F479873
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 492 | 639 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0194164|Ga0501037_0194164_232_1071 |
| Length | 279 |
| Sequence | MTALQSGRASIPGKVPPLNKADVLKLPSMPAAGPSYPAGPYRFINREYMVITYETDAAEIAEQLPEPLEPLDRPLVHYEWIRMPDSTGFGSYTESGVVIPCRLPKDLGGEEVNFVSQMYLDDDPPIVAGREIWGFPKKYAHPKLEIVKDTLTGTLEYAGQQVAMGTMGYKHESMAGNGEKTTATLAKTQVNLKLIPGVDGSPETCQLVAYNLTDITVKGSWMGPARLHLIPHVNAPVADLPVKRVIGAHHFIADLTLPYGRVVFDYNRHAISPELRATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 7 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 12 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 17 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 18 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 19 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 20 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 21 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 27 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 28 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 29 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 30 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 31 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 32 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 33 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 34 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 35 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 36 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 37 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 38 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 39 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 40 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 41 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 42 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 43 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 44 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 45 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 48 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 49 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 52 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 53 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 54 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 55 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 56 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 57 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 58 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 59 | 2906610324 | |||
| 60 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 61 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 62 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 63 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 64 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 65 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 66 | 2922368715 | |||
| 67 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 68 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 69 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 70 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 71 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 72 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 73 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 74 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 75 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 76 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 77 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 78 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 79 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 80 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 81 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 82 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 83 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 84 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 85 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 86 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 87 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 88 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 89 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 90 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 91 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 92 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 93 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 94 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 95 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 96 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 97 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 98 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 99 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 100 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 101 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 102 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 103 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 104 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 105 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 106 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 107 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 108 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 109 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 110 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 111 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 112 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 113 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 114 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 115 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 116 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 117 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 118 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 119 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 121 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 122 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 123 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 124 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 125 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 126 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 127 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 128 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 130 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 133 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 149 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 152 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 157 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 159 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 160 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 161 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 162 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 163 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 164 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 165 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 166 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 167 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 168 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 169 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 170 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 171 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 172 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 173 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 174 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 175 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 176 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 178 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 179 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 180 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 182 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 183 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 184 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 185 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 186 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 187 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 188 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 189 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 212 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 213 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 214 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 272 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 275 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 276 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 281 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 282 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 283 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 285 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 286 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 294 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 296 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 300 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 308 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 311 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 312 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 313 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 314 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 315 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 316 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 426 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 429 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 430 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 441 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 444 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 445 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 447 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 450 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 451 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 452 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 454 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 455 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 456 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 457 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 458 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 459 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 460 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 463 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 464 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 465 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 469 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 470 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 474 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 475 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 478 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 480 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 482 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 483 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 484 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 485 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 486 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 487 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 488 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 489 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 490 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 491 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 492 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.64 |
| Metatranscriptomes | 0 |
| Isolates | 16.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.28 |
| Nodule | 13.19 |
| Rhizoplane | 5.48 |
| Rhizosphere | 51.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10036620 | 3300001990 | Bacteria | 1515 |
| 2 | JGI25159J45721_1015563 | 3300002987 | Bacteria | 1660 |
| 3 | JGI25151J46595_10015149 | 3300003187 | Bacteria | 3413 |
| 4 | JGI25406J46586_10005513 | 3300003203 | Bacteria | 5861 |
| 5 | JGI25153J46596_10000054 | 3300003215 | Bacteria | 136806 |
| 6 | JGI25153J46596_10000956 | 3300003215 | Bacteria | 17526 |
| 7 | JGI25160J50197_1001301 | 3300003354 | Bacteria | 12602 |
| 8 | JGI25160J50197_1007787 | 3300003354 | Bacteria | 4149 |
| 9 | JGI25407J50210_10050528 | 3300003373 | Bacteria | 1055 |
| 10 | JGI25404J52841_10001679 | 3300003659 | Bacteria | 3981 |
| 11 | JGI25404J52841_10007890 | 3300003659 | Bacteria | 2258 |
| 12 | JGI25404J52841_10016775 | 3300003659 | Bacteria | 1588 |
| 13 | JGI25404J52841_10017971 | 3300003659 | Bacteria | 1532 |
| 14 | JGI25404J52841_10028950 | 3300003659 | Bacteria | 1188 |
| 15 | Ga0055530_10034137 | 3300003791 | Bacteria | 1303 |
| 16 | Ga0055531_10015224 | 3300003794 | Bacteria | 3407 |
| 17 | Ga0055543_1026967 | 3300004625 | Bacteria | 1019 |
| 18 | Ga0065165_1000209 | 3300005262 | Bacteria | 101834 |
| 19 | Ga0065165_1001615 | 3300005262 | Bacteria | 22970 |
| 20 | Ga0070676_10158355 | 3300005328 | Bacteria | 1455 |
| 21 | Ga0070676_10284344 | 3300005328 | Bacteria | 1116 |
