 3924 |
| 635 | Ga0268265_10378484 | 3300028380 | Bacteria | 1301 |
| 636 | Ga0268265_10399626 | 3300028380 | Bacteria | 1270 |
| 637 | Ga0268265_11048321 | 3300028380 | Bacteria | 807 |
| 638 | Ga0268264_10121237 | 3300028381 | Bacteria | 2305 |
| 639 | Ga0268264_10121248 | 3300028381 | Bacteria | 2304 |
| 640 | Ga0268264_10167421 | 3300028381 | Bacteria | 1985 |
| 641 | Ga0268264_10308055 | 3300028381 | Bacteria | 1493 |
| 642 | Ga0268264_10405023 | 3300028381 | Bacteria | 1312 |
| 643 | Ga0268264_10443495 | 3300028381 | Bacteria | 1256 |
| 644 | Ga0307408_100001243 | 3300031548 | Bacteria | 19119 |
| 645 | Ga0307405_10225698 | 3300031731 | Bacteria | 1377 |
| 646 | Ga0307413_10256327 | 3300031824 | Bacteria | 1301 |
| 647 | Ga0307413_10483864 | 3300031824 | Bacteria | 990 |
| 648 | Ga0307410_10023943 | 3300031852 | Bacteria | 3807 |
| 649 | Ga0307410_10090006 | 3300031852 | Bacteria | 2176 |
| 650 | Ga0307406_10001021 | 3300031901 | Bacteria | 15570 |
| 651 | Ga0307407_10125290 | 3300031903 | Bacteria | 1635 |
| 652 | Ga0307412_10025475 | 3300031911 | Bacteria | 3665 |
| 653 | Ga0307412_10470281 | 3300031911 | Bacteria | 1040 |
| 654 | Ga0307409_100028349 | 3300031995 | Bacteria | 3988 |
| 655 | Ga0307416_100079110 | 3300032002 | Unclassified | 2769 |
| 656 | Ga0307416_100625002 | 3300032002 | Bacteria | 1159 |
| 657 | Ga0307414_10000585 | 3300032004 | Bacteria | 18889 |
| 658 | Ga0307415_100000479 | 3300032126 | Bacteria | 17301 |
| 659 | Ga0307415_100216235 | 3300032126 | Bacteria | 1533 |
| 660 | Ga0307415_100244837 | 3300032126 | Bacteria | 1453 |
| 661 | Ga0373951_0002340 | 3300035091 | Unclassified | 4808 |
| 662 | Ga0373941_0013172 | 3300035115 | Bacteria | 2180 |
| 663 | Ga0373941_0068723 | 3300035115 | Bacteria | 1171 |
| 664 | Ga0373942_0002199 | 3300035207 | Bacteria | 4798 |
| 665 | Ga0373937_0040474 | 3300036401 | Bacteria | 4248 |
| 666 | Ga0395900_0318659 | 3300037418 | Unclassified | 1536 |
| 667 | Ga0395900_0662274 | 3300037418 | Bacteria | 980 |
| 668 | Ga0395898_0030070 | 3300037466 | Bacteria | 5439 |
| 669 | Ga0395898_0109812 | 3300037466 | Bacteria | 2644 |
| 670 | Ga0395905_0006255 | 3300037471 | Bacteria | 12019 |
| 671 | Ga0436364_0591090 | 3300037853 | Bacteria | 1686 |
| 672 | Ga0242420_013404 | 3300038996 | Unclassified | 1397 |
| 673 | Ga0436365_0407503 | 3300039437 | Bacteria | 219857 |
| 674 | Ga0436365_1230778 | 3300039437 | Bacteria | 38145 |
| 675 | Ga0436362_0300217 | 3300039453 | Bacteria | 1275 |
| 676 | Ga0439458_0002105 | 3300042157 | Bacteria | 4938 |
| 677 | Ga0453683_0203128 | 3300044673 | Bacteria | 1258 |
| 678 | Ga0453683_0245113 | 3300044673 | Bacteria | 1141 |
| 679 | Ga0453683_0267229 | 3300044673 | Bacteria | 1091 |
| 680 | Ga0451576_0386104 | 3300045051 | Bacteria | 1468 |
| 681 | Ga0451576_0617124 | 3300045051 | Bacteria | 1140 |
| 682 | Ga0451576_1127066 | 3300045051 | Bacteria | 821 |
| 683 | Ga0495664_0420561 | 3300046477 | Bacteria | 802 |
| 684 | Ga0495598_0094833 | 3300046537 | Unclassified | 979 |
| 685 | Ga0495621_0030213 | 3300046539 | Bacteria | 1851 |
| 686 | Ga0495634_0459935 | 3300046642 | Bacteria | 750 |
| 687 | Ga0496102_0019571 | 3300048905 | Bacteria | 5963 |
| 688 | Ga0496103_0361850 | 3300048906 | Bacteria | 933 |
| 689 | Ga0496104_0091376 | 3300048907 | Bacteria | 2910 |
| 690 | Ga0496106_0163300 | 3300048909 | Unclassified | 1762 |
| 691 | Ga0496106_0580730 | 3300048909 | Unclassified | 898 |
| 692 | Ga0496108_0749442 | 3300048911 | Unclassified | 845 |
| 693 | Ga0496112_0105263 | 3300048915 | Bacteria | 2791 |
| 694 | Ga0496112_0148038 | 3300048915 | Bacteria | 2316 |
| 695 | Ga0501291_002900 | 3300049514 | Bacteria | 2098 |
| 696 | Ga0501291_020907 | 3300049514 | Bacteria | 1039 |
| 697 | Ga0501291_021510 | 3300049514 | Bacteria | 1029 |
| 698 | Ga0501292_011005 | 3300049515 | Bacteria | 1363 |
| 699 | Ga0501292_011073 | 3300049515 | Bacteria | 1360 |
| 700 | Ga0501296_001846 | 3300049519 | Bacteria | 2158 |
| 701 | Ga0501297_010123 | 3300049520 | Bacteria | 1063 |
| 702 | Ga0501298_005326 | 3300049521 | Bacteria | 2059 |
| 703 | Ga0501298_058481 | 3300049521 | Bacteria | 812 |
| 704 | Ga0501038_0007917 | 3300049574 | Bacteria | 9799 |
| 705 | Ga0501038_0080645 | 3300049574 | Bacteria | 2743 |
| 706 | Ga0501198_004796 | 3300049649 | Unclassified | 1888 |
| 707 | Ga0501198_014886 | 3300049649 | Bacteria | 1189 |
| 708 | Ga0501201_003184 | 3300049651 | Bacteria | 1505 |
| 709 | Ga0501202_019476 | 3300049652 | Bacteria | 1341 |
| 710 | Ga0501207_003365 | 3300049654 | Unclassified | 2127 |
| 711 | Ga0501209_056644 | 3300049656 | Unclassified | 1083 |
| 712 | Ga0501211_009763 | 3300049658 | Bacteria | 940 |
| 713 | Ga0501216_000404 | 3300049660 | Bacteria | 5053 |
| 714 | Ga0501217_000501 | 3300049661 | Bacteria | 6476 |
| 715 | Ga0501217_001421 | 3300049661 | Bacteria | 4483 |
| 716 | Ga0501223_010755 | 3300049663 | Bacteria | 1839 |
| 717 | Ga0501224_001054 | 3300049664 | Unclassified | 3592 |
| 718 | Ga0501235_008343 | 3300049669 | Unclassified | 2260 |
| 719 | Ga0501235_023618 | 3300049669 | Bacteria | 1372 |
| 720 | Ga0501240_004611 | 3300049673 | Bacteria | 1608 |
| 721 | Ga0501243_026313 | 3300049675 | Bacteria | 979 |
| 722 | Ga0501249_019273 | 3300049679 | Bacteria | 1481 |
| 723 | Ga0501257_009411 | 3300049686 | Bacteria | 2207 |
| 724 | Ga0501260_010629 | 3300049689 | Bacteria | 925 |
| 725 | Ga0501221_065247 | 3300049704 | Bacteria | 849 |
| 726 | Ga0501225_0000268 | 3300049705 | Bacteria | 16456 |
| 727 | Ga0501225_0016691 | 3300049705 | Bacteria | 2041 |
| 728 | Ga0501225_0049152 | 3300049705 | Unclassified | 1172 |
| 729 | Ga0501234_000872 | 3300049707 | Unclassified | 4758 |
| 730 | Ga0501283_006493 | 3300049779 | Bacteria | 1640 |
| 731 | Ga0501283_021910 | 3300049779 | Unclassified | 1028 |
| 732 | Ga0501212_005859 | 3300049851 | Bacteria | 1640 |
| 733 | Ga0501212_009428 | 3300049851 | Bacteria | 1374 |
| 734 | Ga0501226_009413 | 3300049853 | Unclassified | 1087 |
| 735 | Ga0501226_014974 | 3300049853 | Unclassified | 856 |
| 736 | nmdc:mga05p37_1254091_c1 | 3300050507 | Bacteria | 760 |
| 737 | nmdc:mga05p37_133933_c1 | 3300050507 | Unclassified | 3040 |
| 738 | nmdc:mga05p37_196792_c1 | 3300050507 | Bacteria | 2444 |
| 739 | nmdc:mga05p37_384232_c1 | 3300050507 | Bacteria | 1644 |
| 740 | nmdc:mga05p37_88893_c1 | 3300050507 | Bacteria | 3807 |
| 741 | nmdc:mga05p37_899444_c1 | 3300050507 | Bacteria | 955 |
| 742 | nmdc:mga09592_171358_c1 | 3300050508 | Bacteria | 1877 |
| 743 | nmdc:mga09592_64775_c1 | 3300050508 | Bacteria | 3094 |
| 744 | nmdc:mga0qj67_184920_c1 | 3300050509 | Bacteria | 1693 |
| 745 | nmdc:mga0qj67_29879_c1 | 3300050509 | Bacteria | 4236 |
| 746 | nmdc:mga06r32_216935_c1 | 3300050510 | Unclassified | 1901 |
| 747 | nmdc:mga06r32_25661_c1 | 3300050510 | Bacteria | 5485 |
| 748 | nmdc:mga06r32_46784_c1 | 3300050510 | Unclassified | 4129 |
| 749 | nmdc:mga08y16_205093_c1 | 3300050511 | Bacteria | 2043 |
| 750 | nmdc:mga08y16_34486_c1 | 3300050511 | Bacteria | 5316 |
| 751 | nmdc:mga08y16_4740_c1 | 3300050511 | Bacteria | 14184 |
| 752 | nmdc:mga0n895_21252_c2 | 3300050512 | Bacteria | 4930 |
| 753 | nmdc:mga0n895_285969_c1 | 3300050512 | Bacteria | 1672 |
| 754 | nmdc:mga0n895_354298_c1 | 3300050512 | Unclassified | 1486 |
| 755 | nmdc:mga0n895_796064_c1 | 3300050512 | Bacteria | 936 |
| 756 | nmdc:mga0n895_90855_c1 | 3300050512 | Bacteria | 3055 |
| 757 | nmdc:mga0rr50_1046100_c1 | 3300050513 | Unclassified | 695 |
| 758 | nmdc:mga0rr50_195073_c1 | 3300050513 | Bacteria | 1661 |
| 759 | nmdc:mga08x19_11_c1 | 3300050514 | Bacteria | 403007 |
| 760 | nmdc:mga08x19_16_c1 | 3300050514 | Bacteria | 348119 |
| 761 | nmdc:mga08x19_8411_c1 | 3300050514 | Bacteria | 6149 |
| 762 | nmdc:mga0a205_12578_c1 | 3300050515 | Bacteria | 7831 |
| 763 | nmdc:mga0a205_132922_c1 | 3300050515 | Bacteria | 2388 |
| 764 | nmdc:mga0a205_28779_c1 | 3300050515 | Bacteria | 5313 |
| 765 | nmdc:mga0a205_67468_c1 | 3300050515 | Unclassified | 3456 |
| 766 | Ga0495619_0083142 | 3300053085 | Bacteria | 2159 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049705 | Ga0501225_0016691 | Ga0501225_0016691_1371_1940 | 183 |
