F479873

General Info

Members Datasets Scaffolds Average Seq Length
766 492 639 255

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0194164|Ga0501037_0194164_232_1071
Length 279
Sequence MTALQSGRASIPGKVPPLNKADVLKLPSMPAAGPSYPAGPYRFINREYMVITYETDAAEIAEQLPEPLEPLDRPLVHYEWIRMPDSTGFGSYTESGVVIPCRLPKDLGGEEVNFVSQMYLDDDPPIVAGREIWGFPKKYAHPKLEIVKDTLTGTLEYAGQQVAMGTMGYKHESMAGNGEKTTATLAKTQVNLKLIPGVDGSPETCQLVAYNLTDITVKGSWMGPARLHLIPHVNAPVADLPVKRVIGAHHFIADLTLPYGRVVFDYNRHAISPELRATA

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
17 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
35 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
36 2841760612 Bosea sp. Tri-49 Isolate Nodule
37 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
38 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2844104063 Bosea sp. Tri-39 Isolate Nodule
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2851182111 Bosea sp. Tri-44 Isolate Nodule
48 2851246043 Bosea sp. Tri-54 Isolate Nodule
49 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
52 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
53 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
54 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
55 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
56 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
57 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
58 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
59 2906610324
60 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
61 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
62 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
63 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
64 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
65 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
66 2922368715
67 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
68 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
69 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
70 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
71 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
72 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
73 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
74 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
75 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
76 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
77 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
78 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
79 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
80 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
81 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
82 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
83 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
84 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
85 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
86 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
87 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
88 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
89 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
90 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
91 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
92 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
93 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
94 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
95 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
96 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
97 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
98 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
99 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
100 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
101 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
102 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
103 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
104 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
105 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
106 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
107 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
108 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
109 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
110 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
111 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
112 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
113 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
114 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
115 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
116 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
117 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
118 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
119 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
121 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
122 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
123 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
125 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
126 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
127 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
128 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
129 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
130 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
131 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
132 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
133 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
134 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
135 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
140 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
141 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
142 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
143 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
147 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
148 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
149 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
150 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
151 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
152 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
153 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
160 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
161 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
162 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
163 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
164 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
165 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
166 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
167 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
168 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
169 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
170 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
172 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
173 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
177 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
178 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
179 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
180 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
182 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
183 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
184 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
185 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
186 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
187 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
188 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
203 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
204 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
205 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
206 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
207 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
208 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
209 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
210 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
211 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
212 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
213 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
214 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
221 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
262 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
263 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
264 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
272 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
273 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
274 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
275 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
276 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
277 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
278 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
281 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
282 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
283 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
284 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
285 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
289 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
291 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
309 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
310 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
313 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
314 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
315 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
316 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
324 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
333 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
334 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
338 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
339 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
340 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
341 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
342 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
343 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
344 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
345 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
355 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
356 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
360 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
416 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
417 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
418 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
426 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
427 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
428 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
429 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
432 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
433 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
434 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
435 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
436 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
437 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