| 22 | Ga0068869_100041248 | 3300005334 | Bacteria | 3304 |
| 23 | Ga0068869_100500095 | 3300005334 | Bacteria | 1015 |
| 24 | Ga0070680_100165691 | 3300005336 | Bacteria | 1858 |
| 25 | Ga0070682_100329151 | 3300005337 | Bacteria | 1131 |
| 26 | Ga0068868_100281999 | 3300005338 | Bacteria | 1406 |
| 27 | Ga0070661_100439146 | 3300005344 | Bacteria | 1037 |
| 28 | Ga0070661_100468257 | 3300005344 | Bacteria | 1004 |
| 29 | Ga0070668_100010301 | 3300005347 | Bacteria | 6941 |
| 30 | Ga0070668_100273119 | 3300005347 | Bacteria | 1409 |
| 31 | Ga0070668_100413572 | 3300005347 | Bacteria | 1154 |
| 32 | Ga0070671_100015721 | 3300005355 | Bacteria | 6115 |
| 33 | Ga0070671_100232728 | 3300005355 | Bacteria | 1564 |
| 34 | Ga0070673_100141675 | 3300005364 | Bacteria | 2028 |
| 35 | Ga0070709_10024373 | 3300005434 | Bacteria | 3560 |
| 36 | Ga0070713_100016644 | 3300005436 | Bacteria | 5532 |
| 37 | Ga0070713_100131716 | 3300005436 | Bacteria | 2206 |
| 38 | Ga0070713_100283233 | 3300005436 | Bacteria | 1521 |
| 39 | Ga0070713_100356634 | 3300005436 | Bacteria | 1358 |
| 40 | Ga0070710_10015274 | 3300005437 | Bacteria | 3884 |
| 41 | Ga0070710_10130051 | 3300005437 | Bacteria | 1534 |
| 42 | Ga0070711_100027855 | 3300005439 | Bacteria | 3713 |
| 43 | Ga0070711_100029811 | 3300005439 | Bacteria | 3605 |
| 44 | Ga0070711_100039402 | 3300005439 | Bacteria | 3183 |
| 45 | Ga0070700_100113941 | 3300005441 | Bacteria | 1802 |
| 46 | Ga0070694_100129746 | 3300005444 | Bacteria | 1819 |
| 47 | Ga0070708_100432756 | 3300005445 | Bacteria | 1241 |
| 48 | Ga0070663_100022613 | 3300005455 | Bacteria | 4206 |
| 49 | Ga0070663_100048502 | 3300005455 | Bacteria | 3011 |
| 50 | Ga0070663_100237153 | 3300005455 | Bacteria | 1438 |
| 51 | Ga0070678_100011505 | 3300005456 | Bacteria | 5464 |
| 52 | Ga0070662_100002137 | 3300005457 | Bacteria | 12120 |
| 53 | Ga0070681_10007037 | 3300005458 | Bacteria | 10953 |
| 54 | Ga0068867_100000068 | 3300005459 | Bacteria | 62945 |
| 55 | Ga0070685_10197036 | 3300005466 | Bacteria | 1307 |
| 56 | Ga0070697_100380141 | 3300005536 | Bacteria | 1223 |
| 57 | Ga0068853_100093623 | 3300005539 | Bacteria | 2645 |
| 58 | Ga0068853_100143194 | 3300005539 | Bacteria | 2147 |
| 59 | Ga0068853_100268278 | 3300005539 | Bacteria | 1571 |
| 60 | Ga0070672_100001670 | 3300005543 | Bacteria | 13824 |
| 61 | Ga0070693_100082763 | 3300005547 | Bacteria | 1917 |
| 62 | Ga0070665_100094396 | 3300005548 | Bacteria | 2996 |
| 63 | Ga0070665_100096246 | 3300005548 | Bacteria | 2965 |
| 64 | Ga0070665_100226316 | 3300005548 | Bacteria | 1871 |
| 65 | Ga0070665_100279086 | 3300005548 | Bacteria | 1672 |
| 66 | Ga0070665_100758004 | 3300005548 | Bacteria | 984 |
| 67 | Ga0070704_100534816 | 3300005549 | Bacteria | 1022 |
| 68 | Ga0068855_100022315 | 3300005563 | Bacteria | 7584 |
| 69 | Ga0068855_100295151 | 3300005563 | Bacteria | 1796 |
| 70 | Ga0070664_100058232 | 3300005564 | Bacteria | 3286 |
| 71 | Ga0070664_100071706 | 3300005564 | Bacteria | 2969 |
| 72 | Ga0068857_100150119 | 3300005577 | Bacteria | 2111 |
| 73 | Ga0068857_100238070 | 3300005577 | Bacteria | 1666 |
| 74 | Ga0068854_100122932 | 3300005578 | Bacteria | 1973 |
| 75 | Ga0068856_100021869 | 3300005614 | Bacteria | 6216 |
| 76 | Ga0068856_100114758 | 3300005614 | Bacteria | 2693 |
| 77 | Ga0068852_100074444 | 3300005616 | Bacteria | 2991 |
| 78 | Ga0068864_100148006 | 3300005618 | Bacteria | 2125 |
| 79 | Ga0068861_100164970 | 3300005719 | Bacteria | 1831 |
| 80 | Ga0068861_100189381 | 3300005719 | Bacteria | 1719 |
| 81 | Ga0068863_100510328 | 3300005841 | Bacteria | 1185 |
| 82 | Ga0068858_100110771 | 3300005842 | Bacteria | 2563 |
| 83 | Ga0068860_100087844 | 3300005843 | Bacteria | 2959 |
| 84 | Ga0068862_100100829 | 3300005844 | Bacteria | 2525 |
| 85 | Ga0081455_10000257 | 3300005937 | Bacteria | 69896 |
| 86 | Ga0081455_10013857 | 3300005937 | Bacteria | 7929 |
| 87 | Ga0081455_10027984 | 3300005937 | Bacteria | 5156 |
| 88 | Ga0081455_10029417 | 3300005937 | Bacteria | 5009 |
| 89 | Ga0081455_10029943 | 3300005937 | Bacteria | 4955 |
| 90 | Ga0081455_10045454 | 3300005937 | Bacteria | 3820 |
| 91 | Ga0081538_10008909 | 3300005981 | Bacteria | 8435 |
| 92 | Ga0081540_1000022 | 3300005983 | Bacteria | 161205 |
| 93 | Ga0081540_1000731 | 3300005983 | Bacteria | 30244 |
| 94 | Ga0081540_1002537 | 3300005983 | Bacteria | 14812 |
| 95 | Ga0081540_1003164 | 3300005983 | Bacteria | 13135 |
| 96 | Ga0081540_1005764 | 3300005983 | Bacteria | 9169 |
| 97 | Ga0081540_1006159 | 3300005983 | Bacteria | 8798 |
| 98 | Ga0081540_1013773 | 3300005983 | Bacteria | 5238 |
| 99 | Ga0081540_1016629 | 3300005983 | Bacteria | 4593 |
| 100 | Ga0081540_1027170 | 3300005983 | Bacteria | 3248 |
| 101 | Ga0081540_1048913 | 3300005983 | Bacteria | 2114 |
| 102 | Ga0081540_1059871 | 3300005983 | Bacteria | 1825 |
| 103 | Ga0081540_1111576 | 3300005983 | Bacteria | 1155 |
| 104 | Ga0081539_10000437 | 3300005985 | Bacteria | 88848 |
| 105 | Ga0081539_10000979 | 3300005985 | Bacteria | 53212 |
| 106 | Ga0081539_10001065 | 3300005985 | Bacteria | 50187 |
| 107 | Ga0075365_10134234 | 3300006038 | Bacteria | 1714 |
| 108 | Ga0075368_10002266 | 3300006042 | Bacteria | 6250 |
| 109 | Ga0075363_100021002 | 3300006048 | Bacteria | 3282 |
| 110 | Ga0075364_10039676 | 3300006051 | Bacteria | 3053 |
| 111 | Ga0075364_10055260 | 3300006051 | Bacteria | 2597 |
| 112 | Ga0075364_10067640 | 3300006051 | Bacteria | 2348 |
| 113 | Ga0075364_10072819 | 3300006051 | Bacteria | 2264 |
| 114 | Ga0075364_10358796 | 3300006051 | Bacteria | 994 |
| 115 | Ga0070712_100095561 | 3300006175 | Bacteria | 2187 |
| 116 | Ga0075367_10000751 | 3300006178 | Bacteria | 12637 |
| 117 | Ga0075367_10078465 | 3300006178 | Bacteria | 1994 |
| 118 | Ga0075369_10005862 | 3300006186 | Bacteria | 4617 |
| 119 | Ga0075366_10057364 | 3300006195 | Bacteria | 2314 |
| 120 | Ga0075366_10072598 | 3300006195 | Bacteria | 2051 |
| 121 | Ga0075366_10232792 | 3300006195 | Bacteria | 1123 |
| 122 | Ga0097621_100266531 | 3300006237 | Bacteria | 1504 |
| 123 | Ga0097621_100406530 | 3300006237 | Bacteria | 1220 |
| 124 | Ga0068871_100325248 | 3300006358 | Bacteria | 1355 |
| 125 | Ga0075430_100000274 | 3300006846 | Bacteria | 36446 |
| 126 | Ga0075434_100308096 | 3300006871 | Bacteria | 1604 |
| 127 | Ga0075434_100863103 | 3300006871 | Bacteria | 920 |
| 128 | Ga0075429_100009612 | 3300006880 | Bacteria | 8387 |
| 129 | Ga0099824_1002487 | 3300006942 | Bacteria | 26950 |
| 130 | Ga0099822_1001480 | 3300006943 | Bacteria | 27484 |
| 131 | Ga0075435_100057062 | 3300007076 | Bacteria | 3158 |
| 132 | Ga0099794_10070996 | 3300007265 | Bacteria | 1706 |
| 133 | Ga0105240_10316569 | 3300009093 | Bacteria | 1780 |
| 134 | Ga0111539_10103570 | 3300009094 | Bacteria | 3340 |
| 135 | Ga0111539_10634956 | 3300009094 | Bacteria | 1243 |
| 136 | Ga0105245_10043869 | 3300009098 | Bacteria | 3990 |
| 137 | Ga0105247_10128943 | 3300009101 | Bacteria | 1647 |
| 138 | Ga0105243_10001337 | 3300009148 | Bacteria | 21977 |
| 139 | Ga0105243_10066172 | 3300009148 | Bacteria | 2906 |
| 140 | Ga0105243_10140580 | 3300009148 | Bacteria | 2059 |
| 141 | Ga0105241_10084858 | 3300009174 | Bacteria | 2487 |
| 142 | Ga0105241_10101607 | 3300009174 | Bacteria | 2286 |
| 143 | Ga0105242_10071448 | 3300009176 | Bacteria | 2880 |
| 144 | Ga0105242_10763168 | 3300009176 | Bacteria | 953 |
| 145 | Ga0105248_10077818 | 3300009177 | Bacteria | 3729 |
| 146 | Ga0105248_10793869 | 3300009177 | Bacteria | 1068 |
| 147 | Ga0105248_11129975 | 3300009177 | Bacteria | 886 |
| 148 | Ga0105237_10014818 | 3300009545 | Bacteria | 8137 |
| 149 | Ga0105237_10256008 | 3300009545 | Bacteria | 1753 |
| 150 | Ga0105238_10071974 | 3300009551 | Bacteria | 3454 |
| 151 | Ga0105238_10486559 | 3300009551 | Bacteria | 1234 |
| 152 | Ga0105249_10283871 | 3300009553 | Bacteria | 1654 |
| 153 | Ga0105249_10422258 | 3300009553 | Bacteria | 1367 |
| 154 | Ga0105239_10186038 | 3300010375 | Bacteria | 2324 |
| 155 | Ga0105239_10292263 | 3300010375 | Bacteria | 1835 |
| 156 | Ga0105239_10320821 | 3300010375 | Bacteria | 1747 |
| 157 | Ga0105239_11373187 | 3300010375 | Bacteria | 815 |
| 158 | Ga0105246_10019289 | 3300011119 | Bacteria | 4356 |
| 159 | Ga0105246_10059196 | 3300011119 | Bacteria | 2656 |
| 160 | Ga0157374_10098561 | 3300013296 | Bacteria | 2799 |
| 161 | Ga0157378_10371040 | 3300013297 | Bacteria | 1403 |
| 162 | Ga0163162_10131585 | 3300013306 | Bacteria | 2610 |
| 163 | Ga0157375_10693484 | 3300013308 | Bacteria | 1172 |
| 164 | Ga0163163_10303413 | 3300014325 | Bacteria | 1649 |
| 165 | Ga0163163_10622470 | 3300014325 | Bacteria | 1143 |
| 166 | Ga0163163_10714150 | 3300014325 | Bacteria | 1066 |
| 167 | Ga0157377_10000082 | 3300014745 | Bacteria | 74078 |
| 168 | Ga0157377_10055070 | 3300014745 | Bacteria | 2254 |
| 169 | Ga0157377_10167977 | 3300014745 | Bacteria | 1370 |
| 170 | Ga0157379_10030359 | 3300014968 | Bacteria | 4811 |
| 171 | Ga0157379_10993677 | 3300014968 | Bacteria | 800 |
| 172 | Ga0157376_10261411 | 3300014969 | Bacteria | 1622 |
| 173 | Ga0163161_10191240 | 3300017792 | Bacteria | 1574 |
| 174 | Ga0213876_10087979 | 3300021384 | Bacteria | 1645 |
| 175 | Ga0213876_10088910 | 3300021384 | Bacteria | 1636 |
| 176 | Ga0213875_10168988 | 3300021388 | Bacteria | 1027 |
| 177 | Ga0213871_10000629 | 3300021441 | Bacteria | 5034 |
| 178 | Ga0213871_10023614 | 3300021441 | Bacteria | 1550 |
| 179 | Ga0209148_1000537 | 3300025254 | Bacteria | 36806 |
| 180 | Ga0209233_1002379 | 3300025261 | Bacteria | 6966 |
| 181 | Ga0209455_1002053 | 3300025272 | Bacteria | 8145 |
| 182 | Ga0209130_1000080 | 3300025284 | Bacteria | 166684 |
| 183 | Ga0209130_1000631 | 3300025284 | Bacteria | 33098 |
| 184 | Ga0209025_1000741 | 3300025294 | Bacteria | 55042 |
| 185 | Ga0209025_1006130 | 3300025294 | Bacteria | 9476 |
| 186 | Ga0209564_1002134 | 3300025295 | Bacteria | 16725 |
| 187 | Ga0209758_1000048 | 3300025297 | Bacteria | 358400 |
| 188 | Ga0209758_1000063 | 3300025297 | Bacteria | 315999 |
| 189 | Ga0209758_1005830 | 3300025297 | Bacteria | 9203 |
| 190 | Ga0209758_1012479 | 3300025297 | Bacteria | 4753 |
| 191 | Ga0209758_1024417 | 3300025297 | Bacteria | 2694 |
| 192 | Ga0207426_1000080 | 3300025302 | Bacteria | 304917 |
| 193 | Ga0207426_1000278 | 3300025302 | Bacteria | 105775 |
| 194 | Ga0207426_1000434 | 3300025302 | Bacteria | 68127 |
| 195 | Ga0207426_1016917 | 3300025302 | Bacteria | 2603 |
| 196 | Ga0207426_1026198 | 3300025302 | Bacteria | 1956 |
| 197 | Ga0209051_1043612 | 3300025303 | Bacteria | 1572 |
| 198 | Ga0209257_1000334 | 3300025304 | Bacteria | 98054 |
| 199 | Ga0209257_1025936 | 3300025304 | Bacteria | 1989 |
| 200 | Ga0209257_1038945 | 3300025304 | Bacteria | 1434 |
| 201 | Ga0207692_10050633 | 3300025898 | Bacteria | 2102 |
| 202 | Ga0207692_10198248 | 3300025898 | Bacteria | 1179 |
| 203 | Ga0207688_10009448 | 3300025901 | Bacteria | 5307 |
| 204 | Ga0207647_10002905 | 3300025904 | Bacteria | 12903 |
| 205 | Ga0207699_10009741 | 3300025906 | Bacteria | 4796 |
| 206 | Ga0207699_10073539 | 3300025906 | Bacteria | 2097 |
| 207 | Ga0207699_10110199 | 3300025906 | Bacteria | 1763 |
| 208 | Ga0207684_10654611 | 3300025910 | Bacteria | 895 |
| 209 | Ga0207707_10028963 | 3300025912 | Bacteria | 4840 |
| 210 | Ga0207671_10096147 | 3300025914 | Bacteria | 2238 |
| 211 | Ga0207671_10188273 | 3300025914 | Bacteria | 1608 |
| 212 | Ga0207671_10399010 | 3300025914 | Bacteria | 1094 |
| 213 | Ga0207693_10015503 | 3300025915 | Bacteria | 6114 |
| 214 | Ga0207693_10060889 | 3300025915 | Bacteria | 2957 |
| 215 | Ga0207693_10538787 | 3300025915 | Bacteria | 911 |
| 216 | Ga0207663_10017868 | 3300025916 | Bacteria | 3961 |
| 217 | Ga0207657_10087243 | 3300025919 | Bacteria | 2611 |
| 218 | Ga0207657_10385343 | 3300025919 | Bacteria | 1103 |
| 219 | Ga0207649_10501256 | 3300025920 | Bacteria | 923 |
| 220 | Ga0207681_10074914 | 3300025923 | Bacteria | 2373 |
| 221 | Ga0207681_10449277 | 3300025923 | Bacteria | 1048 |
| 222 | Ga0207694_10088200 | 3300025924 | Bacteria | 2445 |
| 223 | Ga0207694_10170564 | 3300025924 | Bacteria | 1762 |
| 224 | Ga0207687_10020973 | 3300025927 | Bacteria | 4338 |
| 225 | Ga0207700_10012573 | 3300025928 | Bacteria | 5467 |
| 226 | Ga0207700_10031294 | 3300025928 | Bacteria | 3778 |
| 227 | Ga0207700_10055741 | 3300025928 | Bacteria | 2972 |
| 228 | Ga0207700_10226913 | 3300025928 | Bacteria | 1586 |
| 229 | Ga0207664_10481186 | 3300025929 | Bacteria | 1110 |
| 230 | Ga0207644_10284074 | 3300025931 | Bacteria | 1329 |
| 231 | Ga0207706_10000870 | 3300025933 | Bacteria | 31103 |
| 232 | Ga0207706_10027409 | 3300025933 | Bacteria | 5093 |
| 233 | Ga0207709_10000935 | 3300025935 | Bacteria | 21921 |
| 234 | Ga0207670_10282391 | 3300025936 | Bacteria | 1294 |
| 235 | Ga0207711_10208842 | 3300025941 | Bacteria | 1783 |
| 236 | Ga0207689_10019627 | 3300025942 | Bacteria | 5697 |
| 237 | Ga0207689_10499258 | 3300025942 | Bacteria | 1019 |
| 238 | Ga0207679_10103279 | 3300025945 | Bacteria | 2233 |
| 239 | Ga0207667_10050515 | 3300025949 | Bacteria | 4387 |
| 240 | Ga0207667_10078982 | 3300025949 | Bacteria | 3410 |
| 241 | Ga0207651_10179600 | 3300025960 | Bacteria | 1678 |
| 242 | Ga0207668_10122093 | 3300025972 | Bacteria | 1974 |
| 243 | Ga0207668_10478151 | 3300025972 | Bacteria | 1068 |