| 2 | 3300049779 | Ga0501283_021910 | Ga0501283_021910_17_595 | 184 |
| 3 | 3300049853 | Ga0501226_014974 | Ga0501226_014974_23_601 | 184 |
| 4 | 3300005337 | Ga0070682_100954886 | Ga0070682_1009548861 | 187 |
| 5 | 3300014326 | Ga0157380_10653389 | Ga0157380_106533892 | 187 |
| 6 | 3300025923 | Ga0207681_10891112 | Ga0207681_108911121 | 187 |
| 7 | 3300025934 | Ga0207686_10121632 | Ga0207686_101216322 | 188 |
| 8 | 3300025935 | Ga0207709_10004095 | Ga0207709_100040955 | 188 |
| 9 | 3300026089 | Ga0207648_10083630 | Ga0207648_100836301 | 188 |
| 10 | 3300005334 | Ga0068869_100531802 | Ga0068869_1005318022 | 190 |
| 11 | 3300005336 | Ga0070680_100021413 | Ga0070680_1000214134 | 190 |
| 12 | 3300005344 | Ga0070661_100005268 | Ga0070661_1000052684 | 190 |
| 13 | 3300005366 | Ga0070659_100022165 | Ga0070659_1000221654 | 190 |
| 14 | 3300005441 | Ga0070700_100178028 | Ga0070700_1001780282 | 190 |
| 15 | 3300005458 | Ga0070681_10003413 | Ga0070681_1000341312 | 190 |
| 16 | 3300005459 | Ga0068867_101007696 | Ga0068867_1010076961 | 190 |
| 17 | 3300005530 | Ga0070679_100053076 | Ga0070679_1000530762 | 190 |
| 18 | 3300005539 | Ga0068853_100015348 | Ga0068853_1000153485 | 190 |
| 19 | 3300005564 | Ga0070664_100001504 | Ga0070664_10000150418 | 190 |
| 20 | 3300005577 | Ga0068857_100001572 | Ga0068857_10000157212 | 190 |
| 21 | 3300005618 | Ga0068864_100017822 | Ga0068864_1000178224 | 190 |
| 22 | 3300013100 | Ga0157373_10112898 | Ga0157373_101128982 | 190 |
| 23 | 3300014325 | Ga0163163_10001737 | Ga0163163_1000173716 | 190 |
| 24 | 3300017792 | Ga0163161_10055814 | Ga0163161_100558141 | 190 |
| 25 | 3300025912 | Ga0207707_10019734 | Ga0207707_100197344 | 190 |
| 26 | 3300025917 | Ga0207660_10006252 | Ga0207660_100062526 | 190 |
| 27 | 3300025919 | Ga0207657_10120733 | Ga0207657_101207332 | 190 |
| 28 | 3300025945 | Ga0207679_10063737 | Ga0207679_100637372 | 190 |
| 29 | 3300026089 | Ga0207648_11023462 | Ga0207648_110234621 | 190 |
| 30 | 3300026095 | Ga0207676_10088803 | Ga0207676_100888032 | 190 |
| 31 | 3300026116 | Ga0207674_10000036 | Ga0207674_1000003667 | 190 |
| 32 | 3300005343 | Ga0070687_100016979 | Ga0070687_1000169793 | 191 |
| 33 | 3300005353 | Ga0070669_100598924 | Ga0070669_1005989241 | 191 |
| 34 | 3300013102 | Ga0157371_10606219 | Ga0157371_106062191 | 191 |
| 35 | 3300025918 | Ga0207662_10004270 | Ga0207662_100042703 | 191 |
| 36 | 3300025923 | Ga0207681_10544705 | Ga0207681_105447051 | 191 |
| 37 | 3300025935 | Ga0207709_10508947 | Ga0207709_105089471 | 191 |
| 38 | 3300049705 | Ga0501225_0049152 | Ga0501225_0049152_554_1159 | 193 |
| 39 | 3300005546 | Ga0070696_100194935 | Ga0070696_1001949353 | 194 |
| 40 | 3300005345 | Ga0070692_10237689 | Ga0070692_102376892 | 196 |
| 41 | 3300005544 | Ga0070686_100046212 | Ga0070686_1000462123 | 196 |
| 42 | 3300005545 | Ga0070695_100504357 | Ga0070695_1005043572 | 196 |
| 43 | 3300044673 | Ga0453683_0245113 | Ga0453683_0245113_331_987 | 196 |
| 44 | 3300005290 | Ga0065712_10218737 | Ga0065712_102187372 | 197 |
| 45 | 3300017792 | Ga0163161_10405371 | Ga0163161_104053711 | 197 |
| 46 | 3300013308 | Ga0157375_10281022 | Ga0157375_102810222 | 198 |
| 47 | 3300049519 | Ga0501296_001846 | Ga0501296_001846_1199_1873 | 200 |
| 48 | 3300049520 | Ga0501297_010123 | Ga0501297_010123_131_805 | 200 |
| 49 | 3300049649 | Ga0501198_014886 | Ga0501198_014886_373_1047 | 200 |
| 50 | 3300049851 | Ga0501212_009428 | Ga0501212_009428_611_1285 | 200 |
| 51 | 3300000532 | CNAas_1003399 | CNAas_10033992 | 201 |
| 52 | 3300005331 | Ga0070670_100009843 | Ga0070670_1000098439 | 201 |
| 53 | 3300005331 | Ga0070670_100490155 | Ga0070670_1004901552 | 201 |
| 54 | 3300005340 | Ga0070689_100009405 | Ga0070689_1000094056 | 201 |
| 55 | 3300005364 | Ga0070673_100085054 | Ga0070673_1000850541 | 201 |
| 56 | 3300005617 | Ga0068859_100205474 | Ga0068859_1002054742 | 201 |
| 57 | 3300005618 | Ga0068864_100175271 | Ga0068864_1001752713 | 201 |
| 58 | 3300005841 | Ga0068863_100074503 | Ga0068863_1000745035 | 201 |
| 59 | 3300006931 | Ga0097620_100205472 | Ga0097620_1002054723 | 201 |
| 60 | 3300014325 | Ga0163163_10103857 | Ga0163163_101038573 | 201 |
| 61 | 3300025908 | Ga0207643_10004012 | Ga0207643_100040128 | 201 |
| 62 | 3300025922 | Ga0207646_10196560 | Ga0207646_101965602 | 201 |
| 63 | 3300025925 | Ga0207650_10225580 | Ga0207650_102255802 | 201 |
| 64 | 3300025936 | Ga0207670_10001600 | Ga0207670_100016002 | 201 |
| 65 | 3300025940 | Ga0207691_10196613 | Ga0207691_101966133 | 201 |
| 66 | 3300026116 | Ga0207674_10079314 | Ga0207674_100793142 | 201 |
| 67 | 3300049574 | Ga0501038_0080645 | Ga0501038_0080645_908_1525 | 201 |
| 68 | 3300006914 | Ga0075436_100001766 | Ga0075436_10000176613 | 202 |
| 69 | 3300046477 | Ga0495664_0420561 | Ga0495664_0420561_14_622 | 202 |
| 70 | 3300046642 | Ga0495634_0459935 | Ga0495634_0459935_13_627 | 202 |
| 71 | 3300050514 | nmdc:mga08x19_8411_c1 | nmdc:mga08x19_8411_c1_1851_2459 | 202 |
| 72 | 3300005471 | Ga0070698_100264567 | Ga0070698_1002645672 | 203 |
| 73 | 3300009553 | Ga0105249_10001430 | Ga0105249_100014304 | 205 |
| 74 | 3300013306 | Ga0163162_10000027 | Ga0163162_10000027122 | 205 |
| 75 | 3300014326 | Ga0157380_10228784 | Ga0157380_102287842 | 205 |
| 76 | 3300025961 | Ga0207712_10000956 | Ga0207712_1000095617 | 205 |
| 77 | 3300005290 | Ga0065712_10000296 | Ga0065712_100002965 | 207 |
| 78 | 3300005467 | Ga0070706_100568032 | Ga0070706_1005680322 | 207 |
| 79 | 3300005468 | Ga0070707_100084614 | Ga0070707_1000846144 | 207 |
| 80 | 3300005518 | Ga0070699_100579135 | Ga0070699_1005791352 | 207 |
| 81 | 3300025922 | Ga0207646_10062586 | Ga0207646_100625864 | 207 |
| 82 | 3300005337 | Ga0070682_100002890 | Ga0070682_1000028909 | 208 |
| 83 | 3300005338 | Ga0068868_100333046 | Ga0068868_1003330462 | 208 |
| 84 | 3300005343 | Ga0070687_100104329 | Ga0070687_1001043291 | 208 |
| 85 | 3300005345 | Ga0070692_10029041 | Ga0070692_100290412 | 208 |
| 86 | 3300005406 | Ga0070703_10014271 | Ga0070703_100142712 | 208 |
| 87 | 3300005440 | Ga0070705_100001180 | Ga0070705_1000011805 | 208 |
| 88 | 3300005441 | Ga0070700_100037052 | Ga0070700_1000370523 | 208 |
| 89 | 3300005444 | Ga0070694_100003400 | Ga0070694_1000034003 | 208 |
| 90 | 3300005467 | Ga0070706_100000085 | Ga0070706_10000008562 | 208 |
| 91 | 3300005545 | Ga0070695_100045162 | Ga0070695_1000451624 | 208 |
| 92 | 3300005546 | Ga0070696_100244863 | Ga0070696_1002448632 | 208 |
| 93 | 3300005547 | Ga0070693_100010936 | Ga0070693_1000109364 | 208 |
| 94 | 3300005549 | Ga0070704_100010265 | Ga0070704_1000102653 | 208 |
| 95 | 3300005615 | Ga0070702_100001575 | Ga0070702_1000015755 | 208 |
| 96 | 3300005615 | Ga0070702_100352676 | Ga0070702_1003526762 | 208 |
| 97 | 3300005616 | Ga0068852_100074178 | Ga0068852_1000741783 | 208 |
| 98 | 3300005616 | Ga0068852_100269493 | Ga0068852_1002694932 | 208 |
| 99 | 3300005617 | Ga0068859_100115041 | Ga0068859_1001150412 | 208 |
| 100 | 3300005617 | Ga0068859_101501654 | Ga0068859_1015016541 | 208 |
| 101 | 3300005618 | Ga0068864_100540965 | Ga0068864_1005409651 | 208 |
| 102 | 3300005719 | Ga0068861_100192740 | Ga0068861_1001927402 | 208 |
| 103 | 3300005834 | Ga0068851_10002245 | Ga0068851_100022455 | 208 |
| 104 | 3300005841 | Ga0068863_100328038 | Ga0068863_1003280382 | 208 |
| 105 | 3300005842 | Ga0068858_100053043 | Ga0068858_1000530432 | 208 |
| 106 | 3300006931 | Ga0097620_100115030 | Ga0097620_1001150302 | 208 |
| 107 | 3300006931 | Ga0097620_101501728 | Ga0097620_1015017281 | 208 |
| 108 | 3300009101 | Ga0105247_10043304 | Ga0105247_100433043 | 208 |
| 109 | 3300009177 | Ga0105248_10054579 | Ga0105248_100545793 | 208 |
| 110 | 3300009545 | Ga0105237_10000527 | Ga0105237_1000052736 | 208 |
| 111 | 3300013306 | Ga0163162_10207754 | Ga0163162_102077542 | 208 |
| 112 | 3300014745 | Ga0157377_10021040 | Ga0157377_100210403 | 208 |
| 113 | 3300014968 | Ga0157379_10166679 | Ga0157379_101666792 | 208 |
| 114 | 3300014968 | Ga0157379_10628090 | Ga0157379_106280902 | 208 |