444 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
445 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
446 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
447 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
448 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
449 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
450 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
451 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
452 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
453 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
454 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
455 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
456 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
457 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
458 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
459 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
463 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
464 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
465 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
466 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
467 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
468 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
469 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
475 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
476 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
477 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
480 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
481 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
482 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
483 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
484 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
485 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
486 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
487 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
488 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
489 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
490 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
491 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
492 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.64
Metatranscriptomes 0
Isolates 16.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.28
Nodule 13.19
Rhizoplane 5.48
Rhizosphere 51.57
Stem 0
Stem Tuber 0
Unclassified 11.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10036620 3300001990 Bacteria 1515
2 JGI25159J45721_1015563 3300002987 Bacteria 1660
3 JGI25151J46595_10015149 3300003187 Bacteria 3413
4 JGI25406J46586_10005513 3300003203 Bacteria 5861
5 JGI25153J46596_10000054 3300003215 Bacteria 136806
6 JGI25153J46596_10000956 3300003215 Bacteria 17526
7 JGI25160J50197_1001301 3300003354 Bacteria 12602
8 JGI25160J50197_1007787 3300003354 Bacteria 4149
9 JGI25407J50210_10050528 3300003373 Bacteria 1055
10 JGI25404J52841_10001679 3300003659 Bacteria 3981
11 JGI25404J52841_10007890 3300003659 Bacteria 2258
12 JGI25404J52841_10016775 3300003659 Bacteria 1588
13 JGI25404J52841_10017971 3300003659 Bacteria 1532
14 JGI25404J52841_10028950 3300003659 Bacteria 1188
15 Ga0055530_10034137 3300003791 Bacteria 1303
16 Ga0055531_10015224 3300003794 Bacteria 3407
17 Ga0055543_1026967 3300004625 Bacteria 1019
18 Ga0065165_1000209 3300005262 Bacteria 101834
19 Ga0065165_1001615 3300005262 Bacteria 22970
20 Ga0070676_10158355 3300005328 Bacteria 1455
21 Ga0070676_10284344 3300005328 Bacteria 1116
22 Ga0068869_100041248 3300005334 Bacteria 3304
23 Ga0068869_100500095 3300005334 Bacteria 1015
24 Ga0070680_100165691 3300005336 Bacteria 1858
25 Ga0070682_100329151 3300005337 Bacteria 1131
26 Ga0068868_100281999 3300005338 Bacteria 1406
27 Ga0070661_100439146 3300005344 Bacteria 1037
28 Ga0070661_100468257 3300005344 Bacteria 1004
29 Ga0070668_100010301 3300005347 Bacteria 6941
30 Ga0070668_100273119 3300005347 Bacteria 1409
31 Ga0070668_100413572 3300005347 Bacteria 1154
32 Ga0070671_100015721 3300005355 Bacteria 6115
33 Ga0070671_100232728 3300005355 Bacteria 1564
34 Ga0070673_100141675 3300005364 Bacteria 2028
35 Ga0070709_10024373 3300005434 Bacteria 3560
36 Ga0070713_100016644 3300005436 Bacteria 5532
37 Ga0070713_100131716 3300005436 Bacteria 2206
38 Ga0070713_100283233 3300005436 Bacteria 1521
39 Ga0070713_100356634 3300005436 Bacteria 1358
40 Ga0070710_10015274 3300005437 Bacteria 3884
41 Ga0070710_10130051 3300005437 Bacteria 1534
42 Ga0070711_100027855 3300005439 Bacteria 3713
43 Ga0070711_100029811 3300005439 Bacteria 3605
44 Ga0070711_100039402 3300005439 Bacteria 3183
45 Ga0070700_100113941 3300005441 Bacteria 1802
46 Ga0070694_100129746 3300005444 Bacteria 1819
47 Ga0070708_100432756 3300005445 Bacteria 1241
48 Ga0070663_100022613 3300005455 Bacteria 4206
49 Ga0070663_100048502 3300005455 Bacteria 3011
50 Ga0070663_100237153 3300005455 Bacteria 1438
51 Ga0070678_100011505 3300005456 Bacteria 5464
52 Ga0070662_100002137 3300005457 Bacteria 12120
53 Ga0070681_10007037 3300005458 Bacteria 10953
54 Ga0068867_100000068 3300005459 Bacteria 62945
55 Ga0070685_10197036 3300005466 Bacteria 1307
56 Ga0070697_100380141 3300005536 Bacteria 1223
57 Ga0068853_100093623 3300005539 Bacteria 2645
58 Ga0068853_100143194 3300005539 Bacteria 2147
59 Ga0068853_100268278 3300005539 Bacteria 1571
60 Ga0070672_100001670 3300005543 Bacteria 13824
61 Ga0070693_100082763 3300005547 Bacteria 1917
62 Ga0070665_100094396 3300005548 Bacteria 2996
63 Ga0070665_100096246 3300005548 Bacteria 2965
64 Ga0070665_100226316 3300005548 Bacteria 1871
65 Ga0070665_100279086 3300005548 Bacteria 1672
66 Ga0070665_100758004 3300005548 Bacteria 984
67 Ga0070704_100534816 3300005549 Bacteria 1022
68 Ga0068855_100022315 3300005563 Bacteria 7584
69 Ga0068855_100295151 3300005563 Bacteria 1796
70 Ga0070664_100058232 3300005564 Bacteria 3286
71 Ga0070664_100071706 3300005564 Bacteria 2969
72 Ga0068857_100150119 3300005577 Bacteria 2111
73 Ga0068857_100238070 3300005577 Bacteria 1666
74 Ga0068854_100122932 3300005578 Bacteria 1973
75 Ga0068856_100021869 3300005614 Bacteria 6216
76 Ga0068856_100114758 3300005614 Bacteria 2693
77 Ga0068852_100074444 3300005616 Bacteria 2991
78 Ga0068864_100148006 3300005618 Bacteria 2125
79 Ga0068861_100164970 3300005719 Bacteria 1831
80 Ga0068861_100189381 3300005719 Bacteria 1719
81 Ga0068863_100510328 3300005841 Bacteria 1185
82 Ga0068858_100110771 3300005842 Bacteria 2563
83 Ga0068860_100087844 3300005843 Bacteria 2959
84 Ga0068862_100100829 3300005844 Bacteria 2525
85 Ga0081455_10000257 3300005937 Bacteria 69896
86 Ga0081455_10013857 3300005937 Bacteria 7929
87 Ga0081455_10027984 3300005937 Bacteria 5156
88 Ga0081455_10029417 3300005937 Bacteria 5009
89 Ga0081455_10029943 3300005937 Bacteria 4955
90 Ga0081455_10045454 3300005937 Bacteria 3820
91 Ga0081538_10008909 3300005981 Bacteria 8435
92 Ga0081540_1000022 3300005983 Bacteria 161205
93 Ga0081540_1000731 3300005983 Bacteria 30244
94 Ga0081540_1002537 3300005983 Bacteria 14812
95 Ga0081540_1003164 3300005983 Bacteria 13135
96 Ga0081540_1005764 3300005983 Bacteria 9169
97 Ga0081540_1006159 3300005983 Bacteria 8798
98 Ga0081540_1013773 3300005983 Bacteria 5238
99 Ga0081540_1016629 3300005983 Bacteria 4593
100 Ga0081540_1027170 3300005983 Bacteria 3248
101 Ga0081540_1048913 3300005983 Bacteria 2114
102 Ga0081540_1059871 3300005983 Bacteria 1825
103 Ga0081540_1111576 3300005983 Bacteria 1155
104 Ga0081539_10000437 3300005985 Bacteria 88848
105 Ga0081539_10000979 3300005985 Bacteria 53212
106 Ga0081539_10001065 3300005985 Bacteria 50187
107 Ga0075365_10134234 3300006038 Bacteria 1714
108 Ga0075368_10002266 3300006042 Bacteria 6250
109 Ga0075363_100021002 3300006048 Bacteria 3282
110 Ga0075364_10039676 3300006051 Bacteria 3053
111 Ga0075364_10055260 3300006051 Bacteria 2597
112 Ga0075364_10067640 3300006051 Bacteria 2348
113 Ga0075364_10072819 3300006051 Bacteria 2264
114 Ga0075364_10358796 3300006051 Bacteria 994
115 Ga0070712_100095561 3300006175 Bacteria 2187
116 Ga0075367_10000751 3300006178 Bacteria 12637
117 Ga0075367_10078465 3300006178 Bacteria 1994
118 Ga0075369_10005862 3300006186 Bacteria 4617
119 Ga0075366_10057364 3300006195 Bacteria 2314
120 Ga0075366_10072598 3300006195 Bacteria 2051
121 Ga0075366_10232792 3300006195 Bacteria 1123
122 Ga0097621_100266531 3300006237 Bacteria 1504
123 Ga0097621_100406530 3300006237 Bacteria 1220
124 Ga0068871_100325248 3300006358 Bacteria 1355
125 Ga0075430_100000274 3300006846 Bacteria 36446
126 Ga0075434_100308096 3300006871 Bacteria 1604
127 Ga0075434_100863103 3300006871 Bacteria 920
128 Ga0075429_100009612 3300006880 Bacteria 8387
129 Ga0099824_1002487 3300006942 Bacteria 26950
130 Ga0099822_1001480 3300006943 Bacteria 27484
131 Ga0075435_100057062 3300007076 Bacteria 3158
132 Ga0099794_10070996 3300007265 Bacteria 1706
133 Ga0105240_10316569 3300009093 Bacteria 1780
134 Ga0111539_10103570 3300009094 Bacteria 3340
135 Ga0111539_10634956 3300009094 Bacteria 1243
136 Ga0105245_10043869 3300009098 Bacteria 3990
137 Ga0105247_10128943 3300009101 Bacteria 1647
138 Ga0105243_10001337 3300009148 Bacteria 21977
139 Ga0105243_10066172 3300009148 Bacteria 2906
140 Ga0105243_10140580 3300009148 Bacteria 2059
141 Ga0105241_10084858 3300009174 Bacteria 2487
142 Ga0105241_10101607 3300009174 Bacteria 2286
143 Ga0105242_10071448 3300009176 Bacteria 2880
144 Ga0105242_10763168 3300009176 Bacteria 953
145 Ga0105248_10077818 3300009177 Bacteria 3729
146 Ga0105248_10793869 3300009177 Bacteria 1068
147 Ga0105248_11129975 3300009177 Bacteria 886
148 Ga0105237_10014818 3300009545 Bacteria 8137
149 Ga0105237_10256008 3300009545 Bacteria 1753
150 Ga0105238_10071974 3300009551 Bacteria 3454
151 Ga0105238_10486559 3300009551 Bacteria 1234
152 Ga0105249_10283871 3300009553 Bacteria 1654
153 Ga0105249_10422258 3300009553 Bacteria 1367
154 Ga0105239_10186038 3300010375 Bacteria 2324
155 Ga0105239_10292263 3300010375 Bacteria 1835
156 Ga0105239_10320821 3300010375 Bacteria 1747
157 Ga0105239_11373187 3300010375 Bacteria 815
158 Ga0105246_10019289 3300011119 Bacteria 4356
159 Ga0105246_10059196 3300011119 Bacteria 2656
160 Ga0157374_10098561 3300013296 Bacteria 2799
161 Ga0157378_10371040 3300013297 Bacteria 1403
162 Ga0163162_10131585 3300013306 Bacteria 2610
163 Ga0157375_10693484 3300013308 Bacteria 1172
164 Ga0163163_10303413 3300014325 Bacteria 1649
165 Ga0163163_10622470 3300014325 Bacteria 1143
166 Ga0163163_10714150 3300014325 Bacteria 1066
167 Ga0157377_10000082 3300014745 Bacteria 74078
168 Ga0157377_10055070 3300014745 Bacteria 2254
169 Ga0157377_10167977 3300014745 Bacteria 1370
170 Ga0157379_10030359 3300014968 Bacteria 4811
171 Ga0157379_10993677 3300014968 Bacteria 800
172 Ga0157376_10261411 3300014969 Bacteria 1622
173 Ga0163161_10191240 3300017792 Bacteria 1574
174 Ga0213876_10087979 3300021384 Bacteria 1645
175 Ga0213876_10088910 3300021384 Bacteria 1636
176 Ga0213875_10168988 3300021388 Bacteria 1027
177 Ga0213871_10000629 3300021441 Bacteria 5034
178 Ga0213871_10023614 3300021441 Bacteria 1550
179 Ga0209148_1000537 3300025254 Bacteria 36806
180 Ga0209233_1002379 3300025261 Bacteria 6966
181 Ga0209455_1002053 3300025272 Bacteria 8145
182 Ga0209130_1000080 3300025284 Bacteria 166684
183 Ga0209130_1000631 3300025284 Bacteria 33098
184 Ga0209025_1000741 3300025294 Bacteria 55042
185 Ga0209025_1006130 3300025294 Bacteria 9476
186 Ga0209564_1002134 3300025295 Bacteria 16725
187 Ga0209758_1000048 3300025297 Bacteria 358400
188 Ga0209758_1000063 3300025297 Bacteria 315999
189 Ga0209758_1005830 3300025297 Bacteria 9203
190 Ga0209758_1012479 3300025297 Bacteria 4753
191 Ga0209758_1024417 3300025297 Bacteria 2694
192 Ga0207426_1000080 3300025302 Bacteria 304917
193 Ga0207426_1000278 3300025302 Bacteria 105775
194 Ga0207426_1000434 3300025302 Bacteria 68127
195 Ga0207426_1016917 3300025302 Bacteria 2603
196 Ga0207426_1026198 3300025302 Bacteria 1956
197 Ga0209051_1043612 3300025303 Bacteria 1572
198 Ga0209257_1000334 3300025304 Bacteria 98054
199 Ga0209257_1025936 3300025304 Bacteria 1989
200 Ga0209257_1038945 3300025304 Bacteria 1434
201 Ga0207692_10050633 3300025898 Bacteria 2102
202 Ga0207692_10198248 3300025898 Bacteria 1179
203 Ga0207688_10009448 3300025901 Bacteria 5307
204 Ga0207647_10002905 3300025904 Bacteria 12903
205 Ga0207699_10009741 3300025906 Bacteria 4796
206 Ga0207699_10073539 3300025906 Bacteria 2097
207 Ga0207699_10110199 3300025906 Bacteria 1763
208 Ga0207684_10654611 3300025910 Bacteria 895
209 Ga0207707_10028963 3300025912 Bacteria 4840
210 Ga0207671_10096147 3300025914 Bacteria 2238
211 Ga0207671_10188273 3300025914 Bacteria 1608
212 Ga0207671_10399010 3300025914 Bacteria 1094
213 Ga0207693_10015503 3300025915 Bacteria 6114
214 Ga0207693_10060889 3300025915 Bacteria 2957
215 Ga0207693_10538787 3300025915 Bacteria 911
216 Ga0207663_10017868 3300025916 Bacteria 3961
217 Ga0207657_10087243 3300025919 Bacteria 2611
218 Ga0207657_10385343 3300025919 Bacteria 1103
219 Ga0207649_10501256 3300025920 Bacteria 923
220 Ga0207681_10074914 3300025923 Bacteria 2373
221 Ga0207681_10449277 3300025923 Bacteria 1048
222 Ga0207694_10088200 3300025924 Bacteria 2445
223 Ga0207694_10170564 3300025924 Bacteria 1762
224 Ga0207687_10020973 3300025927 Bacteria 4338
225 Ga0207700_10012573 3300025928 Bacteria 5467
226 Ga0207700_10031294 3300025928 Bacteria 3778
227 Ga0207700_10055741 3300025928 Bacteria 2972
228 Ga0207700_10226913 3300025928 Bacteria 1586
229 Ga0207664_10481186 3300025929 Bacteria 1110
230 Ga0207644_10284074 3300025931 Bacteria 1329
231 Ga0207706_10000870 3300025933 Bacteria 31103
232 Ga0207706_10027409 3300025933 Bacteria 5093
233 Ga0207709_10000935 3300025935 Bacteria 21921
234 Ga0207670_10282391 3300025936 Bacteria 1294
235 Ga0207711_10208842 3300025941 Bacteria 1783
236 Ga0207689_10019627 3300025942 Bacteria 5697
237 Ga0207689_10499258 3300025942 Bacteria 1019
238 Ga0207679_10103279 3300025945 Bacteria 2233
239 Ga0207667_10050515 3300025949 Bacteria 4387
240 Ga0207667_10078982 3300025949 Bacteria 3410
241 Ga0207651_10179600 3300025960 Bacteria 1678
242 Ga0207668_10122093 3300025972 Bacteria 1974
243 Ga0207668_10478151 3300025972 Bacteria 1068
244 Ga0207677_10153346 3300026023 Bacteria 1781
245 Ga0207677_10667299 3300026023 Bacteria 919
246 Ga0207639_10286933 3300026041 Bacteria 1450
247 Ga0207639_10411858 3300026041 Bacteria 1220
248 Ga0207678_10007112 3300026067 Bacteria 9927
249 Ga0207678_10041583 3300026067 Bacteria 3985
250 Ga0207678_10044234 3300026067 Bacteria 3852
251 Ga0207678_10092531 3300026067 Bacteria 2584
252 Ga0207678_10274304 3300026067 Bacteria 1447
253 Ga0207708_10195038 3300026075 Bacteria 1614
254 Ga0207702_10305376 3300026078 Bacteria 1511
255 Ga0207648_10000942 3300026089 Bacteria 32855
256 Ga0207648_10418282 3300026089 Bacteria 1217
257 Ga0207676_10225068 3300026095 Bacteria 1673
258 Ga0207674_10047170 3300026116 Bacteria 4419
259 Ga0207674_10068754 3300026116 Bacteria 3563
260 Ga0207675_100175512 3300026118 Bacteria 2050
261 Ga0207675_100206135 3300026118 Bacteria 1890
262 Ga0207683_10019537 3300026121 Bacteria 5786
263 Ga0207698_10086451 3300026142 Bacteria 2550
264 Ga0207698_10206167 3300026142 Bacteria 1765
265 Ga0209589_1000001 3300027357 Bacteria 794224
266 Ga0209489_100001 3300027361 Bacteria 794224
267 Ga0209700_100001 3300027363 Bacteria 794224
268 Ga0209588_1021413 3300027671 Bacteria 2031
269 Ga0207428_10004660 3300027907 Bacteria 12987
270 Ga0268266_10098912 3300028379 Bacteria 2567
271 Ga0268266_10678846 3300028379 Bacteria 992
272 Ga0268265_10070482 3300028380 Bacteria 2719
273 Ga0268265_10136887 3300028380 Bacteria 2044
274 Ga0268264_10244044 3300028381 Bacteria 1665
275 Ga0307515_10054386 3300028794 Bacteria 5878
276 Ga0307515_10105384 3300028794 Bacteria 3358
277 Ga0265338_10000014 3300028800 Bacteria 378751
278 Ga0307512_10038687 3300030522 Bacteria 4009
279 Ga0265330_10008460 3300031235 Bacteria 4952
280 Ga0265332_10002568 3300031238 Bacteria 9199
281 Ga0265328_10002067 3300031239 Bacteria 9063
282 Ga0265328_10007332 3300031239 Bacteria 4603
283 Ga0265325_10000013 3300031241 Bacteria 142935
284 Ga0265329_10006602 3300031242 Bacteria 4591
285 Ga0265339_10001198 3300031249 Bacteria 19545
286 Ga0265339_10091130 3300031249 Bacteria 1598
287 Ga0265339_10110529 3300031249 Bacteria 1422
288 Ga0265331_10000885 3300031250 Bacteria 24307
289 Ga0265331_10008911 3300031250 Bacteria 5676
290 Ga0307513_10017182 3300031456 Bacteria 8683
291 Ga0307513_10138015 3300031456 Bacteria 2370
292 Ga0307509_10139933 3300031507 Bacteria 2358
293 Ga0265313_10003504 3300031595 Bacteria 12648
294 Ga0307508_10001988 3300031616 Bacteria 22347
295 Ga0265314_10000610 3300031711 Bacteria 44130
296 Ga0265314_10007230 3300031711 Bacteria 9652
297 Ga0265342_10024701 3300031712 Bacteria 3790
298 Ga0307516_10001957 3300031730 Bacteria 28200
299 Ga0307516_10015472 3300031730 Bacteria 8025
300 Ga0307516_10129471 3300031730 Bacteria 2304
301 Ga0307412_10519068 3300031911 Bacteria 995
302 Ga0307510_10100044 3300033180 Bacteria 2695
303 Ga0315911_1000006 3300033442 Bacteria 414563
304 Ga0373923_0012177 3300035111 Bacteria 3173
305 Ga0373953_0022623 3300035117 Bacteria 2372
306 Ga0373957_0050829 3300035120 Bacteria 1585
307 Ga0373924_0033430 3300035410 Bacteria 2076
308 Ga0373927_0312032 3300035695 Bacteria 1035
309 Ga0373933_0004938 3300035724 Bacteria 7272
310 Ga0373947_0045026 3300035725 Bacteria 2640
311 Ga0373937_0002003 3300036401 Bacteria 17035
312 Ga0373925_0128015 3300037068 Bacteria 1977
313 Ga0395900_0104784 3300037418 Bacteria 2906
314 Ga0395900_0157448 3300037418 Bacteria 2320
315 Ga0395905_0055415 3300037471 Bacteria 3710
316 Ga0395905_0200798 3300037471 Bacteria 1869
317 Ga0395905_0208280 3300037471 Bacteria 1832
318 Ga0395905_0232271 3300037471 Bacteria 1725
319 Ga0395905_0662800 3300037471 Bacteria 945
320 Ga0436364_0765298 3300037853 Bacteria 1266
321 Ga0395901_0142980 3300038443 Bacteria 2515
322 Ga0237819_07428 3300038705 Bacteria 1575
323 Ga0436365_0194098 3300039437 Bacteria 5543
324 Ga0436365_0824955 3300039437 Bacteria 878
325 Ga0436365_0862796 3300039437 Bacteria 5828
326 Ga0436365_0888520 3300039437 Bacteria 2524
327 Ga0436365_1135457 3300039437 Bacteria 1977
328 Ga0436360_0172085 3300039438 Bacteria 5059
329 Ga0436360_1140127 3300039438 Bacteria 4267
330 Ga0436360_1237858 3300039438 Bacteria 2840
331 Ga0436360_1320220 3300039438 Bacteria 1916
332 Ga0436363_1060761 3300039450 Bacteria 979
333 Ga0436362_0759359 3300039453 Bacteria 2841
334 Ga0439465_0061168 3300041413 Bacteria 1248
335 Ga0451802_1475528 3300041460 Bacteria 1178
336 Ga0451804_0672755 3300041463 Bacteria 1193
337 Ga0451833_0772404 3300041491 Bacteria 1075
338 Ga0451837_0827062 3300041494 Bacteria 792
339 Ga0451841_1126302 3300041498 Bacteria 1071
340 Ga0439454_026369 3300042011 Bacteria 888
341 Ga0450898_017548 3300042134 Bacteria 1232
342 Ga0451577_0043580 3300042876 Bacteria 4019
343 Ga0453683_0151324 3300044673 Bacteria 1466
344 Ga0466963_0210585 3300044694 Bacteria 1360
345 Ga0466968_0092520 3300044735 Bacteria 1342
346 Ga0466960_0172169 3300044901 Bacteria 1169
347 Ga0466958_0010641 3300045836 Bacteria 5158
348 Ga0495592_0006749 3300046454 Bacteria 8558
349 Ga0495603_0310149 3300046455 Bacteria 906
350 Ga0495590_0031972 3300046457 Bacteria 1841
351 Ga0495629_0087079 3300046459 Bacteria 2179
352 Ga0495638_0032998 3300046460 Bacteria 3313
353 Ga0495638_0181996 3300046460 Bacteria 1198
354 Ga0495638_0201579 3300046460 Bacteria 1123
355 Ga0495651_0000265 3300046462 Bacteria 40572
356 Ga0495653_0080879 3300046463 Bacteria 2402
357 Ga0495605_0107265 3300046474 Bacteria 1278
358 Ga0495584_0002607 3300046491 Bacteria 10158
359 Ga0495584_0087712 3300046491 Bacteria 1568
360 Ga0495585_0005504 3300046492 Bacteria 7971
361 Ga0495585_0091472 3300046492 Bacteria 1638
362 Ga0495594_0000553 3300046499 Bacteria 19140
363 Ga0495596_0058284 3300046500 Bacteria 1506
364 Ga0495607_0173427 3300046501 Bacteria 1087
365 Ga0495583_0102024 3300046506 Bacteria 1224
366 Ga0495606_0028926 3300046507 Bacteria 3900
367 Ga0495606_0063971 3300046507 Bacteria 2343
368 Ga0495608_0000435 3300046511 Bacteria 29113
369 Ga0495616_0047203 3300046513 Bacteria 2170
370 Ga0495620_0008241 3300046515 Bacteria 5605
371 Ga0495628_0208285 3300046516 Bacteria 1471
372 Ga0495631_0003300 3300046518 Bacteria 8876
373 Ga0495632_0141763 3300046519 Bacteria 1114
374 Ga0495637_0053329 3300046520 Bacteria 1684
375 Ga0495643_0017241 3300046522 Bacteria 4226
376 Ga0495643_0022296 3300046522 Bacteria 3616
377 Ga0495643_0039269 3300046522 Bacteria 2589
378 Ga0495666_0086697 3300046526 Bacteria 1479
379 Ga0495642_0222226 3300046528 Bacteria 825
380 Ga0495654_0041619 3300046530 Bacteria 2284
381 Ga0495587_0002595 3300046536 Bacteria 12066
382 Ga0495587_0167702 3300046536 Bacteria 1248
383 Ga0495645_0247456 3300046543 Bacteria 1186
384 Ga0495622_0009294 3300046557 Bacteria 4549
385 Ga0495667_0000817 3300046559 Bacteria 20052
386 Ga0495656_0152029 3300046615 Bacteria 1119
387 Ga0495668_0081240 3300046616 Bacteria 1779
388 Ga0495668_0117430 3300046616 Bacteria 1455
389 Ga0495634_0017385 3300046642 Bacteria 5132
390 Ga0495634_0273880 3300046642 Bacteria 1027
391 Ga0495611_0001995 3300046648 Bacteria 9666
392 Ga0495611_0085325 3300046648 Bacteria 1456
393 Ga0495625_0031645 3300046660 Bacteria 3932
394 Ga0495625_0212942 3300046660 Bacteria 1269
395 Ga0495635_0079050 3300046663 Bacteria 2251
396 Ga0495661_0016887 3300046665 Bacteria 4824
397 Ga0495661_0043463 3300046665 Bacteria 2761
398 Ga0495588_0059472 3300046674 Bacteria 1977
399 Ga0495657_0019625 3300046675 Bacteria 4875
400 Ga0495599_0016230 3300046678 Bacteria 4623
401 Ga0495646_0056521 3300046680 Bacteria 2352
402 Ga0495646_0161340 3300046680 Bacteria 1241
403 Ga0495670_0013358 3300046691 Bacteria 4040
404 Ga0495670_0284080 3300046691 Bacteria 885
405 Ga0495649_0187408 3300046694 Bacteria 1078
406 Ga0495589_0108024 3300046794 Bacteria 1344
407 Ga0495600_0034239 3300046809 Bacteria 3297
408 Ga0495636_0006052 3300047318 Bacteria 4748
409 Ga0495636_0158802 3300047318 Bacteria 1018
410 Ga0495674_0001917 3300047319 Bacteria 20530
411 Ga0495672_0015183 3300047320 Bacteria 5240
412 Ga0495672_0060742 3300047320 Bacteria 2181
413 Ga0495676_0219762 3300047321 Bacteria 1310
414 Ga0495680_0002679 3300047322 Bacteria 17978
415 Ga0495683_0010346 3300047323 Bacteria 4933
416 Ga0495681_0022146 3300047470 Bacteria 3408
417 Ga0495684_0110372 3300047471 Bacteria 2076
418 Ga0495602_0006478 3300048088 Bacteria 12283
419 Ga0495602_0361756 3300048088 Bacteria 1044
420 Ga0495626_0033417 3300048091 Bacteria 2466
421 Ga0495626_0037111 3300048091 Bacteria 2318
422 Ga0496100_0076608 3300048903 Bacteria 2246
423 Ga0496100_0111614 3300048903 Bacteria 1900
424 Ga0496101_0048304 3300048904 Bacteria 3058
425 Ga0496101_0481478 3300048904 Bacteria 980
426 Ga0496102_0024579 3300048905 Bacteria 5356
427 Ga0496102_0076340 3300048905 Bacteria 3082
428 Ga0496102_0227341 3300048905 Bacteria 1759
429 Ga0496102_0743858 3300048905 Bacteria 903
430 Ga0496103_0004525 3300048906 Bacteria 8424
431 Ga0496104_0131643 3300048907 Bacteria 2403
432 Ga0496104_0162889 3300048907 Bacteria 2139
433 Ga0496105_0016638 3300048908 Bacteria 5872
434 Ga0496105_0140766 3300048908 Bacteria 1986
435 Ga0496105_0173137 3300048908 Bacteria 1769
436 Ga0496105_0181504 3300048908 Bacteria 1723
437 Ga0496105_0226044 3300048908 Bacteria 1522
438 Ga0496106_0747093 3300048909 Bacteria 778
439 Ga0496107_0047996 3300048910 Bacteria 3075
440 Ga0496107_0189421 3300048910 Bacteria 1528
441 Ga0496107_0509818 3300048910 Bacteria 892
442 Ga0496108_0078632 3300048911 Bacteria 2792
443 Ga0496108_0294495 3300048911 Bacteria 1413
444 Ga0496108_0468669 3300048911 Bacteria 1100
445 Ga0496109_0073761 3300048912 Bacteria 3136
446 Ga0496109_0380482 3300048912 Bacteria 1333
447 Ga0496110_0099098 3300048913 Bacteria 2613
448 Ga0496111_0100564 3300048914 Bacteria 2124
449 Ga0496112_0087644 3300048915 Bacteria 3080
450 Ga0496112_0232736 3300048915 Bacteria 1797
451 Ga0496112_0291307 3300048915 Bacteria 1578
452 Ga0496113_0063282 3300048916 Bacteria 2796
453 Ga0496113_0138505 3300048916 Bacteria 1914
454 Ga0496113_0212430 3300048916 Bacteria 1540
455 Ga0496113_0665888 3300048916 Bacteria 832
456 Ga0496114_0033255 3300048917 Bacteria 4248
457 Ga0496114_0426805 3300048917 Bacteria 1174
458 Ga0496115_0078247 3300048918 Bacteria 2690
459 Ga0496115_0402689 3300048918 Bacteria 1110
460 Ga0496116_0001246 3300048919 Bacteria 29566
461 Ga0496116_0071370 3300048919 Bacteria 2199
462 Ga0496117_0126906 3300048920 Bacteria 1555
463 Ga0496117_0220779 3300048920 Bacteria 1055
464 Ga0496117_0283669 3300048920 Bacteria 885
465 Ga0496118_0008413 3300048921 Bacteria 10670
466 Ga0496118_0031802 3300048921 Bacteria 4365
467 Ga0496118_0096034 3300048921 Bacteria 2021
468 Ga0496118_0349612 3300048921 Bacteria 788
469 Ga0496119_0040086 3300048922 Bacteria 3001
470 Ga0496119_0084016 3300048922 Bacteria 1826
471 Ga0496121_0000128 3300048924 Bacteria 168457
472 Ga0496121_0007261 3300048924 Bacteria 13411
473 Ga0496121_0011114 3300048924 Bacteria 10045
474 Ga0496121_0082455 3300048924 Bacteria 2542
475 Ga0496121_0092406 3300048924 Bacteria 2359
476 Ga0496121_0168109 3300048924 Bacteria 1596
477 Ga0496121_0387587 3300048924 Bacteria 919
478 Ga0496123_0059427 3300048926 Bacteria 2472
479 Ga0496124_0082437 3300048927 Bacteria 2640
480 Ga0496125_0002221 3300048928 Bacteria 25866
481 Ga0496125_0018095 3300048928 Bacteria 6697
482 Ga0496125_0020298 3300048928 Bacteria 6237
483 Ga0496125_0241456 3300048928 Bacteria 1147
484 Ga0496125_0291833 3300048928 Bacteria 1004
485 Ga0496126_0001652 3300048929 Bacteria 33559
486 Ga0496126_0007875 3300048929 Bacteria 11602
487 Ga0496126_0011734 3300048929 Bacteria 9026
488 Ga0496126_0035142 3300048929 Bacteria 4700
489 Ga0496126_0063436 3300048929 Bacteria 3312
490 Ga0496126_0090099 3300048929 Bacteria 2699
491 Ga0496126_0112336 3300048929 Bacteria 2372
492 Ga0496126_0154903 3300048929 Bacteria 1961
493 Ga0496126_0200151 3300048929 Bacteria 1687
494 Ga0495682_0016730 3300049460 Bacteria 2775
495 Ga0495682_0021357 3300049460 Bacteria 2426
496 Ga0501032_0088942 3300049569 Bacteria 2050
497 Ga0501033_0099934 3300049570 Bacteria 2117
498 Ga0501034_0227742 3300049571 Bacteria 1814
499 Ga0501037_0062226 3300049573 Bacteria 2721
500 Ga0501037_0194164 3300049573 Bacteria 1437
501 Ga0501038_0214285 3300049574 Bacteria 1539
502 Ga0501038_0343607 3300049574 Bacteria 1163
503 Ga0501038_0547087 3300049574 Bacteria 881
504 Ga0501039_0162354 3300049575 Bacteria 1756
505 Ga0501041_0125962 3300049577 Bacteria 1594
506 Ga0501043_0135090 3300049579 Bacteria 1932
507 Ga0501046_0164151 3300049580 Bacteria 1669
508 Ga0501046_0194142 3300049580 Bacteria 1513
509 Ga0501047_0012850 3300049581 Bacteria 7933
510 Ga0501048_0200526 3300049582 Bacteria 1414
511 Ga0501068_0079456 3300049584 Bacteria 2011
512 Ga0501070_0014522 3300049586 Bacteria 6626
513 Ga0501072_0090791 3300049588 Bacteria 2425
514 Ga0501072_0241440 3300049588 Bacteria 1439
515 Ga0501073_0167038 3300049589 Bacteria 1523
516 Ga0501074_0020328 3300049590 Bacteria 4826
517 Ga0501074_0061355 3300049590 Bacteria 2709
518 Ga0501077_0137313 3300049593 Bacteria 1550
519 Ga0501080_0018253 3300049742 Bacteria 6492
520 Ga0501080_0079213 3300049742 Bacteria 3054
521 Ga0501080_0096336 3300049742 Bacteria 2747
522 Ga0501081_0064170 3300049743 Bacteria 2550
523 Ga0501083_0007632 3300049744 Bacteria 7666
524 Ga0501083_0073549 3300049744 Bacteria 2272
525 Ga0501035_0299740 3300049822 Bacteria 1354
526 Ga0501035_0312878 3300049822 Bacteria 1321
527 Ga0501044_0135193 3300049823 Bacteria 2457
528 Ga0501044_0350221 3300049823 Bacteria 1396
529 Ga0501044_0429262 3300049823 Bacteria 1231
530 Ga0501045_0119876 3300049824 Bacteria 1953
531 nmdc:mga03n38_123817_c1 3300050490 Bacteria 1274
532 nmdc:mga03n38_38606_c1 3300050490 Bacteria 2066
533 nmdc:mga00v17_120073_c1 3300050491 Bacteria 1673
534 nmdc:mga0yw44_27139_c1 3300050492 Bacteria 3277
535 nmdc:mga0yw44_37656_c1 3300050492 Bacteria 2857
536 nmdc:mga0k408_100882_c1 3300050493 Bacteria 1702
537 nmdc:mga0k408_132851_c1 3300050493 Bacteria 1478
538 nmdc:mga06z11_3102_c1 3300050494 Bacteria 6410
539 nmdc:mga06z11_78311_c1 3300050494 Bacteria 1767
540 nmdc:mga06z11_83197_c1 3300050494 Bacteria 1722
541 nmdc:mga07m45_115639_c1 3300050496 Bacteria 1547
542 nmdc:mga07m45_178454_c1 3300050496 Bacteria 1235
543 nmdc:mga07m45_61539_c1 3300050496 Bacteria 2126
544 nmdc:mga09592_11937_c1 3300050508 Bacteria 7068
545 nmdc:mga0qj67_347_c1 3300050509 Bacteria 31880
546 nmdc:mga08y16_7449_c1 3300050511 Bacteria 11464
547 nmdc:mga0n895_821039_c1 3300050512 Bacteria 919
548 nmdc:mga0rr50_597139_c1 3300050513 Bacteria 941
549 nmdc:mga0a205_375835_c1 3300050515 Bacteria 1286
550 nmdc:mga0sz30_77963_c1 3300050516 Bacteria 1432
551 Ga0495601_0150526 3300053077 Bacteria 1519
552 Ga0495612_0004824 3300053078 Bacteria 5584
553 Ga0500635_0065227 3300053080 Bacteria 1280
554 Ga0495595_0002519 3300053084 Bacteria 7189
555 Ga0495619_0022890 3300053085 Bacteria 4000
556 Ga0495619_0271241 3300053085 Unclassified 1176
557 Ga0500578_0120259 3300053086 Bacteria 1651
558 Ga0500578_0133003 3300053086 Bacteria 1559
559 Ga0500643_000035 3300053087 Bacteria 184794
560 Ga0500643_015992 3300053087 Bacteria 2558
561 Ga0500644_0000965 3300053088 Bacteria 8999
562 Ga0500651_0004300 3300053093 Bacteria 7955
563 Ga0500651_0032093 3300053093 Bacteria 3310
564 Ga0500651_0400152 3300053093 Bacteria 771
565 Ga0500566_0000463 3300053094 Bacteria 22603
566 Ga0500566_0000995 3300053094 Bacteria 16308
567 Ga0500566_0004916 3300053094 Bacteria 7963
568 Ga0500641_0034361 3300053096 Bacteria 2017
569 Ga0500650_0002012 3300053098 Bacteria 6497
570 Ga0500650_0099855 3300053098 Bacteria 1358
571 Ga0500554_001390 3300053102 Bacteria 4682
572 Ga0500555_001337 3300053103 Bacteria 7735
573 Ga0500555_012842 3300053103 Bacteria 2412
574 Ga0500556_0000051 3300053104 Bacteria 119031
575 Ga0500556_0055006 3300053104 Bacteria 1450
576 Ga0500557_000004 3300053105 Bacteria 202318
577 Ga0500562_014289 3300053108 Bacteria 2033
578 Ga0500562_015517 3300053108 Bacteria 1954
579 Ga0500569_056487 3300053109 Bacteria 1200
580 Ga0500595_001628 3300053119 Bacteria 11788
581 Ga0500595_001671 3300053119 Bacteria 11662
582 Ga0500595_006726 3300053119 Bacteria 4848
583 Ga0500595_008583 3300053119 Bacteria 4169
584 Ga0500595_008810 3300053119 Bacteria 4101
585 Ga0500595_009047 3300053119 Bacteria 4041
586 Ga0500595_011726 3300053119 Bacteria 3416
587 Ga0500595_017722 3300053119 Bacteria 2622
588 Ga0500595_020522 3300053119 Bacteria 2377
589 Ga0500595_056922 3300053119 Bacteria 1193
590 Ga0500621_076191 3300053126 Bacteria 1349
591 Ga0500642_0000041 3300053130 Bacteria 89564
592 Ga0500642_0000124 3300053130 Bacteria 35205
593 Ga0500642_0000963 3300053130 Bacteria 8262
594 Ga0500642_0180726 3300053130 Bacteria 986
595 Ga0500652_000004 3300053131 Bacteria 173428
596 Ga0500652_004929 3300053131 Bacteria 4172
597 Ga0500652_085835 3300053131 Bacteria 1312
598 Ga0500658_0007535 3300053134 Bacteria 4023
599 Ga0500658_0022139 3300053134 Bacteria 2412
600 Ga0500658_0090635 3300053134 Bacteria 1321
601 Ga0500559_0001229 3300053136 Bacteria 15171
602 Ga0500568_0005321 3300053139 Bacteria 6674
603 Ga0500568_0030262 3300053139 Bacteria 2242
604 Ga0500577_0042640 3300053142 Bacteria 1663
605 Ga0500577_0165643 3300053142 Bacteria 943
606 Ga0500586_020822 3300053145 Bacteria 2059
607 Ga0500590_023968 3300053148 Bacteria 3167
608 Ga0500604_0002804 3300053151 Bacteria 4731
609 Ga0500604_0005114 3300053151 Bacteria 3466
610 Ga0500604_0025918 3300053151 Bacteria 1688
611 Ga0500616_0000150 3300053153 Bacteria 117918
612 Ga0500616_0000481 3300053153 Bacteria 51776
613 Ga0500616_0003206 3300053153 Bacteria 12701
614 Ga0500616_0010846 3300053153 Bacteria 5432
615 Ga0500616_0220612 3300053153 Bacteria 827
616 Ga0500622_0000502 3300053156 Bacteria 36464
617 Ga0500622_0004375 3300053156 Bacteria 8909
618 Ga0500622_0008776 3300053156 Bacteria 5629
619 Ga0500633_0088997 3300053160 Bacteria 1126
620 Ga0500634_0125150 3300053161 Bacteria 1244
621 Ga0500638_001049 3300053162 Bacteria 8082
622 Ga0500636_0004222 3300053177 Bacteria 8138
623 Ga0500636_0005500 3300053177 Bacteria 7240
624 Ga0500636_0037828 3300053177 Bacteria 2854
625 Ga0500637_0000377 3300053178 Bacteria 16875
626 Ga0500637_0020362 3300053178 Bacteria 3592
627 Ga0500625_011730 3300053729 Bacteria 3990
628 Ga0500645_033205 3300053730 Bacteria 1545
629 Ga0500645_036609 3300053730 Bacteria 1460
630 Ga0500609_000884 3300053731 Bacteria 4491
631 Ga0500609_016761 3300053731 Bacteria 995
632 Ga0500601_000616 3300053737 Bacteria 5041
633 Ga0501084_0121215 3300054114 Bacteria 2199
634 Ga0500661_000708 3300055283 Bacteria 6227
635 Ga0500661_016040 3300055283 Bacteria 1342
636 Ga0501082_0088996 3300060353 Bacteria 2665
637 Ga0501082_0126524 3300060353 Bacteria 2216
638 Ga0501082_0283461 3300060353 Bacteria 1442
639 Ga0530510_0032181 3300061734 Bacteria 3771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0273880 Ga0495634_0273880_104_799 228
2 3300014745 Ga0157377_10055070 Ga0157377_100550702 229
3 iso_pu_bacteria 2585428062 2587755090 234
4 iso_pu_bacteria 2821443989 2821447601 234
5 3300014968 Ga0157379_10993677 Ga0157379_109936772 235
6 3300046526 Ga0495666_0086697 Ga0495666_0086697_193_930 236
7 3300046809 Ga0495600_0034239 Ga0495600_0034239_2569_3282 237
8 3300003373 JGI25407J50210_10050528 JGI25407J50210_100505282 238
9 3300005981 Ga0081538_10008909 Ga0081538_100089097 238
10 3300053093 Ga0500651_0400152 Ga0500651_0400152_18_734 238
11 3300053134 Ga0500658_0007535 Ga0500658_0007535_864_1592 238
12 iso_pu_bacteria 8019648815 8019658802 239
13 iso_pu_bacteria 2824671348 2824674941 240
14 iso_pu_bacteria 2824687955 2824691366 240
15 iso_pu_bacteria 8055909800 8055912416 241
16 3300010375 Ga0105239_10186038 Ga0105239_101860383 242
17 3300044673 Ga0453683_0151324 Ga0453683_0151324_32_787 242
18 3300030522 Ga0307512_10038687 Ga0307512_100386874 243
19 3300005563 Ga0068855_100022315 Ga0068855_1000223153 244
20 3300025949 Ga0207667_10078982 Ga0207667_100789823 244
21 3300049589 Ga0501073_0167038 Ga0501073_0167038_367_1122 244
22 3300049742 Ga0501080_0079213 Ga0501080_0079213_183_938 244
23 3300049744 Ga0501083_0073549 Ga0501083_0073549_1306_2061 244
24 3300054114 Ga0501084_0121215 Ga0501084_0121215_1012_1767 244
25 3300060353 Ga0501082_0283461 Ga0501082_0283461_345_1100 244
26 iso_pu_bacteria 2643221736 2644745997 244
27 iso_pu_bacteria 2841760612 2841765939 244
28 iso_pu_bacteria 2841911363 2841915586 244
29 iso_pu_bacteria 2841917233 2841920788 244
30 iso_pu_bacteria 2844104063 2844105705 244
31 iso_pu_bacteria 2851182111 2851187699 244
32 iso_pu_bacteria 2851246043 2851246061 244
33 iso_pu_bacteria 8057529695 8057531737 244
34 3300005437 Ga0070710_10130051 Ga0070710_101300512 245
35 3300005439 Ga0070711_100027855 Ga0070711_1000278556 245
36 3300006175 Ga0070712_100095561 Ga0070712_1000955612 245
37 3300025915 Ga0207693_10060889 Ga0207693_100608894 245
38 3300028379 Ga0268266_10678846 Ga0268266_106788462 245
39 3300031456 Ga0307513_10017182 Ga0307513_100171827 245
40 3300031730 Ga0307516_10001957 Ga0307516_100019573 245
41 3300009093 Ga0105240_10316569 Ga0105240_103165692 246
42 3300009148 Ga0105243_10140580 Ga0105243_101405802 246
43 3300009174 Ga0105241_10101607 Ga0105241_101016073 246
44 3300009177 Ga0105248_10793869 Ga0105248_107938691 246
45 3300009545 Ga0105237_10014818 Ga0105237_100148189 246
46 3300011119 Ga0105246_10059196 Ga0105246_100591962 246
47 3300037418 Ga0395900_0157448 Ga0395900_0157448_1392_2141 246
48 3300037471 Ga0395905_0208280 Ga0395905_0208280_31_780 246
49 3300037471 Ga0395905_0662800 Ga0395905_0662800_20_802 246
50 3300038443 Ga0395901_0142980 Ga0395901_0142980_1675_2424 246
51 3300041494 Ga0451837_0827062 Ga0451837_0827062_17_766 246
52 3300046455 Ga0495603_0310149 Ga0495603_0310149_98_847 246
53 3300046492 Ga0495585_0091472 Ga0495585_0091472_156_905 246
54 3300046522 Ga0495643_0039269 Ga0495643_0039269_417_1166 246
55 3300046528 Ga0495642_0222226 Ga0495642_0222226_34_783 246
56 3300046616 Ga0495668_0081240 Ga0495668_0081240_41_781 246
57 3300046616 Ga0495668_0117430 Ga0495668_0117430_657_1406 246
58 3300046674 Ga0495588_0059472 Ga0495588_0059472_749_1498 246
59 3300046694 Ga0495649_0187408 Ga0495649_0187408_174_923 246
60 3300048903 Ga0496100_0111614 Ga0496100_0111614_972_1721 246
61 3300048904 Ga0496101_0048304 Ga0496101_0048304_802_1551 246
62 3300048905 Ga0496102_0024579 Ga0496102_0024579_33_782 246
63 3300048905 Ga0496102_0743858 Ga0496102_0743858_35_784 246
64 3300048906 Ga0496103_0004525 Ga0496103_0004525_3712_4461 246
65 3300048907 Ga0496104_0162889 Ga0496104_0162889_902_1651 246
66 3300048908 Ga0496105_0173137 Ga0496105_0173137_864_1613 246
67 3300048908 Ga0496105_0226044 Ga0496105_0226044_522_1271 246
68 3300048910 Ga0496107_0509818 Ga0496107_0509818_141_881 246
69 3300048911 Ga0496108_0468669 Ga0496108_0468669_195_944 246
70 3300048912 Ga0496109_0073761 Ga0496109_0073761_197_946 246
71 3300048915 Ga0496112_0291307 Ga0496112_0291307_619_1368 246
72 3300048916 Ga0496113_0212430 Ga0496113_0212430_50_799 246
73 3300048918 Ga0496115_0402689 Ga0496115_0402689_184_933 246
74 3300048919 Ga0496116_0071370 Ga0496116_0071370_939_1688 246
75 3300048920 Ga0496117_0126906 Ga0496117_0126906_588_1337 246
76 3300048920 Ga0496117_0220779 Ga0496117_0220779_16_756 246
77 3300048921 Ga0496118_0031802 Ga0496118_0031802_2667_3416 246
78 3300048921 Ga0496118_0349612 Ga0496118_0349612_23_763 246
79 3300048922 Ga0496119_0084016 Ga0496119_0084016_658_1407 246
80 3300048924 Ga0496121_0387587 Ga0496121_0387587_67_816 246
81 3300048928 Ga0496125_0291833 Ga0496125_0291833_56_805 246
82 3300048929 Ga0496126_0200151 Ga0496126_0200151_271_1020 246
83 3300050490 nmdc:mga03n38_38606_c1 nmdc:mga03n38_38606_c1_555_1304 246
84 3300050492 nmdc:mga0yw44_37656_c1 nmdc:mga0yw44_37656_c1_1102_1851 246
85 3300050494 nmdc:mga06z11_3102_c1 nmdc:mga06z11_3102_c1_5026_5766 246
86 3300053080 Ga0500635_0065227 Ga0500635_0065227_514_1254 246
87 3300053087 Ga0500643_000035 Ga0500643_000035_38434_39183 246
88 3300053094 Ga0500566_0004916 Ga0500566_0004916_6963_7712 246
89 3300053102 Ga0500554_001390 Ga0500554_001390_677_1426 246
90 3300053103 Ga0500555_001337 Ga0500555_001337_4452_5201 246
91 3300053104 Ga0500556_0055006 Ga0500556_0055006_473_1222 246
92 3300053105 Ga0500557_000004 Ga0500557_000004_98878_99627 246
93 3300053108 Ga0500562_014289 Ga0500562_014289_560_1309 246
94 3300053119 Ga0500595_001628 Ga0500595_001628_6738_7487 246
95 3300053119 Ga0500595_017722 Ga0500595_017722_376_1125 246
96 3300053130 Ga0500642_0000124 Ga0500642_0000124_12584_13333 246
97 3300053134 Ga0500658_0090635 Ga0500658_0090635_191_940 246
98 3300053151 Ga0500604_0025918 Ga0500604_0025918_885_1634 246
99 3300053153 Ga0500616_0220612 Ga0500616_0220612_11_760 246
100 3300053156 Ga0500622_0004375 Ga0500622_0004375_6843_7592 246
101 3300053162 Ga0500638_001049 Ga0500638_001049_1370_2119 246
102 3300053178 Ga0500637_0000377 Ga0500637_0000377_11901_12650 246
103 3300053729 Ga0500625_011730 Ga0500625_011730_1120_1869 246
104 3300053730 Ga0500645_036609 Ga0500645_036609_68_817 246
105 3300053737 Ga0500601_000616 Ga0500601_000616_1774_2523 246
106 3300055283 Ga0500661_000708 Ga0500661_000708_3625_4374 246
107 3300055283 Ga0500661_016040 Ga0500661_016040_417_1166 246
108 3300003791 Ga0055530_10034137 Ga0055530_100341371 247
109 3300003794 Ga0055531_10015224 Ga0055531_100152242 247
110 3300005337 Ga0070682_100329151 Ga0070682_1003291512 247
111 3300005564 Ga0070664_100071706 Ga0070664_1000717062 247
112 3300021441 Ga0213871_10023614 Ga0213871_100236142 247
113 3300025303 Ga0209051_1043612 Ga0209051_10436122 247
114 3300025304 Ga0209257_1000334 Ga0209257_100033464 247
115 3300025910 Ga0207684_10654611 Ga0207684_106546112 247
116 3300028794 Ga0307515_10105384 Ga0307515_101053842 247
117 3300028800 Ga0265338_10000014 Ga0265338_10000014105 247
118 3300031241 Ga0265325_10000013 Ga0265325_1000001334 247
119 3300031249 Ga0265339_10001198 Ga0265339_100011984 247
120 3300031250 Ga0265331_10008911 Ga0265331_100089112 247
121 3300031595 Ga0265313_10003504 Ga0265313_100035043 247
122 3300031616 Ga0307508_10001988 Ga0307508_1000198817 247
123 3300037471 Ga0395905_0055415 Ga0395905_0055415_2521_3309 247
124 3300039438 Ga0436360_1237858 Ga0436360_1237858_1093_1836 247
125 3300042011 Ga0439454_026369 Ga0439454_026369_83_871 247
126 3300042134 Ga0450898_017548 Ga0450898_017548_13_780 247
127 3300042876 Ga0451577_0043580 Ga0451577_0043580_161_952 247
128 3300046491 Ga0495584_0002607 Ga0495584_0002607_9337_10107 247
129 3300046492 Ga0495585_0005504 Ga0495585_0005504_2976_3746 247
130 3300046499 Ga0495594_0000553 Ga0495594_0000553_5784_6554 247
131 3300046518 Ga0495631_0003300 Ga0495631_0003300_133_903 247
132 3300046648 Ga0495611_0001995 Ga0495611_0001995_3095_3865 247
133 3300046665 Ga0495661_0016887 Ga0495661_0016887_4003_4773 247
134 3300046691 Ga0495670_0013358 Ga0495670_0013358_2092_2862 247
135 3300047318 Ga0495636_0006052 Ga0495636_0006052_1012_1782 247
136 3300047319 Ga0495674_0001917 Ga0495674_0001917_14917_15687 247
137 3300047321 Ga0495676_0219762 Ga0495676_0219762_432_1202 247
138 3300047323 Ga0495683_0010346 Ga0495683_0010346_3302_4072 247
139 3300048915 Ga0496112_0232736 Ga0496112_0232736_549_1295 247
140 3300049574 Ga0501038_0547087 Ga0501038_0547087_14_757 247
141 3300053119 Ga0500595_006726 Ga0500595_006726_3003_3746 247
142 3300053119 Ga0500595_011726 Ga0500595_011726_1873_2616 247
143 3300053131 Ga0500652_000004 Ga0500652_000004_82304_83047 247
144 3300053177 Ga0500636_0005500 Ga0500636_0005500_2934_3677 247
145 iso_pu_bacteria 2904615490 2904616267 247
146 iso_pu_bacteria 2904615490 2904624898 247
147 3300002987 JGI25159J45721_1015563 JGI25159J45721_10155632 248
148 3300003215 JGI25153J46596_10000956 JGI25153J46596_100009563 248
149 3300003659 JGI25404J52841_10017971 JGI25404J52841_100179711 248
150 3300005262 Ga0065165_1000209 Ga0065165_100020986 248
151 3300005466 Ga0070685_10197036 Ga0070685_101970362 248
152 3300005983 Ga0081540_1000022 Ga0081540_100002235 248
153 3300005983 Ga0081540_1048913 Ga0081540_10489132 248
154 3300005985 Ga0081539_10000437 Ga0081539_100004373 248
155 3300006051 Ga0075364_10072819 Ga0075364_100728192 248
156 3300006846 Ga0075430_100000274 Ga0075430_1000002749 248
157 3300009094 Ga0111539_10634956 Ga0111539_106349562 248
158 3300010375 Ga0105239_11373187 Ga0105239_113731871 248
159 3300025254 Ga0209148_1000537 Ga0209148_100053729 248
160 3300025272 Ga0209455_1002053 Ga0209455_10020537 248
161 3300025284 Ga0209130_1000080 Ga0209130_100008041 248
162 3300025294 Ga0209025_1006130 Ga0209025_10061307 248
163 3300025297 Ga0209758_1000063 Ga0209758_1000063248 248
164 3300025302 Ga0207426_1016917 Ga0207426_10169172 248
165 3300025923 Ga0207681_10449277 Ga0207681_104492771 248
166 3300025936 Ga0207670_10282391 Ga0207670_102823912 248
167 3300031730 Ga0307516_10129471 Ga0307516_101294712 248
168 3300035111 Ga0373923_0012177 Ga0373923_0012177_749_1495 248
169 3300035117 Ga0373953_0022623 Ga0373953_0022623_166_912 248
170 3300035120 Ga0373957_0050829 Ga0373957_0050829_258_1004 248
171 3300035410 Ga0373924_0033430 Ga0373924_0033430_348_1094 248
172 3300035724 Ga0373933_0004938 Ga0373933_0004938_5544_6290 248
173 3300036401 Ga0373937_0002003 Ga0373937_0002003_6571_7317 248
174 3300037853 Ga0436364_0765298 Ga0436364_0765298_372_1118 248
175 3300038705 Ga0237819_07428 Ga0237819_07428_27_773 248
176 3300039437 Ga0436365_0862796 Ga0436365_0862796_3914_4663 248
177 3300046454 Ga0495592_0006749 Ga0495592_0006749_3761_4507 248
178 3300046460 Ga0495638_0032998 Ga0495638_0032998_1831_2580 248
179 3300046462 Ga0495651_0000265 Ga0495651_0000265_3678_4424 248
180 3300046463 Ga0495653_0080879 Ga0495653_0080879_936_1682 248
181 3300046511 Ga0495608_0000435 Ga0495608_0000435_4028_4774 248
182 3300046516 Ga0495628_0208285 Ga0495628_0208285_562_1308 248
183 3300046522 Ga0495643_0017241 Ga0495643_0017241_1167_1913 248
184 3300046536 Ga0495587_0002595 Ga0495587_0002595_9459_10205 248
185 3300046536 Ga0495587_0167702 Ga0495587_0167702_481_1227 248
186 3300046543 Ga0495645_0247456 Ga0495645_0247456_39_785 248
187 3300046559 Ga0495667_0000817 Ga0495667_0000817_18404_19150 248
188 3300046642 Ga0495634_0017385 Ga0495634_0017385_726_1472 248
189 3300046663 Ga0495635_0079050 Ga0495635_0079050_538_1284 248
190 3300046675 Ga0495657_0019625 Ga0495657_0019625_1744_2490 248
191 3300046678 Ga0495599_0016230 Ga0495599_0016230_1592_2338 248
192 3300046680 Ga0495646_0056521 Ga0495646_0056521_1088_1834 248
193 3300046680 Ga0495646_0161340 Ga0495646_0161340_25_771 248
194 3300047322 Ga0495680_0002679 Ga0495680_0002679_175_921 248
195 3300047471 Ga0495684_0110372 Ga0495684_0110372_1083_1829 248
196 3300048088 Ga0495602_0006478 Ga0495602_0006478_835_1581 248
197 3300048088 Ga0495602_0361756 Ga0495602_0361756_249_995 248
198 3300048905 Ga0496102_0227341 Ga0496102_0227341_846_1592 248
199 3300048913 Ga0496110_0099098 Ga0496110_0099098_248_994 248
200 3300048916 Ga0496113_0665888 Ga0496113_0665888_16_765 248
201 3300050509 nmdc:mga0qj67_347_c1 nmdc:mga0qj67_347_c1_17246_17992 248
202 3300053078 Ga0495612_0004824 Ga0495612_0004824_4566_5312 248
203 3300053084 Ga0495595_0002519 Ga0495595_0002519_4695_5441 248
204 3300053086 Ga0500578_0133003 Ga0500578_0133003_42_788 248
205 3300053119 Ga0500595_020522 Ga0500595_020522_914_1660 248
206 3300053119 Ga0500595_056922 Ga0500595_056922_42_788 248
207 3300053131 Ga0500652_085835 Ga0500652_085835_498_1244 248
208 3300053142 Ga0500577_0042640 Ga0500577_0042640_83_829 248
209 3300053153 Ga0500616_0010846 Ga0500616_0010846_79_825 248
210 3300053156 Ga0500622_0008776 Ga0500622_0008776_2447_3193 248
211 3300053177 Ga0500636_0004222 Ga0500636_0004222_5041_5787 248
212 3300003187 JGI25151J46595_10015149 JGI25151J46595_100151494 249
213 3300003215 JGI25153J46596_10000054 JGI25153J46596_1000005410 249
214 3300003354 JGI25160J50197_1007787 JGI25160J50197_10077873 249
215 3300005436 Ga0070713_100283233 Ga0070713_1002832332 249
216 3300005441 Ga0070700_100113941 Ga0070700_1001139412 249
217 3300005536 Ga0070697_100380141 Ga0070697_1003801411 249
218 3300005539 Ga0068853_100268278 Ga0068853_1002682782 249
219 3300005844 Ga0068862_100100829 Ga0068862_1001008293 249
220 3300005985 Ga0081539_10000979 Ga0081539_1000097942 249
221 3300006871 Ga0075434_100863103 Ga0075434_1008631031 249
222 3300006880 Ga0075429_100009612 Ga0075429_1000096125 249
223 3300009094 Ga0111539_10103570 Ga0111539_101035702 249
224 3300009177 Ga0105248_11129975 Ga0105248_111299751 249
225 3300009545 Ga0105237_10256008 Ga0105237_102560082 249
226 3300009551 Ga0105238_10486559 Ga0105238_104865592 249
227 3300025284 Ga0209130_1000631 Ga0209130_100063119 249
228 3300025294 Ga0209025_1000741 Ga0209025_100074142 249
229 3300025297 Ga0209758_1000048 Ga0209758_1000048108 249
230 3300025297 Ga0209758_1024417 Ga0209758_10244172 249
231 3300025302 Ga0207426_1000080 Ga0207426_100008028 249
232 3300025906 Ga0207699_10110199 Ga0207699_101101992 249
233 3300025914 Ga0207671_10188273 Ga0207671_101882732 249
234 3300026041 Ga0207639_10286933 Ga0207639_102869331 249
235 3300026075 Ga0207708_10195038 Ga0207708_101950382 249
236 3300027907 Ga0207428_10004660 Ga0207428_1000466011 249
237 3300028380 Ga0268265_10136887 Ga0268265_101368873 249
238 3300031235 Ga0265330_10008460 Ga0265330_100084602 249
239 3300031238 Ga0265332_10002568 Ga0265332_1000256810 249
240 3300031239 Ga0265328_10002067 Ga0265328_100020674 249
241 3300031239 Ga0265328_10007332 Ga0265328_100073326 249
242 3300031242 Ga0265329_10006602 Ga0265329_100066022 249
243 3300031249 Ga0265339_10091130 Ga0265339_100911301 249
244 3300031250 Ga0265331_10000885 Ga0265331_100008858 249
245 3300031711 Ga0265314_10000610 Ga0265314_1000061019 249
246 3300031712 Ga0265342_10024701 Ga0265342_100247014 249
247 3300035695 Ga0373927_0312032 Ga0373927_0312032_152_901 249
248 3300035725 Ga0373947_0045026 Ga0373947_0045026_415_1164 249
249 3300037068 Ga0373925_0128015 Ga0373925_0128015_385_1134 249
250 3300037418 Ga0395900_0104784 Ga0395900_0104784_57_806 249
251 3300039450 Ga0436363_1060761 Ga0436363_1060761_22_771 249
252 3300041413 Ga0439465_0061168 Ga0439465_0061168_136_885 249
253 3300041460 Ga0451802_1475528 Ga0451802_1475528_164_913 249
254 3300045836 Ga0466958_0010641 Ga0466958_0010641_4293_5081 249
255 3300046459 Ga0495629_0087079 Ga0495629_0087079_1305_2054 249
256 3300048908 Ga0496105_0181504 Ga0496105_0181504_117_866 249
257 3300048909 Ga0496106_0747093 Ga0496106_0747093_17_766 249
258 3300048916 Ga0496113_0138505 Ga0496113_0138505_696_1445 249
259 3300048917 Ga0496114_0426805 Ga0496114_0426805_394_1143 249
260 3300049577 Ga0501041_0125962 Ga0501041_0125962_357_1106 249
261 3300049588 Ga0501072_0090791 Ga0501072_0090791_507_1256 249
262 3300049590 Ga0501074_0061355 Ga0501074_0061355_1942_2691 249
263 3300049593 Ga0501077_0137313 Ga0501077_0137313_620_1369 249
264 3300049743 Ga0501081_0064170 Ga0501081_0064170_1236_1985 249
265 3300049822 Ga0501035_0312878 Ga0501035_0312878_34_783 249
266 3300049823 Ga0501044_0429262 Ga0501044_0429262_400_1149 249
267 3300049824 Ga0501045_0119876 Ga0501045_0119876_198_947 249
268 3300050508 nmdc:mga09592_11937_c1 nmdc:mga09592_11937_c1_4391_5140 249
269 3300050511 nmdc:mga08y16_7449_c1 nmdc:mga08y16_7449_c1_9022_9771 249
270 3300050512 nmdc:mga0n895_821039_c1 nmdc:mga0n895_821039_c1_95_844 249
271 3300050513 nmdc:mga0rr50_597139_c1 nmdc:mga0rr50_597139_c1_73_822 249
272 3300053085 Ga0495619_0022890 Ga0495619_0022890_444_1193 249
273 3300053085 Ga0495619_0271241 Ga0495619_0271241_281_1069 249
274 3300053086 Ga0500578_0120259 Ga0500578_0120259_689_1438 249
275 3300053103 Ga0500555_012842 Ga0500555_012842_1344_2105 249
276 3300053119 Ga0500595_001671 Ga0500595_001671_5721_6482 249
277 3300053130 Ga0500642_0000963 Ga0500642_0000963_6190_6951 249
278 3300053139 Ga0500568_0030262 Ga0500568_0030262_672_1427 249
279 3300053151 Ga0500604_0002804 Ga0500604_0002804_3304_4053 249
280 3300053151 Ga0500604_0005114 Ga0500604_0005114_1135_1884 249
281 3300053153 Ga0500616_0003206 Ga0500616_0003206_8940_9701 249
282 3300053731 Ga0500609_000884 Ga0500609_000884_779_1528 249
283 3300060353 Ga0501082_0088996 Ga0501082_0088996_25_774 249
284 3300061734 Ga0530510_0032181 Ga0530510_0032181_239_988 249
285 3300005336 Ga0070680_100165691 Ga0070680_1001656911 251
286 3300005457 Ga0070662_100002137 Ga0070662_10000213710 251
287 3300005458 Ga0070681_10007037 Ga0070681_100070377 251
288 3300006195 Ga0075366_10232792 Ga0075366_102327921 251
289 3300025912 Ga0207707_10028963 Ga0207707_100289634 251
290 3300025933 Ga0207706_10000870 Ga0207706_1000087015 251
291 3300044735 Ga0466968_0092520 Ga0466968_0092520_319_1125 251
292 3300044901 Ga0466960_0172169 Ga0466960_0172169_250_1056 251
293 3300049742 Ga0501080_0096336 Ga0501080_0096336_158_913 251
294 iso_pu_bacteria 2617270735 2617347123 251
295 iso_pu_bacteria 2874612657 2874619492 251
296 iso_pu_bacteria 2876761206 2876764796 251
297 3300025928 Ga0207700_10031294 Ga0207700_100312941 252
298 3300039438 Ga0436360_1320220 Ga0436360_1320220_932_1708 252
299 iso_pu_bacteria 2513237092 2513629145 252
300 iso_pu_bacteria 2513237098 2513674424 252
301 iso_pu_bacteria 2513237139 2513873016 252
302 iso_pu_bacteria 2513237161 2514015690 252
303 iso_pu_bacteria 2791355196 2793062721 252
304 iso_pu_bacteria 2802429603 2805915084 252
305 iso_pu_bacteria 2824696289 2824699453 252
306 iso_pu_bacteria 2824704595 2824712556 252
307 iso_pu_bacteria 2824753945 2824754227 252
308 iso_pu_bacteria 2824763712 2824768964 252
309 iso_pu_bacteria 2824773399 2824775383 252
310 iso_pu_bacteria 2838122688 2838123482 252
311 iso_pu_bacteria 2841941048 2841947745 252
312 iso_pu_bacteria 2841949485 2841949584 252
313 iso_pu_bacteria 2841966195 2841971911 252
314 iso_pu_bacteria 2841974524 2841974746 252
315 iso_pu_bacteria 2841983080 2841983694 252
316 iso_pu_bacteria 2847939898 2847946818 252
317 iso_pu_bacteria 2903768456 2903774439 252
318 iso_pu_bacteria 2904690495 2904694814 252
319 iso_pu_bacteria 2904711408 2904714950 252
320 iso_pu_bacteria 2908756301 2908760034 252
321 iso_pu_bacteria 2935648319 2935651014 252
322 iso_pu_bacteria 2935656913 2935659195 252
323 iso_pu_bacteria 2935984226 2935987468 252
324 iso_pu_bacteria 2936011229 2936013610 252
325 iso_pu_bacteria 2936019824 2936022263 252
326 iso_pu_bacteria 2936028420 2936030709 252
327 iso_pu_bacteria 2936046547 2936048522 252
328 iso_pu_bacteria 2936055302 2936058736 252
329 iso_pu_bacteria 3005474847 3005480491 252
330 iso_pu_bacteria 3005483717 3005484576 252
331 iso_pu_bacteria 8056689827 8056695717 252
332 3300005328 Ga0070676_10284344 Ga0070676_102843441 253
333 3300006178 Ga0075367_10078465 Ga0075367_100784652 253
334 3300014325 Ga0163163_10714150 Ga0163163_107141501 253
335 3300039437 Ga0436365_0888520 Ga0436365_0888520_1580_2341 253
336 3300039438 Ga0436360_1140127 Ga0436360_1140127_2150_2938 253
337 3300048903 Ga0496100_0076608 Ga0496100_0076608_752_1690 253
338 3300048904 Ga0496101_0481478 Ga0496101_0481478_44_832 253
339 3300048908 Ga0496105_0016638 Ga0496105_0016638_3067_3993 253
340 3300048910 Ga0496107_0047996 Ga0496107_0047996_1560_2498 253
341 3300048917 Ga0496114_0033255 Ga0496114_0033255_1522_2448 253
342 3300050494 nmdc:mga06z11_83197_c1 nmdc:mga06z11_83197_c1_456_1217 253
343 iso_pu_bacteria 2508501009 2508542402 253
344 iso_pu_bacteria 2508501042 2508691847 253
345 iso_pu_bacteria 2513237094 2513640638 253
346 iso_pu_bacteria 2513237096 2513657874 253
347 iso_pu_bacteria 2513237137 2513855574 253
348 iso_pu_bacteria 2513237145 2513920033 253
349 iso_pu_bacteria 2517093001 2517102793 253
350 iso_pu_bacteria 2517572143 2517892119 253
351 iso_pu_bacteria 2524023205 2524437601 253
352 iso_pu_bacteria 2524023228 2524534204 253
353 iso_pu_bacteria 2528768022 2528857024 253
354 iso_pu_bacteria 2602042107 2603862359 253
355 iso_pu_bacteria 2667528175 2671121843 253
356 iso_pu_bacteria 2728368998 2728751077 253
357 iso_pu_bacteria 2744054633 2745079535 253
358 iso_pu_bacteria 2791355197 2793068796 253
359 iso_pu_bacteria 2824661429 2824661433 253
360 iso_pu_bacteria 2841957949 2841964165 253
361 iso_pu_bacteria 2857524615 2857525751 253
362 iso_pu_bacteria 2874628541 2874632131 253
363 iso_pu_bacteria 2879099564 2879104537 253
364 iso_pu_bacteria 2893066018 2893067955 253
365 iso_pu_bacteria 2906610324 2906617248 253
366 iso_pu_bacteria 2906626472 2906633591 253
367 iso_pu_bacteria 2906635258 2906643361 253
368 iso_pu_bacteria 2906660503 2906662508 253
369 iso_pu_bacteria 2908739725 2908742399 253
370 iso_pu_bacteria 2919073203 2919074385 253
371 iso_pu_bacteria 2922368715 2922374702 253
372 iso_pu_bacteria 2932784394 2932788643 253
373 iso_pu_bacteria 2932794094 2932798099 253
374 iso_pu_bacteria 2932801729 2932807045 253
375 iso_pu_bacteria 2932809354 2932817421 253
376 iso_pu_bacteria 2932818245 2932826190 253
377 iso_pu_bacteria 2932828146 2932830291 253
378 iso_pu_bacteria 2935616580 2935616582 253
379 iso_pu_bacteria 2935630451 2935631256 253
380 iso_pu_bacteria 2935638405 2935642088 253
381 iso_pu_bacteria 2935665750 2935672528 253
382 iso_pu_bacteria 2935675223 2935676007 253
383 iso_pu_bacteria 2935684952 2935685999 253
384 iso_pu_bacteria 2935694250 2935697757 253
385 iso_pu_bacteria 2935703347 2935705839 253
386 iso_pu_bacteria 2935713505 2935714551 253
387 iso_pu_bacteria 2935722832 2935725170 253
388 iso_pu_bacteria 2935732158 2935732470 253
389 iso_pu_bacteria 2935741537 2935741849 253
390 iso_pu_bacteria 2935750917 2935751964 253
391 iso_pu_bacteria 2935760218 2935765221 253
392 iso_pu_bacteria 2935801545 2935802836 253
393 iso_pu_bacteria 2935810662 2935813332 253
394 iso_pu_bacteria 2935827899 2935830255 253
395 iso_pu_bacteria 2935837841 2935838152 253
396 iso_pu_bacteria 2935855204 2935855206 253
397 iso_pu_bacteria 2935864058 2935867531 253
398 iso_pu_bacteria 2935873716 2935875631 253
399 iso_pu_bacteria 2935883170 2935886828 253
400 iso_pu_bacteria 2935959822 2935960667 253
401 iso_pu_bacteria 2935992306 2935996314 253
402 iso_pu_bacteria 2936002035 2936003597 253
403 iso_pu_bacteria 2936037263 2936042281 253
404 iso_pu_bacteria 2940556831 2940557233 253
405 iso_pu_bacteria 2941507105 2941509997 253
406 iso_pu_bacteria 2941515067 2941518916 253
407 iso_pu_bacteria 2941523033 2941525396 253
408 iso_pu_bacteria 2941531003 2941533064 253
409 iso_pu_bacteria 2941538514 2941539181 253
410 iso_pu_bacteria 3005710791 3005715157 253
411 iso_pu_bacteria 8006933436 8006940288 253
412 iso_pu_bacteria 8006973647 8006980066 253
413 iso_pu_bacteria 8016511872 8016522016 253
414 iso_pu_bacteria 8017057580 8017063652 253
415 iso_pu_bacteria 8019576017 8019582979 253
416 iso_pu_bacteria 8019586578 8019590776 253
417 iso_pu_bacteria 8056681323 8056687348 253
418 3300005983 Ga0081540_1027170 Ga0081540_10271701 254
419 3300009553 Ga0105249_10422258 Ga0105249_104222582 254
420 3300031711 Ga0265314_10007230 Ga0265314_1000723010 254
421 3300048926 Ga0496123_0059427 Ga0496123_0059427_842_1627 254
422 3300004625 Ga0055543_1026967 Ga0055543_10269671 255
423 3300005262 Ga0065165_1001615 Ga0065165_100161510 255
424 3300014325 Ga0163163_10622470 Ga0163163_106224701 255
425 3300025302 Ga0207426_1000434 Ga0207426_100043423 255
426 3300048924 Ga0496121_0000128 Ga0496121_0000128_144812_145600 255
427 3300049573 Ga0501037_0194164 Ga0501037_0194164_232_1071 255
428 3300003659 JGI25404J52841_10016775 JGI25404J52841_100167752 256
429 3300005937 Ga0081455_10029943 Ga0081455_100299434 256
430 3300005983 Ga0081540_1003164 Ga0081540_10031648 256
431 3300006942 Ga0099824_1002487 Ga0099824_100248712 256
432 3300010375 Ga0105239_10320821 Ga0105239_103208212 256
433 3300025898 Ga0207692_10198248 Ga0207692_101982482 256
434 3300031456 Ga0307513_10138015 Ga0307513_101380153 256
435 3300031507 Ga0307509_10139933 Ga0307509_101399333 256
436 3300037471 Ga0395905_0200798 Ga0395905_0200798_236_1048 256
437 3300049460 Ga0495682_0021357 Ga0495682_0021357_1393_2193 256
438 3300053088 Ga0500644_0000965 Ga0500644_0000965_1904_2683 256
439 3300053093 Ga0500651_0032093 Ga0500651_0032093_1733_2512 256
440 3300053119 Ga0500595_008810 Ga0500595_008810_2365_3141 256
441 3300053153 Ga0500616_0000481 Ga0500616_0000481_8365_9144 256
442 3300001990 JGI24737J22298_10036620 JGI24737J22298_100366202 257
443 3300003203 JGI25406J46586_10005513 JGI25406J46586_100055134 257
444 3300003354 JGI25160J50197_1001301 JGI25160J50197_10013013 257
445 3300003659 JGI25404J52841_10001679 JGI25404J52841_100016794 257
446 3300003659 JGI25404J52841_10007890 JGI25404J52841_100078902 257
447 3300003659 JGI25404J52841_10028950 JGI25404J52841_100289502 257
448 3300005328 Ga0070676_10158355 Ga0070676_101583552 257
449 3300005334 Ga0068869_100041248 Ga0068869_1000412483 257
450 3300005334 Ga0068869_100500095 Ga0068869_1005000951 257
451 3300005338 Ga0068868_100281999 Ga0068868_1002819992 257
452 3300005344 Ga0070661_100439146 Ga0070661_1004391462 257
453 3300005344 Ga0070661_100468257 Ga0070661_1004682572 257
454 3300005347 Ga0070668_100010301 Ga0070668_1000103012 257
455 3300005347 Ga0070668_100273119 Ga0070668_1002731191 257
456 3300005347 Ga0070668_100413572 Ga0070668_1004135721 257
457 3300005355 Ga0070671_100015721 Ga0070671_1000157215 257
458 3300005355 Ga0070671_100232728 Ga0070671_1002327282 257
459 3300005364 Ga0070673_100141675 Ga0070673_1001416752 257
460 3300005434 Ga0070709_10024373 Ga0070709_100243733 257
461 3300005436 Ga0070713_100016644 Ga0070713_1000166442 257
462 3300005436 Ga0070713_100131716 Ga0070713_1001317161 257
463 3300005436 Ga0070713_100356634 Ga0070713_1003566342 257
464 3300005437 Ga0070710_10015274 Ga0070710_100152742 257
465 3300005439 Ga0070711_100029811 Ga0070711_1000298113 257
466 3300005439 Ga0070711_100039402 Ga0070711_1000394023 257
467 3300005444 Ga0070694_100129746 Ga0070694_1001297461 257
468 3300005445 Ga0070708_100432756 Ga0070708_1004327562 257
469 3300005455 Ga0070663_100022613 Ga0070663_1000226133 257
470 3300005455 Ga0070663_100048502 Ga0070663_1000485023 257
471 3300005455 Ga0070663_100237153 Ga0070663_1002371532 257
472 3300005456 Ga0070678_100011505 Ga0070678_1000115053 257
473 3300005459 Ga0068867_100000068 Ga0068867_10000006830 257
474 3300005539 Ga0068853_100093623 Ga0068853_1000936233 257
475 3300005539 Ga0068853_100143194 Ga0068853_1001431942 257
476 3300005543 Ga0070672_100001670 Ga0070672_1000016704 257
477 3300005547 Ga0070693_100082763 Ga0070693_1000827632 257
478 3300005548 Ga0070665_100094396 Ga0070665_1000943962 257
479 3300005548 Ga0070665_100096246 Ga0070665_1000962462 257
480 3300005548 Ga0070665_100226316 Ga0070665_1002263162 257
481 3300005548 Ga0070665_100279086 Ga0070665_1002790862 257
482 3300005548 Ga0070665_100758004 Ga0070665_1007580041 257
483 3300005549 Ga0070704_100534816 Ga0070704_1005348162 257
484 3300005563 Ga0068855_100295151 Ga0068855_1002951512 257
485 3300005564 Ga0070664_100058232 Ga0070664_1000582323 257
486 3300005577 Ga0068857_100150119 Ga0068857_1001501193 257
487 3300005577 Ga0068857_100238070 Ga0068857_1002380702 257
488 3300005578 Ga0068854_100122932 Ga0068854_1001229322 257
489 3300005614 Ga0068856_100021869 Ga0068856_1000218692 257
490 3300005614 Ga0068856_100114758 Ga0068856_1001147583 257
491 3300005616 Ga0068852_100074444 Ga0068852_1000744443 257
492 3300005618 Ga0068864_100148006 Ga0068864_1001480061 257
493 3300005719 Ga0068861_100164970 Ga0068861_1001649702 257
494 3300005719 Ga0068861_100189381 Ga0068861_1001893812 257
495 3300005841 Ga0068863_100510328 Ga0068863_1005103283 257
496 3300005842 Ga0068858_100110771 Ga0068858_1001107713 257
497 3300005843 Ga0068860_100087844 Ga0068860_1000878443 257
498 3300005937 Ga0081455_10000257 Ga0081455_1000025732 257
499 3300005937 Ga0081455_10013857 Ga0081455_100138576 257
500 3300005937 Ga0081455_10027984 Ga0081455_100279844 257
501 3300005937 Ga0081455_10029417 Ga0081455_100294172 257
502 3300005937 Ga0081455_10045454 Ga0081455_100454544 257
503 3300005983 Ga0081540_1000731 Ga0081540_100073124 257
504 3300005983 Ga0081540_1002537 Ga0081540_10025377 257
505 3300005983 Ga0081540_1005764 Ga0081540_10057646 257
506 3300005983 Ga0081540_1006159 Ga0081540_10061594 257
507 3300005983 Ga0081540_1013773 Ga0081540_10137733 257
508 3300005983 Ga0081540_1016629 Ga0081540_10166292 257
509 3300005983 Ga0081540_1059871 Ga0081540_10598712 257
510 3300005983 Ga0081540_1111576 Ga0081540_11115761 257
511 3300005985 Ga0081539_10001065 Ga0081539_1000106523 257
512 3300006038 Ga0075365_10134234 Ga0075365_101342342 257
513 3300006042 Ga0075368_10002266 Ga0075368_100022666 257
514 3300006048 Ga0075363_100021002 Ga0075363_1000210022 257
515 3300006051 Ga0075364_10039676 Ga0075364_100396762 257
516 3300006051 Ga0075364_10055260 Ga0075364_100552602 257
517 3300006051 Ga0075364_10067640 Ga0075364_100676403 257
518 3300006051 Ga0075364_10358796 Ga0075364_103587961 257
519 3300006178 Ga0075367_10000751 Ga0075367_100007514 257
520 3300006186 Ga0075369_10005862 Ga0075369_100058623 257
521 3300006195 Ga0075366_10057364 Ga0075366_100573642 257
522 3300006195 Ga0075366_10072598 Ga0075366_100725982 257
523 3300006237 Ga0097621_100266531 Ga0097621_1002665312 257
524 3300006237 Ga0097621_100406530 Ga0097621_1004065302 257
525 3300006358 Ga0068871_100325248 Ga0068871_1003252482 257
526 3300006871 Ga0075434_100308096 Ga0075434_1003080962 257
527 3300006943 Ga0099822_1001480 Ga0099822_10014806 257
528 3300007076 Ga0075435_100057062 Ga0075435_1000570623 257
529 3300007265 Ga0099794_10070996 Ga0099794_100709962 257
530 3300009098 Ga0105245_10043869 Ga0105245_100438694 257
531 3300009101 Ga0105247_10128943 Ga0105247_101289432 257
532 3300009148 Ga0105243_10001337 Ga0105243_100013378 257
533 3300009148 Ga0105243_10066172 Ga0105243_100661722 257
534 3300009174 Ga0105241_10084858 Ga0105241_100848583 257
535 3300009176 Ga0105242_10071448 Ga0105242_100714483 257
536 3300009176 Ga0105242_10763168 Ga0105242_107631681 257
537 3300009177 Ga0105248_10077818 Ga0105248_100778182 257
538 3300009551 Ga0105238_10071974 Ga0105238_100719742 257
539 3300009553 Ga0105249_10283871 Ga0105249_102838711 257
540 3300010375 Ga0105239_10292263 Ga0105239_102922632 257
541 3300011119 Ga0105246_10019289 Ga0105246_100192892 257
542 3300013296 Ga0157374_10098561 Ga0157374_100985613 257
543 3300013297 Ga0157378_10371040 Ga0157378_103710402 257
544 3300013306 Ga0163162_10131585 Ga0163162_101315852 257
545 3300013308 Ga0157375_10693484 Ga0157375_106934841 257
546 3300014325 Ga0163163_10303413 Ga0163163_103034132 257
547 3300014745 Ga0157377_10000082 Ga0157377_1000008240 257
548 3300014745 Ga0157377_10167977 Ga0157377_101679772 257
549 3300014968 Ga0157379_10030359 Ga0157379_100303593 257
550 3300014969 Ga0157376_10261411 Ga0157376_102614112 257
551 3300017792 Ga0163161_10191240 Ga0163161_101912401 257
552 3300021384 Ga0213876_10087979 Ga0213876_100879792 257
553 3300021384 Ga0213876_10088910 Ga0213876_100889101 257
554 3300021388 Ga0213875_10168988 Ga0213875_101689881 257
555 3300021441 Ga0213871_10000629 Ga0213871_100006295 257
556 3300025261 Ga0209233_1002379 Ga0209233_10023794 257
557 3300025295 Ga0209564_1002134 Ga0209564_10021349 257
558 3300025297 Ga0209758_1005830 Ga0209758_100583010 257
559 3300025297 Ga0209758_1012479 Ga0209758_10124792 257
560 3300025302 Ga0207426_1000278 Ga0207426_100027894 257
561 3300025302 Ga0207426_1026198 Ga0207426_10261982 257
562 3300025304 Ga0209257_1025936 Ga0209257_10259363 257
563 3300025304 Ga0209257_1038945 Ga0209257_10389452 257
564 3300025898 Ga0207692_10050633 Ga0207692_100506332 257
565 3300025901 Ga0207688_10009448 Ga0207688_100094482 257
566 3300025904 Ga0207647_10002905 Ga0207647_1000290510 257
567 3300025906 Ga0207699_10009741 Ga0207699_100097413 257
568 3300025906 Ga0207699_10073539 Ga0207699_100735392 257
569 3300025914 Ga0207671_10096147 Ga0207671_100961472 257
570 3300025914 Ga0207671_10399010 Ga0207671_103990102 257
571 3300025915 Ga0207693_10015503 Ga0207693_100155036 257
572 3300025915 Ga0207693_10538787 Ga0207693_105387871 257
573 3300025916 Ga0207663_10017868 Ga0207663_100178683 257
574 3300025919 Ga0207657_10087243 Ga0207657_100872433 257
575 3300025919 Ga0207657_10385343 Ga0207657_103853432 257
576 3300025920 Ga0207649_10501256 Ga0207649_105012561 257
577 3300025923 Ga0207681_10074914 Ga0207681_100749143 257
578 3300025924 Ga0207694_10088200 Ga0207694_100882002 257
579 3300025924 Ga0207694_10170564 Ga0207694_101705642 257
580 3300025927 Ga0207687_10020973 Ga0207687_100209733 257
581 3300025928 Ga0207700_10012573 Ga0207700_100125732 257
582 3300025928 Ga0207700_10055741 Ga0207700_100557412 257
583 3300025928 Ga0207700_10226913 Ga0207700_102269132 257
584 3300025929 Ga0207664_10481186 Ga0207664_104811862 257
585 3300025931 Ga0207644_10284074 Ga0207644_102840742 257
586 3300025933 Ga0207706_10027409 Ga0207706_100274094 257
587 3300025935 Ga0207709_10000935 Ga0207709_100009352 257
588 3300025941 Ga0207711_10208842 Ga0207711_102088421 257
589 3300025942 Ga0207689_10019627 Ga0207689_100196274 257
590 3300025942 Ga0207689_10499258 Ga0207689_104992582 257
591 3300025945 Ga0207679_10103279 Ga0207679_101032792 257
592 3300025949 Ga0207667_10050515 Ga0207667_100505153 257
593 3300025960 Ga0207651_10179600 Ga0207651_101796001 257
594 3300025972 Ga0207668_10122093 Ga0207668_101220932 257
595 3300025972 Ga0207668_10478151 Ga0207668_104781511 257
596 3300026023 Ga0207677_10153346 Ga0207677_101533462 257
597 3300026023 Ga0207677_10667299 Ga0207677_106672991 257
598 3300026041 Ga0207639_10411858 Ga0207639_104118582 257
599 3300026067 Ga0207678_10007112 Ga0207678_100071123 257
600 3300026067 Ga0207678_10041583 Ga0207678_100415834 257
601 3300026067 Ga0207678_10044234 Ga0207678_100442343 257
602 3300026067 Ga0207678_10092531 Ga0207678_100925313 257
603 3300026067 Ga0207678_10274304 Ga0207678_102743042 257
604 3300026078 Ga0207702_10305376 Ga0207702_103053762 257
605 3300026089 Ga0207648_10000942 Ga0207648_100009429 257
606 3300026089 Ga0207648_10418282 Ga0207648_104182821 257
607 3300026095 Ga0207676_10225068 Ga0207676_102250682 257
608 3300026116 Ga0207674_10047170 Ga0207674_100471702 257
609 3300026116 Ga0207674_10068754 Ga0207674_100687542 257
610 3300026118 Ga0207675_100175512 Ga0207675_1001755122 257
611 3300026118 Ga0207675_100206135 Ga0207675_1002061351 257
612 3300026121 Ga0207683_10019537 Ga0207683_100195374 257
613 3300026142 Ga0207698_10086451 Ga0207698_100864512 257
614 3300026142 Ga0207698_10206167 Ga0207698_102061672 257
615 3300027357 Ga0209589_1000001 Ga0209589_1000001188 257
616 3300027361 Ga0209489_100001 Ga0209489_100001188 257
617 3300027363 Ga0209700_100001 Ga0209700_100001188 257
618 3300027671 Ga0209588_1021413 Ga0209588_10214132 257
619 3300028379 Ga0268266_10098912 Ga0268266_100989122 257
620 3300028380 Ga0268265_10070482 Ga0268265_100704823 257
621 3300028381 Ga0268264_10244044 Ga0268264_102440441 257
622 3300028794 Ga0307515_10054386 Ga0307515_100543863 257
623 3300031249 Ga0265339_10110529 Ga0265339_101105293 257
624 3300031730 Ga0307516_10015472 Ga0307516_100154723 257
625 3300031911 Ga0307412_10519068 Ga0307412_105190681 257
626 3300033180 Ga0307510_10100044 Ga0307510_101000442 257
627 3300033442 Ga0315911_1000006 Ga0315911_1000006298 257
628 3300037471 Ga0395905_0232271 Ga0395905_0232271_805_1578 257
629 3300039437 Ga0436365_0194098 Ga0436365_0194098_1106_1909 257
630 3300039437 Ga0436365_0824955 Ga0436365_0824955_50_823 257
631 3300039437 Ga0436365_1135457 Ga0436365_1135457_821_1606 257
632 3300039438 Ga0436360_0172085 Ga0436360_0172085_2780_3553 257
633 3300039453 Ga0436362_0759359 Ga0436362_0759359_747_1520 257
634 3300041463 Ga0451804_0672755 Ga0451804_0672755_338_1120 257
635 3300041491 Ga0451833_0772404 Ga0451833_0772404_15_797 257
636 3300041498 Ga0451841_1126302 Ga0451841_1126302_13_819 257
637 3300044694 Ga0466963_0210585 Ga0466963_0210585_116_889 257
638 3300046457 Ga0495590_0031972 Ga0495590_0031972_706_1479 257
639 3300046460 Ga0495638_0181996 Ga0495638_0181996_364_1137 257
640 3300046460 Ga0495638_0201579 Ga0495638_0201579_212_985 257
641 3300046474 Ga0495605_0107265 Ga0495605_0107265_297_1070 257
642 3300046491 Ga0495584_0087712 Ga0495584_0087712_350_1123 257
643 3300046500 Ga0495596_0058284 Ga0495596_0058284_381_1154 257
644 3300046501 Ga0495607_0173427 Ga0495607_0173427_150_923 257
645 3300046506 Ga0495583_0102024 Ga0495583_0102024_118_900 257
646 3300046507 Ga0495606_0028926 Ga0495606_0028926_789_1562 257
647 3300046507 Ga0495606_0063971 Ga0495606_0063971_1144_1917 257
648 3300046513 Ga0495616_0047203 Ga0495616_0047203_80_853 257
649 3300046515 Ga0495620_0008241 Ga0495620_0008241_4547_5320 257
650 3300046519 Ga0495632_0141763 Ga0495632_0141763_319_1092 257
651 3300046520 Ga0495637_0053329 Ga0495637_0053329_839_1612 257
652 3300046522 Ga0495643_0022296 Ga0495643_0022296_2257_3030 257
653 3300046530 Ga0495654_0041619 Ga0495654_0041619_206_979 257
654 3300046557 Ga0495622_0009294 Ga0495622_0009294_2627_3400 257
655 3300046615 Ga0495656_0152029 Ga0495656_0152029_292_1065 257
656 3300046648 Ga0495611_0085325 Ga0495611_0085325_320_1093 257
657 3300046660 Ga0495625_0031645 Ga0495625_0031645_2114_2887 257
658 3300046660 Ga0495625_0212942 Ga0495625_0212942_81_854 257
659 3300046665 Ga0495661_0043463 Ga0495661_0043463_796_1569 257
660 3300046691 Ga0495670_0284080 Ga0495670_0284080_49_822 257
661 3300046794 Ga0495589_0108024 Ga0495589_0108024_225_998 257
662 3300047318 Ga0495636_0158802 Ga0495636_0158802_231_1004 257
663 3300047320 Ga0495672_0015183 Ga0495672_0015183_517_1290 257
664 3300047320 Ga0495672_0060742 Ga0495672_0060742_308_1099 257
665 3300047470 Ga0495681_0022146 Ga0495681_0022146_412_1185 257
666 3300048091 Ga0495626_0033417 Ga0495626_0033417_768_1541 257
667 3300048091 Ga0495626_0037111 Ga0495626_0037111_543_1316 257
668 3300048905 Ga0496102_0076340 Ga0496102_0076340_2105_2878 257
669 3300048907 Ga0496104_0131643 Ga0496104_0131643_676_1449 257
670 3300048908 Ga0496105_0140766 Ga0496105_0140766_579_1382 257
671 3300048910 Ga0496107_0189421 Ga0496107_0189421_230_1003 257
672 3300048911 Ga0496108_0078632 Ga0496108_0078632_1226_2029 257
673 3300048911 Ga0496108_0294495 Ga0496108_0294495_140_913 257
674 3300048912 Ga0496109_0380482 Ga0496109_0380482_16_789 257
675 3300048914 Ga0496111_0100564 Ga0496111_0100564_777_1550 257
676 3300048915 Ga0496112_0087644 Ga0496112_0087644_130_933 257
677 3300048916 Ga0496113_0063282 Ga0496113_0063282_1083_1856 257
678 3300048918 Ga0496115_0078247 Ga0496115_0078247_495_1271 257
679 3300048919 Ga0496116_0001246 Ga0496116_0001246_17728_18501 257
680 3300048920 Ga0496117_0283669 Ga0496117_0283669_89_862 257
681 3300048921 Ga0496118_0008413 Ga0496118_0008413_7284_8057 257
682 3300048921 Ga0496118_0096034 Ga0496118_0096034_769_1542 257
683 3300048922 Ga0496119_0040086 Ga0496119_0040086_509_1282 257
684 3300048924 Ga0496121_0007261 Ga0496121_0007261_8518_9291 257
685 3300048924 Ga0496121_0011114 Ga0496121_0011114_3322_4095 257
686 3300048924 Ga0496121_0082455 Ga0496121_0082455_40_825 257
687 3300048924 Ga0496121_0092406 Ga0496121_0092406_1428_2201 257
688 3300048924 Ga0496121_0168109 Ga0496121_0168109_22_795 257
689 3300048927 Ga0496124_0082437 Ga0496124_0082437_1288_2061 257
690 3300048928 Ga0496125_0002221 Ga0496125_0002221_5243_6016 257
691 3300048928 Ga0496125_0018095 Ga0496125_0018095_5124_5897 257
692 3300048928 Ga0496125_0020298 Ga0496125_0020298_3648_4421 257
693 3300048928 Ga0496125_0241456 Ga0496125_0241456_179_961 257
694 3300048929 Ga0496126_0001652 Ga0496126_0001652_23790_24572 257
695 3300048929 Ga0496126_0007875 Ga0496126_0007875_3335_4108 257
696 3300048929 Ga0496126_0011734 Ga0496126_0011734_8221_8994 257
697 3300048929 Ga0496126_0035142 Ga0496126_0035142_795_1568 257
698 3300048929 Ga0496126_0063436 Ga0496126_0063436_1348_2121 257
699 3300048929 Ga0496126_0090099 Ga0496126_0090099_241_1014 257
700 3300048929 Ga0496126_0112336 Ga0496126_0112336_1392_2174 257
701 3300048929 Ga0496126_0154903 Ga0496126_0154903_590_1363 257
702 3300049460 Ga0495682_0016730 Ga0495682_0016730_1934_2707 257
703 3300049569 Ga0501032_0088942 Ga0501032_0088942_122_895 257
704 3300049570 Ga0501033_0099934 Ga0501033_0099934_1165_1938 257
705 3300049571 Ga0501034_0227742 Ga0501034_0227742_602_1375 257
706 3300049573 Ga0501037_0062226 Ga0501037_0062226_1358_2179 257
707 3300049574 Ga0501038_0214285 Ga0501038_0214285_24_845 257
708 3300049574 Ga0501038_0343607 Ga0501038_0343607_247_1020 257
709 3300049575 Ga0501039_0162354 Ga0501039_0162354_321_1094 257
710 3300049579 Ga0501043_0135090 Ga0501043_0135090_520_1293 257
711 3300049580 Ga0501046_0164151 Ga0501046_0164151_590_1363 257
712 3300049580 Ga0501046_0194142 Ga0501046_0194142_574_1347 257
713 3300049581 Ga0501047_0012850 Ga0501047_0012850_4527_5300 257
714 3300049582 Ga0501048_0200526 Ga0501048_0200526_544_1317 257
715 3300049584 Ga0501068_0079456 Ga0501068_0079456_418_1191 257
716 3300049586 Ga0501070_0014522 Ga0501070_0014522_5469_6242 257
717 3300049588 Ga0501072_0241440 Ga0501072_0241440_419_1240 257
718 3300049590 Ga0501074_0020328 Ga0501074_0020328_4037_4810 257
719 3300049742 Ga0501080_0018253 Ga0501080_0018253_3543_4316 257
720 3300049744 Ga0501083_0007632 Ga0501083_0007632_2955_3776 257
721 3300049822 Ga0501035_0299740 Ga0501035_0299740_186_959 257
722 3300049823 Ga0501044_0135193 Ga0501044_0135193_1273_2046 257
723 3300049823 Ga0501044_0350221 Ga0501044_0350221_35_808 257
724 3300050490 nmdc:mga03n38_123817_c1 nmdc:mga03n38_123817_c1_362_1135 257
725 3300050491 nmdc:mga00v17_120073_c1 nmdc:mga00v17_120073_c1_279_1052 257
726 3300050492 nmdc:mga0yw44_27139_c1 nmdc:mga0yw44_27139_c1_958_1731 257
727 3300050493 nmdc:mga0k408_100882_c1 nmdc:mga0k408_100882_c1_378_1151 257
728 3300050493 nmdc:mga0k408_132851_c1 nmdc:mga0k408_132851_c1_426_1199 257
729 3300050494 nmdc:mga06z11_78311_c1 nmdc:mga06z11_78311_c1_646_1419 257
730 3300050496 nmdc:mga07m45_115639_c1 nmdc:mga07m45_115639_c1_470_1243 257
731 3300050496 nmdc:mga07m45_178454_c1 nmdc:mga07m45_178454_c1_25_798 257
732 3300050496 nmdc:mga07m45_61539_c1 nmdc:mga07m45_61539_c1_489_1262 257
733 3300050515 nmdc:mga0a205_375835_c1 nmdc:mga0a205_375835_c1_370_1143 257
734 3300050516 nmdc:mga0sz30_77963_c1 nmdc:mga0sz30_77963_c1_475_1248 257
735 3300053077 Ga0495601_0150526 Ga0495601_0150526_699_1472 257
736 3300053087 Ga0500643_015992 Ga0500643_015992_856_1629 257
737 3300053093 Ga0500651_0004300 Ga0500651_0004300_3671_4444 257
738 3300053094 Ga0500566_0000463 Ga0500566_0000463_13938_14711 257
739 3300053094 Ga0500566_0000995 Ga0500566_0000995_8977_9759 257
740 3300053096 Ga0500641_0034361 Ga0500641_0034361_1065_1838 257
741 3300053098 Ga0500650_0002012 Ga0500650_0002012_2141_2914 257
742 3300053098 Ga0500650_0099855 Ga0500650_0099855_100_873 257
743 3300053104 Ga0500556_0000051 Ga0500556_0000051_41191_41964 257
744 3300053108 Ga0500562_015517 Ga0500562_015517_445_1218 257
745 3300053109 Ga0500569_056487 Ga0500569_056487_377_1150 257
746 3300053119 Ga0500595_008583 Ga0500595_008583_1993_2766 257
747 3300053119 Ga0500595_009047 Ga0500595_009047_1452_2225 257
748 3300053126 Ga0500621_076191 Ga0500621_076191_266_1039 257
749 3300053130 Ga0500642_0000041 Ga0500642_0000041_9065_9838 257
750 3300053130 Ga0500642_0180726 Ga0500642_0180726_162_935 257
751 3300053131 Ga0500652_004929 Ga0500652_004929_985_1758 257
752 3300053134 Ga0500658_0022139 Ga0500658_0022139_1088_1861 257
753 3300053136 Ga0500559_0001229 Ga0500559_0001229_12395_13168 257
754 3300053139 Ga0500568_0005321 Ga0500568_0005321_3837_4610 257
755 3300053142 Ga0500577_0165643 Ga0500577_0165643_22_795 257
756 3300053145 Ga0500586_020822 Ga0500586_020822_256_1029 257
757 3300053148 Ga0500590_023968 Ga0500590_023968_454_1227 257
758 3300053153 Ga0500616_0000150 Ga0500616_0000150_40943_41716 257
759 3300053156 Ga0500622_0000502 Ga0500622_0000502_13302_14075 257
760 3300053160 Ga0500633_0088997 Ga0500633_0088997_333_1106 257
761 3300053161 Ga0500634_0125150 Ga0500634_0125150_28_801 257
762 3300053177 Ga0500636_0037828 Ga0500636_0037828_891_1673 257
763 3300053178 Ga0500637_0020362 Ga0500637_0020362_2266_3039 257
764 3300053730 Ga0500645_033205 Ga0500645_033205_437_1210 257
765 3300053731 Ga0500609_016761 Ga0500609_016761_137_910 257
766 3300060353 Ga0501082_0126524 Ga0501082_0126524_337_1158 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06314

ADC

Acetoacetate decarboxylase (ADC)

26

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.9647 18 244
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9495 1 244
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.946 1 244
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9382 1 244
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9348 1 244
ID Description Score Start End Superfamily
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9634 13 244 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9551 13 244 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.877 11 243 2.40.400.10
4jmcB00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8467 11 244 2.40.400.10
3cmbA00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8306 21 242 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A2T4YKU7-F1-model_v4 Acetoacetate decarboxylase 0.9731 1 244 GO:0016829
AF-A0A2A6PQI3-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9724 1 254 GO:0047602
AF-A0A4R2LM89-F1-model_v4 Acetoacetate decarboxylase 0.9724 1 244 GO:0016829
AF-A0A4R7BWF3-F1-model_v4 Acetoacetate decarboxylase 0.9707 1 244 GO:0016829
AF-A0A257P8C1-F1-model_v4 Acetoacetate decarboxylase 0.9703 75 244 GO:0016829

Feature Viewer

pLDDT pTM Quality
90.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map