| 244 | Ga0207677_10153346 | 3300026023 | Bacteria | 1781 |
| 245 | Ga0207677_10667299 | 3300026023 | Bacteria | 919 |
| 246 | Ga0207639_10286933 | 3300026041 | Bacteria | 1450 |
| 247 | Ga0207639_10411858 | 3300026041 | Bacteria | 1220 |
| 248 | Ga0207678_10007112 | 3300026067 | Bacteria | 9927 |
| 249 | Ga0207678_10041583 | 3300026067 | Bacteria | 3985 |
| 250 | Ga0207678_10044234 | 3300026067 | Bacteria | 3852 |
| 251 | Ga0207678_10092531 | 3300026067 | Bacteria | 2584 |
| 252 | Ga0207678_10274304 | 3300026067 | Bacteria | 1447 |
| 253 | Ga0207708_10195038 | 3300026075 | Bacteria | 1614 |
| 254 | Ga0207702_10305376 | 3300026078 | Bacteria | 1511 |
| 255 | Ga0207648_10000942 | 3300026089 | Bacteria | 32855 |
| 256 | Ga0207648_10418282 | 3300026089 | Bacteria | 1217 |
| 257 | Ga0207676_10225068 | 3300026095 | Bacteria | 1673 |
| 258 | Ga0207674_10047170 | 3300026116 | Bacteria | 4419 |
| 259 | Ga0207674_10068754 | 3300026116 | Bacteria | 3563 |
| 260 | Ga0207675_100175512 | 3300026118 | Bacteria | 2050 |
| 261 | Ga0207675_100206135 | 3300026118 | Bacteria | 1890 |
| 262 | Ga0207683_10019537 | 3300026121 | Bacteria | 5786 |
| 263 | Ga0207698_10086451 | 3300026142 | Bacteria | 2550 |
| 264 | Ga0207698_10206167 | 3300026142 | Bacteria | 1765 |
| 265 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 266 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 267 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 268 | Ga0209588_1021413 | 3300027671 | Bacteria | 2031 |
| 269 | Ga0207428_10004660 | 3300027907 | Bacteria | 12987 |
| 270 | Ga0268266_10098912 | 3300028379 | Bacteria | 2567 |
| 271 | Ga0268266_10678846 | 3300028379 | Bacteria | 992 |
| 272 | Ga0268265_10070482 | 3300028380 | Bacteria | 2719 |
| 273 | Ga0268265_10136887 | 3300028380 | Bacteria | 2044 |
| 274 | Ga0268264_10244044 | 3300028381 | Bacteria | 1665 |
| 275 | Ga0307515_10054386 | 3300028794 | Bacteria | 5878 |
| 276 | Ga0307515_10105384 | 3300028794 | Bacteria | 3358 |
| 277 | Ga0265338_10000014 | 3300028800 | Bacteria | 378751 |
| 278 | Ga0307512_10038687 | 3300030522 | Bacteria | 4009 |
| 279 | Ga0265330_10008460 | 3300031235 | Bacteria | 4952 |
| 280 | Ga0265332_10002568 | 3300031238 | Bacteria | 9199 |
| 281 | Ga0265328_10002067 | 3300031239 | Bacteria | 9063 |
| 282 | Ga0265328_10007332 | 3300031239 | Bacteria | 4603 |
| 283 | Ga0265325_10000013 | 3300031241 | Bacteria | 142935 |
| 284 | Ga0265329_10006602 | 3300031242 | Bacteria | 4591 |
| 285 | Ga0265339_10001198 | 3300031249 | Bacteria | 19545 |
| 286 | Ga0265339_10091130 | 3300031249 | Bacteria | 1598 |
| 287 | Ga0265339_10110529 | 3300031249 | Bacteria | 1422 |
| 288 | Ga0265331_10000885 | 3300031250 | Bacteria | 24307 |
| 289 | Ga0265331_10008911 | 3300031250 | Bacteria | 5676 |
| 290 | Ga0307513_10017182 | 3300031456 | Bacteria | 8683 |
| 291 | Ga0307513_10138015 | 3300031456 | Bacteria | 2370 |
| 292 | Ga0307509_10139933 | 3300031507 | Bacteria | 2358 |
| 293 | Ga0265313_10003504 | 3300031595 | Bacteria | 12648 |
| 294 | Ga0307508_10001988 | 3300031616 | Bacteria | 22347 |
| 295 | Ga0265314_10000610 | 3300031711 | Bacteria | 44130 |
| 296 | Ga0265314_10007230 | 3300031711 | Bacteria | 9652 |
| 297 | Ga0265342_10024701 | 3300031712 | Bacteria | 3790 |
| 298 | Ga0307516_10001957 | 3300031730 | Bacteria | 28200 |
| 299 | Ga0307516_10015472 | 3300031730 | Bacteria | 8025 |
| 300 | Ga0307516_10129471 | 3300031730 | Bacteria | 2304 |
| 301 | Ga0307412_10519068 | 3300031911 | Bacteria | 995 |
| 302 | Ga0307510_10100044 | 3300033180 | Bacteria | 2695 |
| 303 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 304 | Ga0373923_0012177 | 3300035111 | Bacteria | 3173 |
| 305 | Ga0373953_0022623 | 3300035117 | Bacteria | 2372 |
| 306 | Ga0373957_0050829 | 3300035120 | Bacteria | 1585 |
| 307 | Ga0373924_0033430 | 3300035410 | Bacteria | 2076 |
| 308 | Ga0373927_0312032 | 3300035695 | Bacteria | 1035 |
| 309 | Ga0373933_0004938 | 3300035724 | Bacteria | 7272 |
| 310 | Ga0373947_0045026 | 3300035725 | Bacteria | 2640 |
| 311 | Ga0373937_0002003 | 3300036401 | Bacteria | 17035 |
| 312 | Ga0373925_0128015 | 3300037068 | Bacteria | 1977 |
| 313 | Ga0395900_0104784 | 3300037418 | Bacteria | 2906 |
| 314 | Ga0395900_0157448 | 3300037418 | Bacteria | 2320 |
| 315 | Ga0395905_0055415 | 3300037471 | Bacteria | 3710 |
| 316 | Ga0395905_0200798 | 3300037471 | Bacteria | 1869 |
| 317 | Ga0395905_0208280 | 3300037471 | Bacteria | 1832 |
| 318 | Ga0395905_0232271 | 3300037471 | Bacteria | 1725 |
| 319 | Ga0395905_0662800 | 3300037471 | Bacteria | 945 |
| 320 | Ga0436364_0765298 | 3300037853 | Bacteria | 1266 |
| 321 | Ga0395901_0142980 | 3300038443 | Bacteria | 2515 |
| 322 | Ga0237819_07428 | 3300038705 | Bacteria | 1575 |
| 323 | Ga0436365_0194098 | 3300039437 | Bacteria | 5543 |
| 324 | Ga0436365_0824955 | 3300039437 | Bacteria | 878 |
| 325 | Ga0436365_0862796 | 3300039437 | Bacteria | 5828 |
| 326 | Ga0436365_0888520 | 3300039437 | Bacteria | 2524 |
| 327 | Ga0436365_1135457 | 3300039437 | Bacteria | 1977 |
| 328 | Ga0436360_0172085 | 3300039438 | Bacteria | 5059 |
| 329 | Ga0436360_1140127 | 3300039438 | Bacteria | 4267 |
| 330 | Ga0436360_1237858 | 3300039438 | Bacteria | 2840 |
| 331 | Ga0436360_1320220 | 3300039438 | Bacteria | 1916 |
| 332 | Ga0436363_1060761 | 3300039450 | Bacteria | 979 |
| 333 | Ga0436362_0759359 | 3300039453 | Bacteria | 2841 |
| 334 | Ga0439465_0061168 | 3300041413 | Bacteria | 1248 |
| 335 | Ga0451802_1475528 | 3300041460 | Bacteria | 1178 |
| 336 | Ga0451804_0672755 | 3300041463 | Bacteria | 1193 |
| 337 | Ga0451833_0772404 | 3300041491 | Bacteria | 1075 |
| 338 | Ga0451837_0827062 | 3300041494 | Bacteria | 792 |
| 339 | Ga0451841_1126302 | 3300041498 | Bacteria | 1071 |
| 340 | Ga0439454_026369 | 3300042011 | Bacteria | 888 |
| 341 | Ga0450898_017548 | 3300042134 | Bacteria | 1232 |
| 342 | Ga0451577_0043580 | 3300042876 | Bacteria | 4019 |
| 343 | Ga0453683_0151324 | 3300044673 | Bacteria | 1466 |
| 344 | Ga0466963_0210585 | 3300044694 | Bacteria | 1360 |
| 345 | Ga0466968_0092520 | 3300044735 | Bacteria | 1342 |
| 346 | Ga0466960_0172169 | 3300044901 | Bacteria | 1169 |
| 347 | Ga0466958_0010641 | 3300045836 | Bacteria | 5158 |
| 348 | Ga0495592_0006749 | 3300046454 | Bacteria | 8558 |
| 349 | Ga0495603_0310149 | 3300046455 | Bacteria | 906 |
| 350 | Ga0495590_0031972 | 3300046457 | Bacteria | 1841 |
| 351 | Ga0495629_0087079 | 3300046459 | Bacteria | 2179 |
| 352 | Ga0495638_0032998 | 3300046460 | Bacteria | 3313 |
| 353 | Ga0495638_0181996 | 3300046460 | Bacteria | 1198 |
| 354 | Ga0495638_0201579 | 3300046460 | Bacteria | 1123 |
| 355 | Ga0495651_0000265 | 3300046462 | Bacteria | 40572 |
| 356 | Ga0495653_0080879 | 3300046463 | Bacteria | 2402 |
| 357 | Ga0495605_0107265 | 3300046474 | Bacteria | 1278 |
| 358 | Ga0495584_0002607 | 3300046491 | Bacteria | 10158 |
| 359 | Ga0495584_0087712 | 3300046491 | Bacteria | 1568 |
| 360 | Ga0495585_0005504 | 3300046492 | Bacteria | 7971 |
| 361 | Ga0495585_0091472 | 3300046492 | Bacteria | 1638 |
| 362 | Ga0495594_0000553 | 3300046499 | Bacteria | 19140 |
| 363 | Ga0495596_0058284 | 3300046500 | Bacteria | 1506 |
| 364 | Ga0495607_0173427 | 3300046501 | Bacteria | 1087 |
| 365 | Ga0495583_0102024 | 3300046506 | Bacteria | 1224 |
| 366 | Ga0495606_0028926 | 3300046507 | Bacteria | 3900 |
| 367 | Ga0495606_0063971 | 3300046507 | Bacteria | 2343 |
| 368 | Ga0495608_0000435 | 3300046511 | Bacteria | 29113 |
| 369 | Ga0495616_0047203 | 3300046513 | Bacteria | 2170 |
| 370 | Ga0495620_0008241 | 3300046515 | Bacteria | 5605 |
| 371 | Ga0495628_0208285 | 3300046516 | Bacteria | 1471 |
| 372 | Ga0495631_0003300 | 3300046518 | Bacteria | 8876 |
| 373 | Ga0495632_0141763 | 3300046519 | Bacteria | 1114 |
| 374 | Ga0495637_0053329 | 3300046520 | Bacteria | 1684 |
| 375 | Ga0495643_0017241 | 3300046522 | Bacteria | 4226 |
| 376 | Ga0495643_0022296 | 3300046522 | Bacteria | 3616 |
| 377 | Ga0495643_0039269 | 3300046522 | Bacteria | 2589 |
| 378 | Ga0495666_0086697 | 3300046526 | Bacteria | 1479 |
| 379 | Ga0495642_0222226 | 3300046528 | Bacteria | 825 |
| 380 | Ga0495654_0041619 | 3300046530 | Bacteria | 2284 |
| 381 | Ga0495587_0002595 | 3300046536 | Bacteria | 12066 |
| 382 | Ga0495587_0167702 | 3300046536 | Bacteria | 1248 |
| 383 | Ga0495645_0247456 | 3300046543 | Bacteria | 1186 |
| 384 | Ga0495622_0009294 | 3300046557 | Bacteria | 4549 |
| 385 | Ga0495667_0000817 | 3300046559 | Bacteria | 20052 |
| 386 | Ga0495656_0152029 | 3300046615 | Bacteria | 1119 |
| 387 | Ga0495668_0081240 | 3300046616 | Bacteria | 1779 |
| 388 | Ga0495668_0117430 | 3300046616 | Bacteria | 1455 |
| 389 | Ga0495634_0017385 | 3300046642 | Bacteria | 5132 |
| 390 | Ga0495634_0273880 | 3300046642 | Bacteria | 1027 |
| 391 | Ga0495611_0001995 | 3300046648 | Bacteria | 9666 |
| 392 | Ga0495611_0085325 | 3300046648 | Bacteria | 1456 |
| 393 | Ga0495625_0031645 | 3300046660 | Bacteria | 3932 |
| 394 | Ga0495625_0212942 | 3300046660 | Bacteria | 1269 |
| 395 | Ga0495635_0079050 | 3300046663 | Bacteria | 2251 |
| 396 | Ga0495661_0016887 | 3300046665 | Bacteria | 4824 |
| 397 | Ga0495661_0043463 | 3300046665 | Bacteria | 2761 |
| 398 | Ga0495588_0059472 | 3300046674 | Bacteria | 1977 |
| 399 | Ga0495657_0019625 | 3300046675 | Bacteria | 4875 |
| 400 | Ga0495599_0016230 | 3300046678 | Bacteria | 4623 |
| 401 | Ga0495646_0056521 | 3300046680 | Bacteria | 2352 |
| 402 | Ga0495646_0161340 | 3300046680 | Bacteria | 1241 |
| 403 | Ga0495670_0013358 | 3300046691 | Bacteria | 4040 |
| 404 | Ga0495670_0284080 | 3300046691 | Bacteria | 885 |
| 405 | Ga0495649_0187408 | 3300046694 | Bacteria | 1078 |
| 406 | Ga0495589_0108024 | 3300046794 | Bacteria | 1344 |
| 407 | Ga0495600_0034239 | 3300046809 | Bacteria | 3297 |
| 408 | Ga0495636_0006052 | 3300047318 | Bacteria | 4748 |
| 409 | Ga0495636_0158802 | 3300047318 | Bacteria | 1018 |
| 410 | Ga0495674_0001917 | 3300047319 | Bacteria | 20530 |
| 411 | Ga0495672_0015183 | 3300047320 | Bacteria | 5240 |
| 412 | Ga0495672_0060742 | 3300047320 | Bacteria | 2181 |
| 413 | Ga0495676_0219762 | 3300047321 | Bacteria | 1310 |
| 414 | Ga0495680_0002679 | 3300047322 | Bacteria | 17978 |
| 415 | Ga0495683_0010346 | 3300047323 | Bacteria | 4933 |
| 416 | Ga0495681_0022146 | 3300047470 | Bacteria | 3408 |
| 417 | Ga0495684_0110372 | 3300047471 | Bacteria | 2076 |
| 418 | Ga0495602_0006478 | 3300048088 | Bacteria | 12283 |
| 419 | Ga0495602_0361756 | 3300048088 | Bacteria | 1044 |
| 420 | Ga0495626_0033417 | 3300048091 | Bacteria | 2466 |
| 421 | Ga0495626_0037111 | 3300048091 | Bacteria | 2318 |
| 422 | Ga0496100_0076608 | 3300048903 | Bacteria | 2246 |
| 423 | Ga0496100_0111614 | 3300048903 | Bacteria | 1900 |
| 424 | Ga0496101_0048304 | 3300048904 | Bacteria | 3058 |
| 425 | Ga0496101_0481478 | 3300048904 | Bacteria | 980 |
| 426 | Ga0496102_0024579 | 3300048905 | Bacteria | 5356 |
| 427 | Ga0496102_0076340 | 3300048905 | Bacteria | 3082 |
| 428 | Ga0496102_0227341 | 3300048905 | Bacteria | 1759 |
| 429 | Ga0496102_0743858 | 3300048905 | Bacteria | 903 |
| 430 | Ga0496103_0004525 | 3300048906 | Bacteria | 8424 |
| 431 | Ga0496104_0131643 | 3300048907 | Bacteria | 2403 |
| 432 | Ga0496104_0162889 | 3300048907 | Bacteria | 2139 |
| 433 | Ga0496105_0016638 | 3300048908 | Bacteria | 5872 |
| 434 | Ga0496105_0140766 | 3300048908 | Bacteria | 1986 |
| 435 | Ga0496105_0173137 | 3300048908 | Bacteria | 1769 |
| 436 | Ga0496105_0181504 | 3300048908 | Bacteria | 1723 |
| 437 | Ga0496105_0226044 | 3300048908 | Bacteria | 1522 |
| 438 | Ga0496106_0747093 | 3300048909 | Bacteria | 778 |
| 439 | Ga0496107_0047996 | 3300048910 | Bacteria | 3075 |
| 440 | Ga0496107_0189421 | 3300048910 | Bacteria | 1528 |
| 441 | Ga0496107_0509818 | 3300048910 | Bacteria | 892 |
| 442 | Ga0496108_0078632 | 3300048911 | Bacteria | 2792 |
| 443 | Ga0496108_0294495 | 3300048911 | Bacteria | 1413 |
| 444 | Ga0496108_0468669 | 3300048911 | Bacteria | 1100 |
| 445 | Ga0496109_0073761 | 3300048912 | Bacteria | 3136 |
| 446 | Ga0496109_0380482 | 3300048912 | Bacteria | 1333 |
| 447 | Ga0496110_0099098 | 3300048913 | Bacteria | 2613 |
| 448 | Ga0496111_0100564 | 3300048914 | Bacteria | 2124 |
| 449 | Ga0496112_0087644 | 3300048915 | Bacteria | 3080 |
| 450 | Ga0496112_0232736 | 3300048915 | Bacteria | 1797 |
| 451 | Ga0496112_0291307 | 3300048915 | Bacteria | 1578 |
| 452 | Ga0496113_0063282 | 3300048916 | Bacteria | 2796 |
| 453 | Ga0496113_0138505 | 3300048916 | Bacteria | 1914 |
| 454 | Ga0496113_0212430 | 3300048916 | Bacteria | 1540 |
| 455 | Ga0496113_0665888 | 3300048916 | Bacteria | 832 |
| 456 | Ga0496114_0033255 | 3300048917 | Bacteria | 4248 |
| 457 | Ga0496114_0426805 | 3300048917 | Bacteria | 1174 |
| 458 | Ga0496115_0078247 | 3300048918 | Bacteria | 2690 |
| 459 | Ga0496115_0402689 | 3300048918 | Bacteria | 1110 |
| 460 | Ga0496116_0001246 | 3300048919 | Bacteria | 29566 |
| 461 | Ga0496116_0071370 | 3300048919 | Bacteria | 2199 |
| 462 | Ga0496117_0126906 | 3300048920 | Bacteria | 1555 |
| 463 | Ga0496117_0220779 | 3300048920 | Bacteria | 1055 |
| 464 | Ga0496117_0283669 | 3300048920 | Bacteria | 885 |
| 465 | Ga0496118_0008413 | 3300048921 | Bacteria | 10670 |
| 466 | Ga0496118_0031802 | 3300048921 | Bacteria | 4365 |
| 467 | Ga0496118_0096034 | 3300048921 | Bacteria | 2021 |
| 468 | Ga0496118_0349612 | 3300048921 | Bacteria | 788 |
| 469 | Ga0496119_0040086 | 3300048922 | Bacteria | 3001 |
| 470 | Ga0496119_0084016 | 3300048922 | Bacteria | 1826 |
| 471 | Ga0496121_0000128 | 3300048924 | Bacteria | 168457 |
| 472 | Ga0496121_0007261 | 3300048924 | Bacteria | 13411 |
| 473 | Ga0496121_0011114 | 3300048924 | Bacteria | 10045 |
| 474 | Ga0496121_0082455 | 3300048924 | Bacteria | 2542 |
| 475 | Ga0496121_0092406 | 3300048924 | Bacteria | 2359 |
| 476 | Ga0496121_0168109 | 3300048924 | Bacteria | 1596 |
| 477 | Ga0496121_0387587 | 3300048924 | Bacteria | 919 |
| 478 | Ga0496123_0059427 | 3300048926 | Bacteria | 2472 |
| 479 | Ga0496124_0082437 | 3300048927 | Bacteria | 2640 |
| 480 | Ga0496125_0002221 | 3300048928 | Bacteria | 25866 |
| 481 | Ga0496125_0018095 | 3300048928 | Bacteria | 6697 |
| 482 | Ga0496125_0020298 | 3300048928 | Bacteria | 6237 |
| 483 | Ga0496125_0241456 | 3300048928 | Bacteria | 1147 |
| 484 | Ga0496125_0291833 | 3300048928 | Bacteria | 1004 |
| 485 | Ga0496126_0001652 | 3300048929 | Bacteria | 33559 |
| 486 | Ga0496126_0007875 | 3300048929 | Bacteria | 11602 |
| 487 | Ga0496126_0011734 | 3300048929 | Bacteria | 9026 |
| 488 | Ga0496126_0035142 | 3300048929 | Bacteria | 4700 |
| 489 | Ga0496126_0063436 | 3300048929 | Bacteria | 3312 |
| 490 | Ga0496126_0090099 | 3300048929 | Bacteria | 2699 |
| 491 | Ga0496126_0112336 | 3300048929 | Bacteria | 2372 |
| 492 | Ga0496126_0154903 | 3300048929 | Bacteria | 1961 |
| 493 | Ga0496126_0200151 | 3300048929 | Bacteria | 1687 |
| 494 | Ga0495682_0016730 | 3300049460 | Bacteria | 2775 |
| 495 | Ga0495682_0021357 | 3300049460 | Bacteria | 2426 |
| 496 | Ga0501032_0088942 | 3300049569 | Bacteria | 2050 |
| 497 | Ga0501033_0099934 | 3300049570 | Bacteria | 2117 |
| 498 | Ga0501034_0227742 | 3300049571 | Bacteria | 1814 |
| 499 | Ga0501037_0062226 | 3300049573 | Bacteria | 2721 |
| 500 | Ga0501037_0194164 | 3300049573 | Bacteria | 1437 |
| 501 | Ga0501038_0214285 | 3300049574 | Bacteria | 1539 |
| 502 | Ga0501038_0343607 | 3300049574 | Bacteria | 1163 |
| 503 | Ga0501038_0547087 | 3300049574 | Bacteria | 881 |
| 504 | Ga0501039_0162354 | 3300049575 | Bacteria | 1756 |
| 505 | Ga0501041_0125962 | 3300049577 | Bacteria | 1594 |
| 506 | Ga0501043_0135090 | 3300049579 | Bacteria | 1932 |
| 507 | Ga0501046_0164151 | 3300049580 | Bacteria | 1669 |
| 508 | Ga0501046_0194142 | 3300049580 | Bacteria | 1513 |
| 509 | Ga0501047_0012850 | 3300049581 | Bacteria | 7933 |
| 510 | Ga0501048_0200526 | 3300049582 | Bacteria | 1414 |
| 511 | Ga0501068_0079456 | 3300049584 | Bacteria | 2011 |
| 512 | Ga0501070_0014522 | 3300049586 | Bacteria | 6626 |
| 513 | Ga0501072_0090791 | 3300049588 | Bacteria | 2425 |
| 514 | Ga0501072_0241440 | 3300049588 | Bacteria | 1439 |
| 515 | Ga0501073_0167038 | 3300049589 | Bacteria | 1523 |
| 516 | Ga0501074_0020328 | 3300049590 | Bacteria | 4826 |
| 517 | Ga0501074_0061355 | 3300049590 | Bacteria | 2709 |
| 518 | Ga0501077_0137313 | 3300049593 | Bacteria | 1550 |
| 519 | Ga0501080_0018253 | 3300049742 | Bacteria | 6492 |
| 520 | Ga0501080_0079213 | 3300049742 | Bacteria | 3054 |
| 521 | Ga0501080_0096336 | 3300049742 | Bacteria | 2747 |
| 522 | Ga0501081_0064170 | 3300049743 | Bacteria | 2550 |
| 523 | Ga0501083_0007632 | 3300049744 | Bacteria | 7666 |
| 524 | Ga0501083_0073549 | 3300049744 | Bacteria | 2272 |
| 525 | Ga0501035_0299740 | 3300049822 | Bacteria | 1354 |
| 526 | Ga0501035_0312878 | 3300049822 | Bacteria | 1321 |
| 527 | Ga0501044_0135193 | 3300049823 | Bacteria | 2457 |
| 528 | Ga0501044_0350221 | 3300049823 | Bacteria | 1396 |
| 529 | Ga0501044_0429262 | 3300049823 | Bacteria | 1231 |
| 530 | Ga0501045_0119876 | 3300049824 | Bacteria | 1953 |
| 531 | nmdc:mga03n38_123817_c1 | 3300050490 | Bacteria | 1274 |
| 532 | nmdc:mga03n38_38606_c1 | 3300050490 | Bacteria | 2066 |
| 533 | nmdc:mga00v17_120073_c1 | 3300050491 | Bacteria | 1673 |
| 534 | nmdc:mga0yw44_27139_c1 | 3300050492 | Bacteria | 3277 |
| 535 | nmdc:mga0yw44_37656_c1 | 3300050492 | Bacteria | 2857 |
| 536 | nmdc:mga0k408_100882_c1 | 3300050493 | Bacteria | 1702 |
| 537 | nmdc:mga0k408_132851_c1 | 3300050493 | Bacteria | 1478 |
| 538 | nmdc:mga06z11_3102_c1 | 3300050494 | Bacteria | 6410 |
| 539 | nmdc:mga06z11_78311_c1 | 3300050494 | Bacteria | 1767 |
| 540 | nmdc:mga06z11_83197_c1 | 3300050494 | Bacteria | 1722 |
| 541 | nmdc:mga07m45_115639_c1 | 3300050496 | Bacteria | 1547 |
| 542 | nmdc:mga07m45_178454_c1 | 3300050496 | Bacteria | 1235 |
| 543 | nmdc:mga07m45_61539_c1 | 3300050496 | Bacteria | 2126 |
| 544 | nmdc:mga09592_11937_c1 | 3300050508 | Bacteria | 7068 |
| 545 | nmdc:mga0qj67_347_c1 | 3300050509 | Bacteria | 31880 |
| 546 | nmdc:mga08y16_7449_c1 | 3300050511 | Bacteria | 11464 |
| 547 | nmdc:mga0n895_821039_c1 | 3300050512 | Bacteria | 919 |
| 548 | nmdc:mga0rr50_597139_c1 | 3300050513 | Bacteria | 941 |
| 549 | nmdc:mga0a205_375835_c1 | 3300050515 | Bacteria | 1286 |
| 550 | nmdc:mga0sz30_77963_c1 | 3300050516 | Bacteria | 1432 |
| 551 | Ga0495601_0150526 | 3300053077 | Bacteria | 1519 |
| 552 | Ga0495612_0004824 | 3300053078 | Bacteria | 5584 |
| 553 | Ga0500635_0065227 | 3300053080 | Bacteria | 1280 |
| 554 | Ga0495595_0002519 | 3300053084 | Bacteria | 7189 |
| 555 | Ga0495619_0022890 | 3300053085 | Bacteria | 4000 |
| 556 | Ga0495619_0271241 | 3300053085 | Unclassified | 1176 |
| 557 | Ga0500578_0120259 | 3300053086 | Bacteria | 1651 |
| 558 | Ga0500578_0133003 | 3300053086 | Bacteria | 1559 |
| 559 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 560 | Ga0500643_015992 | 3300053087 | Bacteria | 2558 |
| 561 | Ga0500644_0000965 | 3300053088 | Bacteria | 8999 |
| 562 | Ga0500651_0004300 | 3300053093 | Bacteria | 7955 |
| 563 | Ga0500651_0032093 | 3300053093 | Bacteria | 3310 |
| 564 | Ga0500651_0400152 | 3300053093 | Bacteria | 771 |
| 565 | Ga0500566_0000463 | 3300053094 | Bacteria | 22603 |
| 566 | Ga0500566_0000995 | 3300053094 | Bacteria | 16308 |
| 567 | Ga0500566_0004916 | 3300053094 | Bacteria | 7963 |
| 568 | Ga0500641_0034361 | 3300053096 | Bacteria | 2017 |
| 569 | Ga0500650_0002012 | 3300053098 | Bacteria | 6497 |
| 570 | Ga0500650_0099855 | 3300053098 | Bacteria | 1358 |
| 571 | Ga0500554_001390 | 3300053102 | Bacteria | 4682 |
| 572 | Ga0500555_001337 | 3300053103 | Bacteria | 7735 |
| 573 | Ga0500555_012842 | 3300053103 | Bacteria | 2412 |
| 574 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 575 | Ga0500556_0055006 | 3300053104 | Bacteria | 1450 |
| 576 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 577 | Ga0500562_014289 | 3300053108 | Bacteria | 2033 |
| 578 | Ga0500562_015517 | 3300053108 | Bacteria | 1954 |
| 579 | Ga0500569_056487 | 3300053109 | Bacteria | 1200 |
| 580 | Ga0500595_001628 | 3300053119 | Bacteria | 11788 |
| 581 | Ga0500595_001671 | 3300053119 | Bacteria | 11662 |
| 582 | Ga0500595_006726 | 3300053119 | Bacteria | 4848 |
| 583 | Ga0500595_008583 | 3300053119 | Bacteria | 4169 |
| 584 | Ga0500595_008810 | 3300053119 | Bacteria | 4101 |
| 585 | Ga0500595_009047 | 3300053119 | Bacteria | 4041 |
| 586 | Ga0500595_011726 | 3300053119 | Bacteria | 3416 |
| 587 | Ga0500595_017722 | 3300053119 | Bacteria | 2622 |
| 588 | Ga0500595_020522 | 3300053119 | Bacteria | 2377 |
| 589 | Ga0500595_056922 | 3300053119 | Bacteria | 1193 |
| 590 | Ga0500621_076191 | 3300053126 | Bacteria | 1349 |
| 591 | Ga0500642_0000041 | 3300053130 | Bacteria | 89564 |
| 592 | Ga0500642_0000124 | 3300053130 | Bacteria | 35205 |
| 593 | Ga0500642_0000963 | 3300053130 | Bacteria | 8262 |
| 594 | Ga0500642_0180726 | 3300053130 | Bacteria | 986 |
| 595 | Ga0500652_000004 | 3300053131 | Bacteria | 173428 |
| 596 | Ga0500652_004929 | 3300053131 | Bacteria | 4172 |
| 597 | Ga0500652_085835 | 3300053131 | Bacteria | 1312 |
| 598 | Ga0500658_0007535 | 3300053134 | Bacteria | 4023 |
| 599 | Ga0500658_0022139 | 3300053134 | Bacteria | 2412 |
| 600 | Ga0500658_0090635 | 3300053134 | Bacteria | 1321 |
| 601 | Ga0500559_0001229 | 3300053136 | Bacteria | 15171 |
| 602 | Ga0500568_0005321 | 3300053139 | Bacteria | 6674 |
| 603 | Ga0500568_0030262 | 3300053139 | Bacteria | 2242 |
| 604 | Ga0500577_0042640 | 3300053142 | Bacteria | 1663 |
| 605 | Ga0500577_0165643 | 3300053142 | Bacteria | 943 |
| 606 | Ga0500586_020822 | 3300053145 | Bacteria | 2059 |
| 607 | Ga0500590_023968 | 3300053148 | Bacteria | 3167 |
| 608 | Ga0500604_0002804 | 3300053151 | Bacteria | 4731 |
| 609 | Ga0500604_0005114 | 3300053151 | Bacteria | 3466 |
| 610 | Ga0500604_0025918 | 3300053151 | Bacteria | 1688 |
| 611 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 612 | Ga0500616_0000481 | 3300053153 | Bacteria | 51776 |
| 613 | Ga0500616_0003206 | 3300053153 | Bacteria | 12701 |
| 614 | Ga0500616_0010846 | 3300053153 | Bacteria | 5432 |
| 615 | Ga0500616_0220612 | 3300053153 | Bacteria | 827 |
| 616 | Ga0500622_0000502 | 3300053156 | Bacteria | 36464 |
| 617 | Ga0500622_0004375 | 3300053156 | Bacteria | 8909 |
| 618 | Ga0500622_0008776 | 3300053156 | Bacteria | 5629 |
| 619 | Ga0500633_0088997 | 3300053160 | Bacteria | 1126 |
| 620 | Ga0500634_0125150 | 3300053161 | Bacteria | 1244 |
| 621 | Ga0500638_001049 | 3300053162 | Bacteria | 8082 |
| 622 | Ga0500636_0004222 | 3300053177 | Bacteria | 8138 |
| 623 | Ga0500636_0005500 | 3300053177 | Bacteria | 7240 |
| 624 | Ga0500636_0037828 | 3300053177 | Bacteria | 2854 |
| 625 | Ga0500637_0000377 | 3300053178 | Bacteria | 16875 |
| 626 | Ga0500637_0020362 | 3300053178 | Bacteria | 3592 |
| 627 | Ga0500625_011730 | 3300053729 | Bacteria | 3990 |
| 628 | Ga0500645_033205 | 3300053730 | Bacteria | 1545 |
| 629 | Ga0500645_036609 | 3300053730 | Bacteria | 1460 |
| 630 | Ga0500609_000884 | 3300053731 | Bacteria | 4491 |
| 631 | Ga0500609_016761 | 3300053731 | Bacteria | 995 |
| 632 | Ga0500601_000616 | 3300053737 | Bacteria | 5041 |
| 633 | Ga0501084_0121215 | 3300054114 | Bacteria | 2199 |
| 634 | Ga0500661_000708 | 3300055283 | Bacteria | 6227 |
| 635 | Ga0500661_016040 | 3300055283 | Bacteria | 1342 |
| 636 | Ga0501082_0088996 | 3300060353 | Bacteria | 2665 |
| 637 | Ga0501082_0126524 | 3300060353 | Bacteria | 2216 |
| 638 | Ga0501082_0283461 | 3300060353 | Bacteria | 1442 |
| 639 | Ga0530510_0032181 | 3300061734 | Bacteria | 3771 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046642 | Ga0495634_0273880 | Ga0495634_0273880_104_799 | 228 |
| 2 | 3300014745 | Ga0157377_10055070 | Ga0157377_100550702 | 229 |
| 3 | iso_pu_bacteria | 2585428062 | 2587755090 | 234 |
| 4 | iso_pu_bacteria | 2821443989 | 2821447601 | 234 |
| 5 | 3300014968 | Ga0157379_10993677 | Ga0157379_109936772 | 235 |
| 6 | 3300046526 | Ga0495666_0086697 | Ga0495666_0086697_193_930 | 236 |
| 7 | 3300046809 | Ga0495600_0034239 | Ga0495600_0034239_2569_3282 | 237 |
| 8 | 3300003373 | JGI25407J50210_10050528 | JGI25407J50210_100505282 | 238 |
| 9 | 3300005981 | Ga0081538_10008909 | Ga0081538_100089097 | 238 |
| 10 | 3300053093 | Ga0500651_0400152 | Ga0500651_0400152_18_734 | 238 |
| 11 | 3300053134 | Ga0500658_0007535 | Ga0500658_0007535_864_1592 | 238 |
| 12 | iso_pu_bacteria | 8019648815 | 8019658802 | 239 |
| 13 | iso_pu_bacteria | 2824671348 | 2824674941 | 240 |
| 14 | iso_pu_bacteria | 2824687955 | 2824691366 | 240 |
| 15 | iso_pu_bacteria | 8055909800 | 8055912416 | 241 |
| 16 | 3300010375 | Ga0105239_10186038 | Ga0105239_101860383 | 242 |
| 17 | 3300044673 | Ga0453683_0151324 | Ga0453683_0151324_32_787 | 242 |
| 18 | 3300030522 | Ga0307512_10038687 | Ga0307512_100386874 | 243 |
| 19 | 3300005563 | Ga0068855_100022315 | Ga0068855_1000223153 | 244 |
| 20 | 3300025949 | Ga0207667_10078982 | Ga0207667_100789823 | 244 |
| 21 | 3300049589 | Ga0501073_0167038 | Ga0501073_0167038_367_1122 | 244 |
| 22 | 3300049742 | Ga0501080_0079213 | Ga0501080_0079213_183_938 | 244 |
| 23 | 3300049744 | Ga0501083_0073549 | Ga0501083_0073549_1306_2061 | 244 |
| 24 | 3300054114 | Ga0501084_0121215 | Ga0501084_0121215_1012_1767 | 244 |
| 25 | 3300060353 | Ga0501082_0283461 | Ga0501082_0283461_345_1100 | 244 |
| 26 | iso_pu_bacteria | 2643221736 | 2644745997 | 244 |
| 27 | iso_pu_bacteria | 2841760612 | 2841765939 | 244 |
| 28 | iso_pu_bacteria | 2841911363 | 2841915586 | 244 |
| 29 | iso_pu_bacteria | 2841917233 | 2841920788 | 244 |
| 30 | iso_pu_bacteria | 2844104063 | 2844105705 | 244 |
| 31 | iso_pu_bacteria | 2851182111 | 2851187699 | 244 |
| 32 | iso_pu_bacteria | 2851246043 | 2851246061 | 244 |
| 33 | iso_pu_bacteria | 8057529695 | 8057531737 | 244 |
| 34 | 3300005437 | Ga0070710_10130051 | Ga0070710_101300512 | 245 |
| 35 | 3300005439 | Ga0070711_100027855 | Ga0070711_1000278556 | 245 |
| 36 | 3300006175 | Ga0070712_100095561 | Ga0070712_1000955612 | 245 |
| 37 | 3300025915 | Ga0207693_10060889 | Ga0207693_100608894 | 245 |
| 38 | 3300028379 | Ga0268266_10678846 | Ga0268266_106788462 | 245 |
| 39 | 3300031456 | Ga0307513_10017182 | Ga0307513_100171827 | 245 |
| 40 | 3300031730 | Ga0307516_10001957 | Ga0307516_100019573 | 245 |
| 41 | 3300009093 | Ga0105240_10316569 | Ga0105240_103165692 | 246 |
| 42 | 3300009148 | Ga0105243_10140580 | Ga0105243_101405802 | 246 |
| 43 | 3300009174 | Ga0105241_10101607 | Ga0105241_101016073 | 246 |
| 44 | 3300009177 | Ga0105248_10793869 | Ga0105248_107938691 | 246 |
| 45 | 3300009545 | Ga0105237_10014818 | Ga0105237_100148189 | 246 |