| 115 | 3300025321 | Ga0207656_10007353 | Ga0207656_100073532 | 208 |
| 116 | 3300025885 | Ga0207653_10008043 | Ga0207653_100080433 | 208 |
| 117 | 3300025910 | Ga0207684_10000091 | Ga0207684_1000009151 | 208 |
| 118 | 3300025914 | Ga0207671_10003690 | Ga0207671_100036907 | 208 |
| 119 | 3300025918 | Ga0207662_10293377 | Ga0207662_102933771 | 208 |
| 120 | 3300025936 | Ga0207670_10130963 | Ga0207670_101309632 | 208 |
| 121 | 3300025941 | Ga0207711_10312474 | Ga0207711_103124742 | 208 |
| 122 | 3300026023 | Ga0207677_10274566 | Ga0207677_102745662 | 208 |
| 123 | 3300026035 | Ga0207703_10148468 | Ga0207703_101484682 | 208 |
| 124 | 3300026075 | Ga0207708_10032899 | Ga0207708_100328993 | 208 |
| 125 | 3300026088 | Ga0207641_10131881 | Ga0207641_101318813 | 208 |
| 126 | 3300026088 | Ga0207641_10598350 | Ga0207641_105983502 | 208 |
| 127 | 3300026118 | Ga0207675_100159797 | Ga0207675_1001597972 | 208 |
| 128 | 3300026142 | Ga0207698_10118214 | Ga0207698_101182143 | 208 |
| 129 | 3300028380 | Ga0268265_10399626 | Ga0268265_103996262 | 208 |
| 130 | 3300050507 | nmdc:mga05p37_1254091_c1 | nmdc:mga05p37_1254091_c1_116_742 | 208 |
| 131 | 3300005290 | Ga0065712_10080959 | Ga0065712_100809595 | 209 |
| 132 | 3300005331 | Ga0070670_100022889 | Ga0070670_1000228897 | 209 |
| 133 | 3300005547 | Ga0070693_100174303 | Ga0070693_1001743032 | 209 |
| 134 | 3300005549 | Ga0070704_100651713 | Ga0070704_1006517131 | 209 |
| 135 | 3300005577 | Ga0068857_100271103 | Ga0068857_1002711033 | 209 |
| 136 | 3300005615 | Ga0070702_100483417 | Ga0070702_1004834171 | 209 |
| 137 | 3300005843 | Ga0068860_100053151 | Ga0068860_1000531512 | 209 |
| 138 | 3300009094 | Ga0111539_10007694 | Ga0111539_1000769411 | 209 |
| 139 | 3300013306 | Ga0163162_10003480 | Ga0163162_100034808 | 209 |
| 140 | 3300013308 | Ga0157375_10425810 | Ga0157375_104258102 | 209 |
| 141 | 3300014325 | Ga0163163_10000109 | Ga0163163_1000010968 | 209 |
| 142 | 3300025903 | Ga0207680_10559918 | Ga0207680_105599181 | 209 |
| 143 | 3300025904 | Ga0207647_10176023 | Ga0207647_101760232 | 209 |
| 144 | 3300025925 | Ga0207650_10000009 | Ga0207650_1000000971 | 209 |
| 145 | 3300026095 | Ga0207676_10045163 | Ga0207676_100451633 | 209 |
| 146 | 3300026116 | Ga0207674_10263490 | Ga0207674_102634903 | 209 |
| 147 | 3300027907 | Ga0207428_10169838 | Ga0207428_101698382 | 209 |
| 148 | 3300037471 | Ga0395905_0006255 | Ga0395905_0006255_4962_5597 | 209 |
| 149 | 3300048909 | Ga0496106_0580730 | Ga0496106_0580730_20_649 | 209 |
| 150 | 3300049515 | Ga0501292_011073 | Ga0501292_011073_245_877 | 209 |
| 151 | 3300050511 | nmdc:mga08y16_205093_c1 | nmdc:mga08y16_205093_c1_628_1302 | 209 |
| 152 | 2162886007 | SwRhRL2b_contig_634714 | SwRhRL2b_0817.00004000 | 210 |
| 153 | 3300005289 | Ga0065704_10071515 | Ga0065704_100715158 | 210 |
| 154 | 3300005289 | Ga0065704_10171333 | Ga0065704_101713333 | 210 |
| 155 | 3300005290 | Ga0065712_10095370 | Ga0065712_100953701 | 210 |
| 156 | 3300005290 | Ga0065712_10125985 | Ga0065712_101259852 | 210 |
| 157 | 3300005293 | Ga0065715_10004340 | Ga0065715_100043407 | 210 |
| 158 | 3300005293 | Ga0065715_10005901 | Ga0065715_100059013 | 210 |
| 159 | 3300005293 | Ga0065715_10174762 | Ga0065715_101747623 | 210 |
| 160 | 3300005295 | Ga0065707_10087245 | Ga0065707_100872455 | 210 |
| 161 | 3300005295 | Ga0065707_10094864 | Ga0065707_100948642 | 210 |
| 162 | 3300005331 | Ga0070670_100092145 | Ga0070670_1000921453 | 210 |
| 163 | 3300005337 | Ga0070682_100003390 | Ga0070682_10000339011 | 210 |
| 164 | 3300005343 | Ga0070687_100140416 | Ga0070687_1001404163 | 210 |
| 165 | 3300005354 | Ga0070675_100810960 | Ga0070675_1008109601 | 210 |
| 166 | 3300005364 | Ga0070673_100121330 | Ga0070673_1001213303 | 210 |
| 167 | 3300005366 | Ga0070659_100183035 | Ga0070659_1001830352 | 210 |
| 168 | 3300005440 | Ga0070705_100202322 | Ga0070705_1002023222 | 210 |
| 169 | 3300005440 | Ga0070705_100231463 | Ga0070705_1002314632 | 210 |
| 170 | 3300005441 | Ga0070700_100000005 | Ga0070700_10000000568 | 210 |
| 171 | 3300005444 | Ga0070694_100040560 | Ga0070694_1000405603 | 210 |
| 172 | 3300005444 | Ga0070694_100154487 | Ga0070694_1001544872 | 210 |
| 173 | 3300005458 | Ga0070681_10003933 | Ga0070681_100039335 | 210 |
| 174 | 3300005458 | Ga0070681_10083531 | Ga0070681_100835312 | 210 |
| 175 | 3300005459 | Ga0068867_100017771 | Ga0068867_1000177714 | 210 |
| 176 | 3300005518 | Ga0070699_100783894 | Ga0070699_1007838941 | 210 |
| 177 | 3300005546 | Ga0070696_100046031 | Ga0070696_1000460312 | 210 |
| 178 | 3300005546 | Ga0070696_100646653 | Ga0070696_1006466531 | 210 |
| 179 | 3300005547 | Ga0070693_100005900 | Ga0070693_1000059005 | 210 |
| 180 | 3300005577 | Ga0068857_100541610 | Ga0068857_1005416102 | 210 |
| 181 | 3300005578 | Ga0068854_100143266 | Ga0068854_1001432662 | 210 |
| 182 | 3300005615 | Ga0070702_100043929 | Ga0070702_1000439291 | 210 |
| 183 | 3300005617 | Ga0068859_100027393 | Ga0068859_1000273937 | 210 |
| 184 | 3300005617 | Ga0068859_100048141 | Ga0068859_1000481415 | 210 |
| 185 | 3300005617 | Ga0068859_100059825 | Ga0068859_1000598252 | 210 |
| 186 | 3300005617 | Ga0068859_100140999 | Ga0068859_1001409993 | 210 |
| 187 | 3300005617 | Ga0068859_100152609 | Ga0068859_1001526093 | 210 |
| 188 | 3300005617 | Ga0068859_100175496 | Ga0068859_1001754962 | 210 |
| 189 | 3300005618 | Ga0068864_100023463 | Ga0068864_1000234636 | 210 |
| 190 | 3300005618 | Ga0068864_100996972 | Ga0068864_1009969721 | 210 |
| 191 | 3300005718 | Ga0068866_10014995 | Ga0068866_100149954 | 210 |
| 192 | 3300005840 | Ga0068870_10123259 | Ga0068870_101232592 | 210 |
| 193 | 3300005840 | Ga0068870_10574044 | Ga0068870_105740441 | 210 |
| 194 | 3300005841 | Ga0068863_100077484 | Ga0068863_1000774845 | 210 |
| 195 | 3300005841 | Ga0068863_100532748 | Ga0068863_1005327482 | 210 |
| 196 | 3300005842 | Ga0068858_100174082 | Ga0068858_1001740821 | 210 |
| 197 | 3300005843 | Ga0068860_100119189 | Ga0068860_1001191895 | 210 |
| 198 | 3300005844 | Ga0068862_100305831 | Ga0068862_1003058312 | 210 |
| 199 | 3300005985 | Ga0081539_10000490 | Ga0081539_1000049011 | 210 |
| 200 | 3300006058 | Ga0075432_10165156 | Ga0075432_101651561 | 210 |
| 201 | 3300006173 | Ga0070716_100000007 | Ga0070716_100000007129 | 210 |
| 202 | 3300006237 | Ga0097621_100003740 | Ga0097621_10000374014 | 210 |
| 203 | 3300006847 | Ga0075431_100125780 | Ga0075431_1001257803 | 210 |
| 204 | 3300006852 | Ga0075433_10027242 | Ga0075433_100272422 | 210 |
| 205 | 3300006852 | Ga0075433_10030871 | Ga0075433_100308712 | 210 |
| 206 | 3300006852 | Ga0075433_10115905 | Ga0075433_101159053 | 210 |
| 207 | 3300006871 | Ga0075434_100017831 | Ga0075434_1000178311 | 210 |
| 208 | 3300006881 | Ga0068865_100244298 | Ga0068865_1002442981 | 210 |
| 209 | 3300006931 | Ga0097620_100027391 | Ga0097620_1000273917 | 210 |
| 210 | 3300006931 | Ga0097620_100048144 | Ga0097620_1000481445 | 210 |
| 211 | 3300006931 | Ga0097620_100059819 | Ga0097620_1000598192 | 210 |
| 212 | 3300006931 | Ga0097620_100141009 | Ga0097620_1001410093 | 210 |
| 213 | 3300006931 | Ga0097620_100152605 | Ga0097620_1001526053 | 210 |
| 214 | 3300006931 | Ga0097620_100175505 | Ga0097620_1001755052 | 210 |
| 215 | 3300009094 | Ga0111539_10000363 | Ga0111539_1000036321 | 210 |
| 216 | 3300009094 | Ga0111539_10813049 | Ga0111539_108130492 | 210 |
| 217 | 3300009098 | Ga0105245_10623793 | Ga0105245_106237931 | 210 |
| 218 | 3300009098 | Ga0105245_11042266 | Ga0105245_110422661 | 210 |
| 219 | 3300009101 | Ga0105247_10008100 | Ga0105247_100081004 | 210 |
| 220 | 3300009101 | Ga0105247_10039422 | Ga0105247_100394222 | 210 |
| 221 | 3300009101 | Ga0105247_10345435 | Ga0105247_103454352 | 210 |
| 222 | 3300009147 | Ga0114129_10235807 | Ga0114129_102358073 | 210 |
| 223 | 3300009147 | Ga0114129_10236812 | Ga0114129_102368124 | 210 |
| 224 | 3300009147 | Ga0114129_10512829 | Ga0114129_105128292 | 210 |
| 225 | 3300009147 | Ga0114129_10612362 | Ga0114129_106123622 | 210 |
| 226 | 3300009148 | Ga0105243_10008920 | Ga0105243_100089208 | 210 |
| 227 | 3300009148 | Ga0105243_10068413 | Ga0105243_100684133 | 210 |
| 228 | 3300009174 | Ga0105241_10060700 | Ga0105241_100607003 | 210 |
| 229 | 3300009174 | Ga0105241_10190194 | Ga0105241_101901941 | 210 |
| 230 | 3300009174 | Ga0105241_10353606 | Ga0105241_103536061 | 210 |
| 231 | 3300009176 | Ga0105242_10113975 | Ga0105242_101139753 | 210 |
| 232 | 3300009176 | Ga0105242_10168726 | Ga0105242_101687262 | 210 |
| 233 | 3300009177 | Ga0105248_10026948 | Ga0105248_100269485 | 210 |
| 234 | 3300009177 | Ga0105248_10246865 | Ga0105248_102468652 | 210 |
| 235 | 3300009551 | Ga0105238_10001996 | Ga0105238_1000199613 | 210 |
| 236 | 3300009553 | Ga0105249_10152210 | Ga0105249_101522103 | 210 |
| 237 | 3300009553 | Ga0105249_10174470 | Ga0105249_101744702 | 210 |
| 238 | 3300009553 | Ga0105249_11098359 | Ga0105249_110983591 | 210 |
| 239 | 3300010375 | Ga0105239_10095819 | Ga0105239_100958192 | 210 |
| 240 | 3300010375 | Ga0105239_10382904 | Ga0105239_103829043 | 210 |
| 241 | 3300011119 | Ga0105246_11072975 | Ga0105246_110729751 | 210 |
| 242 | 3300011119 | Ga0105246_11289814 | Ga0105246_112898141 | 210 |
| 243 | 3300013100 | Ga0157373_10254302 | Ga0157373_102543022 | 210 |
| 244 | 3300013297 | Ga0157378_10064497 | Ga0157378_100644975 | 210 |
| 245 | 3300013297 | Ga0157378_10148736 | Ga0157378_101487362 | 210 |
| 246 | 3300013297 | Ga0157378_11008068 | Ga0157378_110080682 | 210 |
| 247 | 3300013306 | Ga0163162_10155774 | Ga0163162_101557746 | 210 |
| 248 | 3300013307 | Ga0157372_10898692 | Ga0157372_108986922 | 210 |
| 249 | 3300013308 | Ga0157375_10718795 | Ga0157375_107187951 | 210 |
| 250 | 3300014968 | Ga0157379_10448087 | Ga0157379_104480872 | 210 |
| 251 | 3300025899 | Ga0207642_10003705 | Ga0207642_100037051 | 210 |
| 252 | 3300025900 | Ga0207710_10000832 | Ga0207710_1000083211 | 210 |
| 253 | 3300025904 | Ga0207647_10017531 | Ga0207647_100175317 | 210 |
| 254 | 3300025908 | Ga0207643_10115455 | Ga0207643_101154552 | 210 |
| 255 | 3300025908 | Ga0207643_10154827 | Ga0207643_101548271 | 210 |
| 256 | 3300025908 | Ga0207643_10450175 | Ga0207643_104501751 | 210 |
| 257 | 3300025911 | Ga0207654_10083469 | Ga0207654_100834693 | 210 |
| 258 | 3300025912 | Ga0207707_10084084 | Ga0207707_100840843 | 210 |
| 259 | 3300025912 | Ga0207707_10264975 | Ga0207707_102649752 | 210 |
| 260 | 3300025924 | Ga0207694_10010396 | Ga0207694_100103963 | 210 |
| 261 | 3300025925 | Ga0207650_10044178 | Ga0207650_100441783 | 210 |
| 262 | 3300025927 | Ga0207687_10393785 | Ga0207687_103937852 | 210 |
| 263 | 3300025932 | Ga0207690_10338378 | Ga0207690_103383782 | 210 |
| 264 | 3300025934 | Ga0207686_10328878 | Ga0207686_103288782 | 210 |
| 265 | 3300025935 | Ga0207709_10325828 | Ga0207709_103258282 | 210 |
| 266 | 3300025935 | Ga0207709_10504279 | Ga0207709_105042791 | 210 |
| 267 | 3300025939 | Ga0207665_10000018 | Ga0207665_1000001811 | 210 |
| 268 | 3300025940 | Ga0207691_10208715 | Ga0207691_102087151 | 210 |
| 269 | 3300025941 | Ga0207711_10015475 | Ga0207711_100154755 | 210 |
| 270 | 3300025941 | Ga0207711_10219791 | Ga0207711_102197914 | 210 |
| 271 | 3300025941 | Ga0207711_10459526 | Ga0207711_104595262 | 210 |
| 272 | 3300025941 | Ga0207711_10608331 | Ga0207711_106083312 | 210 |
| 273 | 3300025942 | Ga0207689_10501170 | Ga0207689_105011702 | 210 |
| 274 | 3300025960 | Ga0207651_10471323 | Ga0207651_104713232 | 210 |
| 275 | 3300025960 | Ga0207651_10878328 | Ga0207651_108783282 | 210 |
| 276 | 3300025961 | Ga0207712_10037657 | Ga0207712_100376573 | 210 |
| 277 | 3300025981 | Ga0207640_10548803 | Ga0207640_105488032 | 210 |
| 278 | 3300026035 | Ga0207703_10101203 | Ga0207703_101012031 | 210 |
| 279 | 3300026035 | Ga0207703_10493517 | Ga0207703_104935172 | 210 |
| 280 | 3300026035 | Ga0207703_11231684 | Ga0207703_112316841 | 210 |
| 281 | 3300026041 | Ga0207639_10814825 | Ga0207639_108148252 | 210 |
| 282 | 3300026075 | Ga0207708_10000017 | Ga0207708_1000001746 | 210 |
| 283 | 3300026075 | Ga0207708_10016202 | Ga0207708_100162022 | 210 |
| 284 | 3300026088 | Ga0207641_10053459 | Ga0207641_100534592 | 210 |
| 285 | 3300026088 | Ga0207641_10776928 | Ga0207641_107769281 | 210 |
| 286 | 3300026088 | Ga0207641_11057324 | Ga0207641_110573241 | 210 |
| 287 | 3300026089 | Ga0207648_10280012 | Ga0207648_102800123 | 210 |
| 288 | 3300026095 | Ga0207676_10010544 | Ga0207676_100105443 | 210 |
| 289 | 3300026095 | Ga0207676_10265065 | Ga0207676_102650652 | 210 |
| 290 | 3300026095 | Ga0207676_10312561 | Ga0207676_103125612 | 210 |
| 291 | 3300026116 | Ga0207674_10321942 | Ga0207674_103219422 | 210 |
| 292 | 3300026118 | Ga0207675_100305244 | Ga0207675_1003052443 | 210 |
| 293 | 3300026118 | Ga0207675_100535509 | Ga0207675_1005355092 | 210 |
| 294 | 3300027907 | Ga0207428_10008435 | Ga0207428_100084355 | 210 |
| 295 | 3300028381 | Ga0268264_10443495 | Ga0268264_104434952 | 210 |
| 296 | 3300031548 | Ga0307408_100001243 | Ga0307408_1000012437 | 210 |
| 297 | 3300031824 | Ga0307413_10256327 | Ga0307413_102563272 | 210 |
| 298 | 3300031852 | Ga0307410_10023943 | Ga0307410_100239431 | 210 |
| 299 | 3300031901 | Ga0307406_10001021 | Ga0307406_100010215 | 210 |
| 300 | 3300031903 | Ga0307407_10125290 | Ga0307407_101252902 | 210 |
| 301 | 3300031911 | Ga0307412_10470281 | Ga0307412_104702812 | 210 |
| 302 | 3300031995 | Ga0307409_100028349 | Ga0307409_1000283495 | 210 |
| 303 | 3300032002 | Ga0307416_100079110 | Ga0307416_1000791103 | 210 |
| 304 | 3300032004 | Ga0307414_10000585 | Ga0307414_1000058513 | 210 |
| 305 | 3300032126 | Ga0307415_100000479 | Ga0307415_1000004795 | 210 |
| 306 | 3300032126 | Ga0307415_100244837 | Ga0307415_1002448372 | 210 |
| 307 | 3300035091 | Ga0373951_0002340 | Ga0373951_0002340_3456_4091 | 210 |
| 308 | 3300035115 | Ga0373941_0013172 | Ga0373941_0013172_163_795 | 210 |
| 309 | 3300035115 | Ga0373941_0068723 | Ga0373941_0068723_451_1086 | 210 |
| 310 | 3300035207 | Ga0373942_0002199 | Ga0373942_0002199_2260_2898 | 210 |
| 311 | 3300037418 | Ga0395900_0662274 | Ga0395900_0662274_268_906 | 210 |
| 312 | 3300037466 | Ga0395898_0030070 | Ga0395898_0030070_2098_2736 | 210 |
| 313 | 3300037466 | Ga0395898_0109812 | Ga0395898_0109812_131_769 | 210 |
| 314 | 3300042157 | Ga0439458_0002105 | Ga0439458_0002105_71_709 | 210 |
| 315 | 3300045051 | Ga0451576_0386104 | Ga0451576_0386104_205_843 | 210 |
| 316 | 3300048906 | Ga0496103_0361850 | Ga0496103_0361850_232_870 | 210 |
| 317 | 3300048909 | Ga0496106_0163300 | Ga0496106_0163300_1025_1663 | 210 |
| 318 | 3300048911 | Ga0496108_0749442 | Ga0496108_0749442_101_739 | 210 |
| 319 | 3300048915 | Ga0496112_0148038 | Ga0496112_0148038_425_1057 | 210 |
| 320 | 3300049514 | Ga0501291_021510 | Ga0501291_021510_277_912 | 210 |
| 321 | 3300049521 | Ga0501298_058481 | Ga0501298_058481_21_656 | 210 |
| 322 | 3300049649 | Ga0501198_004796 | Ga0501198_004796_1233_1871 | 210 |
| 323 | 3300049654 | Ga0501207_003365 | Ga0501207_003365_1070_1708 | 210 |
| 324 | 3300049656 | Ga0501209_056644 | Ga0501209_056644_10_648 | 210 |
| 325 | 3300049658 | Ga0501211_009763 | Ga0501211_009763_209_844 | 210 |
| 326 | 3300049660 | Ga0501216_000404 | Ga0501216_000404_286_924 | 210 |
| 327 | 3300049661 | Ga0501217_000501 | Ga0501217_000501_3901_4539 | 210 |
| 328 | 3300049663 | Ga0501223_010755 | Ga0501223_010755_618_1253 | 210 |
| 329 | 3300049664 | Ga0501224_001054 | Ga0501224_001054_1927_2565 | 210 |
| 330 | 3300049673 | Ga0501240_004611 | Ga0501240_004611_164_802 | 210 |
| 331 | 3300049675 | Ga0501243_026313 | Ga0501243_026313_205_840 | 210 |
| 332 | 3300049679 | Ga0501249_019273 | Ga0501249_019273_759_1394 | 210 |
| 333 | 3300049704 | Ga0501221_065247 | Ga0501221_065247_199_834 | 210 |
| 334 | 3300049705 | Ga0501225_0000268 | Ga0501225_0000268_5758_6396 | 210 |
| 335 | 3300049707 | Ga0501234_000872 | Ga0501234_000872_3530_4168 | 210 |
| 336 | 3300049853 | Ga0501226_009413 | Ga0501226_009413_395_1033 | 210 |
| 337 | 3300050507 | nmdc:mga05p37_384232_c1 | nmdc:mga05p37_384232_c1_420_1058 | 210 |
| 338 | 3300050510 | nmdc:mga06r32_216935_c1 | nmdc:mga06r32_216935_c1_1130_1765 | 210 |
| 339 | 3300050511 | nmdc:mga08y16_34486_c1 | nmdc:mga08y16_34486_c1_3809_4447 | 210 |
| 340 | 3300050512 | nmdc:mga0n895_285969_c1 | nmdc:mga0n895_285969_c1_771_1409 | 210 |
| 341 | 3300050515 | nmdc:mga0a205_12578_c1 | nmdc:mga0a205_12578_c1_1129_1767 | 210 |
| 342 | 3300053085 | Ga0495619_0083142 | Ga0495619_0083142_1292_2029 | 210 |
| 343 | 3300005288 | Ga0065714_10064507 | Ga0065714_1006450713 | 211 |
| 344 | 3300005290 | Ga0065712_10000138 | Ga0065712_1000013835 | 211 |
| 345 | 3300005293 | Ga0065715_10090469 | Ga0065715_100904692 | 211 |
| 346 | 3300005329 | Ga0070683_100015643 | Ga0070683_1000156432 | 211 |
| 347 | 3300005334 | Ga0068869_100629904 | Ga0068869_1006299042 | 211 |
| 348 | 3300005445 | Ga0070708_100132733 | Ga0070708_1001327332 | 211 |
| 349 | 3300005467 | Ga0070706_100564830 | Ga0070706_1005648302 | 211 |
| 350 | 3300005535 | Ga0070684_100423357 | Ga0070684_1004233572 | 211 |
| 351 | 3300005618 | Ga0068864_100368505 | Ga0068864_1003685052 | 211 |
| 352 | 3300005840 | Ga0068870_10069572 | Ga0068870_100695722 | 211 |
| 353 | 3300006846 | Ga0075430_100113481 | Ga0075430_1001134812 | 211 |
| 354 | 3300006847 | Ga0075431_100010525 | Ga0075431_1000105253 | 211 |
| 355 | 3300006871 | Ga0075434_100836396 | Ga0075434_1008363961 | 211 |
| 356 | 3300006880 | Ga0075429_100397165 | Ga0075429_1003971652 | 211 |
| 357 | 3300006914 | Ga0075436_100000008 | Ga0075436_100000008136 | 211 |
| 358 | 3300007076 | Ga0075435_100000244 | Ga0075435_1000002446 | 211 |
| 359 | 3300007076 | Ga0075435_100006045 | Ga0075435_1000060457 | 211 |
| 360 | 3300009147 | Ga0114129_10164582 | Ga0114129_101645821 | 211 |
| 361 | 3300009174 | Ga0105241_10070199 | Ga0105241_100701992 | 211 |
| 362 | 3300009177 | Ga0105248_10867368 | Ga0105248_108673682 | 211 |
| 363 | 3300010159 | Ga0099796_10112636 | Ga0099796_101126361 | 211 |
| 364 | 3300013100 | Ga0157373_10002322 | Ga0157373_100023228 | 211 |
| 365 | 3300013306 | Ga0163162_10158553 | Ga0163162_101585533 | 211 |
| 366 | 3300013308 | Ga0157375_10003116 | Ga0157375_100031162 | 211 |
| 367 | 3300025904 | Ga0207647_10373602 | Ga0207647_103736021 | 211 |
| 368 | 3300025906 | Ga0207699_10433244 | Ga0207699_104332441 | 211 |
| 369 | 3300025908 | Ga0207643_10122668 | Ga0207643_101226682 | 211 |
| 370 | 3300025911 | Ga0207654_10075558 | Ga0207654_100755582 | 211 |
| 371 | 3300025917 | Ga0207660_10412158 | Ga0207660_104121581 | 211 |
| 372 | 3300025939 | Ga0207665_10078952 | Ga0207665_100789523 | 211 |
| 373 | 3300025944 | Ga0207661_10099802 | Ga0207661_100998024 | 211 |
| 374 | 3300026095 | Ga0207676_10288476 | Ga0207676_102884762 | 211 |
| 375 | 3300031731 | Ga0307405_10225698 | Ga0307405_102256982 | 211 |
| 376 | 3300031824 | Ga0307413_10483864 | Ga0307413_104838642 | 211 |
| 377 | 3300031852 | Ga0307410_10090006 | Ga0307410_100900063 | 211 |
| 378 | 3300031911 | Ga0307412_10025475 | Ga0307412_100254752 | 211 |
| 379 | 3300032002 | Ga0307416_100625002 | Ga0307416_1006250022 | 211 |
| 380 | 3300032126 | Ga0307415_100216235 | Ga0307415_1002162352 | 211 |
| 381 | 3300039453 | Ga0436362_0300217 | Ga0436362_0300217_223_864 | 211 |
| 382 | 3300048915 | Ga0496112_0105263 | Ga0496112_0105263_961_1599 | 211 |
| 383 | 3300049514 | Ga0501291_020907 | Ga0501291_020907_128_799 | 211 |
| 384 | 3300049515 | Ga0501292_011005 | Ga0501292_011005_254_925 | 211 |
| 385 | 3300049521 | Ga0501298_005326 | Ga0501298_005326_816_1487 | 211 |
| 386 | 3300049574 | Ga0501038_0007917 | Ga0501038_0007917_6318_6956 | 211 |
| 387 | 3300049651 | Ga0501201_003184 | Ga0501201_003184_37_708 | 211 |
| 388 | 3300049652 | Ga0501202_019476 | Ga0501202_019476_389_1060 | 211 |
| 389 | 3300049661 | Ga0501217_001421 | Ga0501217_001421_3301_3972 | 211 |
| 390 | 3300049669 | Ga0501235_008343 | Ga0501235_008343_127_798 | 211 |
| 391 | 3300049686 | Ga0501257_009411 | Ga0501257_009411_781_1452 | 211 |
| 392 | 3300049689 | Ga0501260_010629 | Ga0501260_010629_141_812 | 211 |
| 393 | 3300049779 | Ga0501283_006493 | Ga0501283_006493_701_1372 | 211 |
| 394 | 3300049851 | Ga0501212_005859 | Ga0501212_005859_701_1372 | 211 |
| 395 | 3300050507 | nmdc:mga05p37_899444_c1 | nmdc:mga05p37_899444_c1_237_890 | 211 |
| 396 | 3300050508 | nmdc:mga09592_171358_c1 | nmdc:mga09592_171358_c1_403_1056 | 211 |
| 397 | 3300050509 | nmdc:mga0qj67_184920_c1 | nmdc:mga0qj67_184920_c1_132_812 | 211 |
| 398 | 3300050509 | nmdc:mga0qj67_29879_c1 | nmdc:mga0qj67_29879_c1_118_771 | 211 |
| 399 | 3300050510 | nmdc:mga06r32_25661_c1 | nmdc:mga06r32_25661_c1_4092_4745 | 211 |
| 400 | 3300050510 | nmdc:mga06r32_46784_c1 | nmdc:mga06r32_46784_c1_1081_1761 | 211 |
| 401 | 3300050512 | nmdc:mga0n895_354298_c1 | nmdc:mga0n895_354298_c1_437_1102 | 211 |
| 402 | 3300050514 | nmdc:mga08x19_16_c1 | nmdc:mga08x19_16_c1_138544_139179 | 211 |
| 403 | 3300005290 | Ga0065712_10099129 | Ga0065712_100991292 | 212 |
| 404 | 3300005293 | Ga0065715_10033378 | Ga0065715_100333782 | 212 |
| 405 | 3300005328 | Ga0070676_10057386 | Ga0070676_100573863 | 212 |
| 406 | 3300005330 | Ga0070690_100005770 | Ga0070690_1000057706 | 212 |
| 407 | 3300005334 | Ga0068869_100083550 | Ga0068869_1000835502 | 212 |
| 408 | 3300005335 | Ga0070666_10116685 | Ga0070666_101166851 | 212 |
| 409 | 3300005340 | Ga0070689_100128741 | Ga0070689_1001287411 | 212 |
| 410 | 3300005343 | Ga0070687_100124760 | Ga0070687_1001247602 | 212 |
| 411 | 3300005345 | Ga0070692_10226131 | Ga0070692_102261312 | 212 |
| 412 | 3300005353 | Ga0070669_100079505 | Ga0070669_1000795053 | 212 |
| 413 | 3300005353 | Ga0070669_100119808 | Ga0070669_1001198082 | 212 |
| 414 | 3300005354 | Ga0070675_100109993 | Ga0070675_1001099933 | 212 |
| 415 | 3300005354 | Ga0070675_100140279 | Ga0070675_1001402792 | 212 |
| 416 | 3300005355 | Ga0070671_100044712 | Ga0070671_1000447125 | 212 |
| 417 | 3300005365 | Ga0070688_100582036 | Ga0070688_1005820362 | 212 |
| 418 | 3300005367 | Ga0070667_100032807 | Ga0070667_1000328072 | 212 |
| 419 | 3300005438 | Ga0070701_10087404 | Ga0070701_100874043 | 212 |
| 420 | 3300005440 | Ga0070705_100057489 | Ga0070705_1000574892 | 212 |
| 421 | 3300005441 | Ga0070700_100071533 | Ga0070700_1000715333 | 212 |
| 422 | 3300005444 | Ga0070694_100039687 | Ga0070694_1000396873 | 212 |
| 423 | 3300005444 | Ga0070694_100063544 | Ga0070694_1000635443 | 212 |
| 424 | 3300005445 | Ga0070708_100275416 | Ga0070708_1002754161 | 212 |
| 425 | 3300005456 | Ga0070678_100021052 | Ga0070678_1000210523 | 212 |
| 426 | 3300005457 | Ga0070662_100067297 | Ga0070662_1000672972 | 212 |
| 427 | 3300005459 | Ga0068867_100170264 | Ga0068867_1001702641 | 212 |
| 428 | 3300005466 | Ga0070685_10045527 | Ga0070685_100455271 | 212 |
| 429 | 3300005467 | Ga0070706_100006573 | Ga0070706_10000657310 | 212 |
| 430 | 3300005536 | Ga0070697_100303033 | Ga0070697_1003030331 | 212 |
| 431 | 3300005543 | Ga0070672_100121466 | Ga0070672_1001214662 | 212 |
| 432 | 3300005543 | Ga0070672_100154798 | Ga0070672_1001547981 | 212 |
| 433 | 3300005544 | Ga0070686_100009728 | Ga0070686_1000097283 | 212 |
| 434 | 3300005544 | Ga0070686_100071842 | Ga0070686_1000718423 | 212 |
| 435 | 3300005546 | Ga0070696_100022307 | Ga0070696_1000223072 | 212 |
| 436 | 3300005546 | Ga0070696_100385191 | Ga0070696_1003851911 | 212 |
| 437 | 3300005617 | Ga0068859_100011491 | Ga0068859_1000114912 | 212 |
| 438 | 3300005617 | Ga0068859_100210714 | Ga0068859_1002107142 | 212 |
| 439 | 3300005618 | Ga0068864_100396693 | Ga0068864_1003966932 | 212 |
| 440 | 3300005718 | Ga0068866_10031205 | Ga0068866_100312053 | 212 |
| 441 | 3300005719 | Ga0068861_100070334 | Ga0068861_1000703342 | 212 |
| 442 | 3300005841 | Ga0068863_100133463 | Ga0068863_1001334631 | 212 |
| 443 | 3300005842 | Ga0068858_100131784 | Ga0068858_1001317842 | 212 |
| 444 | 3300005842 | Ga0068858_100384887 | Ga0068858_1003848872 | 212 |
| 445 | 3300005843 | Ga0068860_100016852 | Ga0068860_1000168523 | 212 |
| 446 | 3300005843 | Ga0068860_100203208 | Ga0068860_1002032081 | 212 |
| 447 | 3300005844 | Ga0068862_100024723 | Ga0068862_1000247233 | 212 |
| 448 | 3300006163 | Ga0070715_10000007 | Ga0070715_10000007164 | 212 |
| 449 | 3300006237 | Ga0097621_100005158 | Ga0097621_1000051587 | 212 |
| 450 | 3300006358 | Ga0068871_100041044 | Ga0068871_1000410443 | 212 |
| 451 | 3300006852 | Ga0075433_10688538 | Ga0075433_106885381 | 212 |
| 452 | 3300006871 | Ga0075434_100002749 | Ga0075434_10000274915 | 212 |
| 453 | 3300006931 | Ga0097620_100011491 | Ga0097620_1000114918 | 212 |
| 454 | 3300006931 | Ga0097620_100210697 | Ga0097620_1002106972 | 212 |
| 455 | 3300009094 | Ga0111539_10084943 | Ga0111539_100849435 | 212 |
| 456 | 3300009147 | Ga0114129_10164080 | Ga0114129_101640803 | 212 |
| 457 | 3300009148 | Ga0105243_10008351 | Ga0105243_100083513 | 212 |
| 458 | 3300009176 | Ga0105242_10009899 | Ga0105242_100098996 | 212 |
| 459 | 3300009553 | Ga0105249_10083701 | Ga0105249_100837012 | 212 |
| 460 | 3300011119 | Ga0105246_10085229 | Ga0105246_100852294 | 212 |
| 461 | 3300013297 | Ga0157378_10036978 | Ga0157378_100369782 | 212 |
| 462 | 3300013297 | Ga0157378_10085236 | Ga0157378_100852362 | 212 |
| 463 | 3300013306 | Ga0163162_10023609 | Ga0163162_100236096 | 212 |
| 464 | 3300013306 | Ga0163162_10175419 | Ga0163162_101754192 | 212 |
| 465 | 3300013308 | Ga0157375_10011832 | Ga0157375_100118322 | 212 |
| 466 | 3300013308 | Ga0157375_10633416 | Ga0157375_106334161 | 212 |
| 467 | 3300014325 | Ga0163163_10129938 | Ga0163163_101299382 | 212 |
| 468 | 3300014969 | Ga0157376_10283737 | Ga0157376_102837372 | 212 |
| 469 | 3300025315 | Ga0207697_10097516 | Ga0207697_100975162 | 212 |
| 470 | 3300025905 | Ga0207685_10000007 | Ga0207685_10000007102 | 212 |
| 471 | 3300025907 | Ga0207645_10424413 | Ga0207645_104244131 | 212 |
| 472 | 3300025910 | Ga0207684_10036975 | Ga0207684_100369751 | 212 |
| 473 | 3300025917 | Ga0207660_10005726 | Ga0207660_100057265 | 212 |
| 474 | 3300025918 | Ga0207662_10006504 | Ga0207662_100065042 | 212 |
| 475 | 3300025923 | Ga0207681_10197409 | Ga0207681_101974091 | 212 |
| 476 | 3300025926 | Ga0207659_10052425 | Ga0207659_100524253 | 212 |
| 477 | 3300025926 | Ga0207659_10118786 | Ga0207659_101187863 | 212 |
| 478 | 3300025931 | Ga0207644_10523846 | Ga0207644_105238461 | 212 |
| 479 | 3300025933 | Ga0207706_10042013 | Ga0207706_100420132 | 212 |
| 480 | 3300025935 | Ga0207709_10079109 | Ga0207709_100791092 | 212 |
| 481 | 3300025936 | Ga0207670_10287819 | Ga0207670_102878192 | 212 |
| 482 | 3300025940 | Ga0207691_10005460 | Ga0207691_100054604 | 212 |
| 483 | 3300025940 | Ga0207691_10173301 | Ga0207691_101733011 | 212 |
| 484 | 3300025942 | Ga0207689_10003363 | Ga0207689_100033636 | 212 |
| 485 | 3300025942 | Ga0207689_10125951 | Ga0207689_101259512 | 212 |
| 486 | 3300025960 | Ga0207651_10303602 | Ga0207651_103036022 | 212 |
| 487 | 3300025961 | Ga0207712_10015539 | Ga0207712_100155393 | 212 |
| 488 | 3300025961 | Ga0207712_10423829 | Ga0207712_104238292 | 212 |
| 489 | 3300025981 | Ga0207640_10030812 | Ga0207640_100308123 | 212 |
| 490 | 3300025986 | Ga0207658_10203170 | Ga0207658_102031701 | 212 |
| 491 | 3300026075 | Ga0207708_10035821 | Ga0207708_100358212 | 212 |
| 492 | 3300026088 | Ga0207641_10082951 | Ga0207641_100829512 | 212 |
| 493 | 3300026089 | Ga0207648_10170744 | Ga0207648_101707442 | 212 |
| 494 | 3300026116 | Ga0207674_10647181 | Ga0207674_106471812 | 212 |
| 495 | 3300026118 | Ga0207675_100004763 | Ga0207675_1000047632 | 212 |
| 496 | 3300026118 | Ga0207675_100759898 | Ga0207675_1007598982 | 212 |
| 497 | 3300026118 | Ga0207675_100827378 | Ga0207675_1008273782 | 212 |
| 498 | 3300027907 | Ga0207428_10310020 | Ga0207428_103100202 | 212 |
| 499 | 3300028380 | Ga0268265_10029798 | Ga0268265_100297983 | 212 |
| 500 | 3300028381 | Ga0268264_10121248 | Ga0268264_101212483 | 212 |
| 501 | 3300028381 | Ga0268264_10167421 | Ga0268264_101674213 | 212 |
| 502 | 3300049514 | Ga0501291_002900 | Ga0501291_002900_49_711 | 212 |
| 503 | 3300049669 | Ga0501235_023618 | Ga0501235_023618_641_1303 | 212 |
| 504 | 3300050507 | nmdc:mga05p37_196792_c1 | nmdc:mga05p37_196792_c1_646_1308 | 212 |
| 505 | 3300005290 | Ga0065712_10092482 | Ga0065712_100924823 | 213 |
| 506 | 3300005293 | Ga0065715_10127631 | Ga0065715_101276312 | 213 |
| 507 | 3300005293 | Ga0065715_10228143 | Ga0065715_102281431 | 213 |
| 508 | 3300005334 | Ga0068869_100158218 | Ga0068869_1001582183 | 213 |
| 509 | 3300005334 | Ga0068869_100755954 | Ga0068869_1007559541 | 213 |
| 510 | 3300005335 | Ga0070666_10113732 | Ga0070666_101137321 | 213 |
| 511 | 3300005338 | Ga0068868_100013647 | Ga0068868_1000136474 | 213 |
| 512 | 3300005345 | Ga0070692_10009492 | Ga0070692_100094922 | 213 |
| 513 | 3300005355 | Ga0070671_100075622 | Ga0070671_1000756223 | 213 |
| 514 | 3300005355 | Ga0070671_100933002 | Ga0070671_1009330021 | 213 |
| 515 | 3300005364 | Ga0070673_100364141 | Ga0070673_1003641412 | 213 |
| 516 | 3300005365 | Ga0070688_100211379 | Ga0070688_1002113792 | 213 |
| 517 | 3300005367 | Ga0070667_100326771 | Ga0070667_1003267712 | 213 |
| 518 | 3300005434 | Ga0070709_10000001 | Ga0070709_1000000178 | 213 |
| 519 | 3300005436 | Ga0070713_100916282 | Ga0070713_1009162821 | 213 |
| 520 | 3300005440 | Ga0070705_100347183 | Ga0070705_1003471832 | 213 |
| 521 | 3300005444 | Ga0070694_100026914 | Ga0070694_1000269142 | 213 |
| 522 | 3300005444 | Ga0070694_100512927 | Ga0070694_1005129271 | 213 |
| 523 | 3300005536 | Ga0070697_100000366 | Ga0070697_1000003668 | 213 |
| 524 | 3300005545 | Ga0070695_100237089 | Ga0070695_1002370892 | 213 |
| 525 | 3300005546 | Ga0070696_100058079 | Ga0070696_1000580794 | 213 |
| 526 | 3300005548 | Ga0070665_100089076 | Ga0070665_1000890762 | 213 |
| 527 | 3300005549 | Ga0070704_100051780 | Ga0070704_1000517802 | 213 |
| 528 | 3300005564 | Ga0070664_100031842 | Ga0070664_1000318422 | 213 |
| 529 | 3300005578 | Ga0068854_100182940 | Ga0068854_1001829402 | 213 |
| 530 | 3300005615 | Ga0070702_100130136 | Ga0070702_1001301361 | 213 |
| 531 | 3300005615 | Ga0070702_100170062 | Ga0070702_1001700622 | 213 |
| 532 | 3300005617 | Ga0068859_100021537 | Ga0068859_1000215374 | 213 |
| 533 | 3300005618 | Ga0068864_100010106 | Ga0068864_1000101063 | 213 |
| 534 | 3300005718 | Ga0068866_10281750 | Ga0068866_102817501 | 213 |
| 535 | 3300005842 | Ga0068858_100119330 | Ga0068858_1001193301 | 213 |
| 536 | 3300005843 | Ga0068860_100125189 | Ga0068860_1001251893 | 213 |
| 537 | 3300005843 | Ga0068860_100408272 | Ga0068860_1004082721 | 213 |
| 538 | 3300006358 | Ga0068871_100125202 | Ga0068871_1001252023 | 213 |
| 539 | 3300006871 | Ga0075434_100034409 | Ga0075434_1000344093 | 213 |
| 540 | 3300006931 | Ga0097620_100021538 | Ga0097620_1000215384 | 213 |
| 541 | 3300009093 | Ga0105240_10016665 | Ga0105240_100166654 | 213 |
| 542 | 3300009098 | Ga0105245_11335123 | Ga0105245_113351231 | 213 |
| 543 | 3300009174 | Ga0105241_10115658 | Ga0105241_101156582 | 213 |
| 544 | 3300009177 | Ga0105248_10001196 | Ga0105248_1000119625 | 213 |
| 545 | 3300009177 | Ga0105248_10221038 | Ga0105248_102210381 | 213 |
| 546 | 3300013297 | Ga0157378_10439189 | Ga0157378_104391891 | 213 |
| 547 | 3300013306 | Ga0163162_10003901 | Ga0163162_100039014 | 213 |
| 548 | 3300013306 | Ga0163162_10085806 | Ga0163162_100858062 | 213 |
| 549 | 3300013307 | Ga0157372_10042422 | Ga0157372_100424226 | 213 |
| 550 | 3300013308 | Ga0157375_10011770 | Ga0157375_100117705 | 213 |
| 551 | 3300013308 | Ga0157375_11664639 | Ga0157375_116646391 | 213 |
| 552 | 3300014325 | Ga0163163_10000527 | Ga0163163_100005271 | 213 |
| 553 | 3300014969 | Ga0157376_10016733 | Ga0157376_100167334 | 213 |
| 554 | 3300025899 | Ga0207642_10178745 | Ga0207642_101787452 | 213 |
| 555 | 3300025906 | Ga0207699_10000004 | Ga0207699_10000004312 | 213 |
| 556 | 3300025913 | Ga0207695_10092686 | Ga0207695_100926862 | 213 |
| 557 | 3300025931 | Ga0207644_10164450 | Ga0207644_101644502 | 213 |
| 558 | 3300025931 | Ga0207644_10679274 | Ga0207644_106792741 | 213 |
| 559 | 3300025935 | Ga0207709_10610492 | Ga0207709_106104921 | 213 |
| 560 | 3300025941 | Ga0207711_10055347 | Ga0207711_100553473 | 213 |
| 561 | 3300025941 | Ga0207711_10240662 | Ga0207711_102406622 | 213 |
| 562 | 3300025942 | Ga0207689_10035998 | Ga0207689_100359984 | 213 |
| 563 | 3300025949 | Ga0207667_10679281 | Ga0207667_106792812 | 213 |
| 564 | 3300025960 | Ga0207651_10781858 | Ga0207651_107818581 | 213 |
| 565 | 3300025981 | Ga0207640_10202586 | Ga0207640_102025862 | 213 |
| 566 | 3300026023 | Ga0207677_10006705 | Ga0207677_100067055 | 213 |
| 567 | 3300026035 | Ga0207703_10731152 | Ga0207703_107311521 | 213 |
| 568 | 3300026088 | Ga0207641_10068851 | Ga0207641_100688513 | 213 |
| 569 | 3300026095 | Ga0207676_10117652 | Ga0207676_101176524 | 213 |
| 570 | 3300028381 | Ga0268264_10121237 | Ga0268264_101212372 | 213 |
| 571 | 3300036401 | Ga0373937_0040474 | Ga0373937_0040474_745_1404 | 213 |
| 572 | 3300046539 | Ga0495621_0030213 | Ga0495621_0030213_269_931 | 213 |
| 573 | 3300050512 | nmdc:mga0n895_21252_c2 | nmdc:mga0n895_21252_c2_1726_2367 | 213 |
| 574 | 3300005289 | Ga0065704_10290960 | Ga0065704_102909601 | 214 |
| 575 | 3300005293 | Ga0065715_10462673 | Ga0065715_104626731 | 214 |
| 576 | 3300005295 | Ga0065707_10003030 | Ga0065707_100030303 | 214 |
| 577 | 3300005336 | Ga0070680_100001059 | Ga0070680_1000010599 | 214 |
| 578 | 3300005336 | Ga0070680_100541342 | Ga0070680_1005413422 | 214 |
| 579 | 3300005345 | Ga0070692_10307070 | Ga0070692_103070701 | 214 |
| 580 | 3300005355 | Ga0070671_100003695 | Ga0070671_1000036955 | 214 |
| 581 | 3300005364 | Ga0070673_100143911 | Ga0070673_1001439113 | 214 |
| 582 | 3300005364 | Ga0070673_100698096 | Ga0070673_1006980961 | 214 |
| 583 | 3300005438 | Ga0070701_10009397 | Ga0070701_100093975 | 214 |
| 584 | 3300005468 | Ga0070707_100000478 | Ga0070707_10000047835 | 214 |
| 585 | 3300005468 | Ga0070707_100805909 | Ga0070707_1008059091 | 214 |
| 586 | 3300005530 | Ga0070679_100000060 | Ga0070679_10000006033 | 214 |
| 587 | 3300005536 | Ga0070697_100057838 | Ga0070697_1000578383 | 214 |
| 588 | 3300005536 | Ga0070697_100225684 | Ga0070697_1002256842 | 214 |
| 589 | 3300005546 | Ga0070696_100499146 | Ga0070696_1004991461 | 214 |
| 590 | 3300005547 | Ga0070693_100564552 | Ga0070693_1005645521 | 214 |
| 591 | 3300005549 | Ga0070704_100226835 | Ga0070704_1002268352 | 214 |
| 592 | 3300005577 | Ga0068857_100690733 | Ga0068857_1006907331 | 214 |
| 593 | 3300005719 | Ga0068861_100107052 | Ga0068861_1001070524 | 214 |
| 594 | 3300005841 | Ga0068863_100424841 | Ga0068863_1004248411 | 214 |
| 595 | 3300005844 | Ga0068862_100110283 | Ga0068862_1001102833 | 214 |
| 596 | 3300006852 | Ga0075433_10011443 | Ga0075433_100114434 | 214 |
| 597 | 3300006852 | Ga0075433_10088923 | Ga0075433_100889232 | 214 |
| 598 | 3300006871 | Ga0075434_100237463 | Ga0075434_1002374633 | 214 |
| 599 | 3300006871 | Ga0075434_100327361 | Ga0075434_1003273612 | 214 |
| 600 | 3300007076 | Ga0075435_100106144 | Ga0075435_1001061443 | 214 |
| 601 | 3300007076 | Ga0075435_100811721 | Ga0075435_1008117211 | 214 |
| 602 | 3300009093 | Ga0105240_10210653 | Ga0105240_102106533 | 214 |
| 603 | 3300009094 | Ga0111539_10366872 | Ga0111539_103668721 | 214 |
| 604 | 3300009147 | Ga0114129_10004613 | Ga0114129_1000461314 | 214 |
| 605 | 3300009148 | Ga0105243_10028284 | Ga0105243_100282843 | 214 |
| 606 | 3300009176 | Ga0105242_10608291 | Ga0105242_106082912 | 214 |
| 607 | 3300009545 | Ga0105237_10043697 | Ga0105237_100436976 | 214 |
| 608 | 3300009553 | Ga0105249_10118014 | Ga0105249_101180141 | 214 |
| 609 | 3300010375 | Ga0105239_11344009 | Ga0105239_113440091 | 214 |
| 610 | 3300014326 | Ga0157380_10004467 | Ga0157380_100044679 | 214 |
| 611 | 3300025912 | Ga0207707_10000015 | Ga0207707_10000015152 | 214 |
| 612 | 3300025921 | Ga0207652_10000253 | Ga0207652_1000025324 | 214 |
| 613 | 3300025922 | Ga0207646_10000849 | Ga0207646_100008495 | 214 |
| 614 | 3300025925 | Ga0207650_10245638 | Ga0207650_102456381 | 214 |
| 615 | 3300025931 | Ga0207644_10010878 | Ga0207644_100108783 | 214 |
| 616 | 3300025935 | Ga0207709_10865240 | Ga0207709_108652401 | 214 |
| 617 | 3300025949 | Ga0207667_10667631 | Ga0207667_106676311 | 214 |
| 618 | 3300026088 | Ga0207641_10237778 | Ga0207641_102377783 | 214 |
| 619 | 3300026118 | Ga0207675_100232756 | Ga0207675_1002327562 | 214 |
| 620 | 3300028380 | Ga0268265_11048321 | Ga0268265_110483211 | 214 |
| 621 | 3300037418 | Ga0395900_0318659 | Ga0395900_0318659_148_831 | 214 |
| 622 | 3300038996 | Ga0242420_013404 | Ga0242420_013404_64_747 | 214 |
| 623 | 3300044673 | Ga0453683_0203128 | Ga0453683_0203128_414_1058 | 214 |
| 624 | 3300045051 | Ga0451576_0617124 | Ga0451576_0617124_410_1093 | 214 |
| 625 | 3300045051 | Ga0451576_1127066 | Ga0451576_1127066_123_767 | 214 |
| 626 | 3300048905 | Ga0496102_0019571 | Ga0496102_0019571_467_1150 | 214 |
| 627 | 3300048907 | Ga0496104_0091376 | Ga0496104_0091376_1616_2299 | 214 |
| 628 | 3300050507 | nmdc:mga05p37_133933_c1 | nmdc:mga05p37_133933_c1_125_799 | 214 |
| 629 | 3300050512 | nmdc:mga0n895_796064_c1 | nmdc:mga0n895_796064_c1_235_909 | 214 |
| 630 | 3300050513 | nmdc:mga0rr50_195073_c1 | nmdc:mga0rr50_195073_c1_186_869 | 214 |
| 631 | 3300050515 | nmdc:mga0a205_28779_c1 | nmdc:mga0a205_28779_c1_1682_2365 | 214 |
| 632 | 3300050515 | nmdc:mga0a205_67468_c1 | nmdc:mga0a205_67468_c1_151_825 | 214 |
| 633 | 2162886006 | SwRhRL3b_contig_3991568 | SwRhRL3b_0927.00001400 | 215 |
| 634 | 3300002074 | JGI24748J21848_1000007 | JGI24748J21848_100000785 | 215 |
| 635 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_1000000297 | 215 |
| 636 | 3300002244 | JGI24742J22300_10010201 | JGI24742J22300_100102013 | 215 |
| 637 | 3300003203 | JGI25406J46586_10003843 | JGI25406J46586_100038437 | 215 |
| 638 | 3300003203 | JGI25406J46586_10037658 | JGI25406J46586_100376581 | 215 |
| 639 | 3300005289 | Ga0065704_10145422 | Ga0065704_101454221 | 215 |
| 640 | 3300005293 | Ga0065715_10150012 | Ga0065715_101500122 | 215 |
| 641 | 3300005295 | Ga0065707_10087734 | Ga0065707_100877345 | 215 |
| 642 | 3300005295 | Ga0065707_10190143 | Ga0065707_101901432 | 215 |
| 643 | 3300005328 | Ga0070676_10454192 | Ga0070676_104541921 | 215 |
| 644 | 3300005330 | Ga0070690_100004266 | Ga0070690_1000042666 | 215 |
| 645 | 3300005330 | Ga0070690_100046047 | Ga0070690_1000460474 | 215 |
| 646 | 3300005330 | Ga0070690_100144975 | Ga0070690_1001449751 | 215 |
| 647 | 3300005334 | Ga0068869_100886103 | Ga0068869_1008861031 | 215 |
| 648 | 3300005338 | Ga0068868_100060106 | Ga0068868_1000601065 | 215 |
| 649 | 3300005355 | Ga0070671_100783723 | Ga0070671_1007837232 | 215 |
| 650 | 3300005364 | Ga0070673_100072566 | Ga0070673_1000725662 | 215 |
| 651 | 3300005365 | Ga0070688_100171011 | Ga0070688_1001710112 | 215 |
| 652 | 3300005406 | Ga0070703_10000313 | Ga0070703_1000031312 | 215 |
| 653 | 3300005438 | Ga0070701_10089825 | Ga0070701_100898252 | 215 |
| 654 | 3300005441 | Ga0070700_100008850 | Ga0070700_1000088505 | 215 |
| 655 | 3300005444 | Ga0070694_100009624 | Ga0070694_1000096247 | 215 |
| 656 | 3300005444 | Ga0070694_100644975 | Ga0070694_1006449751 | 215 |
| 657 | 3300005445 | Ga0070708_100046443 | Ga0070708_1000464433 | 215 |
| 658 | 3300005459 | Ga0068867_100089599 | Ga0068867_1000895992 | 215 |
| 659 | 3300005467 | Ga0070706_100843204 | Ga0070706_1008432041 | 215 |
| 660 | 3300005468 | Ga0070707_100821157 | Ga0070707_1008211571 | 215 |
| 661 | 3300005471 | Ga0070698_100010161 | Ga0070698_1000101616 | 215 |
| 662 | 3300005518 | Ga0070699_100869173 | Ga0070699_1008691731 | 215 |
| 663 | 3300005544 | Ga0070686_100010860 | Ga0070686_1000108602 | 215 |
| 664 | 3300005544 | Ga0070686_100399807 | Ga0070686_1003998071 | 215 |
| 665 | 3300005546 | Ga0070696_100020991 | Ga0070696_1000209915 | 215 |
| 666 | 3300005546 | Ga0070696_100186219 | Ga0070696_1001862192 | 215 |
| 667 | 3300005549 | Ga0070704_100003218 | Ga0070704_1000032186 | 215 |
| 668 | 3300005617 | Ga0068859_100004941 | Ga0068859_10000494111 | 215 |
| 669 | 3300005718 | Ga0068866_10089366 | Ga0068866_100893662 | 215 |
| 670 | 3300005718 | Ga0068866_10301701 | Ga0068866_103017011 | 215 |
| 671 | 3300005719 | Ga0068861_100088073 | Ga0068861_1000880731 | 215 |
| 672 | 3300005841 | Ga0068863_100069037 | Ga0068863_1000690373 | 215 |
| 673 | 3300005842 | Ga0068858_100000008 | Ga0068858_100000008218 | 215 |
| 674 | 3300005843 | Ga0068860_100212741 | Ga0068860_1002127412 | 215 |
| 675 | 3300005985 | Ga0081539_10000022 | Ga0081539_10000022264 | 215 |
| 676 | 3300005985 | Ga0081539_10000411 | Ga0081539_100004118 | 215 |
| 677 | 3300005985 | Ga0081539_10027307 | Ga0081539_100273073 | 215 |
| 678 | 3300006844 | Ga0075428_100112191 | Ga0075428_1001121911 | 215 |
| 679 | 3300006852 | Ga0075433_10092790 | Ga0075433_100927904 | 215 |
| 680 | 3300006852 | Ga0075433_10471782 | Ga0075433_104717823 | 215 |
| 681 | 3300006871 | Ga0075434_100071912 | Ga0075434_1000719123 | 215 |
| 682 | 3300006880 | Ga0075429_100110933 | Ga0075429_1001109332 | 215 |
| 683 | 3300006931 | Ga0097620_100004941 | Ga0097620_10000494111 | 215 |
| 684 | 3300007076 | Ga0075435_100865462 | Ga0075435_1008654621 | 215 |
| 685 | 3300009094 | Ga0111539_10012818 | Ga0111539_100128188 | 215 |
| 686 | 3300009098 | Ga0105245_10048819 | Ga0105245_100488195 | 215 |
| 687 | 3300009098 | Ga0105245_11356286 | Ga0105245_113562861 | 215 |
| 688 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001541 | 215 |
| 689 | 3300009147 | Ga0114129_10175898 | Ga0114129_101758983 | 215 |
| 690 | 3300009147 | Ga0114129_10292629 | Ga0114129_102926291 | 215 |
| 691 | 3300009148 | Ga0105243_10000119 | Ga0105243_1000011972 | 215 |
| 692 | 3300009148 | Ga0105243_10001926 | Ga0105243_1000192611 | 215 |
| 693 | 3300009148 | Ga0105243_10902175 | Ga0105243_109021752 | 215 |
| 694 | 3300009174 | Ga0105241_10808350 | Ga0105241_108083501 | 215 |
| 695 | 3300009176 | Ga0105242_10000113 | Ga0105242_100001135 | 215 |
| 696 | 3300009176 | Ga0105242_10000884 | Ga0105242_1000088411 | 215 |
| 697 | 3300009176 | Ga0105242_10001804 | Ga0105242_1000180417 | 215 |
| 698 | 3300009176 | Ga0105242_10163930 | Ga0105242_101639302 | 215 |
| 699 | 3300009177 | Ga0105248_10020782 | Ga0105248_100207823 | 215 |
| 700 | 3300009177 | Ga0105248_10111271 | Ga0105248_101112714 | 215 |
| 701 | 3300009177 | Ga0105248_10664954 | Ga0105248_106649541 | 215 |
| 702 | 3300009553 | Ga0105249_10856485 | Ga0105249_108564851 | 215 |
| 703 | 3300010375 | Ga0105239_10035696 | Ga0105239_100356965 | 215 |
| 704 | 3300013297 | Ga0157378_10000163 | Ga0157378_1000016363 | 215 |
| 705 | 3300013297 | Ga0157378_10059181 | Ga0157378_100591815 | 215 |
| 706 | 3300013297 | Ga0157378_10096153 | Ga0157378_100961532 | 215 |
| 707 | 3300013297 | Ga0157378_11039329 | Ga0157378_110393291 | 215 |
| 708 | 3300013306 | Ga0163162_10016787 | Ga0163162_100167873 | 215 |
| 709 | 3300013306 | Ga0163162_10074860 | Ga0163162_100748605 | 215 |
| 710 | 3300013306 | Ga0163162_10144081 | Ga0163162_101440813 | 215 |
| 711 | 3300013308 | Ga0157375_10002929 | Ga0157375_100029295 | 215 |
| 712 | 3300013308 | Ga0157375_11336633 | Ga0157375_113366332 | 215 |
| 713 | 3300014326 | Ga0157380_10000563 | Ga0157380_100005639 | 215 |
| 714 | 3300014326 | Ga0157380_10088360 | Ga0157380_100883602 | 215 |
| 715 | 3300014968 | Ga0157379_10070551 | Ga0157379_100705515 | 215 |
| 716 | 3300017792 | Ga0163161_10075052 | Ga0163161_100750523 | 215 |
| 717 | 3300017792 | Ga0163161_10186042 | Ga0163161_101860423 | 215 |
| 718 | 3300017792 | Ga0163161_10696039 | Ga0163161_106960391 | 215 |
| 719 | 3300021384 | Ga0213876_10000527 | Ga0213876_1000052713 | 215 |
| 720 | 3300021384 | Ga0213876_10022807 | Ga0213876_100228075 | 215 |
| 721 | 3300021384 | Ga0213876_10109877 | Ga0213876_101098772 | 215 |
| 722 | 3300025223 | Ga0207672_1000172 | Ga0207672_10001724 | 215 |
| 723 | 3300025885 | Ga0207653_10001006 | Ga0207653_100010067 | 215 |
| 724 | 3300025899 | Ga0207642_10212916 | Ga0207642_102129162 | 215 |
| 725 | 3300025899 | Ga0207642_10225441 | Ga0207642_102254411 | 215 |
| 726 | 3300025900 | Ga0207710_10000003 | Ga0207710_1000000394 | 215 |
| 727 | 3300025907 | Ga0207645_10401416 | Ga0207645_104014161 | 215 |
| 728 | 3300025908 | Ga0207643_10342936 | Ga0207643_103429362 | 215 |
| 729 | 3300025910 | Ga0207684_10606651 | Ga0207684_106066511 | 215 |
| 730 | 3300025916 | Ga0207663_10000074 | Ga0207663_100000746 | 215 |
| 731 | 3300025922 | Ga0207646_10235403 | Ga0207646_102354032 | 215 |
| 732 | 3300025922 | Ga0207646_10677627 | Ga0207646_106776271 | 215 |
| 733 | 3300025931 | Ga0207644_10000209 | Ga0207644_100002097 | 215 |
| 734 | 3300025934 | Ga0207686_10000130 | Ga0207686_1000013012 | 215 |
| 735 | 3300025934 | Ga0207686_10000477 | Ga0207686_1000047721 | 215 |
| 736 | 3300025934 | Ga0207686_10001804 | Ga0207686_1000180411 | 215 |
| 737 | 3300025935 | Ga0207709_10000162 | Ga0207709_1000016272 | 215 |
| 738 | 3300025935 | Ga0207709_10001299 | Ga0207709_1000129912 | 215 |
| 739 | 3300025936 | Ga0207670_10539771 | Ga0207670_105397712 | 215 |
| 740 | 3300025941 | Ga0207711_10685414 | Ga0207711_106854142 | 215 |
| 741 | 3300025941 | Ga0207711_10704719 | Ga0207711_107047192 | 215 |
| 742 | 3300025942 | Ga0207689_10172405 | Ga0207689_101724053 | 215 |
| 743 | 3300025960 | Ga0207651_10254881 | Ga0207651_102548812 | 215 |
| 744 | 3300026023 | Ga0207677_11003292 | Ga0207677_110032921 | 215 |
| 745 | 3300026035 | Ga0207703_10001853 | Ga0207703_100018531 | 215 |
| 746 | 3300026075 | Ga0207708_10010920 | Ga0207708_100109205 | 215 |
| 747 | 3300026088 | Ga0207641_10041526 | Ga0207641_100415263 | 215 |
| 748 | 3300026089 | Ga0207648_10112640 | Ga0207648_101126402 | 215 |
| 749 | 3300026095 | Ga0207676_10149603 | Ga0207676_101496032 | 215 |
| 750 | 3300026118 | Ga0207675_100001995 | Ga0207675_1000019955 | 215 |
| 751 | 3300027907 | Ga0207428_10007463 | Ga0207428_100074636 | 215 |
| 752 | 3300028380 | Ga0268265_10378484 | Ga0268265_103784842 | 215 |
| 753 | 3300028381 | Ga0268264_10308055 | Ga0268264_103080552 | 215 |
| 754 | 3300028381 | Ga0268264_10405023 | Ga0268264_104050231 | 215 |
| 755 | 3300037853 | Ga0436364_0591090 | Ga0436364_0591090_28_711 | 215 |
| 756 | 3300039437 | Ga0436365_0407503 | Ga0436365_0407503_127193_127861 | 215 |
| 757 | 3300039437 | Ga0436365_1230778 | Ga0436365_1230778_309_983 | 215 |
| 758 | 3300044673 | Ga0453683_0267229 | Ga0453683_0267229_401_1051 | 215 |
| 759 | 3300046537 | Ga0495598_0094833 | Ga0495598_0094833_285_932 | 215 |
| 760 | 3300050507 | nmdc:mga05p37_88893_c1 | nmdc:mga05p37_88893_c1_2213_2875 | 215 |
| 761 | 3300050508 | nmdc:mga09592_64775_c1 | nmdc:mga09592_64775_c1_114_761 | 215 |
| 762 | 3300050511 | nmdc:mga08y16_4740_c1 | nmdc:mga08y16_4740_c1_10730_11377 | 215 |
| 763 | 3300050512 | nmdc:mga0n895_90855_c1 | nmdc:mga0n895_90855_c1_641_1288 | 215 |
| 764 | 3300050513 | nmdc:mga0rr50_1046100_c1 | nmdc:mga0rr50_1046100_c1_10_657 | 215 |
| 765 | 3300050514 | nmdc:mga08x19_11_c1 | nmdc:mga08x19_11_c1_110877_111551 | 215 |
| 766 | 3300050515 | nmdc:mga0a205_132922_c1 | nmdc:mga0a205_132922_c1_357_1004 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8giw-assembly2.cif.gz_D | c143k variant of citrate synthase (cita) in mycobacterium tuberculosis | 0.3981 | 24 | 167 |
| 2v0x-assembly1.cif.gz_B | the dimerization domain of lap2alpha | 0.3406 | 51 | 178 |
| 3te0-assembly1.cif.gz_C | crystal structure of hsc k148e | 0.3317 | 7 | 166 |
| 3tdo-assembly1.cif.gz_C | crystal structure of hsc at ph 9.0 | 0.3301 | 7 | 167 |
| 3te1-assembly1.cif.gz_B | crystal structure of hsc t84a | 0.325 | 10 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN27_598_833_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.3913 | 22 | 81 | 3.30.460.10 |
| af_P38125_110_564_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3324 | 25 | 193 | 1.20.1250.20 |
| af_A0A0R0GKF0_3_238_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.3277 | 40 | 204 | 1.20.1080.10 |
| af_Q54FB0_36_153_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3266 | 44 | 172 | 1.20.1250.20 |
| af_Q57727_14_160_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.3193 | 26 | 165 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5WPZ3-F1-model_v4 | Alkaline phosphatase | 0.8949 | 2 | 202 |
GO:0005886
|
| AF-A0A698C407-F1-model_v4 | deleted | 0.8836 | 7 | 163 |
|
| AF-A0A538T7E9-F1-model_v4 | DedA family protein | 0.8698 | 1 | 202 |
GO:0005886
|
| AF-A0A698C407-F1-model_v4 | deleted | 0.8683 | 7 | 163 |
|
| AF-A0A1G2CE34-F1-model_v4 | VTT domain-containing protein | 0.8634 | 4 | 206 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar