F479876

General Info

Members Datasets Scaffolds Average Seq Length
766 250 766 214

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0083142|Ga0495619_0083142_1292_2029
Length 245
Sequence LTLGRRALVDSTGLQSERGPTTRELLRLIHSIENSLLDFISSVYDFISWPGVIFLMAIESACIPLPSELIMPLAGWMLIKEKGLGFEWVLLAALCGAIGNTLGSYISYQAGAIGGRPAVEKYGKYILISRHDLDLADRFFTRWGMIAVFFSRMLPIVRTFISLPAGISKMDLRPFILYTFAGSFIWSLALASAGYLLGQNWEDLRTWMRPADYPIAAILAVLLVWYVVRHIRRAWEEPQPSGPEA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
214 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
215 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
216 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
217 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
220 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
223 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
224 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
225 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
226 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
227 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
228 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
231 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
235 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
238 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
239 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
240 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3991568 2162886006 Bacteria 1185
2 SwRhRL2b_contig_634714 2162886007 Bacteria 3149
3 CNAas_1003399 3300000532 Bacteria 1057
4 JGI24748J21848_1000007 3300002074 Bacteria 208838
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24742J22300_10010201 3300002244 Bacteria 1553
7 JGI25406J46586_10003843 3300003203 Bacteria 7020
8 JGI25406J46586_10037658 3300003203 Bacteria 1741
9 Ga0065714_10064507 3300005288 Bacteria 46235
10 Ga0065704_10071515 3300005289 Bacteria 10836
11 Ga0065704_10145422 3300005289 Bacteria 1476
12 Ga0065704_10171333 3300005289 Bacteria 1289
13 Ga0065704_10290960 3300005289 Bacteria 903
14 Ga0065712_10000138 3300005290 Bacteria 62583
15 Ga0065712_10000296 3300005290 Bacteria 17305
16 Ga0065712_10080959 3300005290 Bacteria 3052
17 Ga0065712_10092482 3300005290 Bacteria 2330
18 Ga0065712_10095370 3300005290 Bacteria 2221
19 Ga0065712_10099129 3300005290 Bacteria 2099
20 Ga0065712_10125985 3300005290 Bacteria 1607
21 Ga0065712_10218737 3300005290 Bacteria 1022
22 Ga0065715_10004340 3300005293 Bacteria 8226
23 Ga0065715_10005901 3300005293 Bacteria 3618
24 Ga0065715_10033378 3300005293 Unclassified 1591
25 Ga0065715_10090469 3300005293 Bacteria 6953
26 Ga0065715_10127631 3300005293 Bacteria 2083
27 Ga0065715_10150012 3300005293 Bacteria 1740
28 Ga0065715_10174762 3300005293 Bacteria 1517
29 Ga0065715_10228143 3300005293 Bacteria 1244
30 Ga0065715_10462673 3300005293 Unclassified 765
31 Ga0065707_10003030 3300005295 Bacteria 4661
32 Ga0065707_10087245 3300005295 Bacteria 5100
33 Ga0065707_10087734 3300005295 Bacteria 4911
34 Ga0065707_10094864 3300005295 Bacteria 3443
35 Ga0065707_10190143 3300005295 Bacteria 1366
36 Ga0070676_10057386 3300005328 Viruses 2304
37 Ga0070676_10454192 3300005328 Bacteria 902
38 Ga0070683_100015643 3300005329 Bacteria 6669
39 Ga0070690_100004266 3300005330 Bacteria 7921
40 Ga0070690_100005770 3300005330 Bacteria 6977
41 Ga0070690_100046047 3300005330 Bacteria 2773
42 Ga0070690_100144975 3300005330 Bacteria 1615
43 Ga0070670_100009843 3300005331 Bacteria 8164
44 Ga0070670_100022889 3300005331 Bacteria 5376
45 Ga0070670_100092145 3300005331 Bacteria 2606
46 Ga0070670_100490155 3300005331 Bacteria 1092
47 Ga0068869_100083550 3300005334 Bacteria 2389
48 Ga0068869_100158218 3300005334 Bacteria 1762
49 Ga0068869_100531802 3300005334 Unclassified 985
50 Ga0068869_100629904 3300005334 Unclassified 909
51 Ga0068869_100755954 3300005334 Bacteria 833
52 Ga0068869_100886103 3300005334 Viruses 771
53 Ga0070666_10113732 3300005335 Unclassified 1873
54 Ga0070666_10116685 3300005335 Bacteria 1849
55 Ga0070680_100001059 3300005336 Bacteria 19716
56 Ga0070680_100021413 3300005336 Bacteria 5139
57 Ga0070680_100541342 3300005336 Bacteria 998
58 Ga0070682_100002890 3300005337 Bacteria 9532
59 Ga0070682_100003390 3300005337 Bacteria 8836
60 Ga0070682_100954886 3300005337 Unclassified 708
61 Ga0068868_100013647 3300005338 Bacteria 5966
62 Ga0068868_100060106 3300005338 Bacteria 3008
63 Ga0068868_100333046 3300005338 Bacteria 1296
64 Ga0070689_100009405 3300005340 Bacteria 6928
65 Ga0070689_100128741 3300005340 Bacteria 2028
66 Ga0070687_100016979 3300005343 Bacteria 3336
67 Ga0070687_100104329 3300005343 Bacteria 1593
68 Ga0070687_100124760 3300005343 Unclassified 1478
69 Ga0070687_100140416 3300005343 Bacteria 1406
70 Ga0070661_100005268 3300005344 Bacteria 8907
71 Ga0070692_10009492 3300005345 Unclassified 4390
72 Ga0070692_10029041 3300005345 Bacteria 2754
73 Ga0070692_10226131 3300005345 Bacteria 1108
74 Ga0070692_10237689 3300005345 Unclassified 1084
75 Ga0070692_10307070 3300005345 Bacteria 971
76 Ga0070669_100079505 3300005353 Bacteria 2439
77 Ga0070669_100119808 3300005353 Bacteria 2006
78 Ga0070669_100598924 3300005353 Bacteria 923
79 Ga0070675_100109993 3300005354 Bacteria 2330
80 Ga0070675_100140279 3300005354 Bacteria 2065
81 Ga0070675_100810960 3300005354 Bacteria 856
82 Ga0070671_100003695 3300005355 Bacteria 11999
83 Ga0070671_100044712 3300005355 Bacteria 3680
84 Ga0070671_100075622 3300005355 Bacteria 2813
85 Ga0070671_100783723 3300005355 Bacteria 829
86 Ga0070671_100933002 3300005355 Bacteria 759
87 Ga0070673_100072566 3300005364 Bacteria 2769
88 Ga0070673_100085054 3300005364 Bacteria 2574
89 Ga0070673_100121330 3300005364 Bacteria 2181
90 Ga0070673_100143911 3300005364 Unclassified 2014
91 Ga0070673_100364141 3300005364 Unclassified 1286
92 Ga0070673_100698096 3300005364 Bacteria 932
93 Ga0070688_100171011 3300005365 Bacteria 1500
94 Ga0070688_100211379 3300005365 Bacteria 1362
95 Ga0070688_100582036 3300005365 Unclassified 855
96 Ga0070659_100022165 3300005366 Unclassified 4846
97 Ga0070659_100183035 3300005366 Bacteria 1720
98 Ga0070667_100032807 3300005367 Bacteria 4333
99 Ga0070667_100326771 3300005367 Unclassified 1385
100 Ga0070703_10000313 3300005406 Bacteria 22089
101 Ga0070703_10014271 3300005406 Bacteria 2262
102 Ga0070709_10000001 3300005434 Bacteria 412391
103 Ga0070713_100916282 3300005436 Unclassified 843
104 Ga0070701_10009397 3300005438 Bacteria 4281
105 Ga0070701_10087404 3300005438 Bacteria 1701
106 Ga0070701_10089825 3300005438 Bacteria 1681
107 Ga0070705_100001180 3300005440 Bacteria 14263
108 Ga0070705_100057489 3300005440 Bacteria 2295
109 Ga0070705_100202322 3300005440 Bacteria 1362
110 Ga0070705_100231463 3300005440 Bacteria 1286
111 Ga0070705_100347183 3300005440 Bacteria 1081
112 Ga0070700_100000005 3300005441 Bacteria 233160
113 Ga0070700_100008850 3300005441 Bacteria 5502
114 Ga0070700_100037052 3300005441 Bacteria 2963
115 Ga0070700_100071533 3300005441 Bacteria 2215
116 Ga0070700_100178028 3300005441 Bacteria 1478
117 Ga0070694_100003400 3300005444 Bacteria 9536
118 Ga0070694_100009624 3300005444 Bacteria 5930
119 Ga0070694_100026914 3300005444 Bacteria 3731
120 Ga0070694_100039687 3300005444 Bacteria 3136
121 Ga0070694_100040560 3300005444 Bacteria 3103
122 Ga0070694_100063544 3300005444 Bacteria 2525
123 Ga0070694_100154487 3300005444 Bacteria 1679
124 Ga0070694_100512927 3300005444 Bacteria 956
125 Ga0070694_100644975 3300005444 Bacteria 857
126 Ga0070708_100046443 3300005445 Bacteria 3832
127 Ga0070708_100132733 3300005445 Bacteria 2305
128 Ga0070708_100275416 3300005445 Bacteria 1583
129 Ga0070678_100021052 3300005456 Bacteria 4292
130 Ga0070662_100067297 3300005457 Bacteria 2630
131 Ga0070681_10003413 3300005458 Bacteria 14879
132 Ga0070681_10003933 3300005458 Bacteria 14010
133 Ga0070681_10083531 3300005458 Bacteria 3147
134 Ga0068867_100017771 3300005459 Bacteria 5049
135 Ga0068867_100089599 3300005459 Bacteria 2333
136 Ga0068867_100170264 3300005459 Bacteria 1724
137 Ga0068867_101007696 3300005459 Unclassified 755
138 Ga0070685_10045527 3300005466 Bacteria 2517
139 Ga0070706_100000085 3300005467 Bacteria 108868
140 Ga0070706_100006573 3300005467 Bacteria 10967
141 Ga0070706_100564830 3300005467 Unclassified 1058
142 Ga0070706_100568032 3300005467 Bacteria 1055
143 Ga0070706_100843204 3300005467 Bacteria 848
144 Ga0070707_100000478 3300005468 Bacteria 39602
145 Ga0070707_100084614 3300005468 Bacteria 3065
146 Ga0070707_100805909 3300005468 Bacteria 903
147 Ga0070707_100821157 3300005468 Bacteria 894
148 Ga0070698_100010161 3300005471 Bacteria 10055
149 Ga0070698_100264567 3300005471 Bacteria 1652
150 Ga0070699_100579135 3300005518 Bacteria 1023
151 Ga0070699_100783894 3300005518 Bacteria 872
152 Ga0070699_100869173 3300005518 Bacteria 826
153 Ga0070679_100000060 3300005530 Bacteria 81237
154 Ga0070679_100053076 3300005530 Unclassified 4035
155 Ga0070684_100423357 3300005535 Unclassified 1229
156 Ga0070697_100000366 3300005536 Bacteria 35335
157 Ga0070697_100057838 3300005536 Bacteria 3154
158 Ga0070697_100225684 3300005536 Unclassified 1597
159 Ga0070697_100303033 3300005536 Unclassified 1374
160 Ga0068853_100015348 3300005539 Bacteria 6295
161 Ga0070672_100121466 3300005543 Bacteria 2138
162 Ga0070672_100154798 3300005543 Bacteria 1898
163 Ga0070686_100009728 3300005544 Bacteria 5402
164 Ga0070686_100010860 3300005544 Bacteria 5152
165 Ga0070686_100046212 3300005544 Bacteria 2746
166 Ga0070686_100071842 3300005544 Unclassified 2267
167 Ga0070686_100399807 3300005544 Bacteria 1044
168 Ga0070695_100045162 3300005545 Bacteria 2807
169 Ga0070695_100237089 3300005545 Bacteria 1322
170 Ga0070695_100504357 3300005545 Bacteria 936
171 Ga0070696_100020991 3300005546 Bacteria 4427
172 Ga0070696_100022307 3300005546 Bacteria 4300
173 Ga0070696_100046031 3300005546 Bacteria 3024
174 Ga0070696_100058079 3300005546 Bacteria 2702
175 Ga0070696_100186219 3300005546 Bacteria 1543
176 Ga0070696_100194935 3300005546 Bacteria 1509
177 Ga0070696_100244863 3300005546 Bacteria 1354
178 Ga0070696_100385191 3300005546 Bacteria 1094
179 Ga0070696_100499146 3300005546 Bacteria 968
180 Ga0070696_100646653 3300005546 Bacteria 857
181 Ga0070693_100005900 3300005547 Bacteria 5921
182 Ga0070693_100010936 3300005547 Bacteria 4559
183 Ga0070693_100174303 3300005547 Bacteria 1380
184 Ga0070693_100564552 3300005547 Unclassified 817
185 Ga0070665_100089076 3300005548 Bacteria 3092
186 Ga0070704_100003218 3300005549 Bacteria 9339
187 Ga0070704_100010265 3300005549 Bacteria 5694
188 Ga0070704_100051780 3300005549 Bacteria 2893
189 Ga0070704_100226835 3300005549 Bacteria 1522
190 Ga0070704_100651713 3300005549 Bacteria 930
191 Ga0070664_100001504 3300005564 Bacteria 18579
192 Ga0070664_100031842 3300005564 Bacteria 4409
193 Ga0068857_100001572 3300005577 Bacteria 18294
194 Ga0068857_100271103 3300005577 Bacteria 1560
195 Ga0068857_100541610 3300005577 Bacteria 1096
196 Ga0068857_100690733 3300005577 Bacteria 969
197 Ga0068854_100143266 3300005578 Bacteria 1836
198 Ga0068854_100182940 3300005578 Unclassified 1638
199 Ga0070702_100001575 3300005615 Bacteria 9405
200 Ga0070702_100043929 3300005615 Bacteria 2520
201 Ga0070702_100130136 3300005615 Bacteria 1588
202 Ga0070702_100170062 3300005615 Unclassified 1417
203 Ga0070702_100352676 3300005615 Bacteria 1037
204 Ga0070702_100483417 3300005615 Bacteria 906
205 Ga0068852_100074178 3300005616 Unclassified 2995
206 Ga0068852_100269493 3300005616 Bacteria 1638
207 Ga0068859_100004941 3300005617 Bacteria 13544
208 Ga0068859_100011491 3300005617 Bacteria 8901
209 Ga0068859_100021537 3300005617 Bacteria 6470
210 Ga0068859_100027393 3300005617 Bacteria 5716
211 Ga0068859_100048141 3300005617 Bacteria 4283
212 Ga0068859_100059825 3300005617 Bacteria 3839
213 Ga0068859_100115041 3300005617 Bacteria 2754
214 Ga0068859_100140999 3300005617 Bacteria 2484
215 Ga0068859_100152609 3300005617 Bacteria 2386
216 Ga0068859_100175496 3300005617 Bacteria 2225
217 Ga0068859_100205474 3300005617 Bacteria 2055
218 Ga0068859_100210714 3300005617 Bacteria 2029
219 Ga0068859_101501654 3300005617 Bacteria 744
220 Ga0068864_100010106 3300005618 Bacteria 7792
221 Ga0068864_100017822 3300005618 Bacteria 5923
222 Ga0068864_100023463 3300005618 Bacteria 5181
223 Ga0068864_100175271 3300005618 Bacteria 1957
224 Ga0068864_100368505 3300005618 Bacteria 1359
225 Ga0068864_100396693 3300005618 Bacteria 1310
226 Ga0068864_100540965 3300005618 Bacteria 1125
227 Ga0068864_100996972 3300005618 Bacteria 831
228 Ga0068866_10014995 3300005718 Bacteria 3435
229 Ga0068866_10031205 3300005718 Bacteria 2564
230 Ga0068866_10089366 3300005718 Bacteria 1674
231 Ga0068866_10281750 3300005718 Unclassified 1030
232 Ga0068866_10301701 3300005718 Bacteria 1001
233 Ga0068861_100070334 3300005719 Bacteria 2709
234 Ga0068861_100088073 3300005719 Bacteria 2444
235 Ga0068861_100107052 3300005719 Bacteria 2235
236 Ga0068861_100192740 3300005719 Bacteria 1705
237 Ga0068851_10002245 3300005834 Bacteria 8494
238 Ga0068870_10069572 3300005840 Bacteria 1915
239 Ga0068870_10123259 3300005840 Bacteria 1496
240 Ga0068870_10574044 3300005840 Bacteria 763
241 Ga0068863_100069037 3300005841 Bacteria 3342
242 Ga0068863_100074503 3300005841 Bacteria 3211
243 Ga0068863_100077484 3300005841 Bacteria 3146
244 Ga0068863_100133463 3300005841 Bacteria 2371
245 Ga0068863_100328038 3300005841 Bacteria 1488
246 Ga0068863_100424841 3300005841 Bacteria 1302
247 Ga0068863_100532748 3300005841 Bacteria 1159
248 Ga0068858_100000008 3300005842 Bacteria 238361
249 Ga0068858_100053043 3300005842 Bacteria 3752
250 Ga0068858_100119330 3300005842 Bacteria 2466
251 Ga0068858_100131784 3300005842 Bacteria 2344
252 Ga0068858_100174082 3300005842 Unclassified 2030
253 Ga0068858_100384887 3300005842 Bacteria 1346
254 Ga0068860_100016852 3300005843 Bacteria 7123
255 Ga0068860_100053151 3300005843 Unclassified 3852
256 Ga0068860_100119189 3300005843 Unclassified 2526
257 Ga0068860_100125189 3300005843 Unclassified 2463
258 Ga0068860_100203208 3300005843 Bacteria 1920
259 Ga0068860_100212741 3300005843 Bacteria 1876
260 Ga0068860_100408272 3300005843 Bacteria 1344
261 Ga0068862_100024723 3300005844 Bacteria 5040
262 Ga0068862_100110283 3300005844 Bacteria 2415
263 Ga0068862_100305831 3300005844 Bacteria 1464
264 Ga0081539_10000022 3300005985 Bacteria 356710
265 Ga0081539_10000411 3300005985 Bacteria 91279
266 Ga0081539_10000490 3300005985 Bacteria 83577
267 Ga0081539_10027307 3300005985 Bacteria 3618
268 Ga0075432_10165156 3300006058 Unclassified 858
269 Ga0070715_10000007 3300006163 Bacteria 192075
270 Ga0070716_100000007 3300006173 Bacteria 256300
271 Ga0097621_100003740 3300006237 Bacteria 10543
272 Ga0097621_100005158 3300006237 Bacteria 9178
273 Ga0068871_100041044 3300006358 Bacteria 3709
274 Ga0068871_100125202 3300006358 Bacteria 2175
275 Ga0075428_100112191 3300006844 Bacteria 2969
276 Ga0075430_100113481 3300006846 Bacteria 2258
277 Ga0075431_100010525 3300006847 Bacteria 9299
278 Ga0075431_100125780 3300006847 Unclassified 2645
279 Ga0075433_10011443 3300006852 Bacteria 7146
280 Ga0075433_10027242 3300006852 Bacteria 4845
281 Ga0075433_10030871 3300006852 Bacteria 4575
282 Ga0075433_10088923 3300006852 Bacteria 2730
283 Ga0075433_10092790 3300006852 Viruses 2671
284 Ga0075433_10115905 3300006852 Bacteria 2377
285 Ga0075433_10471782 3300006852 Bacteria 1106
286 Ga0075433_10688538 3300006852 Bacteria 896
287 Ga0075434_100002749 3300006871 Bacteria 15553
288 Ga0075434_100017831 3300006871 Bacteria 6848
289 Ga0075434_100034409 3300006871 Bacteria 5003
290 Ga0075434_100071912 3300006871 Bacteria 3451
291 Ga0075434_100237463 3300006871 Bacteria 1842
292 Ga0075434_100327361 3300006871 Bacteria 1553
293 Ga0075434_100836396 3300006871 Unclassified 936
294 Ga0075429_100110933 3300006880 Bacteria 2397
295 Ga0075429_100397165 3300006880 Bacteria 1207
296 Ga0068865_100244298 3300006881 Unclassified 1414
297 Ga0075436_100000008 3300006914 Bacteria 279288
298 Ga0075436_100001766 3300006914 Bacteria 14815
299 Ga0097620_100004941 3300006931 Bacteria 13544
300 Ga0097620_100011491 3300006931 Bacteria 8901
301 Ga0097620_100021538 3300006931 Bacteria 6470
302 Ga0097620_100027391 3300006931 Bacteria 5716
303 Ga0097620_100048144 3300006931 Bacteria 4283
304 Ga0097620_100059819 3300006931 Bacteria 3839
305 Ga0097620_100115030 3300006931 Bacteria 2754
306 Ga0097620_100141009 3300006931 Bacteria 2484
307 Ga0097620_100152605 3300006931 Bacteria 2386
308 Ga0097620_100175505 3300006931 Bacteria 2225
309 Ga0097620_100205472 3300006931 Bacteria 2055
310 Ga0097620_100210697 3300006931 Bacteria 2029
311 Ga0097620_101501728 3300006931 Bacteria 744
312 Ga0075435_100000244 3300007076 Bacteria 33626
313 Ga0075435_100006045 3300007076 Bacteria 8525
314 Ga0075435_100106144 3300007076 Bacteria 2332
315 Ga0075435_100811721 3300007076 Bacteria 815
316 Ga0075435_100865462 3300007076 Viruses 788
317 Ga0105240_10016665 3300009093 Bacteria 9940
318 Ga0105240_10210653 3300009093 Bacteria 2271
319 Ga0111539_10000363 3300009094 Bacteria 55793
320 Ga0111539_10007694 3300009094 Bacteria 13758
321 Ga0111539_10012818 3300009094 Bacteria 10492
322 Ga0111539_10084943 3300009094 Bacteria 3721
323 Ga0111539_10366872 3300009094 Bacteria 1676
324 Ga0111539_10813049 3300009094 Unclassified 1088
325 Ga0105245_10048819 3300009098 Bacteria 3787
326 Ga0105245_10623793 3300009098 Bacteria 1106
327 Ga0105245_11042266 3300009098 Bacteria 863
328 Ga0105245_11335123 3300009098 Bacteria 766
329 Ga0105245_11356286 3300009098 Bacteria 761
330 Ga0105247_10000001 3300009101 Bacteria 739726
331 Ga0105247_10008100 3300009101 Bacteria 6421
332 Ga0105247_10039422 3300009101 Bacteria 2886
333 Ga0105247_10043304 3300009101 Bacteria 2758
334 Ga0105247_10345435 3300009101 Bacteria 1045
335 Ga0114129_10004613 3300009147 Bacteria 19450
336 Ga0114129_10164080 3300009147 Bacteria 3033
337 Ga0114129_10164582 3300009147 Bacteria 3028
338 Ga0114129_10175898 3300009147 Bacteria 2915
339 Ga0114129_10235807 3300009147 Bacteria 2462
340 Ga0114129_10236812 3300009147 Bacteria 2455
341 Ga0114129_10292629 3300009147 Bacteria 2173
342 Ga0114129_10512829 3300009147 Bacteria 1564
343 Ga0114129_10612362 3300009147 Bacteria 1410
344 Ga0105243_10000119 3300009148 Bacteria 91258
345 Ga0105243_10001926 3300009148 Bacteria 17694
346 Ga0105243_10008351 3300009148 Bacteria 7950
347 Ga0105243_10008920 3300009148 Bacteria 7666
348 Ga0105243_10028284 3300009148 Bacteria 4303
349 Ga0105243_10068413 3300009148 Bacteria 2862
350 Ga0105243_10902175 3300009148 Bacteria 879
351 Ga0105241_10060700 3300009174 Unclassified 2909
352 Ga0105241_10070199 3300009174 Bacteria 2717
353 Ga0105241_10115658 3300009174 Bacteria 2153
354 Ga0105241_10190194 3300009174 Bacteria 1708
355 Ga0105241_10353606 3300009174 Bacteria 1276
356 Ga0105241_10808350 3300009174 Bacteria 864
357 Ga0105242_10000113 3300009176 Bacteria 58633
358 Ga0105242_10000884 3300009176 Bacteria 23248
359 Ga0105242_10001804 3300009176 Bacteria 16878
360 Ga0105242_10009899 3300009176 Bacteria 7302
361 Ga0105242_10113975 3300009176 Bacteria 2309
362 Ga0105242_10163930 3300009176 Bacteria 1948
363 Ga0105242_10168726 3300009176 Bacteria 1921
364 Ga0105242_10608291 3300009176 Bacteria 1057
365 Ga0105248_10001196 3300009177 Bacteria 28995
366 Ga0105248_10020782 3300009177 Bacteria 7273
367 Ga0105248_10026948 3300009177 Bacteria 6391
368 Ga0105248_10054579 3300009177 Unclassified 4481
369 Ga0105248_10111271 3300009177 Bacteria 3088
370 Ga0105248_10221038 3300009177 Bacteria 2132
371 Ga0105248_10246865 3300009177 Bacteria 2009
372 Ga0105248_10664954 3300009177 Bacteria 1175
373 Ga0105248_10867368 3300009177 Bacteria 1019
374 Ga0105237_10000527 3300009545 Bacteria 53805
375 Ga0105237_10043697 3300009545 Bacteria 4513
376 Ga0105238_10001996 3300009551 Bacteria 20559
377 Ga0105249_10001430 3300009553 Bacteria 20929
378 Ga0105249_10083701 3300009553 Bacteria 2970
379 Ga0105249_10118014 3300009553 Bacteria 2517
380 Ga0105249_10152210 3300009553 Bacteria 2228
381 Ga0105249_10174470 3300009553 Bacteria 2087
382 Ga0105249_10856485 3300009553 Bacteria 974
383 Ga0105249_11098359 3300009553 Bacteria 865
384 Ga0099796_10112636 3300010159 Bacteria 1037
385 Ga0105239_10035696 3300010375 Bacteria 5458
386 Ga0105239_10095819 3300010375 Bacteria 3278
387 Ga0105239_10382904 3300010375 Bacteria 1590
388 Ga0105239_11344009 3300010375 Unclassified 825
389 Ga0105246_10085229 3300011119 Bacteria 2262
390 Ga0105246_11072975 3300011119 Bacteria 734
391 Ga0105246_11289814 3300011119 Unclassified 676
392 Ga0157373_10002322 3300013100 Bacteria 14422
393 Ga0157373_10112898 3300013100 Bacteria 1910
394 Ga0157373_10254302 3300013100 Bacteria 1243
395 Ga0157371_10606219 3300013102 Unclassified 815
396 Ga0157378_10000163 3300013297 Bacteria 63786
397 Ga0157378_10036978 3300013297 Bacteria 4322
398 Ga0157378_10059181 3300013297 Bacteria 3418
399 Ga0157378_10064497 3300013297 Bacteria 3277
400 Ga0157378_10085236 3300013297 Bacteria 2862
401 Ga0157378_10096153 3300013297 Bacteria 2699
402 Ga0157378_10148736 3300013297 Bacteria 2181
403 Ga0157378_10439189 3300013297 Bacteria 1293
404 Ga0157378_11008068 3300013297 Unclassified 867
405 Ga0157378_11039329 3300013297 Bacteria 855
406 Ga0163162_10000027 3300013306 Bacteria 178451
407 Ga0163162_10003480 3300013306 Bacteria 15046
408 Ga0163162_10003901 3300013306 Bacteria 14319
409 Ga0163162_10016787 3300013306 Bacteria 7158
410 Ga0163162_10023609 3300013306 Bacteria 6072
411 Ga0163162_10074860 3300013306 Bacteria 3445
412 Ga0163162_10085806 3300013306 Bacteria 3226
413 Ga0163162_10144081 3300013306 Bacteria 2497
414 Ga0163162_10155774 3300013306 Bacteria 2404
415 Ga0163162_10158553 3300013306 Bacteria 2384
416 Ga0163162_10175419 3300013306 Bacteria 2269
417 Ga0163162_10207754 3300013306 Bacteria 2087
418 Ga0157372_10042422 3300013307 Bacteria 5032
419 Ga0157372_10898692 3300013307 Bacteria 1028
420 Ga0157375_10002929 3300013308 Bacteria 14806
421 Ga0157375_10003116 3300013308 Bacteria 14397
422 Ga0157375_10011770 3300013308 Bacteria 7736
423 Ga0157375_10011832 3300013308 Bacteria 7715
424 Ga0157375_10281022 3300013308 Bacteria 1828
425 Ga0157375_10425810 3300013308 Bacteria 1493
426 Ga0157375_10633416 3300013308 Bacteria 1226
427 Ga0157375_10718795 3300013308 Bacteria 1152
428 Ga0157375_11336633 3300013308 Bacteria 843
429 Ga0157375_11664639 3300013308 Bacteria 755
430 Ga0163163_10000109 3300014325 Bacteria 87294
431 Ga0163163_10000527 3300014325 Bacteria 34143
432 Ga0163163_10001737 3300014325 Bacteria 18359
433 Ga0163163_10103857 3300014325 Unclassified 2866
434 Ga0163163_10129938 3300014325 Unclassified 2559
435 Ga0157380_10000563 3300014326 Bacteria 22799
436 Ga0157380_10004467 3300014326 Bacteria 9690
437 Ga0157380_10088360 3300014326 Unclassified 2550
438 Ga0157380_10228784 3300014326 Bacteria 1669
439 Ga0157380_10653389 3300014326 Bacteria 1049
440 Ga0157377_10021040 3300014745 Unclassified 3426
441 Ga0157379_10070551 3300014968 Bacteria 3126
442 Ga0157379_10166679 3300014968 Bacteria 1988
443 Ga0157379_10448087 3300014968 Bacteria 1191
444 Ga0157379_10628090 3300014968 Bacteria 1004
445 Ga0157376_10016733 3300014969 Bacteria 5576
446 Ga0157376_10283737 3300014969 Bacteria 1560
447 Ga0163161_10055814 3300017792 Bacteria 2868
448 Ga0163161_10075052 3300017792 Bacteria 2481
449 Ga0163161_10186042 3300017792 Bacteria 1594
450 Ga0163161_10405371 3300017792 Bacteria 1094
451 Ga0163161_10696039 3300017792 Unclassified 846
452 Ga0213876_10000527 3300021384 Bacteria 29161
453 Ga0213876_10022807 3300021384 Bacteria 3307
454 Ga0213876_10109877 3300021384 Bacteria 1463
455 Ga0207672_1000172 3300025223 Bacteria 8920
456 Ga0207697_10097516 3300025315 Unclassified 1251
457 Ga0207656_10007353 3300025321 Bacteria 4005
458 Ga0207653_10001006 3300025885 Bacteria 9292
459 Ga0207653_10008043 3300025885 Bacteria 3287
460 Ga0207642_10003705 3300025899 Bacteria 4859
461 Ga0207642_10178745 3300025899 Unclassified 1154
462 Ga0207642_10212916 3300025899 Bacteria 1075
463 Ga0207642_10225441 3300025899 Bacteria 1050
464 Ga0207710_10000003 3300025900 Bacteria 1071597
465 Ga0207710_10000832 3300025900 Bacteria 16664
466 Ga0207680_10559918 3300025903 Bacteria 816
467 Ga0207647_10017531 3300025904 Bacteria 4866
468 Ga0207647_10176023 3300025904 Bacteria 1245
469 Ga0207647_10373602 3300025904 Unclassified 805
470 Ga0207685_10000007 3300025905 Bacteria 278341
471 Ga0207699_10000004 3300025906 Bacteria 567333
472 Ga0207699_10433244 3300025906 Unclassified 941
473 Ga0207645_10401416 3300025907 Viruses 922
474 Ga0207645_10424413 3300025907 Viruses 896
475 Ga0207643_10004012 3300025908 Bacteria 7920
476 Ga0207643_10115455 3300025908 Bacteria 1585
477 Ga0207643_10122668 3300025908 Bacteria 1540
478 Ga0207643_10154827 3300025908 Bacteria 1376
479 Ga0207643_10342936 3300025908 Bacteria 937
480 Ga0207643_10450175 3300025908 Unclassified 819
481 Ga0207684_10000091 3300025910 Bacteria 170468
482 Ga0207684_10036975 3300025910 Bacteria 4144
483 Ga0207684_10606651 3300025910 Unclassified 935
484 Ga0207654_10075558 3300025911 Bacteria 2014
485 Ga0207654_10083469 3300025911 Unclassified 1929
486 Ga0207707_10000015 3300025912 Bacteria 259670
487 Ga0207707_10019734 3300025912 Bacteria 5884
488 Ga0207707_10084084 3300025912 Bacteria 2779
489 Ga0207707_10264975 3300025912 Bacteria 1490
490 Ga0207695_10092686 3300025913 Bacteria 3031
491 Ga0207671_10003690 3300025914 Bacteria 15096
492 Ga0207663_10000074 3300025916 Bacteria 47918
493 Ga0207660_10005726 3300025917 Bacteria 8063
494 Ga0207660_10006252 3300025917 Bacteria 7731
495 Ga0207660_10412158 3300025917 Bacteria 1089
496 Ga0207662_10004270 3300025918 Bacteria 7501
497 Ga0207662_10006504 3300025918 Bacteria 6313
498 Ga0207662_10293377 3300025918 Bacteria 1079
499 Ga0207657_10120733 3300025919 Unclassified 2156
500 Ga0207652_10000253 3300025921 Bacteria 55673
501 Ga0207646_10000849 3300025922 Bacteria 39555
502 Ga0207646_10062586 3300025922 Bacteria 3322
503 Ga0207646_10196560 3300025922 Bacteria 1821
504 Ga0207646_10235403 3300025922 Bacteria 1655
505 Ga0207646_10677627 3300025922 Bacteria 923
506 Ga0207681_10197409 3300025923 Unclassified 1543
507 Ga0207681_10544705 3300025923 Bacteria 954
508 Ga0207681_10891112 3300025923 Unclassified 745
509 Ga0207694_10010396 3300025924 Bacteria 7016
510 Ga0207650_10000009 3300025925 Bacteria 483583
511 Ga0207650_10044178 3300025925 Bacteria 3273
512 Ga0207650_10225580 3300025925 Bacteria 1509
513 Ga0207650_10245638 3300025925 Bacteria 1447
514 Ga0207659_10052425 3300025926 Bacteria 2906
515 Ga0207659_10118786 3300025926 Bacteria 2023
516 Ga0207687_10393785 3300025927 Bacteria 1138
517 Ga0207644_10000209 3300025931 Bacteria 40524
518 Ga0207644_10010878 3300025931 Bacteria 6008
519 Ga0207644_10164450 3300025931 Bacteria 1727
520 Ga0207644_10523846 3300025931 Unclassified 979
521 Ga0207644_10679274 3300025931 Bacteria 858
522 Ga0207690_10338378 3300025932 Bacteria 1187
523 Ga0207706_10042013 3300025933 Bacteria 4051
524 Ga0207686_10000130 3300025934 Bacteria 60144
525 Ga0207686_10000477 3300025934 Bacteria 26408
526 Ga0207686_10001804 3300025934 Bacteria 11895
527 Ga0207686_10121632 3300025934 Bacteria 1778
528 Ga0207686_10328878 3300025934 Bacteria 1144
529 Ga0207709_10000162 3300025935 Bacteria 91279
530 Ga0207709_10001299 3300025935 Bacteria 17795
531 Ga0207709_10004095 3300025935 Bacteria 8486
532 Ga0207709_10079109 3300025935 Viruses 2113
533 Ga0207709_10325828 3300025935 Bacteria 1151
534 Ga0207709_10504279 3300025935 Bacteria 945
535 Ga0207709_10508947 3300025935 Unclassified 941
536 Ga0207709_10610492 3300025935 Bacteria 865
537 Ga0207709_10865240 3300025935 Bacteria 733
538 Ga0207670_10001600 3300025936 Bacteria 11799
539 Ga0207670_10130963 3300025936 Unclassified 1838
540 Ga0207670_10287819 3300025936 Bacteria 1283
541 Ga0207670_10539771 3300025936 Bacteria 951
542 Ga0207665_10000018 3300025939 Bacteria 122653
543 Ga0207665_10078952 3300025939 Bacteria 2262
544 Ga0207691_10005460 3300025940 Bacteria 12275
545 Ga0207691_10173301 3300025940 Bacteria 1888
546 Ga0207691_10196613 3300025940 Unclassified 1756
547 Ga0207691_10208715 3300025940 Bacteria 1698
548 Ga0207711_10015475 3300025941 Bacteria 6331
549 Ga0207711_10055347 3300025941 Bacteria 3406
550 Ga0207711_10219791 3300025941 Bacteria 1737
551 Ga0207711_10240662 3300025941 Unclassified 1659
552 Ga0207711_10312474 3300025941 Bacteria 1451
553 Ga0207711_10459526 3300025941 Bacteria 1185
554 Ga0207711_10608331 3300025941 Bacteria 1020
555 Ga0207711_10685414 3300025941 Bacteria 956
556 Ga0207711_10704719 3300025941 Bacteria 942
557 Ga0207689_10003363 3300025942 Bacteria 14640
558 Ga0207689_10035998 3300025942 Unclassified 4109
559 Ga0207689_10125951 3300025942 Bacteria 2107
560 Ga0207689_10172405 3300025942 Unclassified 1784
561 Ga0207689_10501170 3300025942 Bacteria 1017
562 Ga0207661_10099802 3300025944 Bacteria 2436
563 Ga0207679_10063737 3300025945 Unclassified 2752
564 Ga0207667_10667631 3300025949 Bacteria 1044
565 Ga0207667_10679281 3300025949 Unclassified 1033
566 Ga0207651_10254881 3300025960 Bacteria 1437
567 Ga0207651_10303602 3300025960 Bacteria 1328
568 Ga0207651_10471323 3300025960 Bacteria 1081
569 Ga0207651_10781858 3300025960 Unclassified 845
570 Ga0207651_10878328 3300025960 Bacteria 798
571 Ga0207712_10000956 3300025961 Bacteria 20827
572 Ga0207712_10015539 3300025961 Bacteria 4914
573 Ga0207712_10037657 3300025961 Bacteria 3302
574 Ga0207712_10423829 3300025961 Bacteria 1123
575 Ga0207640_10030812 3300025981 Bacteria 3308
576 Ga0207640_10202586 3300025981 Bacteria 1505
577 Ga0207640_10548803 3300025981 Bacteria 970
578 Ga0207658_10203170 3300025986 Bacteria 1656
579 Ga0207677_10006705 3300026023 Bacteria 6326
580 Ga0207677_10274566 3300026023 Bacteria 1381
581 Ga0207677_11003292 3300026023 Unclassified 757
582 Ga0207703_10001853 3300026035 Bacteria 18797
583 Ga0207703_10101203 3300026035 Bacteria 2443
584 Ga0207703_10148468 3300026035 Unclassified 2042
585 Ga0207703_10493517 3300026035 Bacteria 1148
586 Ga0207703_10731152 3300026035 Unclassified 942
587 Ga0207703_11231684 3300026035 Bacteria 719
588 Ga0207639_10814825 3300026041 Unclassified 870
589 Ga0207708_10000017 3300026075 Bacteria 190414
590 Ga0207708_10010920 3300026075 Bacteria 6754
591 Ga0207708_10016202 3300026075 Bacteria 5600
592 Ga0207708_10032899 3300026075 Bacteria 3937
593 Ga0207708_10035821 3300026075 Bacteria 3776
594 Ga0207641_10041526 3300026088 Bacteria 3855
595 Ga0207641_10053459 3300026088 Bacteria 3424
596 Ga0207641_10068851 3300026088 Bacteria 3036
597 Ga0207641_10082951 3300026088 Bacteria 2786
598 Ga0207641_10131881 3300026088 Bacteria 2245
599 Ga0207641_10237778 3300026088 Unclassified 1696
600 Ga0207641_10598350 3300026088 Bacteria 1079
601 Ga0207641_10776928 3300026088 Bacteria 946
602 Ga0207641_11057324 3300026088 Bacteria 810
603 Ga0207648_10083630 3300026089 Bacteria 2783
604 Ga0207648_10112640 3300026089 Bacteria 2389
605 Ga0207648_10170744 3300026089 Bacteria 1922
606 Ga0207648_10280012 3300026089 Bacteria 1491
607 Ga0207648_11023462 3300026089 Unclassified 774
608 Ga0207676_10010544 3300026095 Bacteria 6584
609 Ga0207676_10045163 3300026095 Bacteria 3403
610 Ga0207676_10088803 3300026095 Unclassified 2531
611 Ga0207676_10117652 3300026095 Bacteria 2235
612 Ga0207676_10149603 3300026095 Bacteria 2009
613 Ga0207676_10265065 3300026095 Unclassified 1553
614 Ga0207676_10288476 3300026095 Bacteria 1493
615 Ga0207676_10312561 3300026095 Bacteria 1439
616 Ga0207674_10000036 3300026116 Bacteria 135434
617 Ga0207674_10079314 3300026116 Bacteria 3287
618 Ga0207674_10263490 3300026116 Bacteria 1671
619 Ga0207674_10321942 3300026116 Bacteria 1495
620 Ga0207674_10647181 3300026116 Bacteria 1021
621 Ga0207675_100001995 3300026118 Bacteria 20351
622 Ga0207675_100004763 3300026118 Bacteria 13073
623 Ga0207675_100159797 3300026118 Bacteria 2149
624 Ga0207675_100232756 3300026118 Bacteria 1778
625 Ga0207675_100305244 3300026118 Bacteria 1551
626 Ga0207675_100535509 3300026118 Unclassified 1169
627 Ga0207675_100759898 3300026118 Unclassified 981
628 Ga0207675_100827378 3300026118 Bacteria 940
629 Ga0207698_10118214 3300026142 Bacteria 2238
630 Ga0207428_10007463 3300027907 Bacteria 9967
631 Ga0207428_10008435 3300027907 Bacteria 9303
632 Ga0207428_10169838 3300027907 Bacteria 1652
633 Ga0207428_10310020 3300027907 Bacteria 1167
634 Ga0268265_10029798 3300028380 Bacteria 3924
635 Ga0268265_10378484 3300028380 Bacteria 1301
636 Ga0268265_10399626 3300028380 Bacteria 1270
637 Ga0268265_11048321 3300028380 Bacteria 807
638 Ga0268264_10121237 3300028381 Bacteria 2305
639 Ga0268264_10121248 3300028381 Bacteria 2304
640 Ga0268264_10167421 3300028381 Bacteria 1985
641 Ga0268264_10308055 3300028381 Bacteria 1493
642 Ga0268264_10405023 3300028381 Bacteria 1312
643 Ga0268264_10443495 3300028381 Bacteria 1256
644 Ga0307408_100001243 3300031548 Bacteria 19119
645 Ga0307405_10225698 3300031731 Bacteria 1377
646 Ga0307413_10256327 3300031824 Bacteria 1301
647 Ga0307413_10483864 3300031824 Bacteria 990
648 Ga0307410_10023943 3300031852 Bacteria 3807
649 Ga0307410_10090006 3300031852 Bacteria 2176
650 Ga0307406_10001021 3300031901 Bacteria 15570
651 Ga0307407_10125290 3300031903 Bacteria 1635
652 Ga0307412_10025475 3300031911 Bacteria 3665
653 Ga0307412_10470281 3300031911 Bacteria 1040
654 Ga0307409_100028349 3300031995 Bacteria 3988
655 Ga0307416_100079110 3300032002 Unclassified 2769
656 Ga0307416_100625002 3300032002 Bacteria 1159
657 Ga0307414_10000585 3300032004 Bacteria 18889
658 Ga0307415_100000479 3300032126 Bacteria 17301
659 Ga0307415_100216235 3300032126 Bacteria 1533
660 Ga0307415_100244837 3300032126 Bacteria 1453
661 Ga0373951_0002340 3300035091 Unclassified 4808
662 Ga0373941_0013172 3300035115 Bacteria 2180
663 Ga0373941_0068723 3300035115 Bacteria 1171
664 Ga0373942_0002199 3300035207 Bacteria 4798
665 Ga0373937_0040474 3300036401 Bacteria 4248
666 Ga0395900_0318659 3300037418 Unclassified 1536
667 Ga0395900_0662274 3300037418 Bacteria 980
668 Ga0395898_0030070 3300037466 Bacteria 5439
669 Ga0395898_0109812 3300037466 Bacteria 2644
670 Ga0395905_0006255 3300037471 Bacteria 12019
671 Ga0436364_0591090 3300037853 Bacteria 1686
672 Ga0242420_013404 3300038996 Unclassified 1397
673 Ga0436365_0407503 3300039437 Bacteria 219857
674 Ga0436365_1230778 3300039437 Bacteria 38145
675 Ga0436362_0300217 3300039453 Bacteria 1275
676 Ga0439458_0002105 3300042157 Bacteria 4938
677 Ga0453683_0203128 3300044673 Bacteria 1258
678 Ga0453683_0245113 3300044673 Bacteria 1141
679 Ga0453683_0267229 3300044673 Bacteria 1091
680 Ga0451576_0386104 3300045051 Bacteria 1468
681 Ga0451576_0617124 3300045051 Bacteria 1140
682 Ga0451576_1127066 3300045051 Bacteria 821
683 Ga0495664_0420561 3300046477 Bacteria 802
684 Ga0495598_0094833 3300046537 Unclassified 979
685 Ga0495621_0030213 3300046539 Bacteria 1851
686 Ga0495634_0459935 3300046642 Bacteria 750
687 Ga0496102_0019571 3300048905 Bacteria 5963
688 Ga0496103_0361850 3300048906 Bacteria 933
689 Ga0496104_0091376 3300048907 Bacteria 2910
690 Ga0496106_0163300 3300048909 Unclassified 1762
691 Ga0496106_0580730 3300048909 Unclassified 898
692 Ga0496108_0749442 3300048911 Unclassified 845
693 Ga0496112_0105263 3300048915 Bacteria 2791
694 Ga0496112_0148038 3300048915 Bacteria 2316
695 Ga0501291_002900 3300049514 Bacteria 2098
696 Ga0501291_020907 3300049514 Bacteria 1039
697 Ga0501291_021510 3300049514 Bacteria 1029
698 Ga0501292_011005 3300049515 Bacteria 1363
699 Ga0501292_011073 3300049515 Bacteria 1360
700 Ga0501296_001846 3300049519 Bacteria 2158
701 Ga0501297_010123 3300049520 Bacteria 1063
702 Ga0501298_005326 3300049521 Bacteria 2059
703 Ga0501298_058481 3300049521 Bacteria 812
704 Ga0501038_0007917 3300049574 Bacteria 9799
705 Ga0501038_0080645 3300049574 Bacteria 2743
706 Ga0501198_004796 3300049649 Unclassified 1888
707 Ga0501198_014886 3300049649 Bacteria 1189
708 Ga0501201_003184 3300049651 Bacteria 1505
709 Ga0501202_019476 3300049652 Bacteria 1341
710 Ga0501207_003365 3300049654 Unclassified 2127
711 Ga0501209_056644 3300049656 Unclassified 1083
712 Ga0501211_009763 3300049658 Bacteria 940
713 Ga0501216_000404 3300049660 Bacteria 5053
714 Ga0501217_000501 3300049661 Bacteria 6476
715 Ga0501217_001421 3300049661 Bacteria 4483
716 Ga0501223_010755 3300049663 Bacteria 1839
717 Ga0501224_001054 3300049664 Unclassified 3592
718 Ga0501235_008343 3300049669 Unclassified 2260
719 Ga0501235_023618 3300049669 Bacteria 1372
720 Ga0501240_004611 3300049673 Bacteria 1608
721 Ga0501243_026313 3300049675 Bacteria 979
722 Ga0501249_019273 3300049679 Bacteria 1481
723 Ga0501257_009411 3300049686 Bacteria 2207
724 Ga0501260_010629 3300049689 Bacteria 925
725 Ga0501221_065247 3300049704 Bacteria 849
726 Ga0501225_0000268 3300049705 Bacteria 16456
727 Ga0501225_0016691 3300049705 Bacteria 2041
728 Ga0501225_0049152 3300049705 Unclassified 1172
729 Ga0501234_000872 3300049707 Unclassified 4758
730 Ga0501283_006493 3300049779 Bacteria 1640
731 Ga0501283_021910 3300049779 Unclassified 1028
732 Ga0501212_005859 3300049851 Bacteria 1640
733 Ga0501212_009428 3300049851 Bacteria 1374
734 Ga0501226_009413 3300049853 Unclassified 1087
735 Ga0501226_014974 3300049853 Unclassified 856
736 nmdc:mga05p37_1254091_c1 3300050507 Bacteria 760
737 nmdc:mga05p37_133933_c1 3300050507 Unclassified 3040
738 nmdc:mga05p37_196792_c1 3300050507 Bacteria 2444
739 nmdc:mga05p37_384232_c1 3300050507 Bacteria 1644
740 nmdc:mga05p37_88893_c1 3300050507 Bacteria 3807
741 nmdc:mga05p37_899444_c1 3300050507 Bacteria 955
742 nmdc:mga09592_171358_c1 3300050508 Bacteria 1877
743 nmdc:mga09592_64775_c1 3300050508 Bacteria 3094
744 nmdc:mga0qj67_184920_c1 3300050509 Bacteria 1693
745 nmdc:mga0qj67_29879_c1 3300050509 Bacteria 4236
746 nmdc:mga06r32_216935_c1 3300050510 Unclassified 1901
747 nmdc:mga06r32_25661_c1 3300050510 Bacteria 5485
748 nmdc:mga06r32_46784_c1 3300050510 Unclassified 4129
749 nmdc:mga08y16_205093_c1 3300050511 Bacteria 2043
750 nmdc:mga08y16_34486_c1 3300050511 Bacteria 5316
751 nmdc:mga08y16_4740_c1 3300050511 Bacteria 14184
752 nmdc:mga0n895_21252_c2 3300050512 Bacteria 4930
753 nmdc:mga0n895_285969_c1 3300050512 Bacteria 1672
754 nmdc:mga0n895_354298_c1 3300050512 Unclassified 1486
755 nmdc:mga0n895_796064_c1 3300050512 Bacteria 936
756 nmdc:mga0n895_90855_c1 3300050512 Bacteria 3055
757 nmdc:mga0rr50_1046100_c1 3300050513 Unclassified 695
758 nmdc:mga0rr50_195073_c1 3300050513 Bacteria 1661
759 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
760 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
761 nmdc:mga08x19_8411_c1 3300050514 Bacteria 6149
762 nmdc:mga0a205_12578_c1 3300050515 Bacteria 7831
763 nmdc:mga0a205_132922_c1 3300050515 Bacteria 2388
764 nmdc:mga0a205_28779_c1 3300050515 Bacteria 5313
765 nmdc:mga0a205_67468_c1 3300050515 Unclassified 3456
766 Ga0495619_0083142 3300053085 Bacteria 2159

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049705 Ga0501225_0016691 Ga0501225_0016691_1371_1940 183
2 3300049779 Ga0501283_021910 Ga0501283_021910_17_595 184
3 3300049853 Ga0501226_014974 Ga0501226_014974_23_601 184
4 3300005337 Ga0070682_100954886 Ga0070682_1009548861 187
5 3300014326 Ga0157380_10653389 Ga0157380_106533892 187
6 3300025923 Ga0207681_10891112 Ga0207681_108911121 187
7 3300025934 Ga0207686_10121632 Ga0207686_101216322 188
8 3300025935 Ga0207709_10004095 Ga0207709_100040955 188
9 3300026089 Ga0207648_10083630 Ga0207648_100836301 188
10 3300005334 Ga0068869_100531802 Ga0068869_1005318022 190
11 3300005336 Ga0070680_100021413 Ga0070680_1000214134 190
12 3300005344 Ga0070661_100005268 Ga0070661_1000052684 190
13 3300005366 Ga0070659_100022165 Ga0070659_1000221654 190
14 3300005441 Ga0070700_100178028 Ga0070700_1001780282 190
15 3300005458 Ga0070681_10003413 Ga0070681_1000341312 190
16 3300005459 Ga0068867_101007696 Ga0068867_1010076961 190
17 3300005530 Ga0070679_100053076 Ga0070679_1000530762 190
18 3300005539 Ga0068853_100015348 Ga0068853_1000153485 190
19 3300005564 Ga0070664_100001504 Ga0070664_10000150418 190
20 3300005577 Ga0068857_100001572 Ga0068857_10000157212 190
21 3300005618 Ga0068864_100017822 Ga0068864_1000178224 190
22 3300013100 Ga0157373_10112898 Ga0157373_101128982 190
23 3300014325 Ga0163163_10001737 Ga0163163_1000173716 190
24 3300017792 Ga0163161_10055814 Ga0163161_100558141 190
25 3300025912 Ga0207707_10019734 Ga0207707_100197344 190
26 3300025917 Ga0207660_10006252 Ga0207660_100062526 190
27 3300025919 Ga0207657_10120733 Ga0207657_101207332 190
28 3300025945 Ga0207679_10063737 Ga0207679_100637372 190
29 3300026089 Ga0207648_11023462 Ga0207648_110234621 190
30 3300026095 Ga0207676_10088803 Ga0207676_100888032 190
31 3300026116 Ga0207674_10000036 Ga0207674_1000003667 190
32 3300005343 Ga0070687_100016979 Ga0070687_1000169793 191
33 3300005353 Ga0070669_100598924 Ga0070669_1005989241 191
34 3300013102 Ga0157371_10606219 Ga0157371_106062191 191
35 3300025918 Ga0207662_10004270 Ga0207662_100042703 191
36 3300025923 Ga0207681_10544705 Ga0207681_105447051 191
37 3300025935 Ga0207709_10508947 Ga0207709_105089471 191
38 3300049705 Ga0501225_0049152 Ga0501225_0049152_554_1159 193
39 3300005546 Ga0070696_100194935 Ga0070696_1001949353 194
40 3300005345 Ga0070692_10237689 Ga0070692_102376892 196
41 3300005544 Ga0070686_100046212 Ga0070686_1000462123 196
42 3300005545 Ga0070695_100504357 Ga0070695_1005043572 196
43 3300044673 Ga0453683_0245113 Ga0453683_0245113_331_987 196
44 3300005290 Ga0065712_10218737 Ga0065712_102187372 197
45 3300017792 Ga0163161_10405371 Ga0163161_104053711 197
46 3300013308 Ga0157375_10281022 Ga0157375_102810222 198
47 3300049519 Ga0501296_001846 Ga0501296_001846_1199_1873 200
48 3300049520 Ga0501297_010123 Ga0501297_010123_131_805 200
49 3300049649 Ga0501198_014886 Ga0501198_014886_373_1047 200
50 3300049851 Ga0501212_009428 Ga0501212_009428_611_1285 200
51 3300000532 CNAas_1003399 CNAas_10033992 201
52 3300005331 Ga0070670_100009843 Ga0070670_1000098439 201
53 3300005331 Ga0070670_100490155 Ga0070670_1004901552 201
54 3300005340 Ga0070689_100009405 Ga0070689_1000094056 201
55 3300005364 Ga0070673_100085054 Ga0070673_1000850541 201
56 3300005617 Ga0068859_100205474 Ga0068859_1002054742 201
57 3300005618 Ga0068864_100175271 Ga0068864_1001752713 201
58 3300005841 Ga0068863_100074503 Ga0068863_1000745035 201
59 3300006931 Ga0097620_100205472 Ga0097620_1002054723 201
60 3300014325 Ga0163163_10103857 Ga0163163_101038573 201
61 3300025908 Ga0207643_10004012 Ga0207643_100040128 201
62 3300025922 Ga0207646_10196560 Ga0207646_101965602 201
63 3300025925 Ga0207650_10225580 Ga0207650_102255802 201
64 3300025936 Ga0207670_10001600 Ga0207670_100016002 201
65 3300025940 Ga0207691_10196613 Ga0207691_101966133 201
66 3300026116 Ga0207674_10079314 Ga0207674_100793142 201
67 3300049574 Ga0501038_0080645 Ga0501038_0080645_908_1525 201
68 3300006914 Ga0075436_100001766 Ga0075436_10000176613 202
69 3300046477 Ga0495664_0420561 Ga0495664_0420561_14_622 202
70 3300046642 Ga0495634_0459935 Ga0495634_0459935_13_627 202
71 3300050514 nmdc:mga08x19_8411_c1 nmdc:mga08x19_8411_c1_1851_2459 202
72 3300005471 Ga0070698_100264567 Ga0070698_1002645672 203
73 3300009553 Ga0105249_10001430 Ga0105249_100014304 205
74 3300013306 Ga0163162_10000027 Ga0163162_10000027122 205
75 3300014326 Ga0157380_10228784 Ga0157380_102287842 205
76 3300025961 Ga0207712_10000956 Ga0207712_1000095617 205
77 3300005290 Ga0065712_10000296 Ga0065712_100002965 207
78 3300005467 Ga0070706_100568032 Ga0070706_1005680322 207
79 3300005468 Ga0070707_100084614 Ga0070707_1000846144 207
80 3300005518 Ga0070699_100579135 Ga0070699_1005791352 207
81 3300025922 Ga0207646_10062586 Ga0207646_100625864 207
82 3300005337 Ga0070682_100002890 Ga0070682_1000028909 208
83 3300005338 Ga0068868_100333046 Ga0068868_1003330462 208
84 3300005343 Ga0070687_100104329 Ga0070687_1001043291 208
85 3300005345 Ga0070692_10029041 Ga0070692_100290412 208
86 3300005406 Ga0070703_10014271 Ga0070703_100142712 208
87 3300005440 Ga0070705_100001180 Ga0070705_1000011805 208
88 3300005441 Ga0070700_100037052 Ga0070700_1000370523 208
89 3300005444 Ga0070694_100003400 Ga0070694_1000034003 208
90 3300005467 Ga0070706_100000085 Ga0070706_10000008562 208
91 3300005545 Ga0070695_100045162 Ga0070695_1000451624 208
92 3300005546 Ga0070696_100244863 Ga0070696_1002448632 208
93 3300005547 Ga0070693_100010936 Ga0070693_1000109364 208
94 3300005549 Ga0070704_100010265 Ga0070704_1000102653 208
95 3300005615 Ga0070702_100001575 Ga0070702_1000015755 208
96 3300005615 Ga0070702_100352676 Ga0070702_1003526762 208
97 3300005616 Ga0068852_100074178 Ga0068852_1000741783 208
98 3300005616 Ga0068852_100269493 Ga0068852_1002694932 208
99 3300005617 Ga0068859_100115041 Ga0068859_1001150412 208
100 3300005617 Ga0068859_101501654 Ga0068859_1015016541 208
101 3300005618 Ga0068864_100540965 Ga0068864_1005409651 208
102 3300005719 Ga0068861_100192740 Ga0068861_1001927402 208
103 3300005834 Ga0068851_10002245 Ga0068851_100022455 208
104 3300005841 Ga0068863_100328038 Ga0068863_1003280382 208
105 3300005842 Ga0068858_100053043 Ga0068858_1000530432 208
106 3300006931 Ga0097620_100115030 Ga0097620_1001150302 208
107 3300006931 Ga0097620_101501728 Ga0097620_1015017281 208
108 3300009101 Ga0105247_10043304 Ga0105247_100433043 208
109 3300009177 Ga0105248_10054579 Ga0105248_100545793 208
110 3300009545 Ga0105237_10000527 Ga0105237_1000052736 208
111 3300013306 Ga0163162_10207754 Ga0163162_102077542 208
112 3300014745 Ga0157377_10021040 Ga0157377_100210403 208
113 3300014968 Ga0157379_10166679 Ga0157379_101666792 208
114 3300014968 Ga0157379_10628090 Ga0157379_106280902 208
115 3300025321 Ga0207656_10007353 Ga0207656_100073532 208
116 3300025885 Ga0207653_10008043 Ga0207653_100080433 208
117 3300025910 Ga0207684_10000091 Ga0207684_1000009151 208
118 3300025914 Ga0207671_10003690 Ga0207671_100036907 208
119 3300025918 Ga0207662_10293377 Ga0207662_102933771 208
120 3300025936 Ga0207670_10130963 Ga0207670_101309632 208
121 3300025941 Ga0207711_10312474 Ga0207711_103124742 208
122 3300026023 Ga0207677_10274566 Ga0207677_102745662 208
123 3300026035 Ga0207703_10148468 Ga0207703_101484682 208
124 3300026075 Ga0207708_10032899 Ga0207708_100328993 208
125 3300026088 Ga0207641_10131881 Ga0207641_101318813 208
126 3300026088 Ga0207641_10598350 Ga0207641_105983502 208
127 3300026118 Ga0207675_100159797 Ga0207675_1001597972 208
128 3300026142 Ga0207698_10118214 Ga0207698_101182143 208
129 3300028380 Ga0268265_10399626 Ga0268265_103996262 208
130 3300050507 nmdc:mga05p37_1254091_c1 nmdc:mga05p37_1254091_c1_116_742 208
131 3300005290 Ga0065712_10080959 Ga0065712_100809595 209
132 3300005331 Ga0070670_100022889 Ga0070670_1000228897 209
133 3300005547 Ga0070693_100174303 Ga0070693_1001743032 209
134 3300005549 Ga0070704_100651713 Ga0070704_1006517131 209
135 3300005577 Ga0068857_100271103 Ga0068857_1002711033 209
136 3300005615 Ga0070702_100483417 Ga0070702_1004834171 209
137 3300005843 Ga0068860_100053151 Ga0068860_1000531512 209
138 3300009094 Ga0111539_10007694 Ga0111539_1000769411 209
139 3300013306 Ga0163162_10003480 Ga0163162_100034808 209
140 3300013308 Ga0157375_10425810 Ga0157375_104258102 209
141 3300014325 Ga0163163_10000109 Ga0163163_1000010968 209
142 3300025903 Ga0207680_10559918 Ga0207680_105599181 209
143 3300025904 Ga0207647_10176023 Ga0207647_101760232 209
144 3300025925 Ga0207650_10000009 Ga0207650_1000000971 209
145 3300026095 Ga0207676_10045163 Ga0207676_100451633 209
146 3300026116 Ga0207674_10263490 Ga0207674_102634903 209
147 3300027907 Ga0207428_10169838 Ga0207428_101698382 209
148 3300037471 Ga0395905_0006255 Ga0395905_0006255_4962_5597 209
149 3300048909 Ga0496106_0580730 Ga0496106_0580730_20_649 209
150 3300049515 Ga0501292_011073 Ga0501292_011073_245_877 209
151 3300050511 nmdc:mga08y16_205093_c1 nmdc:mga08y16_205093_c1_628_1302 209
152 2162886007 SwRhRL2b_contig_634714 SwRhRL2b_0817.00004000 210
153 3300005289 Ga0065704_10071515 Ga0065704_100715158 210
154 3300005289 Ga0065704_10171333 Ga0065704_101713333 210
155 3300005290 Ga0065712_10095370 Ga0065712_100953701 210
156 3300005290 Ga0065712_10125985 Ga0065712_101259852 210
157 3300005293 Ga0065715_10004340 Ga0065715_100043407 210
158 3300005293 Ga0065715_10005901 Ga0065715_100059013 210
159 3300005293 Ga0065715_10174762 Ga0065715_101747623 210
160 3300005295 Ga0065707_10087245 Ga0065707_100872455 210
161 3300005295 Ga0065707_10094864 Ga0065707_100948642 210
162 3300005331 Ga0070670_100092145 Ga0070670_1000921453 210
163 3300005337 Ga0070682_100003390 Ga0070682_10000339011 210
164 3300005343 Ga0070687_100140416 Ga0070687_1001404163 210
165 3300005354 Ga0070675_100810960 Ga0070675_1008109601 210
166 3300005364 Ga0070673_100121330 Ga0070673_1001213303 210
167 3300005366 Ga0070659_100183035 Ga0070659_1001830352 210
168 3300005440 Ga0070705_100202322 Ga0070705_1002023222 210
169 3300005440 Ga0070705_100231463 Ga0070705_1002314632 210
170 3300005441 Ga0070700_100000005 Ga0070700_10000000568 210
171 3300005444 Ga0070694_100040560 Ga0070694_1000405603 210
172 3300005444 Ga0070694_100154487 Ga0070694_1001544872 210
173 3300005458 Ga0070681_10003933 Ga0070681_100039335 210
174 3300005458 Ga0070681_10083531 Ga0070681_100835312 210
175 3300005459 Ga0068867_100017771 Ga0068867_1000177714 210
176 3300005518 Ga0070699_100783894 Ga0070699_1007838941 210
177 3300005546 Ga0070696_100046031 Ga0070696_1000460312 210
178 3300005546 Ga0070696_100646653 Ga0070696_1006466531 210
179 3300005547 Ga0070693_100005900 Ga0070693_1000059005 210
180 3300005577 Ga0068857_100541610 Ga0068857_1005416102 210
181 3300005578 Ga0068854_100143266 Ga0068854_1001432662 210
182 3300005615 Ga0070702_100043929 Ga0070702_1000439291 210
183 3300005617 Ga0068859_100027393 Ga0068859_1000273937 210
184 3300005617 Ga0068859_100048141 Ga0068859_1000481415 210
185 3300005617 Ga0068859_100059825 Ga0068859_1000598252 210
186 3300005617 Ga0068859_100140999 Ga0068859_1001409993 210
187 3300005617 Ga0068859_100152609 Ga0068859_1001526093 210
188 3300005617 Ga0068859_100175496 Ga0068859_1001754962 210
189 3300005618 Ga0068864_100023463 Ga0068864_1000234636 210
190 3300005618 Ga0068864_100996972 Ga0068864_1009969721 210
191 3300005718 Ga0068866_10014995 Ga0068866_100149954 210
192 3300005840 Ga0068870_10123259 Ga0068870_101232592 210
193 3300005840 Ga0068870_10574044 Ga0068870_105740441 210
194 3300005841 Ga0068863_100077484 Ga0068863_1000774845 210
195 3300005841 Ga0068863_100532748 Ga0068863_1005327482 210
196 3300005842 Ga0068858_100174082 Ga0068858_1001740821 210
197 3300005843 Ga0068860_100119189 Ga0068860_1001191895 210
198 3300005844 Ga0068862_100305831 Ga0068862_1003058312 210
199 3300005985 Ga0081539_10000490 Ga0081539_1000049011 210
200 3300006058 Ga0075432_10165156 Ga0075432_101651561 210
201 3300006173 Ga0070716_100000007 Ga0070716_100000007129 210
202 3300006237 Ga0097621_100003740 Ga0097621_10000374014 210
203 3300006847 Ga0075431_100125780 Ga0075431_1001257803 210
204 3300006852 Ga0075433_10027242 Ga0075433_100272422 210
205 3300006852 Ga0075433_10030871 Ga0075433_100308712 210
206 3300006852 Ga0075433_10115905 Ga0075433_101159053 210
207 3300006871 Ga0075434_100017831 Ga0075434_1000178311 210
208 3300006881 Ga0068865_100244298 Ga0068865_1002442981 210
209 3300006931 Ga0097620_100027391 Ga0097620_1000273917 210
210 3300006931 Ga0097620_100048144 Ga0097620_1000481445 210
211 3300006931 Ga0097620_100059819 Ga0097620_1000598192 210
212 3300006931 Ga0097620_100141009 Ga0097620_1001410093 210
213 3300006931 Ga0097620_100152605 Ga0097620_1001526053 210
214 3300006931 Ga0097620_100175505 Ga0097620_1001755052 210
215 3300009094 Ga0111539_10000363 Ga0111539_1000036321 210
216 3300009094 Ga0111539_10813049 Ga0111539_108130492 210
217 3300009098 Ga0105245_10623793 Ga0105245_106237931 210
218 3300009098 Ga0105245_11042266 Ga0105245_110422661 210
219 3300009101 Ga0105247_10008100 Ga0105247_100081004 210
220 3300009101 Ga0105247_10039422 Ga0105247_100394222 210
221 3300009101 Ga0105247_10345435 Ga0105247_103454352 210
222 3300009147 Ga0114129_10235807 Ga0114129_102358073 210
223 3300009147 Ga0114129_10236812 Ga0114129_102368124 210
224 3300009147 Ga0114129_10512829 Ga0114129_105128292 210
225 3300009147 Ga0114129_10612362 Ga0114129_106123622 210
226 3300009148 Ga0105243_10008920 Ga0105243_100089208 210
227 3300009148 Ga0105243_10068413 Ga0105243_100684133 210
228 3300009174 Ga0105241_10060700 Ga0105241_100607003 210
229 3300009174 Ga0105241_10190194 Ga0105241_101901941 210
230 3300009174 Ga0105241_10353606 Ga0105241_103536061 210
231 3300009176 Ga0105242_10113975 Ga0105242_101139753 210
232 3300009176 Ga0105242_10168726 Ga0105242_101687262 210
233 3300009177 Ga0105248_10026948 Ga0105248_100269485 210
234 3300009177 Ga0105248_10246865 Ga0105248_102468652 210
235 3300009551 Ga0105238_10001996 Ga0105238_1000199613 210
236 3300009553 Ga0105249_10152210 Ga0105249_101522103 210
237 3300009553 Ga0105249_10174470 Ga0105249_101744702 210
238 3300009553 Ga0105249_11098359 Ga0105249_110983591 210
239 3300010375 Ga0105239_10095819 Ga0105239_100958192 210
240 3300010375 Ga0105239_10382904 Ga0105239_103829043 210
241 3300011119 Ga0105246_11072975 Ga0105246_110729751 210
242 3300011119 Ga0105246_11289814 Ga0105246_112898141 210
243 3300013100 Ga0157373_10254302 Ga0157373_102543022 210
244 3300013297 Ga0157378_10064497 Ga0157378_100644975 210
245 3300013297 Ga0157378_10148736 Ga0157378_101487362 210
246 3300013297 Ga0157378_11008068 Ga0157378_110080682 210
247 3300013306 Ga0163162_10155774 Ga0163162_101557746 210
248 3300013307 Ga0157372_10898692 Ga0157372_108986922 210
249 3300013308 Ga0157375_10718795 Ga0157375_107187951 210
250 3300014968 Ga0157379_10448087 Ga0157379_104480872 210
251 3300025899 Ga0207642_10003705 Ga0207642_100037051 210
252 3300025900 Ga0207710_10000832 Ga0207710_1000083211 210
253 3300025904 Ga0207647_10017531 Ga0207647_100175317 210
254 3300025908 Ga0207643_10115455 Ga0207643_101154552 210
255 3300025908 Ga0207643_10154827 Ga0207643_101548271 210
256 3300025908 Ga0207643_10450175 Ga0207643_104501751 210
257 3300025911 Ga0207654_10083469 Ga0207654_100834693 210
258 3300025912 Ga0207707_10084084 Ga0207707_100840843 210
259 3300025912 Ga0207707_10264975 Ga0207707_102649752 210
260 3300025924 Ga0207694_10010396 Ga0207694_100103963 210
261 3300025925 Ga0207650_10044178 Ga0207650_100441783 210
262 3300025927 Ga0207687_10393785 Ga0207687_103937852 210
263 3300025932 Ga0207690_10338378 Ga0207690_103383782 210
264 3300025934 Ga0207686_10328878 Ga0207686_103288782 210
265 3300025935 Ga0207709_10325828 Ga0207709_103258282 210
266 3300025935 Ga0207709_10504279 Ga0207709_105042791 210
267 3300025939 Ga0207665_10000018 Ga0207665_1000001811 210
268 3300025940 Ga0207691_10208715 Ga0207691_102087151 210
269 3300025941 Ga0207711_10015475 Ga0207711_100154755 210
270 3300025941 Ga0207711_10219791 Ga0207711_102197914 210
271 3300025941 Ga0207711_10459526 Ga0207711_104595262 210
272 3300025941 Ga0207711_10608331 Ga0207711_106083312 210
273 3300025942 Ga0207689_10501170 Ga0207689_105011702 210
274 3300025960 Ga0207651_10471323 Ga0207651_104713232 210
275 3300025960 Ga0207651_10878328 Ga0207651_108783282 210
276 3300025961 Ga0207712_10037657 Ga0207712_100376573 210
277 3300025981 Ga0207640_10548803 Ga0207640_105488032 210
278 3300026035 Ga0207703_10101203 Ga0207703_101012031 210
279 3300026035 Ga0207703_10493517 Ga0207703_104935172 210
280 3300026035 Ga0207703_11231684 Ga0207703_112316841 210
281 3300026041 Ga0207639_10814825 Ga0207639_108148252 210
282 3300026075 Ga0207708_10000017 Ga0207708_1000001746 210
283 3300026075 Ga0207708_10016202 Ga0207708_100162022 210
284 3300026088 Ga0207641_10053459 Ga0207641_100534592 210
285 3300026088 Ga0207641_10776928 Ga0207641_107769281 210
286 3300026088 Ga0207641_11057324 Ga0207641_110573241 210
287 3300026089 Ga0207648_10280012 Ga0207648_102800123 210
288 3300026095 Ga0207676_10010544 Ga0207676_100105443 210
289 3300026095 Ga0207676_10265065 Ga0207676_102650652 210
290 3300026095 Ga0207676_10312561 Ga0207676_103125612 210
291 3300026116 Ga0207674_10321942 Ga0207674_103219422 210
292 3300026118 Ga0207675_100305244 Ga0207675_1003052443 210
293 3300026118 Ga0207675_100535509 Ga0207675_1005355092 210
294 3300027907 Ga0207428_10008435 Ga0207428_100084355 210
295 3300028381 Ga0268264_10443495 Ga0268264_104434952 210
296 3300031548 Ga0307408_100001243 Ga0307408_1000012437 210
297 3300031824 Ga0307413_10256327 Ga0307413_102563272 210
298 3300031852 Ga0307410_10023943 Ga0307410_100239431 210
299 3300031901 Ga0307406_10001021 Ga0307406_100010215 210
300 3300031903 Ga0307407_10125290 Ga0307407_101252902 210
301 3300031911 Ga0307412_10470281 Ga0307412_104702812 210
302 3300031995 Ga0307409_100028349 Ga0307409_1000283495 210
303 3300032002 Ga0307416_100079110 Ga0307416_1000791103 210
304 3300032004 Ga0307414_10000585 Ga0307414_1000058513 210
305 3300032126 Ga0307415_100000479 Ga0307415_1000004795 210
306 3300032126 Ga0307415_100244837 Ga0307415_1002448372 210
307 3300035091 Ga0373951_0002340 Ga0373951_0002340_3456_4091 210
308 3300035115 Ga0373941_0013172 Ga0373941_0013172_163_795 210
309 3300035115 Ga0373941_0068723 Ga0373941_0068723_451_1086 210
310 3300035207 Ga0373942_0002199 Ga0373942_0002199_2260_2898 210
311 3300037418 Ga0395900_0662274 Ga0395900_0662274_268_906 210
312 3300037466 Ga0395898_0030070 Ga0395898_0030070_2098_2736 210
313 3300037466 Ga0395898_0109812 Ga0395898_0109812_131_769 210
314 3300042157 Ga0439458_0002105 Ga0439458_0002105_71_709 210
315 3300045051 Ga0451576_0386104 Ga0451576_0386104_205_843 210
316 3300048906 Ga0496103_0361850 Ga0496103_0361850_232_870 210
317 3300048909 Ga0496106_0163300 Ga0496106_0163300_1025_1663 210
318 3300048911 Ga0496108_0749442 Ga0496108_0749442_101_739 210
319 3300048915 Ga0496112_0148038 Ga0496112_0148038_425_1057 210
320 3300049514 Ga0501291_021510 Ga0501291_021510_277_912 210
321 3300049521 Ga0501298_058481 Ga0501298_058481_21_656 210
322 3300049649 Ga0501198_004796 Ga0501198_004796_1233_1871 210
323 3300049654 Ga0501207_003365 Ga0501207_003365_1070_1708 210
324 3300049656 Ga0501209_056644 Ga0501209_056644_10_648 210
325 3300049658 Ga0501211_009763 Ga0501211_009763_209_844 210
326 3300049660 Ga0501216_000404 Ga0501216_000404_286_924 210
327 3300049661 Ga0501217_000501 Ga0501217_000501_3901_4539 210
328 3300049663 Ga0501223_010755 Ga0501223_010755_618_1253 210
329 3300049664 Ga0501224_001054 Ga0501224_001054_1927_2565 210
330 3300049673 Ga0501240_004611 Ga0501240_004611_164_802 210
331 3300049675 Ga0501243_026313 Ga0501243_026313_205_840 210
332 3300049679 Ga0501249_019273 Ga0501249_019273_759_1394 210
333 3300049704 Ga0501221_065247 Ga0501221_065247_199_834 210
334 3300049705 Ga0501225_0000268 Ga0501225_0000268_5758_6396 210
335 3300049707 Ga0501234_000872 Ga0501234_000872_3530_4168 210
336 3300049853 Ga0501226_009413 Ga0501226_009413_395_1033 210
337 3300050507 nmdc:mga05p37_384232_c1 nmdc:mga05p37_384232_c1_420_1058 210
338 3300050510 nmdc:mga06r32_216935_c1 nmdc:mga06r32_216935_c1_1130_1765 210
339 3300050511 nmdc:mga08y16_34486_c1 nmdc:mga08y16_34486_c1_3809_4447 210
340 3300050512 nmdc:mga0n895_285969_c1 nmdc:mga0n895_285969_c1_771_1409 210
341 3300050515 nmdc:mga0a205_12578_c1 nmdc:mga0a205_12578_c1_1129_1767 210
342 3300053085 Ga0495619_0083142 Ga0495619_0083142_1292_2029 210
343 3300005288 Ga0065714_10064507 Ga0065714_1006450713 211
344 3300005290 Ga0065712_10000138 Ga0065712_1000013835 211
345 3300005293 Ga0065715_10090469 Ga0065715_100904692 211
346 3300005329 Ga0070683_100015643 Ga0070683_1000156432 211
347 3300005334 Ga0068869_100629904 Ga0068869_1006299042 211
348 3300005445 Ga0070708_100132733 Ga0070708_1001327332 211
349 3300005467 Ga0070706_100564830 Ga0070706_1005648302 211
350 3300005535 Ga0070684_100423357 Ga0070684_1004233572 211
351 3300005618 Ga0068864_100368505 Ga0068864_1003685052 211
352 3300005840 Ga0068870_10069572 Ga0068870_100695722 211
353 3300006846 Ga0075430_100113481 Ga0075430_1001134812 211
354 3300006847 Ga0075431_100010525 Ga0075431_1000105253 211
355 3300006871 Ga0075434_100836396 Ga0075434_1008363961 211
356 3300006880 Ga0075429_100397165 Ga0075429_1003971652 211
357 3300006914 Ga0075436_100000008 Ga0075436_100000008136 211
358 3300007076 Ga0075435_100000244 Ga0075435_1000002446 211
359 3300007076 Ga0075435_100006045 Ga0075435_1000060457 211
360 3300009147 Ga0114129_10164582 Ga0114129_101645821 211
361 3300009174 Ga0105241_10070199 Ga0105241_100701992 211
362 3300009177 Ga0105248_10867368 Ga0105248_108673682 211
363 3300010159 Ga0099796_10112636 Ga0099796_101126361 211
364 3300013100 Ga0157373_10002322 Ga0157373_100023228 211
365 3300013306 Ga0163162_10158553 Ga0163162_101585533 211
366 3300013308 Ga0157375_10003116 Ga0157375_100031162 211
367 3300025904 Ga0207647_10373602 Ga0207647_103736021 211
368 3300025906 Ga0207699_10433244 Ga0207699_104332441 211
369 3300025908 Ga0207643_10122668 Ga0207643_101226682 211
370 3300025911 Ga0207654_10075558 Ga0207654_100755582 211
371 3300025917 Ga0207660_10412158 Ga0207660_104121581 211
372 3300025939 Ga0207665_10078952 Ga0207665_100789523 211
373 3300025944 Ga0207661_10099802 Ga0207661_100998024 211
374 3300026095 Ga0207676_10288476 Ga0207676_102884762 211
375 3300031731 Ga0307405_10225698 Ga0307405_102256982 211
376 3300031824 Ga0307413_10483864 Ga0307413_104838642 211
377 3300031852 Ga0307410_10090006 Ga0307410_100900063 211
378 3300031911 Ga0307412_10025475 Ga0307412_100254752 211
379 3300032002 Ga0307416_100625002 Ga0307416_1006250022 211
380 3300032126 Ga0307415_100216235 Ga0307415_1002162352 211
381 3300039453 Ga0436362_0300217 Ga0436362_0300217_223_864 211
382 3300048915 Ga0496112_0105263 Ga0496112_0105263_961_1599 211
383 3300049514 Ga0501291_020907 Ga0501291_020907_128_799 211
384 3300049515 Ga0501292_011005 Ga0501292_011005_254_925 211
385 3300049521 Ga0501298_005326 Ga0501298_005326_816_1487 211
386 3300049574 Ga0501038_0007917 Ga0501038_0007917_6318_6956 211
387 3300049651 Ga0501201_003184 Ga0501201_003184_37_708 211
388 3300049652 Ga0501202_019476 Ga0501202_019476_389_1060 211
389 3300049661 Ga0501217_001421 Ga0501217_001421_3301_3972 211
390 3300049669 Ga0501235_008343 Ga0501235_008343_127_798 211
391 3300049686 Ga0501257_009411 Ga0501257_009411_781_1452 211
392 3300049689 Ga0501260_010629 Ga0501260_010629_141_812 211
393 3300049779 Ga0501283_006493 Ga0501283_006493_701_1372 211
394 3300049851 Ga0501212_005859 Ga0501212_005859_701_1372 211
395 3300050507 nmdc:mga05p37_899444_c1 nmdc:mga05p37_899444_c1_237_890 211
396 3300050508 nmdc:mga09592_171358_c1 nmdc:mga09592_171358_c1_403_1056 211
397 3300050509 nmdc:mga0qj67_184920_c1 nmdc:mga0qj67_184920_c1_132_812 211
398 3300050509 nmdc:mga0qj67_29879_c1 nmdc:mga0qj67_29879_c1_118_771 211
399 3300050510 nmdc:mga06r32_25661_c1 nmdc:mga06r32_25661_c1_4092_4745 211
400 3300050510 nmdc:mga06r32_46784_c1 nmdc:mga06r32_46784_c1_1081_1761 211
401 3300050512 nmdc:mga0n895_354298_c1 nmdc:mga0n895_354298_c1_437_1102 211
402 3300050514 nmdc:mga08x19_16_c1 nmdc:mga08x19_16_c1_138544_139179 211
403 3300005290 Ga0065712_10099129 Ga0065712_100991292 212
404 3300005293 Ga0065715_10033378 Ga0065715_100333782 212
405 3300005328 Ga0070676_10057386 Ga0070676_100573863 212
406 3300005330 Ga0070690_100005770 Ga0070690_1000057706 212
407 3300005334 Ga0068869_100083550 Ga0068869_1000835502 212
408 3300005335 Ga0070666_10116685 Ga0070666_101166851 212
409 3300005340 Ga0070689_100128741 Ga0070689_1001287411 212
410 3300005343 Ga0070687_100124760 Ga0070687_1001247602 212
411 3300005345 Ga0070692_10226131 Ga0070692_102261312 212
412 3300005353 Ga0070669_100079505 Ga0070669_1000795053 212
413 3300005353 Ga0070669_100119808 Ga0070669_1001198082 212
414 3300005354 Ga0070675_100109993 Ga0070675_1001099933 212
415 3300005354 Ga0070675_100140279 Ga0070675_1001402792 212
416 3300005355 Ga0070671_100044712 Ga0070671_1000447125 212
417 3300005365 Ga0070688_100582036 Ga0070688_1005820362 212
418 3300005367 Ga0070667_100032807 Ga0070667_1000328072 212
419 3300005438 Ga0070701_10087404 Ga0070701_100874043 212
420 3300005440 Ga0070705_100057489 Ga0070705_1000574892 212
421 3300005441 Ga0070700_100071533 Ga0070700_1000715333 212
422 3300005444 Ga0070694_100039687 Ga0070694_1000396873 212
423 3300005444 Ga0070694_100063544 Ga0070694_1000635443 212
424 3300005445 Ga0070708_100275416 Ga0070708_1002754161 212
425 3300005456 Ga0070678_100021052 Ga0070678_1000210523 212
426 3300005457 Ga0070662_100067297 Ga0070662_1000672972 212
427 3300005459 Ga0068867_100170264 Ga0068867_1001702641 212
428 3300005466 Ga0070685_10045527 Ga0070685_100455271 212
429 3300005467 Ga0070706_100006573 Ga0070706_10000657310 212
430 3300005536 Ga0070697_100303033 Ga0070697_1003030331 212
431 3300005543 Ga0070672_100121466 Ga0070672_1001214662 212
432 3300005543 Ga0070672_100154798 Ga0070672_1001547981 212
433 3300005544 Ga0070686_100009728 Ga0070686_1000097283 212
434 3300005544 Ga0070686_100071842 Ga0070686_1000718423 212
435 3300005546 Ga0070696_100022307 Ga0070696_1000223072 212
436 3300005546 Ga0070696_100385191 Ga0070696_1003851911 212
437 3300005617 Ga0068859_100011491 Ga0068859_1000114912 212
438 3300005617 Ga0068859_100210714 Ga0068859_1002107142 212
439 3300005618 Ga0068864_100396693 Ga0068864_1003966932 212
440 3300005718 Ga0068866_10031205 Ga0068866_100312053 212
441 3300005719 Ga0068861_100070334 Ga0068861_1000703342 212
442 3300005841 Ga0068863_100133463 Ga0068863_1001334631 212
443 3300005842 Ga0068858_100131784 Ga0068858_1001317842 212
444 3300005842 Ga0068858_100384887 Ga0068858_1003848872 212
445 3300005843 Ga0068860_100016852 Ga0068860_1000168523 212
446 3300005843 Ga0068860_100203208 Ga0068860_1002032081 212
447 3300005844 Ga0068862_100024723 Ga0068862_1000247233 212
448 3300006163 Ga0070715_10000007 Ga0070715_10000007164 212
449 3300006237 Ga0097621_100005158 Ga0097621_1000051587 212
450 3300006358 Ga0068871_100041044 Ga0068871_1000410443 212
451 3300006852 Ga0075433_10688538 Ga0075433_106885381 212
452 3300006871 Ga0075434_100002749 Ga0075434_10000274915 212
453 3300006931 Ga0097620_100011491 Ga0097620_1000114918 212
454 3300006931 Ga0097620_100210697 Ga0097620_1002106972 212
455 3300009094 Ga0111539_10084943 Ga0111539_100849435 212
456 3300009147 Ga0114129_10164080 Ga0114129_101640803 212
457 3300009148 Ga0105243_10008351 Ga0105243_100083513 212
458 3300009176 Ga0105242_10009899 Ga0105242_100098996 212
459 3300009553 Ga0105249_10083701 Ga0105249_100837012 212
460 3300011119 Ga0105246_10085229 Ga0105246_100852294 212
461 3300013297 Ga0157378_10036978 Ga0157378_100369782 212
462 3300013297 Ga0157378_10085236 Ga0157378_100852362 212
463 3300013306 Ga0163162_10023609 Ga0163162_100236096 212
464 3300013306 Ga0163162_10175419 Ga0163162_101754192 212
465 3300013308 Ga0157375_10011832 Ga0157375_100118322 212
466 3300013308 Ga0157375_10633416 Ga0157375_106334161 212
467 3300014325 Ga0163163_10129938 Ga0163163_101299382 212
468 3300014969 Ga0157376_10283737 Ga0157376_102837372 212
469 3300025315 Ga0207697_10097516 Ga0207697_100975162 212
470 3300025905 Ga0207685_10000007 Ga0207685_10000007102 212
471 3300025907 Ga0207645_10424413 Ga0207645_104244131 212
472 3300025910 Ga0207684_10036975 Ga0207684_100369751 212
473 3300025917 Ga0207660_10005726 Ga0207660_100057265 212
474 3300025918 Ga0207662_10006504 Ga0207662_100065042 212
475 3300025923 Ga0207681_10197409 Ga0207681_101974091 212
476 3300025926 Ga0207659_10052425 Ga0207659_100524253 212
477 3300025926 Ga0207659_10118786 Ga0207659_101187863 212
478 3300025931 Ga0207644_10523846 Ga0207644_105238461 212
479 3300025933 Ga0207706_10042013 Ga0207706_100420132 212
480 3300025935 Ga0207709_10079109 Ga0207709_100791092 212
481 3300025936 Ga0207670_10287819 Ga0207670_102878192 212
482 3300025940 Ga0207691_10005460 Ga0207691_100054604 212
483 3300025940 Ga0207691_10173301 Ga0207691_101733011 212
484 3300025942 Ga0207689_10003363 Ga0207689_100033636 212
485 3300025942 Ga0207689_10125951 Ga0207689_101259512 212
486 3300025960 Ga0207651_10303602 Ga0207651_103036022 212
487 3300025961 Ga0207712_10015539 Ga0207712_100155393 212
488 3300025961 Ga0207712_10423829 Ga0207712_104238292 212
489 3300025981 Ga0207640_10030812 Ga0207640_100308123 212
490 3300025986 Ga0207658_10203170 Ga0207658_102031701 212
491 3300026075 Ga0207708_10035821 Ga0207708_100358212 212
492 3300026088 Ga0207641_10082951 Ga0207641_100829512 212
493 3300026089 Ga0207648_10170744 Ga0207648_101707442 212
494 3300026116 Ga0207674_10647181 Ga0207674_106471812 212
495 3300026118 Ga0207675_100004763 Ga0207675_1000047632 212
496 3300026118 Ga0207675_100759898 Ga0207675_1007598982 212
497 3300026118 Ga0207675_100827378 Ga0207675_1008273782 212
498 3300027907 Ga0207428_10310020 Ga0207428_103100202 212
499 3300028380 Ga0268265_10029798 Ga0268265_100297983 212
500 3300028381 Ga0268264_10121248 Ga0268264_101212483 212
501 3300028381 Ga0268264_10167421 Ga0268264_101674213 212
502 3300049514 Ga0501291_002900 Ga0501291_002900_49_711 212
503 3300049669 Ga0501235_023618 Ga0501235_023618_641_1303 212
504 3300050507 nmdc:mga05p37_196792_c1 nmdc:mga05p37_196792_c1_646_1308 212
505 3300005290 Ga0065712_10092482 Ga0065712_100924823 213
506 3300005293 Ga0065715_10127631 Ga0065715_101276312 213
507 3300005293 Ga0065715_10228143 Ga0065715_102281431 213
508 3300005334 Ga0068869_100158218 Ga0068869_1001582183 213
509 3300005334 Ga0068869_100755954 Ga0068869_1007559541 213
510 3300005335 Ga0070666_10113732 Ga0070666_101137321 213
511 3300005338 Ga0068868_100013647 Ga0068868_1000136474 213
512 3300005345 Ga0070692_10009492 Ga0070692_100094922 213
513 3300005355 Ga0070671_100075622 Ga0070671_1000756223 213
514 3300005355 Ga0070671_100933002 Ga0070671_1009330021 213
515 3300005364 Ga0070673_100364141 Ga0070673_1003641412 213
516 3300005365 Ga0070688_100211379 Ga0070688_1002113792 213
517 3300005367 Ga0070667_100326771 Ga0070667_1003267712 213
518 3300005434 Ga0070709_10000001 Ga0070709_1000000178 213
519 3300005436 Ga0070713_100916282 Ga0070713_1009162821 213
520 3300005440 Ga0070705_100347183 Ga0070705_1003471832 213
521 3300005444 Ga0070694_100026914 Ga0070694_1000269142 213
522 3300005444 Ga0070694_100512927 Ga0070694_1005129271 213
523 3300005536 Ga0070697_100000366 Ga0070697_1000003668 213
524 3300005545 Ga0070695_100237089 Ga0070695_1002370892 213
525 3300005546 Ga0070696_100058079 Ga0070696_1000580794 213
526 3300005548 Ga0070665_100089076 Ga0070665_1000890762 213
527 3300005549 Ga0070704_100051780 Ga0070704_1000517802 213
528 3300005564 Ga0070664_100031842 Ga0070664_1000318422 213
529 3300005578 Ga0068854_100182940 Ga0068854_1001829402 213
530 3300005615 Ga0070702_100130136 Ga0070702_1001301361 213
531 3300005615 Ga0070702_100170062 Ga0070702_1001700622 213
532 3300005617 Ga0068859_100021537 Ga0068859_1000215374 213
533 3300005618 Ga0068864_100010106 Ga0068864_1000101063 213
534 3300005718 Ga0068866_10281750 Ga0068866_102817501 213
535 3300005842 Ga0068858_100119330 Ga0068858_1001193301 213
536 3300005843 Ga0068860_100125189 Ga0068860_1001251893 213
537 3300005843 Ga0068860_100408272 Ga0068860_1004082721 213
538 3300006358 Ga0068871_100125202 Ga0068871_1001252023 213
539 3300006871 Ga0075434_100034409 Ga0075434_1000344093 213
540 3300006931 Ga0097620_100021538 Ga0097620_1000215384 213
541 3300009093 Ga0105240_10016665 Ga0105240_100166654 213
542 3300009098 Ga0105245_11335123 Ga0105245_113351231 213
543 3300009174 Ga0105241_10115658 Ga0105241_101156582 213
544 3300009177 Ga0105248_10001196 Ga0105248_1000119625 213
545 3300009177 Ga0105248_10221038 Ga0105248_102210381 213
546 3300013297 Ga0157378_10439189 Ga0157378_104391891 213
547 3300013306 Ga0163162_10003901 Ga0163162_100039014 213
548 3300013306 Ga0163162_10085806 Ga0163162_100858062 213
549 3300013307 Ga0157372_10042422 Ga0157372_100424226 213
550 3300013308 Ga0157375_10011770 Ga0157375_100117705 213
551 3300013308 Ga0157375_11664639 Ga0157375_116646391 213
552 3300014325 Ga0163163_10000527 Ga0163163_100005271 213
553 3300014969 Ga0157376_10016733 Ga0157376_100167334 213
554 3300025899 Ga0207642_10178745 Ga0207642_101787452 213
555 3300025906 Ga0207699_10000004 Ga0207699_10000004312 213
556 3300025913 Ga0207695_10092686 Ga0207695_100926862 213
557 3300025931 Ga0207644_10164450 Ga0207644_101644502 213
558 3300025931 Ga0207644_10679274 Ga0207644_106792741 213
559 3300025935 Ga0207709_10610492 Ga0207709_106104921 213
560 3300025941 Ga0207711_10055347 Ga0207711_100553473 213
561 3300025941 Ga0207711_10240662 Ga0207711_102406622 213
562 3300025942 Ga0207689_10035998 Ga0207689_100359984 213
563 3300025949 Ga0207667_10679281 Ga0207667_106792812 213
564 3300025960 Ga0207651_10781858 Ga0207651_107818581 213
565 3300025981 Ga0207640_10202586 Ga0207640_102025862 213
566 3300026023 Ga0207677_10006705 Ga0207677_100067055 213
567 3300026035 Ga0207703_10731152 Ga0207703_107311521 213
568 3300026088 Ga0207641_10068851 Ga0207641_100688513 213
569 3300026095 Ga0207676_10117652 Ga0207676_101176524 213
570 3300028381 Ga0268264_10121237 Ga0268264_101212372 213
571 3300036401 Ga0373937_0040474 Ga0373937_0040474_745_1404 213
572 3300046539 Ga0495621_0030213 Ga0495621_0030213_269_931 213
573 3300050512 nmdc:mga0n895_21252_c2 nmdc:mga0n895_21252_c2_1726_2367 213
574 3300005289 Ga0065704_10290960 Ga0065704_102909601 214
575 3300005293 Ga0065715_10462673 Ga0065715_104626731 214
576 3300005295 Ga0065707_10003030 Ga0065707_100030303 214
577 3300005336 Ga0070680_100001059 Ga0070680_1000010599 214
578 3300005336 Ga0070680_100541342 Ga0070680_1005413422 214
579 3300005345 Ga0070692_10307070 Ga0070692_103070701 214
580 3300005355 Ga0070671_100003695 Ga0070671_1000036955 214
581 3300005364 Ga0070673_100143911 Ga0070673_1001439113 214
582 3300005364 Ga0070673_100698096 Ga0070673_1006980961 214
583 3300005438 Ga0070701_10009397 Ga0070701_100093975 214
584 3300005468 Ga0070707_100000478 Ga0070707_10000047835 214
585 3300005468 Ga0070707_100805909 Ga0070707_1008059091 214
586 3300005530 Ga0070679_100000060 Ga0070679_10000006033 214
587 3300005536 Ga0070697_100057838 Ga0070697_1000578383 214
588 3300005536 Ga0070697_100225684 Ga0070697_1002256842 214
589 3300005546 Ga0070696_100499146 Ga0070696_1004991461 214
590 3300005547 Ga0070693_100564552 Ga0070693_1005645521 214
591 3300005549 Ga0070704_100226835 Ga0070704_1002268352 214
592 3300005577 Ga0068857_100690733 Ga0068857_1006907331 214
593 3300005719 Ga0068861_100107052 Ga0068861_1001070524 214
594 3300005841 Ga0068863_100424841 Ga0068863_1004248411 214
595 3300005844 Ga0068862_100110283 Ga0068862_1001102833 214
596 3300006852 Ga0075433_10011443 Ga0075433_100114434 214
597 3300006852 Ga0075433_10088923 Ga0075433_100889232 214
598 3300006871 Ga0075434_100237463 Ga0075434_1002374633 214
599 3300006871 Ga0075434_100327361 Ga0075434_1003273612 214
600 3300007076 Ga0075435_100106144 Ga0075435_1001061443 214
601 3300007076 Ga0075435_100811721 Ga0075435_1008117211 214
602 3300009093 Ga0105240_10210653 Ga0105240_102106533 214
603 3300009094 Ga0111539_10366872 Ga0111539_103668721 214
604 3300009147 Ga0114129_10004613 Ga0114129_1000461314 214
605 3300009148 Ga0105243_10028284 Ga0105243_100282843 214
606 3300009176 Ga0105242_10608291 Ga0105242_106082912 214
607 3300009545 Ga0105237_10043697 Ga0105237_100436976 214
608 3300009553 Ga0105249_10118014 Ga0105249_101180141 214
609 3300010375 Ga0105239_11344009 Ga0105239_113440091 214
610 3300014326 Ga0157380_10004467 Ga0157380_100044679 214
611 3300025912 Ga0207707_10000015 Ga0207707_10000015152 214
612 3300025921 Ga0207652_10000253 Ga0207652_1000025324 214
613 3300025922 Ga0207646_10000849 Ga0207646_100008495 214
614 3300025925 Ga0207650_10245638 Ga0207650_102456381 214
615 3300025931 Ga0207644_10010878 Ga0207644_100108783 214
616 3300025935 Ga0207709_10865240 Ga0207709_108652401 214
617 3300025949 Ga0207667_10667631 Ga0207667_106676311 214
618 3300026088 Ga0207641_10237778 Ga0207641_102377783 214
619 3300026118 Ga0207675_100232756 Ga0207675_1002327562 214
620 3300028380 Ga0268265_11048321 Ga0268265_110483211 214
621 3300037418 Ga0395900_0318659 Ga0395900_0318659_148_831 214
622 3300038996 Ga0242420_013404 Ga0242420_013404_64_747 214
623 3300044673 Ga0453683_0203128 Ga0453683_0203128_414_1058 214
624 3300045051 Ga0451576_0617124 Ga0451576_0617124_410_1093 214
625 3300045051 Ga0451576_1127066 Ga0451576_1127066_123_767 214
626 3300048905 Ga0496102_0019571 Ga0496102_0019571_467_1150 214
627 3300048907 Ga0496104_0091376 Ga0496104_0091376_1616_2299 214
628 3300050507 nmdc:mga05p37_133933_c1 nmdc:mga05p37_133933_c1_125_799 214
629 3300050512 nmdc:mga0n895_796064_c1 nmdc:mga0n895_796064_c1_235_909 214
630 3300050513 nmdc:mga0rr50_195073_c1 nmdc:mga0rr50_195073_c1_186_869 214
631 3300050515 nmdc:mga0a205_28779_c1 nmdc:mga0a205_28779_c1_1682_2365 214
632 3300050515 nmdc:mga0a205_67468_c1 nmdc:mga0a205_67468_c1_151_825 214
633 2162886006 SwRhRL3b_contig_3991568 SwRhRL3b_0927.00001400 215
634 3300002074 JGI24748J21848_1000007 JGI24748J21848_100000785 215
635 3300002239 JGI24034J26672_10000002 JGI24034J26672_1000000297 215
636 3300002244 JGI24742J22300_10010201 JGI24742J22300_100102013 215
637 3300003203 JGI25406J46586_10003843 JGI25406J46586_100038437 215
638 3300003203 JGI25406J46586_10037658 JGI25406J46586_100376581 215
639 3300005289 Ga0065704_10145422 Ga0065704_101454221 215
640 3300005293 Ga0065715_10150012 Ga0065715_101500122 215
641 3300005295 Ga0065707_10087734 Ga0065707_100877345 215
642 3300005295 Ga0065707_10190143 Ga0065707_101901432 215
643 3300005328 Ga0070676_10454192 Ga0070676_104541921 215
644 3300005330 Ga0070690_100004266 Ga0070690_1000042666 215
645 3300005330 Ga0070690_100046047 Ga0070690_1000460474 215
646 3300005330 Ga0070690_100144975 Ga0070690_1001449751 215
647 3300005334 Ga0068869_100886103 Ga0068869_1008861031 215
648 3300005338 Ga0068868_100060106 Ga0068868_1000601065 215
649 3300005355 Ga0070671_100783723 Ga0070671_1007837232 215
650 3300005364 Ga0070673_100072566 Ga0070673_1000725662 215
651 3300005365 Ga0070688_100171011 Ga0070688_1001710112 215
652 3300005406 Ga0070703_10000313 Ga0070703_1000031312 215
653 3300005438 Ga0070701_10089825 Ga0070701_100898252 215
654 3300005441 Ga0070700_100008850 Ga0070700_1000088505 215
655 3300005444 Ga0070694_100009624 Ga0070694_1000096247 215
656 3300005444 Ga0070694_100644975 Ga0070694_1006449751 215
657 3300005445 Ga0070708_100046443 Ga0070708_1000464433 215
658 3300005459 Ga0068867_100089599 Ga0068867_1000895992 215
659 3300005467 Ga0070706_100843204 Ga0070706_1008432041 215
660 3300005468 Ga0070707_100821157 Ga0070707_1008211571 215
661 3300005471 Ga0070698_100010161 Ga0070698_1000101616 215
662 3300005518 Ga0070699_100869173 Ga0070699_1008691731 215
663 3300005544 Ga0070686_100010860 Ga0070686_1000108602 215
664 3300005544 Ga0070686_100399807 Ga0070686_1003998071 215
665 3300005546 Ga0070696_100020991 Ga0070696_1000209915 215
666 3300005546 Ga0070696_100186219 Ga0070696_1001862192 215
667 3300005549 Ga0070704_100003218 Ga0070704_1000032186 215
668 3300005617 Ga0068859_100004941 Ga0068859_10000494111 215
669 3300005718 Ga0068866_10089366 Ga0068866_100893662 215
670 3300005718 Ga0068866_10301701 Ga0068866_103017011 215
671 3300005719 Ga0068861_100088073 Ga0068861_1000880731 215
672 3300005841 Ga0068863_100069037 Ga0068863_1000690373 215
673 3300005842 Ga0068858_100000008 Ga0068858_100000008218 215
674 3300005843 Ga0068860_100212741 Ga0068860_1002127412 215
675 3300005985 Ga0081539_10000022 Ga0081539_10000022264 215
676 3300005985 Ga0081539_10000411 Ga0081539_100004118 215
677 3300005985 Ga0081539_10027307 Ga0081539_100273073 215
678 3300006844 Ga0075428_100112191 Ga0075428_1001121911 215
679 3300006852 Ga0075433_10092790 Ga0075433_100927904 215
680 3300006852 Ga0075433_10471782 Ga0075433_104717823 215
681 3300006871 Ga0075434_100071912 Ga0075434_1000719123 215
682 3300006880 Ga0075429_100110933 Ga0075429_1001109332 215
683 3300006931 Ga0097620_100004941 Ga0097620_10000494111 215
684 3300007076 Ga0075435_100865462 Ga0075435_1008654621 215
685 3300009094 Ga0111539_10012818 Ga0111539_100128188 215
686 3300009098 Ga0105245_10048819 Ga0105245_100488195 215
687 3300009098 Ga0105245_11356286 Ga0105245_113562861 215
688 3300009101 Ga0105247_10000001 Ga0105247_10000001541 215
689 3300009147 Ga0114129_10175898 Ga0114129_101758983 215
690 3300009147 Ga0114129_10292629 Ga0114129_102926291 215
691 3300009148 Ga0105243_10000119 Ga0105243_1000011972 215
692 3300009148 Ga0105243_10001926 Ga0105243_1000192611 215
693 3300009148 Ga0105243_10902175 Ga0105243_109021752 215
694 3300009174 Ga0105241_10808350 Ga0105241_108083501 215
695 3300009176 Ga0105242_10000113 Ga0105242_100001135 215
696 3300009176 Ga0105242_10000884 Ga0105242_1000088411 215
697 3300009176 Ga0105242_10001804 Ga0105242_1000180417 215
698 3300009176 Ga0105242_10163930 Ga0105242_101639302 215
699 3300009177 Ga0105248_10020782 Ga0105248_100207823 215
700 3300009177 Ga0105248_10111271 Ga0105248_101112714 215
701 3300009177 Ga0105248_10664954 Ga0105248_106649541 215
702 3300009553 Ga0105249_10856485 Ga0105249_108564851 215
703 3300010375 Ga0105239_10035696 Ga0105239_100356965 215
704 3300013297 Ga0157378_10000163 Ga0157378_1000016363 215
705 3300013297 Ga0157378_10059181 Ga0157378_100591815 215
706 3300013297 Ga0157378_10096153 Ga0157378_100961532 215
707 3300013297 Ga0157378_11039329 Ga0157378_110393291 215
708 3300013306 Ga0163162_10016787 Ga0163162_100167873 215
709 3300013306 Ga0163162_10074860 Ga0163162_100748605 215
710 3300013306 Ga0163162_10144081 Ga0163162_101440813 215
711 3300013308 Ga0157375_10002929 Ga0157375_100029295 215
712 3300013308 Ga0157375_11336633 Ga0157375_113366332 215
713 3300014326 Ga0157380_10000563 Ga0157380_100005639 215
714 3300014326 Ga0157380_10088360 Ga0157380_100883602 215
715 3300014968 Ga0157379_10070551 Ga0157379_100705515 215
716 3300017792 Ga0163161_10075052 Ga0163161_100750523 215
717 3300017792 Ga0163161_10186042 Ga0163161_101860423 215
718 3300017792 Ga0163161_10696039 Ga0163161_106960391 215
719 3300021384 Ga0213876_10000527 Ga0213876_1000052713 215
720 3300021384 Ga0213876_10022807 Ga0213876_100228075 215
721 3300021384 Ga0213876_10109877 Ga0213876_101098772 215
722 3300025223 Ga0207672_1000172 Ga0207672_10001724 215
723 3300025885 Ga0207653_10001006 Ga0207653_100010067 215
724 3300025899 Ga0207642_10212916 Ga0207642_102129162 215
725 3300025899 Ga0207642_10225441 Ga0207642_102254411 215
726 3300025900 Ga0207710_10000003 Ga0207710_1000000394 215
727 3300025907 Ga0207645_10401416 Ga0207645_104014161 215
728 3300025908 Ga0207643_10342936 Ga0207643_103429362 215
729 3300025910 Ga0207684_10606651 Ga0207684_106066511 215
730 3300025916 Ga0207663_10000074 Ga0207663_100000746 215
731 3300025922 Ga0207646_10235403 Ga0207646_102354032 215
732 3300025922 Ga0207646_10677627 Ga0207646_106776271 215
733 3300025931 Ga0207644_10000209 Ga0207644_100002097 215
734 3300025934 Ga0207686_10000130 Ga0207686_1000013012 215
735 3300025934 Ga0207686_10000477 Ga0207686_1000047721 215
736 3300025934 Ga0207686_10001804 Ga0207686_1000180411 215
737 3300025935 Ga0207709_10000162 Ga0207709_1000016272 215
738 3300025935 Ga0207709_10001299 Ga0207709_1000129912 215
739 3300025936 Ga0207670_10539771 Ga0207670_105397712 215
740 3300025941 Ga0207711_10685414 Ga0207711_106854142 215
741 3300025941 Ga0207711_10704719 Ga0207711_107047192 215
742 3300025942 Ga0207689_10172405 Ga0207689_101724053 215
743 3300025960 Ga0207651_10254881 Ga0207651_102548812 215
744 3300026023 Ga0207677_11003292 Ga0207677_110032921 215
745 3300026035 Ga0207703_10001853 Ga0207703_100018531 215
746 3300026075 Ga0207708_10010920 Ga0207708_100109205 215
747 3300026088 Ga0207641_10041526 Ga0207641_100415263 215
748 3300026089 Ga0207648_10112640 Ga0207648_101126402 215
749 3300026095 Ga0207676_10149603 Ga0207676_101496032 215
750 3300026118 Ga0207675_100001995 Ga0207675_1000019955 215
751 3300027907 Ga0207428_10007463 Ga0207428_100074636 215
752 3300028380 Ga0268265_10378484 Ga0268265_103784842 215
753 3300028381 Ga0268264_10308055 Ga0268264_103080552 215
754 3300028381 Ga0268264_10405023 Ga0268264_104050231 215
755 3300037853 Ga0436364_0591090 Ga0436364_0591090_28_711 215
756 3300039437 Ga0436365_0407503 Ga0436365_0407503_127193_127861 215
757 3300039437 Ga0436365_1230778 Ga0436365_1230778_309_983 215
758 3300044673 Ga0453683_0267229 Ga0453683_0267229_401_1051 215
759 3300046537 Ga0495598_0094833 Ga0495598_0094833_285_932 215
760 3300050507 nmdc:mga05p37_88893_c1 nmdc:mga05p37_88893_c1_2213_2875 215
761 3300050508 nmdc:mga09592_64775_c1 nmdc:mga09592_64775_c1_114_761 215
762 3300050511 nmdc:mga08y16_4740_c1 nmdc:mga08y16_4740_c1_10730_11377 215
763 3300050512 nmdc:mga0n895_90855_c1 nmdc:mga0n895_90855_c1_641_1288 215
764 3300050513 nmdc:mga0rr50_1046100_c1 nmdc:mga0rr50_1046100_c1_10_657 215
765 3300050514 nmdc:mga08x19_11_c1 nmdc:mga08x19_11_c1_110877_111551 215
766 3300050515 nmdc:mga0a205_132922_c1 nmdc:mga0a205_132922_c1_357_1004 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

65

196

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8giw-assembly2.cif.gz_D c143k variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3981 24 167
2v0x-assembly1.cif.gz_B the dimerization domain of lap2alpha 0.3406 51 178
3te0-assembly1.cif.gz_C crystal structure of hsc k148e 0.3317 7 166
3tdo-assembly1.cif.gz_C crystal structure of hsc at ph 9.0 0.3301 7 167
3te1-assembly1.cif.gz_B crystal structure of hsc t84a 0.325 10 175
ID Description Score Start End Superfamily
af_P9WN27_598_833_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.3913 22 81 3.30.460.10
af_P38125_110_564_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3324 25 193 1.20.1250.20
af_A0A0R0GKF0_3_238_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3277 40 204 1.20.1080.10
af_Q54FB0_36_153_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3266 44 172 1.20.1250.20
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.3193 26 165 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A4P5WPZ3-F1-model_v4 Alkaline phosphatase 0.8949 2 202 GO:0005886
AF-A0A698C407-F1-model_v4 deleted 0.8836 7 163
AF-A0A538T7E9-F1-model_v4 DedA family protein 0.8698 1 202 GO:0005886
AF-A0A698C407-F1-model_v4 deleted 0.8683 7 163
AF-A0A1G2CE34-F1-model_v4 VTT domain-containing protein 0.8634 4 206 GO:0005886

Feature Viewer

pLDDT pTM Quality
68.11 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map