| 46 | 3300011119 | Ga0105246_10059196 | Ga0105246_100591962 | 246 |
| 47 | 3300037418 | Ga0395900_0157448 | Ga0395900_0157448_1392_2141 | 246 |
| 48 | 3300037471 | Ga0395905_0208280 | Ga0395905_0208280_31_780 | 246 |
| 49 | 3300037471 | Ga0395905_0662800 | Ga0395905_0662800_20_802 | 246 |
| 50 | 3300038443 | Ga0395901_0142980 | Ga0395901_0142980_1675_2424 | 246 |
| 51 | 3300041494 | Ga0451837_0827062 | Ga0451837_0827062_17_766 | 246 |
| 52 | 3300046455 | Ga0495603_0310149 | Ga0495603_0310149_98_847 | 246 |
| 53 | 3300046492 | Ga0495585_0091472 | Ga0495585_0091472_156_905 | 246 |
| 54 | 3300046522 | Ga0495643_0039269 | Ga0495643_0039269_417_1166 | 246 |
| 55 | 3300046528 | Ga0495642_0222226 | Ga0495642_0222226_34_783 | 246 |
| 56 | 3300046616 | Ga0495668_0081240 | Ga0495668_0081240_41_781 | 246 |
| 57 | 3300046616 | Ga0495668_0117430 | Ga0495668_0117430_657_1406 | 246 |
| 58 | 3300046674 | Ga0495588_0059472 | Ga0495588_0059472_749_1498 | 246 |
| 59 | 3300046694 | Ga0495649_0187408 | Ga0495649_0187408_174_923 | 246 |
| 60 | 3300048903 | Ga0496100_0111614 | Ga0496100_0111614_972_1721 | 246 |
| 61 | 3300048904 | Ga0496101_0048304 | Ga0496101_0048304_802_1551 | 246 |
| 62 | 3300048905 | Ga0496102_0024579 | Ga0496102_0024579_33_782 | 246 |
| 63 | 3300048905 | Ga0496102_0743858 | Ga0496102_0743858_35_784 | 246 |
| 64 | 3300048906 | Ga0496103_0004525 | Ga0496103_0004525_3712_4461 | 246 |
| 65 | 3300048907 | Ga0496104_0162889 | Ga0496104_0162889_902_1651 | 246 |
| 66 | 3300048908 | Ga0496105_0173137 | Ga0496105_0173137_864_1613 | 246 |
| 67 | 3300048908 | Ga0496105_0226044 | Ga0496105_0226044_522_1271 | 246 |
| 68 | 3300048910 | Ga0496107_0509818 | Ga0496107_0509818_141_881 | 246 |
| 69 | 3300048911 | Ga0496108_0468669 | Ga0496108_0468669_195_944 | 246 |
| 70 | 3300048912 | Ga0496109_0073761 | Ga0496109_0073761_197_946 | 246 |
| 71 | 3300048915 | Ga0496112_0291307 | Ga0496112_0291307_619_1368 | 246 |
| 72 | 3300048916 | Ga0496113_0212430 | Ga0496113_0212430_50_799 | 246 |
| 73 | 3300048918 | Ga0496115_0402689 | Ga0496115_0402689_184_933 | 246 |
| 74 | 3300048919 | Ga0496116_0071370 | Ga0496116_0071370_939_1688 | 246 |
| 75 | 3300048920 | Ga0496117_0126906 | Ga0496117_0126906_588_1337 | 246 |
| 76 | 3300048920 | Ga0496117_0220779 | Ga0496117_0220779_16_756 | 246 |
| 77 | 3300048921 | Ga0496118_0031802 | Ga0496118_0031802_2667_3416 | 246 |
| 78 | 3300048921 | Ga0496118_0349612 | Ga0496118_0349612_23_763 | 246 |
| 79 | 3300048922 | Ga0496119_0084016 | Ga0496119_0084016_658_1407 | 246 |
| 80 | 3300048924 | Ga0496121_0387587 | Ga0496121_0387587_67_816 | 246 |
| 81 | 3300048928 | Ga0496125_0291833 | Ga0496125_0291833_56_805 | 246 |
| 82 | 3300048929 | Ga0496126_0200151 | Ga0496126_0200151_271_1020 | 246 |
| 83 | 3300050490 | nmdc:mga03n38_38606_c1 | nmdc:mga03n38_38606_c1_555_1304 | 246 |
| 84 | 3300050492 | nmdc:mga0yw44_37656_c1 | nmdc:mga0yw44_37656_c1_1102_1851 | 246 |
| 85 | 3300050494 | nmdc:mga06z11_3102_c1 | nmdc:mga06z11_3102_c1_5026_5766 | 246 |
| 86 | 3300053080 | Ga0500635_0065227 | Ga0500635_0065227_514_1254 | 246 |
| 87 | 3300053087 | Ga0500643_000035 | Ga0500643_000035_38434_39183 | 246 |
| 88 | 3300053094 | Ga0500566_0004916 | Ga0500566_0004916_6963_7712 | 246 |
| 89 | 3300053102 | Ga0500554_001390 | Ga0500554_001390_677_1426 | 246 |
| 90 | 3300053103 | Ga0500555_001337 | Ga0500555_001337_4452_5201 | 246 |
| 91 | 3300053104 | Ga0500556_0055006 | Ga0500556_0055006_473_1222 | 246 |
| 92 | 3300053105 | Ga0500557_000004 | Ga0500557_000004_98878_99627 | 246 |
| 93 | 3300053108 | Ga0500562_014289 | Ga0500562_014289_560_1309 | 246 |
| 94 | 3300053119 | Ga0500595_001628 | Ga0500595_001628_6738_7487 | 246 |
| 95 | 3300053119 | Ga0500595_017722 | Ga0500595_017722_376_1125 | 246 |
| 96 | 3300053130 | Ga0500642_0000124 | Ga0500642_0000124_12584_13333 | 246 |
| 97 | 3300053134 | Ga0500658_0090635 | Ga0500658_0090635_191_940 | 246 |
| 98 | 3300053151 | Ga0500604_0025918 | Ga0500604_0025918_885_1634 | 246 |
| 99 | 3300053153 | Ga0500616_0220612 | Ga0500616_0220612_11_760 | 246 |
| 100 | 3300053156 | Ga0500622_0004375 | Ga0500622_0004375_6843_7592 | 246 |
| 101 | 3300053162 | Ga0500638_001049 | Ga0500638_001049_1370_2119 | 246 |
| 102 | 3300053178 | Ga0500637_0000377 | Ga0500637_0000377_11901_12650 | 246 |
| 103 | 3300053729 | Ga0500625_011730 | Ga0500625_011730_1120_1869 | 246 |
| 104 | 3300053730 | Ga0500645_036609 | Ga0500645_036609_68_817 | 246 |
| 105 | 3300053737 | Ga0500601_000616 | Ga0500601_000616_1774_2523 | 246 |
| 106 | 3300055283 | Ga0500661_000708 | Ga0500661_000708_3625_4374 | 246 |
| 107 | 3300055283 | Ga0500661_016040 | Ga0500661_016040_417_1166 | 246 |
| 108 | 3300003791 | Ga0055530_10034137 | Ga0055530_100341371 | 247 |
| 109 | 3300003794 | Ga0055531_10015224 | Ga0055531_100152242 | 247 |
| 110 | 3300005337 | Ga0070682_100329151 | Ga0070682_1003291512 | 247 |
| 111 | 3300005564 | Ga0070664_100071706 | Ga0070664_1000717062 | 247 |
| 112 | 3300021441 | Ga0213871_10023614 | Ga0213871_100236142 | 247 |
| 113 | 3300025303 | Ga0209051_1043612 | Ga0209051_10436122 | 247 |
| 114 | 3300025304 | Ga0209257_1000334 | Ga0209257_100033464 | 247 |
| 115 | 3300025910 | Ga0207684_10654611 | Ga0207684_106546112 | 247 |
| 116 | 3300028794 | Ga0307515_10105384 | Ga0307515_101053842 | 247 |
| 117 | 3300028800 | Ga0265338_10000014 | Ga0265338_10000014105 | 247 |
| 118 | 3300031241 | Ga0265325_10000013 | Ga0265325_1000001334 | 247 |
| 119 | 3300031249 | Ga0265339_10001198 | Ga0265339_100011984 | 247 |
| 120 | 3300031250 | Ga0265331_10008911 | Ga0265331_100089112 | 247 |
| 121 | 3300031595 | Ga0265313_10003504 | Ga0265313_100035043 | 247 |
| 122 | 3300031616 | Ga0307508_10001988 | Ga0307508_1000198817 | 247 |
| 123 | 3300037471 | Ga0395905_0055415 | Ga0395905_0055415_2521_3309 | 247 |
| 124 | 3300039438 | Ga0436360_1237858 | Ga0436360_1237858_1093_1836 | 247 |
| 125 | 3300042011 | Ga0439454_026369 | Ga0439454_026369_83_871 | 247 |
| 126 | 3300042134 | Ga0450898_017548 | Ga0450898_017548_13_780 | 247 |
| 127 | 3300042876 | Ga0451577_0043580 | Ga0451577_0043580_161_952 | 247 |
| 128 | 3300046491 | Ga0495584_0002607 | Ga0495584_0002607_9337_10107 | 247 |
| 129 | 3300046492 | Ga0495585_0005504 | Ga0495585_0005504_2976_3746 | 247 |
| 130 | 3300046499 | Ga0495594_0000553 | Ga0495594_0000553_5784_6554 | 247 |
| 131 | 3300046518 | Ga0495631_0003300 | Ga0495631_0003300_133_903 | 247 |
| 132 | 3300046648 | Ga0495611_0001995 | Ga0495611_0001995_3095_3865 | 247 |
| 133 | 3300046665 | Ga0495661_0016887 | Ga0495661_0016887_4003_4773 | 247 |
| 134 | 3300046691 | Ga0495670_0013358 | Ga0495670_0013358_2092_2862 | 247 |
| 135 | 3300047318 | Ga0495636_0006052 | Ga0495636_0006052_1012_1782 | 247 |
| 136 | 3300047319 | Ga0495674_0001917 | Ga0495674_0001917_14917_15687 | 247 |
| 137 | 3300047321 | Ga0495676_0219762 | Ga0495676_0219762_432_1202 | 247 |
| 138 | 3300047323 | Ga0495683_0010346 | Ga0495683_0010346_3302_4072 | 247 |
| 139 | 3300048915 | Ga0496112_0232736 | Ga0496112_0232736_549_1295 | 247 |
| 140 | 3300049574 | Ga0501038_0547087 | Ga0501038_0547087_14_757 | 247 |
| 141 | 3300053119 | Ga0500595_006726 | Ga0500595_006726_3003_3746 | 247 |
| 142 | 3300053119 | Ga0500595_011726 | Ga0500595_011726_1873_2616 | 247 |
| 143 | 3300053131 | Ga0500652_000004 | Ga0500652_000004_82304_83047 | 247 |
| 144 | 3300053177 | Ga0500636_0005500 | Ga0500636_0005500_2934_3677 | 247 |
| 145 | iso_pu_bacteria | 2904615490 | 2904616267 | 247 |
| 146 | iso_pu_bacteria | 2904615490 | 2904624898 | 247 |
| 147 | 3300002987 | JGI25159J45721_1015563 | JGI25159J45721_10155632 | 248 |
| 148 | 3300003215 | JGI25153J46596_10000956 | JGI25153J46596_100009563 | 248 |
| 149 | 3300003659 | JGI25404J52841_10017971 | JGI25404J52841_100179711 | 248 |
| 150 | 3300005262 | Ga0065165_1000209 | Ga0065165_100020986 | 248 |
| 151 | 3300005466 | Ga0070685_10197036 | Ga0070685_101970362 | 248 |
| 152 | 3300005983 | Ga0081540_1000022 | Ga0081540_100002235 | 248 |
| 153 | 3300005983 | Ga0081540_1048913 | Ga0081540_10489132 | 248 |
| 154 | 3300005985 | Ga0081539_10000437 | Ga0081539_100004373 | 248 |
| 155 | 3300006051 | Ga0075364_10072819 | Ga0075364_100728192 | 248 |
| 156 | 3300006846 | Ga0075430_100000274 | Ga0075430_1000002749 | 248 |
| 157 | 3300009094 | Ga0111539_10634956 | Ga0111539_106349562 | 248 |
| 158 | 3300010375 | Ga0105239_11373187 | Ga0105239_113731871 | 248 |
| 159 | 3300025254 | Ga0209148_1000537 | Ga0209148_100053729 | 248 |
| 160 | 3300025272 | Ga0209455_1002053 | Ga0209455_10020537 | 248 |
| 161 | 3300025284 | Ga0209130_1000080 | Ga0209130_100008041 | 248 |
| 162 | 3300025294 | Ga0209025_1006130 | Ga0209025_10061307 | 248 |
| 163 | 3300025297 | Ga0209758_1000063 | Ga0209758_1000063248 | 248 |
| 164 | 3300025302 | Ga0207426_1016917 | Ga0207426_10169172 | 248 |
| 165 | 3300025923 | Ga0207681_10449277 | Ga0207681_104492771 | 248 |
| 166 | 3300025936 | Ga0207670_10282391 | Ga0207670_102823912 | 248 |
| 167 | 3300031730 | Ga0307516_10129471 | Ga0307516_101294712 | 248 |
| 168 | 3300035111 | Ga0373923_0012177 | Ga0373923_0012177_749_1495 | 248 |
| 169 | 3300035117 | Ga0373953_0022623 | Ga0373953_0022623_166_912 | 248 |
| 170 | 3300035120 | Ga0373957_0050829 | Ga0373957_0050829_258_1004 | 248 |
| 171 | 3300035410 | Ga0373924_0033430 | Ga0373924_0033430_348_1094 | 248 |
| 172 | 3300035724 | Ga0373933_0004938 | Ga0373933_0004938_5544_6290 | 248 |
| 173 | 3300036401 | Ga0373937_0002003 | Ga0373937_0002003_6571_7317 | 248 |
| 174 | 3300037853 | Ga0436364_0765298 | Ga0436364_0765298_372_1118 | 248 |
| 175 | 3300038705 | Ga0237819_07428 | Ga0237819_07428_27_773 | 248 |
| 176 | 3300039437 | Ga0436365_0862796 | Ga0436365_0862796_3914_4663 | 248 |
| 177 | 3300046454 | Ga0495592_0006749 | Ga0495592_0006749_3761_4507 | 248 |
| 178 | 3300046460 | Ga0495638_0032998 | Ga0495638_0032998_1831_2580 | 248 |
| 179 | 3300046462 | Ga0495651_0000265 | Ga0495651_0000265_3678_4424 | 248 |
| 180 | 3300046463 | Ga0495653_0080879 | Ga0495653_0080879_936_1682 | 248 |
| 181 | 3300046511 | Ga0495608_0000435 | Ga0495608_0000435_4028_4774 | 248 |
| 182 | 3300046516 | Ga0495628_0208285 | Ga0495628_0208285_562_1308 | 248 |
| 183 | 3300046522 | Ga0495643_0017241 | Ga0495643_0017241_1167_1913 | 248 |
| 184 | 3300046536 | Ga0495587_0002595 | Ga0495587_0002595_9459_10205 | 248 |
| 185 | 3300046536 | Ga0495587_0167702 | Ga0495587_0167702_481_1227 | 248 |
| 186 | 3300046543 | Ga0495645_0247456 | Ga0495645_0247456_39_785 | 248 |
| 187 | 3300046559 | Ga0495667_0000817 | Ga0495667_0000817_18404_19150 | 248 |
| 188 | 3300046642 | Ga0495634_0017385 | Ga0495634_0017385_726_1472 | 248 |
| 189 | 3300046663 | Ga0495635_0079050 | Ga0495635_0079050_538_1284 | 248 |
| 190 | 3300046675 | Ga0495657_0019625 | Ga0495657_0019625_1744_2490 | 248 |
| 191 | 3300046678 | Ga0495599_0016230 | Ga0495599_0016230_1592_2338 | 248 |
| 192 | 3300046680 | Ga0495646_0056521 | Ga0495646_0056521_1088_1834 | 248 |
| 193 | 3300046680 | Ga0495646_0161340 | Ga0495646_0161340_25_771 | 248 |
| 194 | 3300047322 | Ga0495680_0002679 | Ga0495680_0002679_175_921 | 248 |
| 195 | 3300047471 | Ga0495684_0110372 | Ga0495684_0110372_1083_1829 | 248 |
| 196 | 3300048088 | Ga0495602_0006478 | Ga0495602_0006478_835_1581 | 248 |
| 197 | 3300048088 | Ga0495602_0361756 | Ga0495602_0361756_249_995 | 248 |
| 198 | 3300048905 | Ga0496102_0227341 | Ga0496102_0227341_846_1592 | 248 |
| 199 | 3300048913 | Ga0496110_0099098 | Ga0496110_0099098_248_994 | 248 |
| 200 | 3300048916 | Ga0496113_0665888 | Ga0496113_0665888_16_765 | 248 |
| 201 | 3300050509 | nmdc:mga0qj67_347_c1 | nmdc:mga0qj67_347_c1_17246_17992 | 248 |
| 202 | 3300053078 | Ga0495612_0004824 | Ga0495612_0004824_4566_5312 | 248 |
| 203 | 3300053084 | Ga0495595_0002519 | Ga0495595_0002519_4695_5441 | 248 |
| 204 | 3300053086 | Ga0500578_0133003 | Ga0500578_0133003_42_788 | 248 |
| 205 | 3300053119 | Ga0500595_020522 | Ga0500595_020522_914_1660 | 248 |
| 206 | 3300053119 | Ga0500595_056922 | Ga0500595_056922_42_788 | 248 |
| 207 | 3300053131 | Ga0500652_085835 | Ga0500652_085835_498_1244 | 248 |
| 208 | 3300053142 | Ga0500577_0042640 | Ga0500577_0042640_83_829 | 248 |
| 209 | 3300053153 | Ga0500616_0010846 | Ga0500616_0010846_79_825 | 248 |
| 210 | 3300053156 | Ga0500622_0008776 | Ga0500622_0008776_2447_3193 | 248 |
| 211 | 3300053177 | Ga0500636_0004222 | Ga0500636_0004222_5041_5787 | 248 |
| 212 | 3300003187 | JGI25151J46595_10015149 | JGI25151J46595_100151494 | 249 |
| 213 | 3300003215 | JGI25153J46596_10000054 | JGI25153J46596_1000005410 | 249 |
| 214 | 3300003354 | JGI25160J50197_1007787 | JGI25160J50197_10077873 | 249 |
| 215 | 3300005436 | Ga0070713_100283233 | Ga0070713_1002832332 | 249 |
| 216 | 3300005441 | Ga0070700_100113941 | Ga0070700_1001139412 | 249 |
| 217 | 3300005536 | Ga0070697_100380141 | Ga0070697_1003801411 | 249 |
| 218 | 3300005539 | Ga0068853_100268278 | Ga0068853_1002682782 | 249 |
| 219 | 3300005844 | Ga0068862_100100829 | Ga0068862_1001008293 | 249 |
| 220 | 3300005985 | Ga0081539_10000979 | Ga0081539_1000097942 | 249 |
| 221 | 3300006871 | Ga0075434_100863103 | Ga0075434_1008631031 | 249 |
| 222 | 3300006880 | Ga0075429_100009612 | Ga0075429_1000096125 | 249 |
| 223 | 3300009094 | Ga0111539_10103570 | Ga0111539_101035702 | 249 |
| 224 | 3300009177 | Ga0105248_11129975 | Ga0105248_111299751 | 249 |
| 225 | 3300009545 | Ga0105237_10256008 | Ga0105237_102560082 | 249 |
| 226 | 3300009551 | Ga0105238_10486559 | Ga0105238_104865592 | 249 |
| 227 | 3300025284 | Ga0209130_1000631 | Ga0209130_100063119 | 249 |
| 228 | 3300025294 | Ga0209025_1000741 | Ga0209025_100074142 | 249 |
| 229 | 3300025297 | Ga0209758_1000048 | Ga0209758_1000048108 | 249 |
| 230 | 3300025297 | Ga0209758_1024417 | Ga0209758_10244172 | 249 |
| 231 | 3300025302 | Ga0207426_1000080 | Ga0207426_100008028 | 249 |
| 232 | 3300025906 | Ga0207699_10110199 | Ga0207699_101101992 | 249 |
| 233 | 3300025914 | Ga0207671_10188273 | Ga0207671_101882732 | 249 |
| 234 | 3300026041 | Ga0207639_10286933 | Ga0207639_102869331 | 249 |
| 235 | 3300026075 | Ga0207708_10195038 | Ga0207708_101950382 | 249 |
| 236 | 3300027907 | Ga0207428_10004660 | Ga0207428_1000466011 | 249 |
| 237 | 3300028380 | Ga0268265_10136887 | Ga0268265_101368873 | 249 |
| 238 | 3300031235 | Ga0265330_10008460 | Ga0265330_100084602 | 249 |
| 239 | 3300031238 | Ga0265332_10002568 | Ga0265332_1000256810 | 249 |
| 240 | 3300031239 | Ga0265328_10002067 | Ga0265328_100020674 | 249 |
| 241 | 3300031239 | Ga0265328_10007332 | Ga0265328_100073326 | 249 |
| 242 | 3300031242 | Ga0265329_10006602 | Ga0265329_100066022 | 249 |
| 243 | 3300031249 | Ga0265339_10091130 | Ga0265339_100911301 | 249 |
| 244 | 3300031250 | Ga0265331_10000885 | Ga0265331_100008858 | 249 |
| 245 | 3300031711 | Ga0265314_10000610 | Ga0265314_1000061019 | 249 |
| 246 | 3300031712 | Ga0265342_10024701 | Ga0265342_100247014 | 249 |
| 247 | 3300035695 | Ga0373927_0312032 | Ga0373927_0312032_152_901 | 249 |
| 248 | 3300035725 | Ga0373947_0045026 | Ga0373947_0045026_415_1164 | 249 |
| 249 | 3300037068 | Ga0373925_0128015 | Ga0373925_0128015_385_1134 | 249 |
| 250 | 3300037418 | Ga0395900_0104784 | Ga0395900_0104784_57_806 | 249 |
| 251 | 3300039450 | Ga0436363_1060761 | Ga0436363_1060761_22_771 | 249 |
| 252 | 3300041413 | Ga0439465_0061168 | Ga0439465_0061168_136_885 | 249 |
| 253 | 3300041460 | Ga0451802_1475528 | Ga0451802_1475528_164_913 | 249 |
| 254 | 3300045836 | Ga0466958_0010641 | Ga0466958_0010641_4293_5081 | 249 |
| 255 | 3300046459 | Ga0495629_0087079 | Ga0495629_0087079_1305_2054 | 249 |
| 256 | 3300048908 | Ga0496105_0181504 | Ga0496105_0181504_117_866 | 249 |
| 257 | 3300048909 | Ga0496106_0747093 | Ga0496106_0747093_17_766 | 249 |
| 258 | 3300048916 | Ga0496113_0138505 | Ga0496113_0138505_696_1445 | 249 |
| 259 | 3300048917 | Ga0496114_0426805 | Ga0496114_0426805_394_1143 | 249 |
| 260 | 3300049577 | Ga0501041_0125962 | Ga0501041_0125962_357_1106 | 249 |
| 261 | 3300049588 | Ga0501072_0090791 | Ga0501072_0090791_507_1256 | 249 |
| 262 | 3300049590 | Ga0501074_0061355 | Ga0501074_0061355_1942_2691 | 249 |
| 263 | 3300049593 | Ga0501077_0137313 | Ga0501077_0137313_620_1369 | 249 |
| 264 | 3300049743 | Ga0501081_0064170 | Ga0501081_0064170_1236_1985 | 249 |
| 265 | 3300049822 | Ga0501035_0312878 | Ga0501035_0312878_34_783 | 249 |
| 266 | 3300049823 | Ga0501044_0429262 | Ga0501044_0429262_400_1149 | 249 |
| 267 | 3300049824 | Ga0501045_0119876 | Ga0501045_0119876_198_947 | 249 |
| 268 | 3300050508 | nmdc:mga09592_11937_c1 | nmdc:mga09592_11937_c1_4391_5140 | 249 |
| 269 | 3300050511 | nmdc:mga08y16_7449_c1 | nmdc:mga08y16_7449_c1_9022_9771 | 249 |
| 270 | 3300050512 | nmdc:mga0n895_821039_c1 | nmdc:mga0n895_821039_c1_95_844 | 249 |
| 271 | 3300050513 | nmdc:mga0rr50_597139_c1 | nmdc:mga0rr50_597139_c1_73_822 | 249 |
| 272 | 3300053085 | Ga0495619_0022890 | Ga0495619_0022890_444_1193 | 249 |
| 273 | 3300053085 | Ga0495619_0271241 | Ga0495619_0271241_281_1069 | 249 |
| 274 | 3300053086 | Ga0500578_0120259 | Ga0500578_0120259_689_1438 | 249 |
| 275 | 3300053103 | Ga0500555_012842 | Ga0500555_012842_1344_2105 | 249 |
| 276 | 3300053119 | Ga0500595_001671 | Ga0500595_001671_5721_6482 | 249 |
| 277 | 3300053130 | Ga0500642_0000963 | Ga0500642_0000963_6190_6951 | 249 |
| 278 | 3300053139 | Ga0500568_0030262 | Ga0500568_0030262_672_1427 | 249 |
| 279 | 3300053151 | Ga0500604_0002804 | Ga0500604_0002804_3304_4053 | 249 |
| 280 | 3300053151 | Ga0500604_0005114 | Ga0500604_0005114_1135_1884 | 249 |
| 281 | 3300053153 | Ga0500616_0003206 | Ga0500616_0003206_8940_9701 | 249 |
| 282 | 3300053731 | Ga0500609_000884 | Ga0500609_000884_779_1528 | 249 |
| 283 | 3300060353 | Ga0501082_0088996 | Ga0501082_0088996_25_774 | 249 |
| 284 | 3300061734 | Ga0530510_0032181 | Ga0530510_0032181_239_988 | 249 |
| 285 | 3300005336 | Ga0070680_100165691 | Ga0070680_1001656911 | 251 |
| 286 | 3300005457 | Ga0070662_100002137 | Ga0070662_10000213710 | 251 |
| 287 | 3300005458 | Ga0070681_10007037 | Ga0070681_100070377 | 251 |
| 288 | 3300006195 | Ga0075366_10232792 | Ga0075366_102327921 | 251 |
| 289 | 3300025912 | Ga0207707_10028963 | Ga0207707_100289634 | 251 |
| 290 | 3300025933 | Ga0207706_10000870 | Ga0207706_1000087015 | 251 |
| 291 | 3300044735 | Ga0466968_0092520 | Ga0466968_0092520_319_1125 | 251 |
| 292 | 3300044901 | Ga0466960_0172169 | Ga0466960_0172169_250_1056 | 251 |
| 293 | 3300049742 | Ga0501080_0096336 | Ga0501080_0096336_158_913 | 251 |
| 294 | iso_pu_bacteria | 2617270735 | 2617347123 | 251 |
| 295 | iso_pu_bacteria | 2874612657 | 2874619492 | 251 |
| 296 | iso_pu_bacteria | 2876761206 | 2876764796 | 251 |
| 297 | 3300025928 | Ga0207700_10031294 | Ga0207700_100312941 | 252 |
| 298 | 3300039438 | Ga0436360_1320220 | Ga0436360_1320220_932_1708 | 252 |
| 299 | iso_pu_bacteria | 2513237092 | 2513629145 | 252 |
| 300 | iso_pu_bacteria | 2513237098 | 2513674424 | 252 |
| 301 | iso_pu_bacteria | 2513237139 | 2513873016 | 252 |
| 302 | iso_pu_bacteria | 2513237161 | 2514015690 | 252 |
| 303 | iso_pu_bacteria | 2791355196 | 2793062721 | 252 |
| 304 | iso_pu_bacteria | 2802429603 | 2805915084 | 252 |
| 305 | iso_pu_bacteria | 2824696289 | 2824699453 | 252 |
| 306 | iso_pu_bacteria | 2824704595 | 2824712556 | 252 |
| 307 | iso_pu_bacteria | 2824753945 | 2824754227 | 252 |
| 308 | iso_pu_bacteria | 2824763712 | 2824768964 | 252 |
| 309 | iso_pu_bacteria | 2824773399 | 2824775383 | 252 |
| 310 | iso_pu_bacteria | 2838122688 | 2838123482 | 252 |
| 311 | iso_pu_bacteria | 2841941048 | 2841947745 | 252 |
| 312 | iso_pu_bacteria | 2841949485 | 2841949584 | 252 |
| 313 | iso_pu_bacteria | 2841966195 | 2841971911 | 252 |
| 314 | iso_pu_bacteria | 2841974524 | 2841974746 | 252 |
| 315 | iso_pu_bacteria | 2841983080 | 2841983694 | 252 |
| 316 | iso_pu_bacteria | 2847939898 | 2847946818 | 252 |
| 317 | iso_pu_bacteria | 2903768456 | 2903774439 | 252 |
| 318 | iso_pu_bacteria | 2904690495 | 2904694814 | 252 |
| 319 | iso_pu_bacteria | 2904711408 | 2904714950 | 252 |
| 320 | iso_pu_bacteria | 2908756301 | 2908760034 | 252 |
| 321 | iso_pu_bacteria | 2935648319 | 2935651014 | 252 |
| 322 | iso_pu_bacteria | 2935656913 | 2935659195 | 252 |
| 323 | iso_pu_bacteria | 2935984226 | 2935987468 | 252 |
| 324 | iso_pu_bacteria | 2936011229 | 2936013610 | 252 |
| 325 | iso_pu_bacteria | 2936019824 | 2936022263 | 252 |
| 326 | iso_pu_bacteria | 2936028420 | 2936030709 | 252 |
| 327 | iso_pu_bacteria | 2936046547 | 2936048522 | 252 |
| 328 | iso_pu_bacteria | 2936055302 | 2936058736 | 252 |
| 329 | iso_pu_bacteria | 3005474847 | 3005480491 | 252 |
| 330 | iso_pu_bacteria | 3005483717 | 3005484576 | 252 |
| 331 | iso_pu_bacteria | 8056689827 | 8056695717 | 252 |
| 332 | 3300005328 | Ga0070676_10284344 | Ga0070676_102843441 | 253 |
| 333 | 3300006178 | Ga0075367_10078465 | Ga0075367_100784652 | 253 |
| 334 | 3300014325 | Ga0163163_10714150 | Ga0163163_107141501 | 253 |
| 335 | 3300039437 | Ga0436365_0888520 | Ga0436365_0888520_1580_2341 | 253 |
| 336 | 3300039438 | Ga0436360_1140127 | Ga0436360_1140127_2150_2938 | 253 |
| 337 | 3300048903 | Ga0496100_0076608 | Ga0496100_0076608_752_1690 | 253 |
| 338 | 3300048904 | Ga0496101_0481478 | Ga0496101_0481478_44_832 | 253 |
| 339 | 3300048908 | Ga0496105_0016638 | Ga0496105_0016638_3067_3993 | 253 |
| 340 | 3300048910 | Ga0496107_0047996 | Ga0496107_0047996_1560_2498 | 253 |
| 341 | 3300048917 | Ga0496114_0033255 | Ga0496114_0033255_1522_2448 | 253 |
| 342 | 3300050494 | nmdc:mga06z11_83197_c1 | nmdc:mga06z11_83197_c1_456_1217 | 253 |
| 343 | iso_pu_bacteria | 2508501009 | 2508542402 | 253 |
| 344 | iso_pu_bacteria | 2508501042 | 2508691847 | 253 |
| 345 | iso_pu_bacteria | 2513237094 | 2513640638 | 253 |
| 346 | iso_pu_bacteria | 2513237096 | 2513657874 | 253 |
| 347 | iso_pu_bacteria | 2513237137 | 2513855574 | 253 |
| 348 | iso_pu_bacteria | 2513237145 | 2513920033 | 253 |
| 349 | iso_pu_bacteria | 2517093001 | 2517102793 | 253 |
| 350 | iso_pu_bacteria | 2517572143 | 2517892119 | 253 |
| 351 | iso_pu_bacteria | 2524023205 | 2524437601 | 253 |
| 352 | iso_pu_bacteria | 2524023228 | 2524534204 | 253 |
| 353 | iso_pu_bacteria | 2528768022 | 2528857024 | 253 |
| 354 | iso_pu_bacteria | 2602042107 | 2603862359 | 253 |
| 355 | iso_pu_bacteria | 2667528175 | 2671121843 | 253 |
| 356 | iso_pu_bacteria | 2728368998 | 2728751077 | 253 |
| 357 | iso_pu_bacteria | 2744054633 | 2745079535 | 253 |
| 358 | iso_pu_bacteria | 2791355197 | 2793068796 | 253 |
| 359 | iso_pu_bacteria | 2824661429 | 2824661433 | 253 |
| 360 | iso_pu_bacteria | 2841957949 | 2841964165 | 253 |
| 361 | iso_pu_bacteria | 2857524615 | 2857525751 | 253 |
| 362 | iso_pu_bacteria | 2874628541 | 2874632131 | 253 |
| 363 | iso_pu_bacteria | 2879099564 | 2879104537 | 253 |
| 364 | iso_pu_bacteria | 2893066018 | 2893067955 | 253 |
| 365 | iso_pu_bacteria | 2906610324 | 2906617248 | 253 |
| 366 | iso_pu_bacteria | 2906626472 | 2906633591 | 253 |
| 367 | iso_pu_bacteria | 2906635258 | 2906643361 | 253 |
| 368 | iso_pu_bacteria | 2906660503 | 2906662508 | 253 |
| 369 | iso_pu_bacteria | 2908739725 | 2908742399 | 253 |
| 370 | iso_pu_bacteria | 2919073203 | 2919074385 | 253 |
| 371 | iso_pu_bacteria | 2922368715 | 2922374702 | 253 |
| 372 | iso_pu_bacteria | 2932784394 | 2932788643 | 253 |
| 373 | iso_pu_bacteria | 2932794094 | 2932798099 | 253 |
| 374 | iso_pu_bacteria | 2932801729 | 2932807045 | 253 |
| 375 | iso_pu_bacteria | 2932809354 | 2932817421 | 253 |
| 376 | iso_pu_bacteria | 2932818245 | 2932826190 | 253 |
| 377 | iso_pu_bacteria | 2932828146 | 2932830291 | 253 |
| 378 | iso_pu_bacteria | 2935616580 | 2935616582 | 253 |
| 379 | iso_pu_bacteria | 2935630451 | 2935631256 | 253 |
| 380 | iso_pu_bacteria | 2935638405 | 2935642088 | 253 |
| 381 | iso_pu_bacteria | 2935665750 | 2935672528 | 253 |
| 382 | iso_pu_bacteria | 2935675223 | 2935676007 | 253 |
| 383 | iso_pu_bacteria | 2935684952 | 2935685999 | 253 |
| 384 | iso_pu_bacteria | 2935694250 | 2935697757 | 253 |
| 385 | iso_pu_bacteria | 2935703347 | 2935705839 | 253 |
| 386 | iso_pu_bacteria | 2935713505 | 2935714551 | 253 |
| 387 | iso_pu_bacteria | 2935722832 | 2935725170 | 253 |
| 388 | iso_pu_bacteria | 2935732158 | 2935732470 | 253 |
| 389 | iso_pu_bacteria | 2935741537 | 2935741849 | 253 |
| 390 | iso_pu_bacteria | 2935750917 | 2935751964 | 253 |
| 391 | iso_pu_bacteria | 2935760218 | 2935765221 | 253 |
| 392 | iso_pu_bacteria | 2935801545 | 2935802836 | 253 |
| 393 | iso_pu_bacteria | 2935810662 | 2935813332 | 253 |
| 394 | iso_pu_bacteria | 2935827899 | 2935830255 | 253 |
| 395 | iso_pu_bacteria | 2935837841 | 2935838152 | 253 |
| 396 | iso_pu_bacteria | 2935855204 | 2935855206 | 253 |
| 397 | iso_pu_bacteria | 2935864058 | 2935867531 | 253 |
| 398 | iso_pu_bacteria | 2935873716 | 2935875631 | 253 |
| 399 | iso_pu_bacteria | 2935883170 | 2935886828 | 253 |
| 400 | iso_pu_bacteria | 2935959822 | 2935960667 | 253 |
| 401 | iso_pu_bacteria | 2935992306 | 2935996314 | 253 |
| 402 | iso_pu_bacteria | 2936002035 | 2936003597 | 253 |
| 403 | iso_pu_bacteria | 2936037263 | 2936042281 | 253 |
| 404 | iso_pu_bacteria | 2940556831 | 2940557233 | 253 |
| 405 | iso_pu_bacteria | 2941507105 | 2941509997 | 253 |
| 406 | iso_pu_bacteria | 2941515067 | 2941518916 | 253 |
| 407 | iso_pu_bacteria | 2941523033 | 2941525396 | 253 |
| 408 | iso_pu_bacteria | 2941531003 | 2941533064 | 253 |
| 409 | iso_pu_bacteria | 2941538514 | 2941539181 | 253 |
| 410 | iso_pu_bacteria | 3005710791 | 3005715157 | 253 |
| 411 | iso_pu_bacteria | 8006933436 | 8006940288 | 253 |
| 412 | iso_pu_bacteria | 8006973647 | 8006980066 | 253 |
| 413 | iso_pu_bacteria | 8016511872 | 8016522016 | 253 |
| 414 | iso_pu_bacteria | 8017057580 | 8017063652 | 253 |
| 415 | iso_pu_bacteria | 8019576017 | 8019582979 | 253 |
| 416 | iso_pu_bacteria | 8019586578 | 8019590776 | 253 |
| 417 | iso_pu_bacteria | 8056681323 | 8056687348 | 253 |
| 418 | 3300005983 | Ga0081540_1027170 | Ga0081540_10271701 | 254 |
| 419 | 3300009553 | Ga0105249_10422258 | Ga0105249_104222582 | 254 |
| 420 | 3300031711 | Ga0265314_10007230 | Ga0265314_1000723010 | 254 |
| 421 | 3300048926 | Ga0496123_0059427 | Ga0496123_0059427_842_1627 | 254 |
| 422 | 3300004625 | Ga0055543_1026967 | Ga0055543_10269671 | 255 |
| 423 | 3300005262 | Ga0065165_1001615 | Ga0065165_100161510 | 255 |
| 424 | 3300014325 | Ga0163163_10622470 | Ga0163163_106224701 | 255 |
| 425 | 3300025302 | Ga0207426_1000434 | Ga0207426_100043423 | 255 |
| 426 | 3300048924 | Ga0496121_0000128 | Ga0496121_0000128_144812_145600 | 255 |
| 427 | 3300049573 | Ga0501037_0194164 | Ga0501037_0194164_232_1071 | 255 |
| 428 | 3300003659 | JGI25404J52841_10016775 | JGI25404J52841_100167752 | 256 |
| 429 | 3300005937 | Ga0081455_10029943 | Ga0081455_100299434 | 256 |
| 430 | 3300005983 | Ga0081540_1003164 | Ga0081540_10031648 | 256 |
| 431 | 3300006942 | Ga0099824_1002487 | Ga0099824_100248712 | 256 |
| 432 | 3300010375 | Ga0105239_10320821 | Ga0105239_103208212 | 256 |
| 433 | 3300025898 | Ga0207692_10198248 | Ga0207692_101982482 | 256 |
| 434 | 3300031456 | Ga0307513_10138015 | Ga0307513_101380153 | 256 |
| 435 | 3300031507 | Ga0307509_10139933 | Ga0307509_101399333 | 256 |
| 436 | 3300037471 | Ga0395905_0200798 | Ga0395905_0200798_236_1048 | 256 |
| 437 | 3300049460 | Ga0495682_0021357 | Ga0495682_0021357_1393_2193 | 256 |
| 438 | 3300053088 | Ga0500644_0000965 | Ga0500644_0000965_1904_2683 | 256 |
| 439 | 3300053093 | Ga0500651_0032093 | Ga0500651_0032093_1733_2512 | 256 |
| 440 | 3300053119 | Ga0500595_008810 | Ga0500595_008810_2365_3141 | 256 |
| 441 | 3300053153 | Ga0500616_0000481 | Ga0500616_0000481_8365_9144 | 256 |
| 442 | 3300001990 | JGI24737J22298_10036620 | JGI24737J22298_100366202 | 257 |
| 443 | 3300003203 | JGI25406J46586_10005513 | JGI25406J46586_100055134 | 257 |
| 444 | 3300003354 | JGI25160J50197_1001301 | JGI25160J50197_10013013 | 257 |
| 445 | 3300003659 | JGI25404J52841_10001679 | JGI25404J52841_100016794 | 257 |
| 446 | 3300003659 | JGI25404J52841_10007890 | JGI25404J52841_100078902 | 257 |
| 447 | 3300003659 | JGI25404J52841_10028950 | JGI25404J52841_100289502 | 257 |
| 448 | 3300005328 | Ga0070676_10158355 | Ga0070676_101583552 | 257 |
| 449 | 3300005334 | Ga0068869_100041248 | Ga0068869_1000412483 | 257 |
| 450 | 3300005334 | Ga0068869_100500095 | Ga0068869_1005000951 | 257 |
| 451 | 3300005338 | Ga0068868_100281999 | Ga0068868_1002819992 | 257 |
| 452 | 3300005344 | Ga0070661_100439146 | Ga0070661_1004391462 | 257 |
| 453 | 3300005344 | Ga0070661_100468257 | Ga0070661_1004682572 | 257 |
| 454 | 3300005347 | Ga0070668_100010301 | Ga0070668_1000103012 | 257 |
| 455 | 3300005347 | Ga0070668_100273119 | Ga0070668_1002731191 | 257 |
| 456 | 3300005347 | Ga0070668_100413572 | Ga0070668_1004135721 | 257 |
| 457 | 3300005355 | Ga0070671_100015721 | Ga0070671_1000157215 | 257 |
| 458 | 3300005355 | Ga0070671_100232728 | Ga0070671_1002327282 | 257 |
| 459 | 3300005364 | Ga0070673_100141675 | Ga0070673_1001416752 | 257 |
| 460 | 3300005434 | Ga0070709_10024373 | Ga0070709_100243733 | 257 |
| 461 | 3300005436 | Ga0070713_100016644 | Ga0070713_1000166442 | 257 |
| 462 | 3300005436 | Ga0070713_100131716 | Ga0070713_1001317161 | 257 |
| 463 | 3300005436 | Ga0070713_100356634 | Ga0070713_1003566342 | 257 |
| 464 | 3300005437 | Ga0070710_10015274 | Ga0070710_100152742 | 257 |
| 465 | 3300005439 | Ga0070711_100029811 | Ga0070711_1000298113 | 257 |
| 466 | 3300005439 | Ga0070711_100039402 | Ga0070711_1000394023 | 257 |
| 467 | 3300005444 | Ga0070694_100129746 | Ga0070694_1001297461 | 257 |
| 468 | 3300005445 | Ga0070708_100432756 | Ga0070708_1004327562 | 257 |
| 469 | 3300005455 | Ga0070663_100022613 | Ga0070663_1000226133 | 257 |
| 470 | 3300005455 | Ga0070663_100048502 | Ga0070663_1000485023 | 257 |
| 471 | 3300005455 | Ga0070663_100237153 | Ga0070663_1002371532 | 257 |
| 472 | 3300005456 | Ga0070678_100011505 | Ga0070678_1000115053 | 257 |
| 473 | 3300005459 | Ga0068867_100000068 | Ga0068867_10000006830 | 257 |
| 474 | 3300005539 | Ga0068853_100093623 | Ga0068853_1000936233 | 257 |
| 475 | 3300005539 | Ga0068853_100143194 | Ga0068853_1001431942 | 257 |
| 476 | 3300005543 | Ga0070672_100001670 | Ga0070672_1000016704 | 257 |
| 477 | 3300005547 | Ga0070693_100082763 | Ga0070693_1000827632 | 257 |
| 478 | 3300005548 | Ga0070665_100094396 | Ga0070665_1000943962 | 257 |
| 479 | 3300005548 | Ga0070665_100096246 | Ga0070665_1000962462 | 257 |
| 480 | 3300005548 | Ga0070665_100226316 | Ga0070665_1002263162 | 257 |
| 481 | 3300005548 | Ga0070665_100279086 | Ga0070665_1002790862 | 257 |
| 482 | 3300005548 | Ga0070665_100758004 | Ga0070665_1007580041 | 257 |
| 483 | 3300005549 | Ga0070704_100534816 | Ga0070704_1005348162 | 257 |
| 484 | 3300005563 | Ga0068855_100295151 | Ga0068855_1002951512 | 257 |
| 485 | 3300005564 | Ga0070664_100058232 | Ga0070664_1000582323 | 257 |
| 486 | 3300005577 | Ga0068857_100150119 | Ga0068857_1001501193 | 257 |
| 487 | 3300005577 | Ga0068857_100238070 | Ga0068857_1002380702 | 257 |
| 488 | 3300005578 | Ga0068854_100122932 | Ga0068854_1001229322 | 257 |
| 489 | 3300005614 | Ga0068856_100021869 | Ga0068856_1000218692 | 257 |
| 490 | 3300005614 | Ga0068856_100114758 | Ga0068856_1001147583 | 257 |
| 491 | 3300005616 | Ga0068852_100074444 | Ga0068852_1000744443 | 257 |
| 492 | 3300005618 | Ga0068864_100148006 | Ga0068864_1001480061 | 257 |
| 493 | 3300005719 | Ga0068861_100164970 | Ga0068861_1001649702 | 257 |
| 494 | 3300005719 | Ga0068861_100189381 | Ga0068861_1001893812 | 257 |
| 495 | 3300005841 | Ga0068863_100510328 | Ga0068863_1005103283 | 257 |
| 496 | 3300005842 | Ga0068858_100110771 | Ga0068858_1001107713 | 257 |
| 497 | 3300005843 | Ga0068860_100087844 | Ga0068860_1000878443 | 257 |
| 498 | 3300005937 | Ga0081455_10000257 | Ga0081455_1000025732 | 257 |
| 499 | 3300005937 | Ga0081455_10013857 | Ga0081455_100138576 | 257 |
| 500 | 3300005937 | Ga0081455_10027984 | Ga0081455_100279844 | 257 |
| 501 | 3300005937 | Ga0081455_10029417 | Ga0081455_100294172 | 257 |
| 502 | 3300005937 | Ga0081455_10045454 | Ga0081455_100454544 | 257 |
| 503 | 3300005983 | Ga0081540_1000731 | Ga0081540_100073124 | 257 |
| 504 | 3300005983 | Ga0081540_1002537 | Ga0081540_10025377 | 257 |
| 505 | 3300005983 | Ga0081540_1005764 | Ga0081540_10057646 | 257 |
| 506 | 3300005983 | Ga0081540_1006159 | Ga0081540_10061594 | 257 |
| 507 | 3300005983 | Ga0081540_1013773 | Ga0081540_10137733 | 257 |
| 508 | 3300005983 | Ga0081540_1016629 | Ga0081540_10166292 | 257 |
| 509 | 3300005983 | Ga0081540_1059871 | Ga0081540_10598712 | 257 |
| 510 | 3300005983 | Ga0081540_1111576 | Ga0081540_11115761 | 257 |
| 511 | 3300005985 | Ga0081539_10001065 | Ga0081539_1000106523 | 257 |
| 512 | 3300006038 | Ga0075365_10134234 | Ga0075365_101342342 | 257 |
| 513 | 3300006042 | Ga0075368_10002266 | Ga0075368_100022666 | 257 |
| 514 | 3300006048 | Ga0075363_100021002 | Ga0075363_1000210022 | 257 |
| 515 | 3300006051 | Ga0075364_10039676 | Ga0075364_100396762 | 257 |
| 516 | 3300006051 | Ga0075364_10055260 | Ga0075364_100552602 | 257 |
| 517 | 3300006051 | Ga0075364_10067640 | Ga0075364_100676403 | 257 |
| 518 | 3300006051 | Ga0075364_10358796 | Ga0075364_103587961 | 257 |
| 519 | 3300006178 | Ga0075367_10000751 | Ga0075367_100007514 | 257 |
| 520 | 3300006186 | Ga0075369_10005862 | Ga0075369_100058623 | 257 |
| 521 | 3300006195 | Ga0075366_10057364 | Ga0075366_100573642 | 257 |
| 522 | 3300006195 | Ga0075366_10072598 | Ga0075366_100725982 | 257 |
| 523 | 3300006237 | Ga0097621_100266531 | Ga0097621_1002665312 | 257 |
| 524 | 3300006237 | Ga0097621_100406530 | Ga0097621_1004065302 | 257 |
| 525 | 3300006358 | Ga0068871_100325248 | Ga0068871_1003252482 | 257 |
| 526 | 3300006871 | Ga0075434_100308096 | Ga0075434_1003080962 | 257 |
| 527 | 3300006943 | Ga0099822_1001480 | Ga0099822_10014806 | 257 |
| 528 | 3300007076 | Ga0075435_100057062 | Ga0075435_1000570623 | 257 |
| 529 | 3300007265 | Ga0099794_10070996 | Ga0099794_100709962 | 257 |
| 530 | 3300009098 | Ga0105245_10043869 | Ga0105245_100438694 | 257 |
| 531 | 3300009101 | Ga0105247_10128943 | Ga0105247_101289432 | 257 |
| 532 | 3300009148 | Ga0105243_10001337 | Ga0105243_100013378 | 257 |
| 533 | 3300009148 | Ga0105243_10066172 | Ga0105243_100661722 | 257 |
| 534 | 3300009174 | Ga0105241_10084858 | Ga0105241_100848583 | 257 |
| 535 | 3300009176 | Ga0105242_10071448 | Ga0105242_100714483 | 257 |
| 536 | 3300009176 | Ga0105242_10763168 | Ga0105242_107631681 | 257 |
| 537 | 3300009177 | Ga0105248_10077818 | Ga0105248_100778182 | 257 |
| 538 | 3300009551 | Ga0105238_10071974 | Ga0105238_100719742 | 257 |
| 539 | 3300009553 | Ga0105249_10283871 | Ga0105249_102838711 | 257 |
| 540 | 3300010375 | Ga0105239_10292263 | Ga0105239_102922632 | 257 |
| 541 | 3300011119 | Ga0105246_10019289 | Ga0105246_100192892 | 257 |
| 542 | 3300013296 | Ga0157374_10098561 | Ga0157374_100985613 | 257 |
| 543 | 3300013297 | Ga0157378_10371040 | Ga0157378_103710402 | 257 |
| 544 | 3300013306 | Ga0163162_10131585 | Ga0163162_101315852 | 257 |
| 545 | 3300013308 | Ga0157375_10693484 | Ga0157375_106934841 | 257 |
| 546 | 3300014325 | Ga0163163_10303413 | Ga0163163_103034132 | 257 |
| 547 | 3300014745 | Ga0157377_10000082 | Ga0157377_1000008240 | 257 |
| 548 | 3300014745 | Ga0157377_10167977 | Ga0157377_101679772 | 257 |
| 549 | 3300014968 | Ga0157379_10030359 | Ga0157379_100303593 | 257 |
| 550 | 3300014969 | Ga0157376_10261411 | Ga0157376_102614112 | 257 |
| 551 | 3300017792 | Ga0163161_10191240 | Ga0163161_101912401 | 257 |
| 552 | 3300021384 | Ga0213876_10087979 | Ga0213876_100879792 | 257 |
| 553 | 3300021384 | Ga0213876_10088910 | Ga0213876_100889101 | 257 |
| 554 | 3300021388 | Ga0213875_10168988 | Ga0213875_101689881 | 257 |
| 555 | 3300021441 | Ga0213871_10000629 | Ga0213871_100006295 | 257 |
| 556 | 3300025261 | Ga0209233_1002379 | Ga0209233_10023794 | 257 |
| 557 | 3300025295 | Ga0209564_1002134 | Ga0209564_10021349 | 257 |
| 558 | 3300025297 | Ga0209758_1005830 | Ga0209758_100583010 | 257 |
| 559 | 3300025297 | Ga0209758_1012479 | Ga0209758_10124792 | 257 |
| 560 | 3300025302 | Ga0207426_1000278 | Ga0207426_100027894 | 257 |
| 561 | 3300025302 | Ga0207426_1026198 | Ga0207426_10261982 | 257 |
| 562 | 3300025304 | Ga0209257_1025936 | Ga0209257_10259363 | 257 |
| 563 | 3300025304 | Ga0209257_1038945 | Ga0209257_10389452 | 257 |
| 564 | 3300025898 | Ga0207692_10050633 | Ga0207692_100506332 | 257 |
| 565 | 3300025901 | Ga0207688_10009448 | Ga0207688_100094482 | 257 |
| 566 | 3300025904 | Ga0207647_10002905 | Ga0207647_1000290510 | 257 |
| 567 | 3300025906 | Ga0207699_10009741 | Ga0207699_100097413 | 257 |
| 568 | 3300025906 | Ga0207699_10073539 | Ga0207699_100735392 | 257 |
| 569 | 3300025914 | Ga0207671_10096147 | Ga0207671_100961472 | 257 |
| 570 | 3300025914 | Ga0207671_10399010 | Ga0207671_103990102 | 257 |
| 571 | 3300025915 | Ga0207693_10015503 | Ga0207693_100155036 | 257 |
| 572 | 3300025915 | Ga0207693_10538787 | Ga0207693_105387871 | 257 |
| 573 | 3300025916 | Ga0207663_10017868 | Ga0207663_100178683 | 257 |
| 574 | 3300025919 | Ga0207657_10087243 | Ga0207657_100872433 | 257 |
| 575 | 3300025919 | Ga0207657_10385343 | Ga0207657_103853432 | 257 |
| 576 | 3300025920 | Ga0207649_10501256 | Ga0207649_105012561 | 257 |
| 577 | 3300025923 | Ga0207681_10074914 | Ga0207681_100749143 | 257 |
| 578 | 3300025924 | Ga0207694_10088200 | Ga0207694_100882002 | 257 |
| 579 | 3300025924 | Ga0207694_10170564 | Ga0207694_101705642 | 257 |
| 580 | 3300025927 | Ga0207687_10020973 | Ga0207687_100209733 | 257 |
| 581 | 3300025928 | Ga0207700_10012573 | Ga0207700_100125732 | 257 |
| 582 | 3300025928 | Ga0207700_10055741 | Ga0207700_100557412 | 257 |
| 583 | 3300025928 | Ga0207700_10226913 | Ga0207700_102269132 | 257 |
| 584 | 3300025929 | Ga0207664_10481186 | Ga0207664_104811862 | 257 |
| 585 | 3300025931 | Ga0207644_10284074 | Ga0207644_102840742 | 257 |
| 586 | 3300025933 | Ga0207706_10027409 | Ga0207706_100274094 | 257 |
| 587 | 3300025935 | Ga0207709_10000935 | Ga0207709_100009352 | 257 |
| 588 | 3300025941 | Ga0207711_10208842 | Ga0207711_102088421 | 257 |
| 589 | 3300025942 | Ga0207689_10019627 | Ga0207689_100196274 | 257 |
| 590 | 3300025942 | Ga0207689_10499258 | Ga0207689_104992582 | 257 |
| 591 | 3300025945 | Ga0207679_10103279 | Ga0207679_101032792 | 257 |
| 592 | 3300025949 | Ga0207667_10050515 | Ga0207667_100505153 | 257 |
| 593 | 3300025960 | Ga0207651_10179600 | Ga0207651_101796001 | 257 |
| 594 | 3300025972 | Ga0207668_10122093 | Ga0207668_101220932 | 257 |
| 595 | 3300025972 | Ga0207668_10478151 | Ga0207668_104781511 | 257 |
| 596 | 3300026023 | Ga0207677_10153346 | Ga0207677_101533462 | 257 |
| 597 | 3300026023 | Ga0207677_10667299 | Ga0207677_106672991 | 257 |
| 598 | 3300026041 | Ga0207639_10411858 | Ga0207639_104118582 | 257 |
| 599 | 3300026067 | Ga0207678_10007112 | Ga0207678_100071123 | 257 |
| 600 | 3300026067 | Ga0207678_10041583 | Ga0207678_100415834 | 257 |
| 601 | 3300026067 | Ga0207678_10044234 | Ga0207678_100442343 | 257 |
| 602 | 3300026067 | Ga0207678_10092531 | Ga0207678_100925313 | 257 |
| 603 | 3300026067 | Ga0207678_10274304 | Ga0207678_102743042 | 257 |
| 604 | 3300026078 | Ga0207702_10305376 | Ga0207702_103053762 | 257 |
| 605 | 3300026089 | Ga0207648_10000942 | Ga0207648_100009429 | 257 |
| 606 | 3300026089 | Ga0207648_10418282 | Ga0207648_104182821 | 257 |
| 607 | 3300026095 | Ga0207676_10225068 | Ga0207676_102250682 | 257 |
| 608 | 3300026116 | Ga0207674_10047170 | Ga0207674_100471702 | 257 |
| 609 | 3300026116 | Ga0207674_10068754 | Ga0207674_100687542 | 257 |
| 610 | 3300026118 | Ga0207675_100175512 | Ga0207675_1001755122 | 257 |
| 611 | 3300026118 | Ga0207675_100206135 | Ga0207675_1002061351 | 257 |
| 612 | 3300026121 | Ga0207683_10019537 | Ga0207683_100195374 | 257 |
| 613 | 3300026142 | Ga0207698_10086451 | Ga0207698_100864512 | 257 |
| 614 | 3300026142 | Ga0207698_10206167 | Ga0207698_102061672 | 257 |
| 615 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001188 | 257 |
| 616 | 3300027361 | Ga0209489_100001 | Ga0209489_100001188 | 257 |
| 617 | 3300027363 | Ga0209700_100001 | Ga0209700_100001188 | 257 |
| 618 | 3300027671 | Ga0209588_1021413 | Ga0209588_10214132 | 257 |
| 619 | 3300028379 | Ga0268266_10098912 | Ga0268266_100989122 | 257 |
| 620 | 3300028380 | Ga0268265_10070482 | Ga0268265_100704823 | 257 |
| 621 | 3300028381 | Ga0268264_10244044 | Ga0268264_102440441 | 257 |
| 622 | 3300028794 | Ga0307515_10054386 | Ga0307515_100543863 | 257 |
| 623 | 3300031249 | Ga0265339_10110529 | Ga0265339_101105293 | 257 |
| 624 | 3300031730 | Ga0307516_10015472 | Ga0307516_100154723 | 257 |
| 625 | 3300031911 | Ga0307412_10519068 | Ga0307412_105190681 | 257 |
| 626 | 3300033180 | Ga0307510_10100044 | Ga0307510_101000442 | 257 |
| 627 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006298 | 257 |
| 628 | 3300037471 | Ga0395905_0232271 | Ga0395905_0232271_805_1578 | 257 |
| 629 | 3300039437 | Ga0436365_0194098 | Ga0436365_0194098_1106_1909 | 257 |
| 630 | 3300039437 | Ga0436365_0824955 | Ga0436365_0824955_50_823 | 257 |
| 631 | 3300039437 | Ga0436365_1135457 | Ga0436365_1135457_821_1606 | 257 |
| 632 | 3300039438 | Ga0436360_0172085 | Ga0436360_0172085_2780_3553 | 257 |
| 633 | 3300039453 | Ga0436362_0759359 | Ga0436362_0759359_747_1520 | 257 |
| 634 | 3300041463 | Ga0451804_0672755 | Ga0451804_0672755_338_1120 | 257 |
| 635 | 3300041491 | Ga0451833_0772404 | Ga0451833_0772404_15_797 | 257 |
| 636 | 3300041498 | Ga0451841_1126302 | Ga0451841_1126302_13_819 | 257 |
| 637 | 3300044694 | Ga0466963_0210585 | Ga0466963_0210585_116_889 | 257 |
| 638 | 3300046457 | Ga0495590_0031972 | Ga0495590_0031972_706_1479 | 257 |
| 639 | 3300046460 | Ga0495638_0181996 | Ga0495638_0181996_364_1137 | 257 |
| 640 | 3300046460 | Ga0495638_0201579 | Ga0495638_0201579_212_985 | 257 |
| 641 | 3300046474 | Ga0495605_0107265 | Ga0495605_0107265_297_1070 | 257 |
| 642 | 3300046491 | Ga0495584_0087712 | Ga0495584_0087712_350_1123 | 257 |
| 643 | 3300046500 | Ga0495596_0058284 | Ga0495596_0058284_381_1154 | 257 |
| 644 | 3300046501 | Ga0495607_0173427 | Ga0495607_0173427_150_923 | 257 |
| 645 | 3300046506 | Ga0495583_0102024 | Ga0495583_0102024_118_900 | 257 |
| 646 | 3300046507 | Ga0495606_0028926 | Ga0495606_0028926_789_1562 | 257 |
| 647 | 3300046507 | Ga0495606_0063971 | Ga0495606_0063971_1144_1917 | 257 |
| 648 | 3300046513 | Ga0495616_0047203 | Ga0495616_0047203_80_853 | 257 |
| 649 | 3300046515 | Ga0495620_0008241 | Ga0495620_0008241_4547_5320 | 257 |
| 650 | 3300046519 | Ga0495632_0141763 | Ga0495632_0141763_319_1092 | 257 |
| 651 | 3300046520 | Ga0495637_0053329 | Ga0495637_0053329_839_1612 | 257 |
| 652 | 3300046522 | Ga0495643_0022296 | Ga0495643_0022296_2257_3030 | 257 |
| 653 | 3300046530 | Ga0495654_0041619 | Ga0495654_0041619_206_979 | 257 |
| 654 | 3300046557 | Ga0495622_0009294 | Ga0495622_0009294_2627_3400 | 257 |
| 655 | 3300046615 | Ga0495656_0152029 | Ga0495656_0152029_292_1065 | 257 |
| 656 | 3300046648 | Ga0495611_0085325 | Ga0495611_0085325_320_1093 | 257 |
| 657 | 3300046660 | Ga0495625_0031645 | Ga0495625_0031645_2114_2887 | 257 |
| 658 | 3300046660 | Ga0495625_0212942 | Ga0495625_0212942_81_854 | 257 |
| 659 | 3300046665 | Ga0495661_0043463 | Ga0495661_0043463_796_1569 | 257 |
| 660 | 3300046691 | Ga0495670_0284080 | Ga0495670_0284080_49_822 | 257 |
| 661 | 3300046794 | Ga0495589_0108024 | Ga0495589_0108024_225_998 | 257 |
| 662 | 3300047318 | Ga0495636_0158802 | Ga0495636_0158802_231_1004 | 257 |
| 663 | 3300047320 | Ga0495672_0015183 | Ga0495672_0015183_517_1290 | 257 |
| 664 | 3300047320 | Ga0495672_0060742 | Ga0495672_0060742_308_1099 | 257 |
| 665 | 3300047470 | Ga0495681_0022146 | Ga0495681_0022146_412_1185 | 257 |
| 666 | 3300048091 | Ga0495626_0033417 | Ga0495626_0033417_768_1541 | 257 |
| 667 | 3300048091 | Ga0495626_0037111 | Ga0495626_0037111_543_1316 | 257 |
| 668 | 3300048905 | Ga0496102_0076340 | Ga0496102_0076340_2105_2878 | 257 |
| 669 | 3300048907 | Ga0496104_0131643 | Ga0496104_0131643_676_1449 | 257 |
| 670 | 3300048908 | Ga0496105_0140766 | Ga0496105_0140766_579_1382 | 257 |
| 671 | 3300048910 | Ga0496107_0189421 | Ga0496107_0189421_230_1003 | 257 |
| 672 | 3300048911 | Ga0496108_0078632 | Ga0496108_0078632_1226_2029 | 257 |
| 673 | 3300048911 | Ga0496108_0294495 | Ga0496108_0294495_140_913 | 257 |
| 674 | 3300048912 | Ga0496109_0380482 | Ga0496109_0380482_16_789 | 257 |
| 675 | 3300048914 | Ga0496111_0100564 | Ga0496111_0100564_777_1550 | 257 |
| 676 | 3300048915 | Ga0496112_0087644 | Ga0496112_0087644_130_933 | 257 |
| 677 | 3300048916 | Ga0496113_0063282 | Ga0496113_0063282_1083_1856 | 257 |
| 678 | 3300048918 | Ga0496115_0078247 | Ga0496115_0078247_495_1271 | 257 |
| 679 | 3300048919 | Ga0496116_0001246 | Ga0496116_0001246_17728_18501 | 257 |
| 680 | 3300048920 | Ga0496117_0283669 | Ga0496117_0283669_89_862 | 257 |
| 681 | 3300048921 | Ga0496118_0008413 | Ga0496118_0008413_7284_8057 | 257 |
| 682 | 3300048921 | Ga0496118_0096034 | Ga0496118_0096034_769_1542 | 257 |
| 683 | 3300048922 | Ga0496119_0040086 | Ga0496119_0040086_509_1282 | 257 |
| 684 | 3300048924 | Ga0496121_0007261 | Ga0496121_0007261_8518_9291 | 257 |
| 685 | 3300048924 | Ga0496121_0011114 | Ga0496121_0011114_3322_4095 | 257 |
| 686 | 3300048924 | Ga0496121_0082455 | Ga0496121_0082455_40_825 | 257 |
| 687 | 3300048924 | Ga0496121_0092406 | Ga0496121_0092406_1428_2201 | 257 |
| 688 | 3300048924 | Ga0496121_0168109 | Ga0496121_0168109_22_795 | 257 |
| 689 | 3300048927 | Ga0496124_0082437 | Ga0496124_0082437_1288_2061 | 257 |
| 690 | 3300048928 | Ga0496125_0002221 | Ga0496125_0002221_5243_6016 | 257 |
| 691 | 3300048928 | Ga0496125_0018095 | Ga0496125_0018095_5124_5897 | 257 |
| 692 | 3300048928 | Ga0496125_0020298 | Ga0496125_0020298_3648_4421 | 257 |
| 693 | 3300048928 | Ga0496125_0241456 | Ga0496125_0241456_179_961 | 257 |
| 694 | 3300048929 | Ga0496126_0001652 | Ga0496126_0001652_23790_24572 | 257 |
| 695 | 3300048929 | Ga0496126_0007875 | Ga0496126_0007875_3335_4108 | 257 |
| 696 | 3300048929 | Ga0496126_0011734 | Ga0496126_0011734_8221_8994 | 257 |
| 697 | 3300048929 | Ga0496126_0035142 | Ga0496126_0035142_795_1568 | 257 |
| 698 | 3300048929 | Ga0496126_0063436 | Ga0496126_0063436_1348_2121 | 257 |
| 699 | 3300048929 | Ga0496126_0090099 | Ga0496126_0090099_241_1014 | 257 |
| 700 | 3300048929 | Ga0496126_0112336 | Ga0496126_0112336_1392_2174 | 257 |
| 701 | 3300048929 | Ga0496126_0154903 | Ga0496126_0154903_590_1363 | 257 |
| 702 | 3300049460 | Ga0495682_0016730 | Ga0495682_0016730_1934_2707 | 257 |
| 703 | 3300049569 | Ga0501032_0088942 | Ga0501032_0088942_122_895 | 257 |
| 704 | 3300049570 | Ga0501033_0099934 | Ga0501033_0099934_1165_1938 | 257 |
| 705 | 3300049571 | Ga0501034_0227742 | Ga0501034_0227742_602_1375 | 257 |
| 706 | 3300049573 | Ga0501037_0062226 | Ga0501037_0062226_1358_2179 | 257 |
| 707 | 3300049574 | Ga0501038_0214285 | Ga0501038_0214285_24_845 | 257 |
| 708 | 3300049574 | Ga0501038_0343607 | Ga0501038_0343607_247_1020 | 257 |
| 709 | 3300049575 | Ga0501039_0162354 | Ga0501039_0162354_321_1094 | 257 |
| 710 | 3300049579 | Ga0501043_0135090 | Ga0501043_0135090_520_1293 | 257 |
| 711 | 3300049580 | Ga0501046_0164151 | Ga0501046_0164151_590_1363 | 257 |
| 712 | 3300049580 | Ga0501046_0194142 | Ga0501046_0194142_574_1347 | 257 |
| 713 | 3300049581 | Ga0501047_0012850 | Ga0501047_0012850_4527_5300 | 257 |
| 714 | 3300049582 | Ga0501048_0200526 | Ga0501048_0200526_544_1317 | 257 |
| 715 | 3300049584 | Ga0501068_0079456 | Ga0501068_0079456_418_1191 | 257 |
| 716 | 3300049586 | Ga0501070_0014522 | Ga0501070_0014522_5469_6242 | 257 |
| 717 | 3300049588 | Ga0501072_0241440 | Ga0501072_0241440_419_1240 | 257 |
| 718 | 3300049590 | Ga0501074_0020328 | Ga0501074_0020328_4037_4810 | 257 |
| 719 | 3300049742 | Ga0501080_0018253 | Ga0501080_0018253_3543_4316 | 257 |
| 720 | 3300049744 | Ga0501083_0007632 | Ga0501083_0007632_2955_3776 | 257 |
| 721 | 3300049822 | Ga0501035_0299740 | Ga0501035_0299740_186_959 | 257 |
| 722 | 3300049823 | Ga0501044_0135193 | Ga0501044_0135193_1273_2046 | 257 |
| 723 | 3300049823 | Ga0501044_0350221 | Ga0501044_0350221_35_808 | 257 |
| 724 | 3300050490 | nmdc:mga03n38_123817_c1 | nmdc:mga03n38_123817_c1_362_1135 | 257 |
| 725 | 3300050491 | nmdc:mga00v17_120073_c1 | nmdc:mga00v17_120073_c1_279_1052 | 257 |
| 726 | 3300050492 | nmdc:mga0yw44_27139_c1 | nmdc:mga0yw44_27139_c1_958_1731 | 257 |
| 727 | 3300050493 | nmdc:mga0k408_100882_c1 | nmdc:mga0k408_100882_c1_378_1151 | 257 |
| 728 | 3300050493 | nmdc:mga0k408_132851_c1 | nmdc:mga0k408_132851_c1_426_1199 | 257 |
| 729 | 3300050494 | nmdc:mga06z11_78311_c1 | nmdc:mga06z11_78311_c1_646_1419 | 257 |
| 730 | 3300050496 | nmdc:mga07m45_115639_c1 | nmdc:mga07m45_115639_c1_470_1243 | 257 |
| 731 | 3300050496 | nmdc:mga07m45_178454_c1 | nmdc:mga07m45_178454_c1_25_798 | 257 |
| 732 | 3300050496 | nmdc:mga07m45_61539_c1 | nmdc:mga07m45_61539_c1_489_1262 | 257 |
| 733 | 3300050515 | nmdc:mga0a205_375835_c1 | nmdc:mga0a205_375835_c1_370_1143 | 257 |
| 734 | 3300050516 | nmdc:mga0sz30_77963_c1 | nmdc:mga0sz30_77963_c1_475_1248 | 257 |
| 735 | 3300053077 | Ga0495601_0150526 | Ga0495601_0150526_699_1472 | 257 |
| 736 | 3300053087 | Ga0500643_015992 | Ga0500643_015992_856_1629 | 257 |
| 737 | 3300053093 | Ga0500651_0004300 | Ga0500651_0004300_3671_4444 | 257 |
| 738 | 3300053094 | Ga0500566_0000463 | Ga0500566_0000463_13938_14711 | 257 |
| 739 | 3300053094 | Ga0500566_0000995 | Ga0500566_0000995_8977_9759 | 257 |
| 740 | 3300053096 | Ga0500641_0034361 | Ga0500641_0034361_1065_1838 | 257 |
| 741 | 3300053098 | Ga0500650_0002012 | Ga0500650_0002012_2141_2914 | 257 |
| 742 | 3300053098 | Ga0500650_0099855 | Ga0500650_0099855_100_873 | 257 |
| 743 | 3300053104 | Ga0500556_0000051 | Ga0500556_0000051_41191_41964 | 257 |
| 744 | 3300053108 | Ga0500562_015517 | Ga0500562_015517_445_1218 | 257 |
| 745 | 3300053109 | Ga0500569_056487 | Ga0500569_056487_377_1150 | 257 |
| 746 | 3300053119 | Ga0500595_008583 | Ga0500595_008583_1993_2766 | 257 |
| 747 | 3300053119 | Ga0500595_009047 | Ga0500595_009047_1452_2225 | 257 |
| 748 | 3300053126 | Ga0500621_076191 | Ga0500621_076191_266_1039 | 257 |
| 749 | 3300053130 | Ga0500642_0000041 | Ga0500642_0000041_9065_9838 | 257 |
| 750 | 3300053130 | Ga0500642_0180726 | Ga0500642_0180726_162_935 | 257 |
| 751 | 3300053131 | Ga0500652_004929 | Ga0500652_004929_985_1758 | 257 |
| 752 | 3300053134 | Ga0500658_0022139 | Ga0500658_0022139_1088_1861 | 257 |
| 753 | 3300053136 | Ga0500559_0001229 | Ga0500559_0001229_12395_13168 | 257 |
| 754 | 3300053139 | Ga0500568_0005321 | Ga0500568_0005321_3837_4610 | 257 |
| 755 | 3300053142 | Ga0500577_0165643 | Ga0500577_0165643_22_795 | 257 |
| 756 | 3300053145 | Ga0500586_020822 | Ga0500586_020822_256_1029 | 257 |
| 757 | 3300053148 | Ga0500590_023968 | Ga0500590_023968_454_1227 | 257 |
| 758 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_40943_41716 | 257 |
| 759 | 3300053156 | Ga0500622_0000502 | Ga0500622_0000502_13302_14075 | 257 |
| 760 | 3300053160 | Ga0500633_0088997 | Ga0500633_0088997_333_1106 | 257 |
| 761 | 3300053161 | Ga0500634_0125150 | Ga0500634_0125150_28_801 | 257 |
| 762 | 3300053177 | Ga0500636_0037828 | Ga0500636_0037828_891_1673 | 257 |
| 763 | 3300053178 | Ga0500637_0020362 | Ga0500637_0020362_2266_3039 | 257 |
| 764 | 3300053730 | Ga0500645_033205 | Ga0500645_033205_437_1210 | 257 |
| 765 | 3300053731 | Ga0500609_016761 | Ga0500609_016761_137_910 | 257 |
| 766 | 3300060353 | Ga0501082_0126524 | Ga0501082_0126524_337_1158 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c8w-assembly1.cif.gz_A | crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution | 0.9647 | 18 | 244 |
| 3bgt-assembly1.cif.gz_D | structural studies of acetoacetate decarboxylase | 0.9495 | 1 | 244 |
| 3bh2-assembly1.cif.gz_A | structural studies of acetoacetate decarboxylase | 0.946 | 1 | 244 |
| 3bgt-assembly1.cif.gz_D | structural studies of acetoacetate decarboxylase | 0.9382 | 1 | 244 |
| 3bh2-assembly1.cif.gz_A | structural studies of acetoacetate decarboxylase | 0.9348 | 1 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bgtC01 | Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like | 0.9634 | 13 | 244 | 2.40.400.10 |
| 3bgtC01 | Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like | 0.9551 | 13 | 244 | 2.40.400.10 |
| 4zbtD00 | Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like | 0.877 | 11 | 243 | 2.40.400.10 |
| 4jmcB00 | Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like | 0.8467 | 11 | 244 | 2.40.400.10 |
| 3cmbA00 | Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like | 0.8306 | 21 | 242 | 2.40.400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4YKU7-F1-model_v4 | Acetoacetate decarboxylase | 0.9731 | 1 | 244 |
GO:0016829
|
| AF-A0A2A6PQI3-F1-model_v4 | Acetoacetate decarboxylase (EC 4.1.1.4) | 0.9724 | 1 | 254 |
GO:0047602
|
| AF-A0A4R2LM89-F1-model_v4 | Acetoacetate decarboxylase | 0.9724 | 1 | 244 |
GO:0016829
|
| AF-A0A4R7BWF3-F1-model_v4 | Acetoacetate decarboxylase | 0.9707 | 1 | 244 |
GO:0016829
|
| AF-A0A257P8C1-F1-model_v4 | Acetoacetate decarboxylase | 0.9703 | 75 | 244 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar